F497446

General Info

Members Datasets Scaffolds Average Seq Length
4475 1411 3916 231

Family's Representative Sequence

Representative Sequence 3300059660|Ga0587124_000554|Ga0587124_000554_912_1673
Length 253
Sequence MAKLSKRAKAIKSKVDRTKQYPFDQAISLIKECATAKFNESIDVSVQLGVDAKKSDQVVRGSVVLPAGTGKTVRVAVFASGDKAEAAKAAGADVVGMEDLAERVKAGDMPFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQYRTDKAGIIHATIGRKSFSDADLKSNLLALIEALNKAKPATSKGVYLRRVAISSVGACSEGQVVLSLRPLRASSSRRRQPYGQVASAIPPQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
7 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
8 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
9 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
10 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
11 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
12 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
13 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
14 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
15 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
16 2511231004 Pseudomonas sp. GM102 Isolate Nodule
17 2511231006 Pseudomonas sp. GM17 Isolate Nodule
18 2511231007 Pseudomonas sp. GM18 Isolate Nodule
19 2511231008 Pseudomonas sp. GM21 Isolate Nodule
20 2511231010 Pseudomonas sp. GM25 Isolate Nodule
21 2511231011 Pseudomonas sp. GM30 Isolate Nodule
22 2511231012 Pseudomonas sp. GM33 Isolate Nodule
23 2511231014 Pseudomonas sp. GM48 Isolate Nodule
24 2511231015 Pseudomonas sp. GM49 Isolate Nodule
25 2511231016 Pseudomonas sp. GM50 Isolate Nodule
26 2511231017 Pseudomonas sp. GM55 Isolate Nodule
27 2511231018 Pseudomonas sp. GM60 Isolate Nodule
28 2511231019 Pseudomonas sp. GM67 Isolate Nodule
29 2511231020 Pseudomonas sp. GM74 Isolate Nodule
30 2511231021 Pseudomonas sp. GM78 Isolate Nodule
31 2511231022 Pseudomonas sp. GM79 Isolate Nodule
32 2511231023 Pseudomonas sp. GM80 Isolate Nodule
33 2511231024 Pseudomonas sp. GM84 Isolate Nodule
34 2511231031 Pseudomonas sp. GM16 Isolate Nodule
35 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
36 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
37 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
38 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
39 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
40 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
41 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
42 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
43 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
44 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
45 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
46 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
47 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
48 2519103095 Burkholderia sp. KJ006 Isolate Nodule
49 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
50 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
51 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
52 2547132374 Acidovorax radicis N35 Isolate Unclassified
53 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
54 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
55 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
56 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
57 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
58 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
59 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
60 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
61 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
62 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
63 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
64 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
65 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
66 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
67 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
68 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
69 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
70 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
71 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
72 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
73 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
74 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
75 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
76 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
77 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
78 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
79 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
80 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
81 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
82 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
83 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
84 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
85 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
86 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
87 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
88 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
89 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
90 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
91 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
92 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
93 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
94 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
95 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
96 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
97 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
98 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
99 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
100 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
101 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
102 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
103 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
104 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
105 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
106 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
107 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
108 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
109 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
110 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
111 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
112 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
113 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
114 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
115 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
116 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
117 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
118 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
119 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
120 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
121 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
122 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
123 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
124 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
125 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
126 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
127 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
128 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
129 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
130 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
131 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
132 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
133 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
134 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
135 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
136 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
137 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
138 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
139 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
140 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
141 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
142 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
143 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
144 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
145 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
146 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
147 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
148 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
149 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
150 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
151 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
152 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
153 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
154 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
155 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
156 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
157 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
158 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
159 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
160 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
161 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
162 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
163 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
164 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
165 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
166 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
167 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
168 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
169 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
170 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
171 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
172 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
173 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
174 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
175 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
176 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
177 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
178 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
179 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
180 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
181 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
182 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
183 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
184 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
185 2643221556 Massilia sp. Root1485 Isolate Unclassified
186 2643221559 Lysobacter sp. Root559 Isolate Unclassified
187 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
188 2643221569 Achromobacter sp. Root565 Isolate Unclassified
189 2643221570 Acidovorax sp. Root568 Isolate Unclassified
190 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
191 2643221573 Lysobacter sp. Root604 Isolate Unclassified
192 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
193 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
194 2643221585 Pelomonas sp. Root662 Isolate Unclassified
195 2643221586 Lysobacter sp. Root667 Isolate Unclassified
196 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
197 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
198 2643221593 Lysobacter sp. Root690 Isolate Unclassified
199 2643221594 Achromobacter sp. Root170 Isolate Unclassified
200 2643221596 Acidovorax sp. Root70 Isolate Unclassified
201 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
202 2643221609 Acidovorax sp. Root217 Isolate Unclassified
203 2643221611 Acidovorax sp. Root219 Isolate Unclassified
204 2643221612 Lysobacter sp. Root76 Isolate Unclassified
205 2643221621 Achromobacter sp. Root83 Isolate Unclassified
206 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
207 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
208 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
209 2643221638 Duganella sp. Root336D2 Isolate Unclassified
210 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
211 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
212 2643221645 Massilia sp. Root351 Isolate Unclassified
213 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
214 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
215 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
216 2643221652 Acidovorax sp. Root402 Isolate Unclassified
217 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
218 2643221656 Pelomonas sp. Root405 Isolate Unclassified
219 2643221658 Variovorax sp. Root411 Isolate Unclassified
220 2643221664 Massilia sp. Root418 Isolate Unclassified
221 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
222 2643221672 Variovorax sp. Root434 Isolate Unclassified
223 2643221683 Variovorax sp. Root473 Isolate Unclassified
224 2643221684 Massilia sp. Root133 Isolate Unclassified
225 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
226 2643221717 Acidovorax sp. Root267 Isolate Unclassified
227 2643221720 Lysobacter sp. Root916 Isolate Unclassified
228 2643221727 Lysobacter sp. Root96 Isolate Unclassified
229 2643221728 Lysobacter sp. Root983 Isolate Unclassified
230 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
231 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
232 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
233 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
234 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
235 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
236 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
237 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
238 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
239 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
240 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
241 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
242 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
243 2721755523 Delftia sp. HK171 Isolate Unclassified
244 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
245 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
246 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
247 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
248 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
249 2738541277 Variovorax sp. GV051 Isolate Unclassified
250 2738541280 Massilia sp. GV090 Isolate Unclassified
251 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
252 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
253 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
254 2738541297 Duganella sp. GV083 Isolate Unclassified
255 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
256 2738541300 Massilia sp. GV016 Isolate Unclassified
257 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
258 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
259 2738541307 Variovorax sp. GV008 Isolate Unclassified
260 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
261 2738541337 Pelomonas sp. BT06 Isolate Unclassified
262 2738541357 Duganella sp. GV053 Isolate Unclassified
263 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
264 2738543003 Duganella sp. GV066 Isolate Unclassified
265 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
266 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
267 2738543012 Acidovorax sp. CF301 Isolate Unclassified
268 2738543013 Variovorax sp. BT01 Isolate Unclassified
269 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
270 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
271 2738543018 Massilia sp. GV045 Isolate Unclassified
272 2738543019 Variovorax sp. GV040 Isolate Unclassified
273 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
274 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
275 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
276 2738543026 Duganella sp. GV089 Isolate Unclassified
277 2738543029 Duganella sp. GV039 Isolate Unclassified
278 2738543030 Massilia sp. GV097 Isolate Unclassified
279 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
280 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
281 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
282 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
283 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
284 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
285 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
286 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
287 2765235841 Pseudomonas putida AA7 Isolate Unclassified
288 2773857670 Pseudomonas sp. 478 Isolate Unclassified
289 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
290 2773857673 Pseudomonas sp. 443 Isolate Unclassified
291 2784132063 Pseudomonas sp. 424 Isolate Unclassified
292 2784132072 Pseudomonas sp. 460 Isolate Unclassified
293 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
294 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
295 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
296 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
297 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
298 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
299 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
300 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
301 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
302 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
303 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
304 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
305 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
306 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
307 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
308 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
309 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
310 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
311 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
312 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
313 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
314 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
315 2816332133 Acidovorax radicis 2721A Isolate Unclassified
316 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
317 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
318 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
319 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
320 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
321 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
322 2818991446 Variovorax sp. 1180 Isolate Unclassified
323 2818991452 Burkholderia cepacia 561 Isolate Unclassified
324 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
325 2818991457 Xanthomonas translucens 569 Isolate Unclassified
326 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
327 2821131069 Duganella sp. 1224 Isolate Unclassified
328 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
329 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
330 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
331 2831864461 Roseateles noduli HZ7 Isolate Nodule
332 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
333 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
334 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
335 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
336 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
337 2842677519 Variovorax sp. R-72495 Isolate Unclassified
338 2842711865 Duganella sp. R-73148 Isolate Unclassified
339 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
340 2842733646 Variovorax sp. R-72446 Isolate Unclassified
341 2842747753 Variovorax sp. R-72060 Isolate Unclassified
342 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
343 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
344 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
345 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
346 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
347 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
348 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
349 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
350 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
351 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
352 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
353 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
354 2855730933 Achromobacter sp. HZ28 Isolate Nodule
355 2855767633 Achromobacter sp. HZ34 Isolate Nodule
356 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
357 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
358 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
359 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
360 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
361 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
362 2857553236 Duganella sp. R-74557 Isolate Unclassified
363 2857558681 Duganella sp. R-74565 Isolate Unclassified
364 2857564685 Duganella sp. R-74599 Isolate Unclassified
365 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
366 2858950400 Achromobacter sp. K91 Isolate Unclassified
367 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
368 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
369 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
370 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
371 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
372 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
373 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
374 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
375 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
376 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
377 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
378 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
379 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
380 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
381 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
382 2885198086 Variovorax sp. 679 Isolate Unclassified
383 2885211737 Variovorax sp. 553 Isolate Unclassified
384 2885266251 Ralstonia sp. SET104 Isolate Nodule
385 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
386 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
387 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
388 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
389 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
390 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
391 2899924645 Variovorax sp. 369 Isolate Unclassified
392 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
393 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
394 2904424332 Duganella sp. 1411 Isolate Rhizosphere
395 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
396 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
397 2904456579 Variovorax sp. 2002 Isolate Unclassified
398 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
399 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
400 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
401 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
402 2904564687 Burkholderia sp. 571 Isolate Unclassified
403 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
404 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
405 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
406 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
407 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
408 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
409 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
410 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
411 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
412 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
413 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
414 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
415 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
416 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
417 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
418 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
419 2919476304 Duganella sp. 3397 Isolate Unclassified
420 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
421 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
422 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
423 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
424 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
425 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
426 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
427 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
428 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
429 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
430 2928037797 Variovorax sp. 1126 Isolate Unclassified
431 2928044640 Variovorax sp. 1128 Isolate Unclassified
432 2928051484 Variovorax sp. 1133 Isolate Unclassified
433 2928058823 Ralstonia sp. 1138 Isolate Unclassified
434 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
435 2928070936 Variovorax gossypii 1167 Isolate Unclassified
436 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
437 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
438 2928163908 Burkholderia sp. 567 Isolate Unclassified
439 2928170801 Burkholderia sp. 572 Isolate Unclassified
440 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
441 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
442 2928536128 Burkholderia sola 565 Isolate Unclassified
443 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
444 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
445 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
446 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
447 2929520902 Variovorax beijingensis 502 Isolate Unclassified
448 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
449 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
450 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
451 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
452 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
453 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
454 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
455 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
456 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
457 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
458 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
459 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
460 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
461 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
462 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
463 2941479691
464 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
465 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
466 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
467 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
468 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
469 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
470 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
471 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
472 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
473 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
474 2952252522 Salinicola sp. DM10 Isolate Unclassified
475 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
476 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
477 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
478 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
479 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
480 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
481 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
482 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
483 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
484 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
485 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
486 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
487 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
488 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
489 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
490 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
491 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
492 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
493 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
494 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
495 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
496 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
497 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
498 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
499 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
500 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
501 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
502 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
503 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
504 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
505 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
506 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
507 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
508 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
509 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
510 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
511 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
512 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
513 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
514 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
515 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
516 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
517 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
518 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
519 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
520 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
521 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
522 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
523 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
524 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
525 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
526 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
527 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
528 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
529 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
530 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
531 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
532 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
533 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
534 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
535 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
536 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
537 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
538 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
539 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
540 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
541 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
542 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
543 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
544 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
545 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
546 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
547 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
548 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
549 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
550 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
552 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
553 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
554 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
555 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
556 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
557 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
558 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
559 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
560 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
561 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
562 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
563 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
564 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
565 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
566 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
567 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
568 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
569 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
570 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
571 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
572 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
573 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
574 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
575 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
577 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
578 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
579 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
580 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
581 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
582 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
583 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
584 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
585 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
586 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
587 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
588 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
589 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
590 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
591 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
592 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
593 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
594 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
595 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
596 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
597 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
598 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
599 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
600 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
601 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
602 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
603 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
604 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
605 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
606 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
607 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
608 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
609 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
610 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
611 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
612 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
613 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
614 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
615 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
616 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
617 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
618 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
619 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
620 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
621 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
622 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
623 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
624 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
625 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
626 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
627 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
628 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
629 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
630 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
631 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
632 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
633 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
634 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
635 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
636 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
637 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
638 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
639 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
640 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
641 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
642 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
643 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
644 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
645 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
646 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
647 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
648 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
649 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
650 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
651 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
652 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
653 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
654 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
655 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
656 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
657 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
658 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
659 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
660 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
661 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
662 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
663 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
664 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
665 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
666 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
667 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
668 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
669 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
670 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
671 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
672 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
673 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
674 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
675 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
676 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
677 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
678 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
679 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
680 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
681 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
682 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
683 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
684 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
685 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
686 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
687 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
688 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
689 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
690 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
691 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
692 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
693 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
694 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
695 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
696 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
697 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
698 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
699 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
700 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
701 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
702 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
703 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
704 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
705 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
706 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
707 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
708 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
709 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
710 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
711 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
712 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
713 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
714 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
715 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
716 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
717 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
718 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
719 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
720 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
721 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
722 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
723 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
724 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
725 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
726 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
727 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
728 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
730 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
731 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
732 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
733 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
734 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
735 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
736 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
737 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
738 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
739 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
740 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
741 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
742 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
743 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
744 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
745 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
746 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
747 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
748 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
749 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
750 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
751 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
752 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
753 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
754 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
755 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
756 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
757 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
758 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
759 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
760 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
761 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
762 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
763 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
764 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
765 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
767 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
768 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
769 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
770 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
771 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
772 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
773 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
774 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
775 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
776 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
777 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
778 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
779 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
780 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
781 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
782 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
783 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
784 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
785 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
786 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
787 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
788 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
790 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
791 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
792 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
793 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
794 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
795 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
796 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
797 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
798 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
799 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
800 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
801 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
802 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
803 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
804 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
805 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
806 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
807 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
808 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
810 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
811 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
814 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
815 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
816 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
817 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
818 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
819 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
820 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
821 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
822 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
823 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
824 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
825 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
826 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
827 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
828 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
829 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
830 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
831 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
832 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
833 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
834 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
835 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
836 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
837 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
838 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
839 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
840 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
841 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
842 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
843 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
844 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
845 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
846 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
847 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
848 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
849 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
850 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
851 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
852 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
853 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
854 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
855 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
856 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
857 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
858 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
859 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
860 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
861 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
862 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
863 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
864 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
865 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
866 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
867 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
868 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
869 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
870 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
871 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
872 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
873 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
874 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
875 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
876 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
877 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
878 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
879 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
880 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
881 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
882 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
883 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
884 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
885 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
886 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
887 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
888 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
889 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
890 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
891 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
892 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
893 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
894 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
895 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
896 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
897 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
898 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
899 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
900 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
901 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
902 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
903 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
904 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
905 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
906 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
907 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
908 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
909 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
910 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
911 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
912 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
913 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
914 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
915 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
916 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
917 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
918 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
919 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
920 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
921 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
922 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
923 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
924 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
925 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
926 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
927 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
928 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
929 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
930 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
931 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
932 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
933 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
934 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
935 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
936 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
937 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
938 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
939 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
940 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
941 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
942 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
943 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
944 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
945 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
946 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
947 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
948 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
949 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
950 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
951 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
952 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
953 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
954 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
955 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
956 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
957 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
958 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
959 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
960 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
961 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
962 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
963 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
964 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
965 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
966 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
967 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
968 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
969 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
970 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
971 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
972 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
973 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
974 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
975 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
976 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
977 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
978 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
979 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
980 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
981 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
982 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
983 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
984 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
985 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
986 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
987 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
988 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
989 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
990 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
991 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
992 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
993 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
994 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
995 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
996 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
997 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
998 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
999 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
1000 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
1001 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
1002 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
1003 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1004 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1005 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1006 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1007 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1008 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
1009 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
1010 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
1011 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
1012 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
1013 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1014 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1015 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
1016 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
1017 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
1018 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
1019 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
1020 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1021 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
1022 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
1023 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
1024 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
1025 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
1026 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
1027 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
1028 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
1029 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
1030 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1031 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
1032 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1033 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
1034 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
1035 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
1036 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
1037 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
1038 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
1039 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1040 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
1041 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
1042 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1043 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
1044 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1045 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
1046 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
1047 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1048 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1049 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1050 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1051 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1052 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
1053 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1054 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
1055 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1056 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1057 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1058 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1059 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1060 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1061 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1062 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1063 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1064 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1065 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1066 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1067 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1068 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
1069 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1070 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1071 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1072 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1073 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1074 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1075 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1076 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1077 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1078 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1079 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1080 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1081 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1082 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1083 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1084 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1085 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1086 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1087 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1088 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1089 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1090 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1091 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1092 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1093 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1094 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1095 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1096 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1097 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1098 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1099 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
1104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1162 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1191 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1192 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1193 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1194 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1195 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1196 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1197 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
1201 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
1202 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
1203 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1204 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1205 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1206 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1207 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1208 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1209 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1210 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1211 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1212 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1213 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1214 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1215 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1216 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1217 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1218 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1242 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
1243 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
1244 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
1245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
1246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
1247 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
1248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1251 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
1252 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
1253 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
1254 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
1255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
1256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1259 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
1260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1280 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1286 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1287 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1289 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1290 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
1291 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1292 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1293 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1295 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
1296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1297 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1299 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
1300 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1304 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1305 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1306 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1309 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1310 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1311 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1312 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1313 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1314 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1315 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1316 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1317 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1318 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1319 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1320 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1321 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1322 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1323 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1324 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1325 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1326 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1327 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1328 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1329 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1330 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1331 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1332 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1333 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1334 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1335 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1336 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1337 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1338 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1339 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1340 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1341 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1342 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1343 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1344 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1345 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1346 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1347 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1348 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1349 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1350 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1354 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
1355 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
1356 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
1357 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
1358 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
1359 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
1360 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
1361 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
1362 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
1363 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
1364 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
1365 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
1366 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
1367 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
1368 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
1369 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1370 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
1371 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
1372 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1373 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
1374 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
1375 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
1376 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
1377 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
1378 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
1379 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
1380 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
1381 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
1382 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
1383 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
1384 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
1385 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
1386 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
1387 8052494512 Pseudomonas putida LD6 Isolate Unclassified
1388 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1389 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1390 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1391 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
1392 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
1393 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
1394 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
1395 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1396 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1397 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
1398 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
1399 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1400 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1401 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1402 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1403 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1404 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1405 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1406 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1407 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1408 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1409 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1410 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
1411 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.28
Metatranscriptomes 8.22
Isolates 12.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 13.09
Nodule 1.56
Rhizoplane 4.87
Rhizosphere 68.94
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_97 2124908027 Bacteria 13370
2 SwRhRL2b_contig_480260 2162886007 Bacteria 5042
3 SwRhRL2b_contig_530085 2162886007 Bacteria 4650
4 SwRhRL2b_contig_93034 2162886007 Bacteria 5076
5 JGI24741J21665_1002533 3300001915 Bacteria 4717
6 JGI24740J21852_10002263 3300001979 Bacteria 8774
7 JGI24740J21852_10008888 3300001979 Bacteria 3973
8 JGI24740J21852_10009980 3300001979 Bacteria 3682
9 JGI24740J21852_10018878 3300001979 Bacteria 2437
10 JGI24740J21852_10020966 3300001979 Bacteria 2271
11 JGI24740J21852_10044406 3300001979 Bacteria 1319
12 JGI24739J22299_10006788 3300001989 Bacteria 4309
13 JGI24739J22299_10012692 3300001989 Bacteria 3089
14 JGI24737J22298_10019023 3300001990 Bacteria 2198
15 JGI24737J22298_10080892 3300001990 Bacteria 967
16 JGI24735J21928_10004283 3300002067 Bacteria 4809
17 JGI24735J21928_10004376 3300002067 Bacteria 4753
18 JGI24735J21928_10015628 3300002067 Bacteria 2365
19 JGI24735J21928_10016824 3300002067 Bacteria 2264
20 JGI24738J21930_10000269 3300002075 Bacteria 14192
21 JGI25155J39150_1000033 3300002704 Bacteria 105391
22 JGI25155J39150_1001463 3300002704 Bacteria 1652
23 JGI25156J39149_1000043 3300002705 Bacteria 105452
24 JGI25156J39149_1006435 3300002705 Bacteria 3208
25 JGI25156J39149_1019169 3300002705 Bacteria 1241
26 JGI25156J39149_1019178 3300002705 Bacteria 1240
27 JGI25156J39149_1022116 3300002705 Bacteria 1086
28 JGI25156J39149_1022234 3300002705 Bacteria 1082
29 JGI25162J39368_1003029 3300002737 Bacteria 5487
30 JGI25162J39368_1013686 3300002737 Bacteria 888
31 JGI25162J39368_1013692 3300002737 Bacteria 888
32 JGI25154J39366_1000062 3300002738 Bacteria 105525
33 JGI25154J39366_1001113 3300002738 Bacteria 10452
34 JGI25154J39366_1002655 3300002738 Bacteria 4401
35 JGI25154J39366_1003448 3300002738 Bacteria 3316
36 JGI25154J39366_1009085 3300002738 Bacteria 1241
37 JGI25154J39366_1009100 3300002738 Bacteria 1240
38 JGI25158J39367_1002309 3300002739 Bacteria 3132
39 JGI25158J39367_1004871 3300002739 Bacteria 1992
40 JGI25158J39367_1005117 3300002739 Bacteria 1935
41 JGI25157J39369_1000060 3300002741 Bacteria 105525
42 JGI25157J39369_1000533 3300002741 Bacteria 23087
43 JGI25157J39369_1002793 3300002741 Bacteria 3986
44 JGI25163J39215_1002498 3300002771 Bacteria 1860
45 JGI25164J39214_1010646 3300002772 Bacteria 888
46 JGI25164J39214_1010659 3300002772 Bacteria 888
47 JGI25152J39213_1001911 3300002773 Bacteria 8323
48 JGI25152J39213_1003388 3300002773 Bacteria 5466
49 JGI25152J39213_1008855 3300002773 Bacteria 2454
50 JGI25150J39212_1001072 3300002774 Bacteria 8314
51 JGI25150J39212_1001674 3300002774 Bacteria 6004
52 JGI25150J39212_1005950 3300002774 Bacteria 2560
53 JGI25150J39212_1007173 3300002774 Bacteria 2254
54 JGI25150J39212_1008078 3300002774 Bacteria 2081
55 JGI25150J39212_1013679 3300002774 Bacteria 1397
56 Ga0006763J43179_104870 3300002870 Bacteria 2587
57 JGI25159J45721_1003731 3300002987 Bacteria 5277
58 JGI25159J45721_1008095 3300002987 Bacteria 2927
59 JGI25159J45721_1008470 3300002987 Bacteria 2821
60 JGI25159J45721_1022089 3300002987 Bacteria 1184
61 JGI25159J45721_1031512 3300002987 Bacteria 849
62 Ga0006765J45826_105488 3300003161 Bacteria 3656
63 Ga0006778J45830_1013353 3300003162 Bacteria 3860
64 Ga0006759J45824_1008312 3300003163 Bacteria 3423
65 Ga0006759J45824_1008313 3300003163 Bacteria 2545
66 Ga0006759J45824_1012908 3300003163 Bacteria 2725
67 Ga0006759J45824_1013393 3300003163 Bacteria 2739
68 Ga0006759J45824_1037313 3300003163 Bacteria 3877
69 Ga0006759J45824_1054940 3300003163 Bacteria 2522
70 Ga0006759J45824_1056950 3300003163 Bacteria 3047
71 Ga0006759J45824_1060960 3300003163 Bacteria 2464
72 JGI25151J46595_10008142 3300003187 Bacteria 5070
73 JGI25151J46595_10009416 3300003187 Bacteria 4627
74 JGI25151J46595_10019549 3300003187 Bacteria 2875
75 JGI25151J46595_10026408 3300003187 Bacteria 2343
76 JGI25151J46595_10049203 3300003187 Bacteria 1449
77 JGI25151J46595_10056919 3300003187 Bacteria 1279
78 JGI25151J46595_10058489 3300003187 Bacteria 1248
79 JGI25151J46595_10064117 3300003187 Bacteria 1152
80 JGI25165J46597_1000973 3300003214 Bacteria 19249
81 JGI25165J46597_1019692 3300003214 Bacteria 888
82 JGI25165J46597_1019703 3300003214 Bacteria 888
83 JGI25153J46596_10003805 3300003215 Bacteria 8323
84 JGI25153J46596_10005611 3300003215 Bacteria 6559
85 JGI25153J46596_10007546 3300003215 Bacteria 5327
86 JGI25153J46596_10010831 3300003215 Bacteria 4088
87 JGI25153J46596_10045449 3300003215 Bacteria 1310
88 JGI25153J46596_10051198 3300003215 Bacteria 1184
89 Ga0007428J48920_101815 3300003288 Bacteria 2339
90 Ga0006758J48902_1003362 3300003300 Bacteria 5424
91 Ga0006758J48902_1013144 3300003300 Bacteria 3018
92 Ga0006758J48902_1013439 3300003300 Bacteria 2941
93 Ga0006758J48902_1021026 3300003300 Bacteria 2056
94 Ga0006770J48903_1008186 3300003305 Bacteria 5363
95 Ga0006770J48903_1028423 3300003305 Bacteria 3352
96 Ga0006777J48905_1018169 3300003308 Bacteria 2850
97 Ga0006777J48905_1021980 3300003308 Bacteria 8416
98 Ga0006777J48905_1035131 3300003308 Bacteria 2894
99 rootL2_10004195 3300003322 Bacteria 3087
100 rootL2_10046672 3300003322 Bacteria 4381
101 rootL2_10062408 3300003322 Bacteria 1316
102 rootH1_10294861 3300003323 Bacteria 1309
103 JGI25160J50197_1002205 3300003354 Bacteria 9150
104 JGI25160J50197_1013215 3300003354 Bacteria 2825
105 JGI25160J50197_1027842 3300003354 Bacteria 1529
106 JGI25160J50197_1036689 3300003354 Bacteria 1184
107 JGI25161J50226_1001064 3300003374 Bacteria 9354
108 JGI25161J50226_1007205 3300003374 Bacteria 1897
109 JGI25161J50226_1010855 3300003374 Bacteria 1184
110 JGI25161J50226_1015114 3300003374 Bacteria 849
111 JGI26136J50244_100632 3300003399 Bacteria 1156
112 Ga0006556J51387_1013499 3300003479 Bacteria 5298
113 Ga0006556J51387_1016726 3300003479 Bacteria 5570
114 Ga0007417J51691_1002081 3300003544 Bacteria 10064
115 Ga0007417J51691_1012480 3300003544 Bacteria 3735
116 Ga0007417J51691_1025655 3300003544 Bacteria 5250
117 Ga0007417J51691_1027677 3300003544 Bacteria 3688
118 Ga0007417J51691_1047720 3300003544 Bacteria 1393
119 Ga0006558J51389_1020499 3300003558 Bacteria 3482
120 Ga0007427J51700_104977 3300003559 Bacteria 3786
121 Ga0007427J51700_106759 3300003559 Bacteria 1077
122 Ga0006560J51390_1014141 3300003565 Bacteria 14363
123 Ga0006560J51390_1019398 3300003565 Bacteria 4229
124 Ga0006554J51385_1014759 3300003567 Bacteria 5312
125 Ga0006781J51513_1018262 3300003568 Bacteria 2178
126 Ga0007410J51695_1002863 3300003574 Bacteria 2678
127 Ga0007410J51695_1004626 3300003574 Bacteria 5753
128 Ga0007410J51695_1006059 3300003574 Bacteria 3944
129 Ga0007410J51695_1045991 3300003574 Bacteria 3465
130 Ga0007409J51694_1015401 3300003575 Bacteria 4272
131 Ga0007409J51694_1020508 3300003575 Bacteria 2581
132 Ga0007409J51694_1024015 3300003575 Bacteria 7372
133 Ga0007409J51694_1041469 3300003575 Bacteria 1563
134 Ga0007409J51694_1053185 3300003575 Bacteria 1767
135 Ga0007416J51690_1008957 3300003577 Bacteria 1298
136 Ga0007416J51690_1008958 3300003577 Bacteria 1083
137 Ga0007416J51690_1013143 3300003577 Bacteria 3753
138 Ga0007416J51690_1022609 3300003577 Bacteria 2448
139 Ga0007416J51690_1031581 3300003577 Bacteria 4320
140 Ga0007416J51690_1034163 3300003577 Bacteria 2857
141 Ga0006562J51391_1010419 3300003578 Bacteria 3619
142 Ga0006562J51391_1020436 3300003578 Bacteria 2927
143 Ga0006562J51391_1022410 3300003578 Bacteria 3640
144 Ga0007429J51699_1009554 3300003579 Bacteria 5322
145 Ga0007429J51699_1013684 3300003579 Bacteria 1151
146 Ga0007429J51699_1075831 3300003579 Bacteria 1239
147 Ga0007411J51799_102169 3300003611 Bacteria 4153
148 Ga0007411J51799_105007 3300003611 Bacteria 2384
149 Ga0007411J51799_110017 3300003611 Bacteria 2623
150 Ga0007415J51800_108879 3300003613 Bacteria 4302
151 Ga0007415J51800_109874 3300003613 Bacteria 1293
152 Ga0032354_1003506 3300003693 Bacteria 3178
153 Ga0032354_1013988 3300003693 Bacteria 3177
154 Ga0032354_1021066 3300003693 Bacteria 945
155 Ga0032354_1024828 3300003693 Bacteria 3589
156 Ga0032354_1033601 3300003693 Bacteria 2968
157 Ga0032354_1035910 3300003693 Bacteria 4518
158 Ga0006780_1004575 3300003735 Bacteria 5394
159 Ga0055538_1000042 3300003751 Bacteria 164754
160 Ga0055539_1000055 3300003752 Bacteria 164754
161 Ga0055539_1001825 3300003752 Bacteria 3616
162 Ga0055533_1000067 3300003756 Bacteria 164754
163 Ga0055533_1000312 3300003756 Bacteria 23470
164 Ga0055533_1000367 3300003756 Bacteria 18717
165 Ga0055533_1005172 3300003756 Bacteria 2156
166 Ga0055533_1006736 3300003756 Bacteria 1648
167 Ga0055533_1010239 3300003756 Bacteria 1074
168 Ga0055532_1000053 3300003758 Bacteria 164751
169 Ga0055532_1000420 3300003758 Bacteria 20446
170 Ga0055532_1000810 3300003758 Bacteria 10720
171 Ga0055532_1000904 3300003758 Bacteria 9723
172 Ga0055532_1012692 3300003758 Bacteria 971
173 Ga0055525_1000147 3300003759 Bacteria 96457
174 Ga0055525_1000697 3300003759 Bacteria 12243
175 Ga0055525_1001045 3300003759 Bacteria 7187
176 Ga0055525_1001619 3300003759 Bacteria 3542
177 Ga0055527_1000706 3300003760 Bacteria 9723
178 Ga0055527_1000854 3300003760 Bacteria 7973
179 Ga0055527_1002227 3300003760 Bacteria 3396
180 Ga0055535_1001280 3300003761 Bacteria 13685
181 Ga0055535_1001602 3300003761 Bacteria 10720
182 Ga0055535_1001743 3300003761 Bacteria 9723
183 Ga0055535_1005243 3300003761 Bacteria 2897
184 Ga0055535_1011680 3300003761 Bacteria 1374
185 Ga0055542_1000965 3300003762 Bacteria 18727
186 Ga0055542_1000994 3300003762 Bacteria 18210
187 Ga0055542_1004878 3300003762 Bacteria 3136
188 Ga0055529_1000375 3300003763 Bacteria 48263
189 Ga0055529_1000766 3300003763 Bacteria 20251
190 Ga0055529_1001175 3300003763 Bacteria 10720
191 Ga0055529_1001229 3300003763 Bacteria 9723
192 Ga0055529_1004017 3300003763 Bacteria 2305
193 Ga0055526_1001586 3300003771 Bacteria 15971
194 Ga0055526_1001760 3300003771 Bacteria 15032
195 Ga0055526_1006995 3300003771 Bacteria 5983
196 Ga0055526_1008227 3300003771 Bacteria 5243
197 Ga0055526_1013133 3300003771 Bacteria 3534
198 Ga0055526_1016495 3300003771 Bacteria 2884
199 Ga0055526_1040102 3300003771 Bacteria 1184
200 Ga0055526_1040108 3300003771 Bacteria 1184
201 Ga0055526_1041603 3300003771 Bacteria 1143
202 Ga0055526_1060711 3300003771 Bacteria 808
203 Ga0055537_1003514 3300003773 Bacteria 4800
204 Ga0055537_1004461 3300003773 Bacteria 3998
205 Ga0055537_1004555 3300003773 Bacteria 3944
206 Ga0055537_1006936 3300003773 Bacteria 2800
207 Ga0055537_1007348 3300003773 Bacteria 2664
208 Ga0055537_1007354 3300003773 Bacteria 2661
209 Ga0055537_1017394 3300003773 Bacteria 1184
210 Ga0055537_1020411 3300003773 Bacteria 1006
211 Ga0055524_1004310 3300003775 Bacteria 6598
212 Ga0055524_1005244 3300003775 Bacteria 5825
213 Ga0055524_1006155 3300003775 Bacteria 5243
214 Ga0055524_1014273 3300003775 Bacteria 2952
215 Ga0055524_1016630 3300003775 Bacteria 2629
216 Ga0055524_1032332 3300003775 Bacteria 1486
217 Ga0055524_1040578 3300003775 Bacteria 1184
218 Ga0055524_1040607 3300003775 Bacteria 1184
219 Ga0055536_1000672 3300003781 Bacteria 23032
220 Ga0055536_1014497 3300003781 Bacteria 2762
221 Ga0055536_1015419 3300003781 Bacteria 2616
222 Ga0055536_1017482 3300003781 Bacteria 2344
223 Ga0055536_1030613 3300003781 Bacteria 1424
224 Ga0055536_1046536 3300003781 Bacteria 985
225 Ga0055534_1003215 3300003784 Bacteria 5246
226 Ga0055534_1003658 3300003784 Bacteria 4765
227 Ga0055534_1003739 3300003784 Bacteria 4688
228 Ga0055534_1004800 3300003784 Bacteria 3800
229 Ga0055534_1006810 3300003784 Bacteria 2819
230 Ga0055534_1007419 3300003784 Bacteria 2615
231 Ga0055534_1008408 3300003784 Bacteria 2339
232 Ga0055534_1010540 3300003784 Bacteria 1930
233 Ga0055534_1019064 3300003784 Bacteria 1184
234 Ga0055528_1003799 3300003790 Bacteria 7438
235 Ga0055528_1003884 3300003790 Bacteria 7344
236 Ga0055528_1006600 3300003790 Bacteria 5246
237 Ga0055528_1007487 3300003790 Bacteria 4820
238 Ga0055528_1007975 3300003790 Bacteria 4609
239 Ga0055528_1012187 3300003790 Bacteria 3355
240 Ga0055528_1017429 3300003790 Bacteria 2489
241 Ga0055528_1032883 3300003790 Bacteria 1312
242 Ga0055528_1036161 3300003790 Bacteria 1184
243 Ga0055530_10008665 3300003791 Bacteria 4029
244 Ga0055530_10012163 3300003791 Bacteria 3023
245 Ga0055530_10014192 3300003791 Bacteria 2668
246 Ga0055530_10016596 3300003791 Bacteria 2344
247 Ga0055530_10018909 3300003791 Bacteria 2106
248 Ga0055540_1002657 3300003792 Bacteria 9244
249 Ga0055540_1004941 3300003792 Bacteria 5809
250 Ga0055540_1015112 3300003792 Bacteria 2264
251 Ga0055540_1019361 3300003792 Bacteria 1834
252 Ga0055540_1020762 3300003792 Bacteria 1728
253 Ga0055540_1026260 3300003792 Bacteria 1411
254 Ga0055540_1045173 3300003792 Bacteria 932
255 Ga0055531_10008751 3300003794 Bacteria 5281
256 Ga0055531_10009310 3300003794 Bacteria 5038
257 Ga0055531_10011515 3300003794 Bacteria 4253
258 Ga0055531_10013115 3300003794 Bacteria 3846
259 Ga0055531_10013410 3300003794 Bacteria 3777
260 Ga0055531_10014923 3300003794 Bacteria 3465
261 Ga0055531_10018127 3300003794 Bacteria 2925
262 Ga0055531_10020406 3300003794 Bacteria 2622
263 Ga0055531_10024841 3300003794 Bacteria 2195
264 Ga0055531_10046801 3300003794 Bacteria 1184
265 Ga0055531_10065047 3300003794 Bacteria 869
266 Ga0055541_1000042 3300003841 Bacteria 164754
267 Ga0055541_1016198 3300003841 Bacteria 972
268 Ga0058692_1003260 3300003856 Bacteria 5078
269 Ga0058692_1003324 3300003856 Bacteria 5001
270 Ga0058692_1008521 3300003856 Bacteria 2644
271 Ga0058692_1021124 3300003856 Bacteria 1357
272 Ga0055543_1000308 3300004625 Bacteria 34048
273 Ga0055543_1001868 3300004625 Bacteria 7667
274 Ga0055543_1006838 3300004625 Bacteria 2709
275 Ga0055543_1019404 3300004625 Bacteria 1258
276 Ga0055543_1020426 3300004625 Bacteria 1217
277 Ga0058858_1366593 3300004785 Bacteria 887
278 Ga0058858_1423729 3300004785 Bacteria 1565
279 Ga0058860_10182235 3300004801 Bacteria 1267
280 Ga0058860_10196087 3300004801 Bacteria 1346
281 Ga0058862_12845279 3300004803 Bacteria 2854
282 Ga0065165_1002163 3300005262 Bacteria 17774
283 Ga0065165_1003318 3300005262 Bacteria 11513
284 Ga0065165_1005491 3300005262 Bacteria 7095
285 Ga0065165_1007574 3300005262 Bacteria 5292
286 Ga0065165_1012211 3300005262 Bacteria 3513
287 Ga0065165_1017368 3300005262 Bacteria 2655
288 Ga0065165_1036732 3300005262 Bacteria 1491
289 Ga0065165_1084770 3300005262 Bacteria 816
290 Ga0065703_1000567 3300005272 Bacteria 4900
291 Ga0065714_10000728 3300005288 Bacteria 3126
292 Ga0065714_10010780 3300005288 Bacteria 2051
293 Ga0065714_10013518 3300005288 Bacteria 4610
294 Ga0065714_10093619 3300005288 Bacteria 1840
295 Ga0065714_10141567 3300005288 Bacteria 1167
296 Ga0065714_10156470 3300005288 Bacteria 1071
297 Ga0065714_10204262 3300005288 Bacteria 886
298 Ga0065704_10004101 3300005289 Bacteria 3740
299 Ga0065704_10012044 3300005289 Bacteria 1903
300 Ga0065704_10033296 3300005289 Bacteria 1034
301 Ga0065704_10048089 3300005289 Bacteria 1697
302 Ga0065704_10071580 3300005289 Bacteria 10645
303 Ga0065704_10083470 3300005289 Bacteria 3462
304 Ga0065704_10083997 3300005289 Bacteria 3390
305 Ga0065704_10109360 3300005289 Bacteria 2005
306 Ga0065704_10148391 3300005289 Bacteria 1451
307 Ga0065704_10174585 3300005289 Bacteria 1271
308 Ga0065704_10326866 3300005289 Bacteria 844
309 Ga0065712_10013211 3300005290 Bacteria 1972
310 Ga0065712_10068086 3300005290 Bacteria 15217
311 Ga0065715_10009586 3300005293 Bacteria 2311
312 Ga0065715_10050774 3300005293 Bacteria 1034
313 Ga0065715_10100546 3300005293 Bacteria 3292
314 Ga0065715_10198104 3300005293 Bacteria 1376
315 Ga0065715_10275534 3300005293 Bacteria 1099
316 Ga0065715_10414577 3300005293 Bacteria 865
317 Ga0065707_10084317 3300005295 Bacteria 7350
318 Ga0065707_10094071 3300005295 Bacteria 3540
319 Ga0065707_10145446 3300005295 Bacteria 1719
320 Ga0070658_10034935 3300005327 Bacteria 4046
321 Ga0070658_10308330 3300005327 Bacteria 1350
322 Ga0070658_10325437 3300005327 Bacteria 1313
323 Ga0070676_10012937 3300005328 Bacteria 4571
324 Ga0070676_10575125 3300005328 Bacteria 809
325 Ga0070683_100062099 3300005329 Bacteria 3474
326 Ga0070683_100108640 3300005329 Bacteria 2616
327 Ga0070683_100367281 3300005329 Bacteria 1370
328 Ga0070690_100024862 3300005330 Bacteria 3686
329 Ga0070690_100079606 3300005330 Bacteria 2142
330 Ga0070690_100324328 3300005330 Bacteria 1111
331 Ga0070690_100334634 3300005330 Bacteria 1095
332 Ga0070690_100632237 3300005330 Bacteria 816
333 Ga0070670_100008976 3300005331 Bacteria 8539
334 Ga0070670_100035940 3300005331 Bacteria 4265
335 Ga0070670_100172285 3300005331 Bacteria 1877
336 Ga0070670_100174975 3300005331 Bacteria 1863
337 Ga0070670_100273814 3300005331 Bacteria 1473
338 Ga0070670_100318007 3300005331 Bacteria 1363
339 Ga0070670_100411167 3300005331 Bacteria 1195
340 Ga0070670_100422365 3300005331 Bacteria 1179
341 Ga0070670_100721135 3300005331 Bacteria 897
342 Ga0070677_10016786 3300005333 Bacteria 2611
343 Ga0070677_10017819 3300005333 Bacteria 2548
344 Ga0070677_10022484 3300005333 Bacteria 2323
345 Ga0070677_10031308 3300005333 Bacteria 2032
346 Ga0070677_10153971 3300005333 Bacteria 1072
347 Ga0068869_100012392 3300005334 Bacteria 5634
348 Ga0068869_100134056 3300005334 Bacteria 1906
349 Ga0068869_100203574 3300005334 Bacteria 1562
350 Ga0068869_100243813 3300005334 Bacteria 1433
351 Ga0068869_100322259 3300005334 Bacteria 1253
352 Ga0068869_100409706 3300005334 Bacteria 1116
353 Ga0070666_10039409 3300005335 Bacteria 3149
354 Ga0070666_10044235 3300005335 Bacteria 2982
355 Ga0070666_10081242 3300005335 Bacteria 2215
356 Ga0070666_10149611 3300005335 Bacteria 1628
357 Ga0070666_10320407 3300005335 Bacteria 1106
358 Ga0070680_100134450 3300005336 Bacteria 2070
359 Ga0070680_100248523 3300005336 Bacteria 1504
360 Ga0070682_100043929 3300005337 Bacteria 2764
361 Ga0070682_100113107 3300005337 Bacteria 1812
362 Ga0070682_100210161 3300005337 Bacteria 1378
363 Ga0070682_100274736 3300005337 Bacteria 1226
364 Ga0070682_100365698 3300005337 Bacteria 1080
365 Ga0068868_100034412 3300005338 Bacteria 3911
366 Ga0068868_100035172 3300005338 Bacteria 3871
367 Ga0068868_100054643 3300005338 Bacteria 3148
368 Ga0068868_100085371 3300005338 Bacteria 2536
369 Ga0068868_100090067 3300005338 Bacteria 2470
370 Ga0070660_100004872 3300005339 Bacteria 9275
371 Ga0070660_100033761 3300005339 Bacteria 3859
372 Ga0070660_100042216 3300005339 Bacteria 3480
373 Ga0070660_100054384 3300005339 Bacteria 3091
374 Ga0070660_100064011 3300005339 Bacteria 2860
375 Ga0070660_100163159 3300005339 Bacteria 1796
376 Ga0070660_100170370 3300005339 Bacteria 1758
377 Ga0070660_100180761 3300005339 Bacteria 1707
378 Ga0070689_100456633 3300005340 Bacteria 1088
379 Ga0070689_100504853 3300005340 Bacteria 1037
380 Ga0070691_10029274 3300005341 Bacteria 2575
381 Ga0070691_10171364 3300005341 Bacteria 1125
382 Ga0070661_100011000 3300005344 Bacteria 6306
383 Ga0070661_100012369 3300005344 Bacteria 5970
384 Ga0070661_100022248 3300005344 Bacteria 4538
385 Ga0070661_100041940 3300005344 Bacteria 3339
386 Ga0070661_100045102 3300005344 Bacteria 3222
387 Ga0070661_100132569 3300005344 Bacteria 1873
388 Ga0070661_100157554 3300005344 Bacteria 1718
389 Ga0070661_100647423 3300005344 Bacteria 858
390 Ga0070668_100014264 3300005347 Bacteria 5938
391 Ga0070668_100039490 3300005347 Bacteria 3609
392 Ga0070668_100042424 3300005347 Bacteria 3487
393 Ga0070668_100082658 3300005347 Bacteria 2519
394 Ga0070668_100518289 3300005347 Bacteria 1034
395 Ga0070669_100001492 3300005353 Bacteria 16905
396 Ga0070669_100015248 3300005353 Bacteria 5474
397 Ga0070669_100036662 3300005353 Bacteria 3555
398 Ga0070669_100053724 3300005353 Bacteria 2949
399 Ga0070669_100079880 3300005353 Bacteria 2433
400 Ga0070669_100144424 3300005353 Bacteria 1837
401 Ga0070669_100191468 3300005353 Bacteria 1605
402 Ga0070669_100251075 3300005353 Bacteria 1408
403 Ga0070669_100301475 3300005353 Bacteria 1289
404 Ga0070669_100448007 3300005353 Bacteria 1064
405 Ga0070669_100674029 3300005353 Bacteria 871
406 Ga0070675_100036618 3300005354 Bacteria 3994
407 Ga0070675_100053700 3300005354 Bacteria 3314
408 Ga0070675_100056757 3300005354 Bacteria 3227
409 Ga0070675_100061728 3300005354 Bacteria 3095
410 Ga0070675_100075970 3300005354 Bacteria 2793
411 Ga0070675_100162855 3300005354 Bacteria 1919
412 Ga0070675_100253368 3300005354 Bacteria 1541
413 Ga0070675_100359043 3300005354 Bacteria 1293
414 Ga0070675_100405037 3300005354 Bacteria 1217
415 Ga0070675_100658881 3300005354 Bacteria 952
416 Ga0070671_100019286 3300005355 Bacteria 5548
417 Ga0070671_100023893 3300005355 Bacteria 5002
418 Ga0070671_100027806 3300005355 Bacteria 4655
419 Ga0070671_100071083 3300005355 Bacteria 2904
420 Ga0070671_100080855 3300005355 Bacteria 2717
421 Ga0070671_100082359 3300005355 Bacteria 2690
422 Ga0070671_100174467 3300005355 Bacteria 1818
423 Ga0070671_100275046 3300005355 Bacteria 1431
424 Ga0070671_100399634 3300005355 Bacteria 1175
425 Ga0070671_100503577 3300005355 Bacteria 1042
426 Ga0070671_100543545 3300005355 Bacteria 1001
427 Ga0070674_100028598 3300005356 Bacteria 3662
428 Ga0070674_100052645 3300005356 Bacteria 2808
429 Ga0070674_100267987 3300005356 Bacteria 1348
430 Ga0070673_100038659 3300005364 Bacteria 3645
431 Ga0070673_100269916 3300005364 Bacteria 1489
432 Ga0070673_100270418 3300005364 Bacteria 1487
433 Ga0070673_100301582 3300005364 Bacteria 1410
434 Ga0070673_100345478 3300005364 Bacteria 1319
435 Ga0070673_100642635 3300005364 Bacteria 971
436 Ga0070659_100004507 3300005366 Bacteria 9949
437 Ga0070659_100022490 3300005366 Bacteria 4814
438 Ga0070659_100023988 3300005366 Bacteria 4673
439 Ga0070659_100039486 3300005366 Bacteria 3685
440 Ga0070659_100047642 3300005366 Bacteria 3363
441 Ga0070659_100061501 3300005366 Bacteria 2967
442 Ga0070659_100174424 3300005366 Bacteria 1763
443 Ga0070659_100618863 3300005366 Bacteria 932
444 Ga0070667_100007562 3300005367 Bacteria 9013
445 Ga0070667_100036835 3300005367 Bacteria 4101
446 Ga0070667_100129740 3300005367 Bacteria 2199
447 Ga0070667_100142463 3300005367 Bacteria 2100
448 Ga0070667_100170432 3300005367 Bacteria 1921
449 Ga0070667_100226428 3300005367 Bacteria 1666
450 Ga0070667_100271951 3300005367 Bacteria 1519
451 Ga0070667_100484284 3300005367 Bacteria 1133
452 Ga0070709_10025539 3300005434 Bacteria 3492
453 Ga0070714_100091839 3300005435 Bacteria 2660
454 Ga0070714_100115809 3300005435 Bacteria 2379
455 Ga0070714_100142641 3300005435 Bacteria 2152
456 Ga0070714_100207729 3300005435 Bacteria 1794
457 Ga0070714_100890750 3300005435 Bacteria 864
458 Ga0070713_100003527 3300005436 Bacteria 10338
459 Ga0070713_100030888 3300005436 Bacteria 4260
460 Ga0070713_100067816 3300005436 Bacteria 3005
461 Ga0070710_10004507 3300005437 Bacteria 6591
462 Ga0070711_100003541 3300005439 Bacteria 9110
463 Ga0070711_100050127 3300005439 Bacteria 2861
464 Ga0070705_100026206 3300005440 Bacteria 3171
465 Ga0070694_100033358 3300005444 Bacteria 3387
466 Ga0070708_100709372 3300005445 Bacteria 947
467 Ga0070663_100001491 3300005455 Bacteria 12866
468 Ga0070663_100002790 3300005455 Bacteria 9908
469 Ga0070663_100044432 3300005455 Bacteria 3132
470 Ga0070663_100220534 3300005455 Bacteria 1489
471 Ga0070663_100472609 3300005455 Bacteria 1037
472 Ga0070678_100001065 3300005456 Bacteria 14335
473 Ga0070678_100020058 3300005456 Bacteria 4378
474 Ga0070678_100071087 3300005456 Bacteria 2604
475 Ga0070678_100235399 3300005456 Bacteria 1529
476 Ga0070662_100018993 3300005457 Bacteria 4659
477 Ga0070662_100023222 3300005457 Bacteria 4258
478 Ga0070662_100045531 3300005457 Bacteria 3148
479 Ga0070662_100142409 3300005457 Bacteria 1859
480 Ga0070662_100242269 3300005457 Bacteria 1447
481 Ga0070662_100252324 3300005457 Bacteria 1419
482 Ga0070662_100278752 3300005457 Bacteria 1352
483 Ga0070662_100317088 3300005457 Bacteria 1270
484 Ga0070662_100366824 3300005457 Bacteria 1183
485 Ga0070681_10042650 3300005458 Bacteria 4546
486 Ga0070681_10239425 3300005458 Bacteria 1728
487 Ga0070681_10315981 3300005458 Bacteria 1471
488 Ga0068867_100020316 3300005459 Bacteria 4732
489 Ga0068867_100036683 3300005459 Bacteria 3561
490 Ga0068867_100072766 3300005459 Bacteria 2573
491 Ga0068867_100079076 3300005459 Bacteria 2475
492 Ga0068867_100085089 3300005459 Bacteria 2390
493 Ga0068867_100191191 3300005459 Bacteria 1633
494 Ga0068867_100233655 3300005459 Bacteria 1487
495 Ga0068867_100241435 3300005459 Bacteria 1465
496 Ga0068867_100523793 3300005459 Bacteria 1022
497 Ga0068867_100558279 3300005459 Bacteria 993
498 Ga0070685_10066875 3300005466 Bacteria 2119
499 Ga0070706_100138334 3300005467 Bacteria 2273
500 Ga0070706_100176493 3300005467 Bacteria 1995
501 Ga0070707_100027492 3300005468 Bacteria 5412
502 Ga0070698_100099864 3300005471 Bacteria 2875
503 Ga0070679_100015259 3300005530 Bacteria 7381
504 Ga0070679_100100542 3300005530 Bacteria 2878
505 Ga0070679_100112579 3300005530 Bacteria 2707
506 Ga0070679_100506104 3300005530 Bacteria 1152
507 Ga0070679_100736605 3300005530 Bacteria 929
508 Ga0070684_100053645 3300005535 Bacteria 3510
509 Ga0070684_100071158 3300005535 Bacteria 3061
510 Ga0068853_100008367 3300005539 Bacteria 8307
511 Ga0068853_100129859 3300005539 Bacteria 2255
512 Ga0068853_100146388 3300005539 Bacteria 2123
513 Ga0068853_100287991 3300005539 Bacteria 1516
514 Ga0068853_100536368 3300005539 Bacteria 1107
515 Ga0068853_100711380 3300005539 Bacteria 958
516 Ga0070672_100014710 3300005543 Bacteria 5551
517 Ga0070672_100083454 3300005543 Bacteria 2564
518 Ga0070672_100112906 3300005543 Bacteria 2217
519 Ga0070672_100251260 3300005543 Bacteria 1489
520 Ga0070672_100295397 3300005543 Bacteria 1372
521 Ga0070672_100323773 3300005543 Bacteria 1311
522 Ga0070672_100348310 3300005543 Bacteria 1262
523 Ga0070672_100384124 3300005543 Bacteria 1201
524 Ga0070672_100511513 3300005543 Bacteria 1039
525 Ga0070686_100097020 3300005544 Bacteria 1983
526 Ga0070686_100618358 3300005544 Bacteria 855
527 Ga0070693_100008770 3300005547 Bacteria 5008
528 Ga0070693_100037395 3300005547 Bacteria 2706
529 Ga0070693_100126049 3300005547 Bacteria 1594
530 Ga0070665_100016625 3300005548 Bacteria 7372
531 Ga0070665_100019353 3300005548 Bacteria 6831
532 Ga0070665_100022199 3300005548 Bacteria 6385
533 Ga0070665_100026283 3300005548 Bacteria 5863
534 Ga0070665_100076166 3300005548 Bacteria 3362
535 Ga0070665_100157559 3300005548 Bacteria 2272
536 Ga0070665_100158839 3300005548 Bacteria 2262
537 Ga0070665_100168679 3300005548 Bacteria 2191
538 Ga0070665_100173818 3300005548 Bacteria 2155
539 Ga0070665_100384776 3300005548 Bacteria 1410
540 Ga0070665_100399193 3300005548 Bacteria 1383
541 Ga0070665_100548171 3300005548 Bacteria 1168
542 Ga0070665_100548241 3300005548 Bacteria 1168
543 Ga0070665_100792787 3300005548 Bacteria 960
544 Ga0070665_100934252 3300005548 Bacteria 880
545 Ga0070665_101017901 3300005548 Bacteria 840
546 Ga0070704_100074190 3300005549 Bacteria 2481
547 Ga0068855_100004511 3300005563 Bacteria 17012
548 Ga0068855_100053580 3300005563 Bacteria 4745
549 Ga0068855_100097026 3300005563 Bacteria 3395
550 Ga0068855_100123020 3300005563 Bacteria 2968
551 Ga0068855_100317666 3300005563 Bacteria 1722
552 Ga0068855_100356361 3300005563 Bacteria 1610
553 Ga0068855_100930881 3300005563 Bacteria 916
554 Ga0070664_100000356 3300005564 Bacteria 33677
555 Ga0070664_100001142 3300005564 Bacteria 21014
556 Ga0070664_100031876 3300005564 Bacteria 4407
557 Ga0070664_100048424 3300005564 Bacteria 3592
558 Ga0070664_100158321 3300005564 Bacteria 2002
559 Ga0070664_100189170 3300005564 Bacteria 1833
560 Ga0070664_100196662 3300005564 Bacteria 1797
561 Ga0070664_100210034 3300005564 Bacteria 1739
562 Ga0070664_100413474 3300005564 Bacteria 1234
563 Ga0070664_100529728 3300005564 Bacteria 1088
564 Ga0070664_100534215 3300005564 Bacteria 1083
565 Ga0070664_100563869 3300005564 Bacteria 1054
566 Ga0068857_100006407 3300005577 Bacteria 10091
567 Ga0068857_100025716 3300005577 Bacteria 5183
568 Ga0068857_100032464 3300005577 Bacteria 4616
569 Ga0068857_100046047 3300005577 Bacteria 3870
570 Ga0068857_100233551 3300005577 Bacteria 1682
571 Ga0068857_100445116 3300005577 Bacteria 1211
572 Ga0068854_100008705 3300005578 Bacteria 6530
573 Ga0068854_100086090 3300005578 Bacteria 2329
574 Ga0068854_100156655 3300005578 Bacteria 1760
575 Ga0068854_100167081 3300005578 Bacteria 1709
576 Ga0068854_100202094 3300005578 Bacteria 1563
577 Ga0068854_100330975 3300005578 Bacteria 1241
578 Ga0068856_100017010 3300005614 Bacteria 7048
579 Ga0068856_100085286 3300005614 Bacteria 3137
580 Ga0068856_100087143 3300005614 Bacteria 3103
581 Ga0068856_100091085 3300005614 Bacteria 3034
582 Ga0068856_100114691 3300005614 Bacteria 2694
583 Ga0068856_100333528 3300005614 Bacteria 1534
584 Ga0068856_100340212 3300005614 Bacteria 1518
585 Ga0068852_100062072 3300005616 Bacteria 3249
586 Ga0068852_100075479 3300005616 Bacteria 2974
587 Ga0068852_100136545 3300005616 Bacteria 2265
588 Ga0068852_100138200 3300005616 Bacteria 2252
589 Ga0068852_100267268 3300005616 Bacteria 1644
590 Ga0068852_100368009 3300005616 Bacteria 1407
591 Ga0068852_100670704 3300005616 Bacteria 1045
592 Ga0068859_100406391 3300005617 Bacteria 1457
593 Ga0068859_100640986 3300005617 Bacteria 1155
594 Ga0068864_100042982 3300005618 Bacteria 3868
595 Ga0068864_100408442 3300005618 Bacteria 1292
596 Ga0068864_100602194 3300005618 Bacteria 1066
597 Ga0068864_100629958 3300005618 Bacteria 1043
598 Ga0068866_10022564 3300005718 Bacteria 2915
599 Ga0068866_10038012 3300005718 Bacteria 2368
600 Ga0068866_10051681 3300005718 Bacteria 2093
601 Ga0068861_100014692 3300005719 Bacteria 5498
602 Ga0068861_100026051 3300005719 Bacteria 4247
603 Ga0068861_100035592 3300005719 Bacteria 3689
604 Ga0068861_100058573 3300005719 Bacteria 2946
605 Ga0068861_100110945 3300005719 Bacteria 2197
606 Ga0068861_100260788 3300005719 Bacteria 1484
607 Ga0068861_100354319 3300005719 Bacteria 1288
608 Ga0068861_100476514 3300005719 Bacteria 1124
609 Ga0068851_10006211 3300005834 Bacteria 5452
610 Ga0068851_10017555 3300005834 Bacteria 3438
611 Ga0068851_10084771 3300005834 Bacteria 1660
612 Ga0068851_10100433 3300005834 Bacteria 1535
613 Ga0068851_10130722 3300005834 Bacteria 1357
614 Ga0068870_10034752 3300005840 Bacteria 2581
615 Ga0068870_10176362 3300005840 Bacteria 1279
616 Ga0068870_10216235 3300005840 Bacteria 1170
617 Ga0068863_100011275 3300005841 Bacteria 8658
618 Ga0068863_100042406 3300005841 Bacteria 4323
619 Ga0068863_100088523 3300005841 Bacteria 2934
620 Ga0068863_100093146 3300005841 Bacteria 2859
621 Ga0068863_100144359 3300005841 Bacteria 2276
622 Ga0068863_100357873 3300005841 Bacteria 1422
623 Ga0068858_100018393 3300005842 Bacteria 6542
624 Ga0068858_100024611 3300005842 Bacteria 5610
625 Ga0068858_100036312 3300005842 Bacteria 4569
626 Ga0068858_100121304 3300005842 Bacteria 2445
627 Ga0068858_100399254 3300005842 Bacteria 1321
628 Ga0068858_100548838 3300005842 Bacteria 1119
629 Ga0068860_100012597 3300005843 Bacteria 8324
630 Ga0068860_100016232 3300005843 Bacteria 7260
631 Ga0068860_100058871 3300005843 Bacteria 3653
632 Ga0068860_100164365 3300005843 Bacteria 2142
633 Ga0068860_100789241 3300005843 Bacteria 963
634 Ga0068862_100024248 3300005844 Bacteria 5089
635 Ga0068862_100100822 3300005844 Bacteria 2525
636 Ga0068862_100105038 3300005844 Bacteria 2475
637 Ga0068862_100118255 3300005844 Bacteria 2333
638 Ga0068862_100123369 3300005844 Bacteria 2285
639 Ga0068862_100125193 3300005844 Bacteria 2269
640 Ga0068862_100156360 3300005844 Bacteria 2032
641 Ga0068862_100382834 3300005844 Bacteria 1312
642 Ga0068862_100485940 3300005844 Bacteria 1170
643 Ga0068862_100598014 3300005844 Bacteria 1059
644 Ga0081455_10000719 3300005937 Bacteria 42956
645 Ga0081539_10000011 3300005985 Bacteria 461887
646 Ga0070717_10008147 3300006028 Bacteria 7821
647 Ga0070717_10233787 3300006028 Bacteria 1619
648 Ga0070717_10270577 3300006028 Bacteria 1505
649 Ga0075365_10020475 3300006038 Bacteria 4102
650 Ga0075365_10057081 3300006038 Bacteria 2597
651 Ga0075365_10065768 3300006038 Bacteria 2430
652 Ga0075365_10336381 3300006038 Bacteria 1064
653 Ga0075368_10009651 3300006042 Bacteria 3475
654 Ga0075368_10014215 3300006042 Bacteria 2937
655 Ga0075368_10121622 3300006042 Bacteria 1081
656 Ga0075368_10178109 3300006042 Bacteria 895
657 Ga0075363_100009222 3300006048 Bacteria 4635
658 Ga0075363_100012214 3300006048 Bacteria 4134
659 Ga0075363_100016273 3300006048 Bacteria 3672
660 Ga0075363_100031525 3300006048 Bacteria 2749
661 Ga0075363_100075525 3300006048 Bacteria 1836
662 Ga0075363_100177638 3300006048 Bacteria 1210
663 Ga0075363_100251625 3300006048 Bacteria 1017
664 Ga0075363_100369406 3300006048 Bacteria 840
665 Ga0075364_10008143 3300006051 Bacteria 6254
666 Ga0075364_10022236 3300006051 Bacteria 4002
667 Ga0075364_10031524 3300006051 Bacteria 3406
668 Ga0075364_10032496 3300006051 Bacteria 3355
669 Ga0075364_10039645 3300006051 Bacteria 3054
670 Ga0075364_10041952 3300006051 Bacteria 2972
671 Ga0075364_10074969 3300006051 Bacteria 2231
672 Ga0075432_10097008 3300006058 Bacteria 1085
673 Ga0070715_10009837 3300006163 Bacteria 3387
674 Ga0070715_10047015 3300006163 Bacteria 1838
675 Ga0070715_10070390 3300006163 Bacteria 1561
676 Ga0070715_10111245 3300006163 Bacteria 1292
677 Ga0070716_100288591 3300006173 Bacteria 1136
678 Ga0070712_100017901 3300006175 Bacteria 4591
679 Ga0070712_100080569 3300006175 Bacteria 2357
680 Ga0075362_10002336 3300006177 Bacteria 6348
681 Ga0075362_10032123 3300006177 Bacteria 2276
682 Ga0075362_10040414 3300006177 Bacteria 2053
683 Ga0075362_10061659 3300006177 Bacteria 1697
684 Ga0075362_10070332 3300006177 Bacteria 1597
685 Ga0075362_10076455 3300006177 Bacteria 1537
686 Ga0075362_10138046 3300006177 Bacteria 1164
687 Ga0075367_10089712 3300006178 Bacteria 1869
688 Ga0075367_10148848 3300006178 Bacteria 1452
689 Ga0075367_10244469 3300006178 Bacteria 1125
690 Ga0075369_10018756 3300006186 Bacteria 2819
691 Ga0075369_10019408 3300006186 Bacteria 2775
692 Ga0075369_10033207 3300006186 Bacteria 2186
693 Ga0075369_10117470 3300006186 Bacteria 1202
694 Ga0075369_10166541 3300006186 Bacteria 1011
695 Ga0075366_10004740 3300006195 Bacteria 7327
696 Ga0075366_10020376 3300006195 Bacteria 3848
697 Ga0075366_10039994 3300006195 Bacteria 2772
698 Ga0075366_10045922 3300006195 Bacteria 2588
699 Ga0075366_10046781 3300006195 Bacteria 2564
700 Ga0075366_10123301 3300006195 Bacteria 1562
701 Ga0075366_10129179 3300006195 Bacteria 1524
702 Ga0075366_10204762 3300006195 Bacteria 1200
703 Ga0075366_10227509 3300006195 Bacteria 1136
704 Ga0075366_10252643 3300006195 Bacteria 1075
705 Ga0075366_10387477 3300006195 Bacteria 860
706 Ga0075366_10425100 3300006195 Bacteria 819
707 Ga0097621_100002428 3300006237 Bacteria 12764
708 Ga0097621_100036459 3300006237 Bacteria 3935
709 Ga0097621_100045976 3300006237 Bacteria 3529
710 Ga0097621_100046420 3300006237 Bacteria 3515
711 Ga0097621_100078941 3300006237 Bacteria 2735
712 Ga0097621_100275244 3300006237 Bacteria 1480
713 Ga0097621_100326365 3300006237 Bacteria 1360
714 Ga0097621_100425942 3300006237 Bacteria 1192
715 Ga0097621_100521674 3300006237 Bacteria 1078
716 Ga0075370_10010622 3300006353 Bacteria 4823
717 Ga0075370_10011570 3300006353 Bacteria 4639
718 Ga0075370_10017419 3300006353 Bacteria 3882
719 Ga0075370_10018877 3300006353 Bacteria 3745
720 Ga0075370_10020081 3300006353 Bacteria 3646
721 Ga0075370_10082080 3300006353 Bacteria 1853
722 Ga0075370_10331532 3300006353 Bacteria 907
723 Ga0068871_100030676 3300006358 Bacteria 4236
724 Ga0068871_100135864 3300006358 Bacteria 2088
725 Ga0068871_100281463 3300006358 Bacteria 1455
726 Ga0068871_100286442 3300006358 Bacteria 1442
727 Ga0068871_100570321 3300006358 Bacteria 1027
728 Ga0068871_100829289 3300006358 Bacteria 854
729 Ga0075428_100049471 3300006844 Bacteria 4612
730 Ga0075428_100114355 3300006844 Bacteria 2940
731 Ga0075430_100062166 3300006846 Bacteria 3137
732 Ga0075430_100258158 3300006846 Bacteria 1443
733 Ga0075430_100552563 3300006846 Bacteria 950
734 Ga0075431_100082693 3300006847 Bacteria 3315
735 Ga0075431_100083964 3300006847 Bacteria 3288
736 Ga0075431_100168183 3300006847 Bacteria 2253
737 Ga0075431_100461728 3300006847 Bacteria 1264
738 Ga0075431_100655978 3300006847 Bacteria 1029
739 Ga0075429_100150353 3300006880 Bacteria 2039
740 Ga0068865_100013447 3300006881 Bacteria 5171
741 Ga0068865_100132161 3300006881 Bacteria 1871
742 Ga0097620_100406394 3300006931 Bacteria 1457
743 Ga0097620_100640938 3300006931 Bacteria 1155
744 Ga0099823_1002332 3300006944 Bacteria 17011
745 Ga0099823_1049317 3300006944 Bacteria 2639
746 Ga0079104_1000460 3300006946 Bacteria 45964
747 Ga0079104_1001225 3300006946 Bacteria 18084
748 Ga0079104_1029861 3300006946 Bacteria 1368
749 Ga0079104_1030543 3300006946 Bacteria 1343
750 Ga0099826_10000051 3300006948 Bacteria 73584
751 Ga0099826_10000093 3300006948 Bacteria 43176
752 Ga0099826_10014646 3300006948 Bacteria 5924
753 Ga0099826_10029122 3300006948 Bacteria 4029
754 Ga0099826_10291196 3300006948 Bacteria 839
755 Ga0075435_100252679 3300007076 Bacteria 1501
756 Ga0105251_10007598 3300009011 Bacteria 6651
757 Ga0105251_10008134 3300009011 Bacteria 6345
758 Ga0105251_10009588 3300009011 Bacteria 5704
759 Ga0105251_10010315 3300009011 Bacteria 5432
760 Ga0105251_10010748 3300009011 Bacteria 5281
761 Ga0105251_10021253 3300009011 Bacteria 3392
762 Ga0105251_10023967 3300009011 Bacteria 3140
763 Ga0105251_10026606 3300009011 Bacteria 2944
764 Ga0105251_10041620 3300009011 Bacteria 2235
765 Ga0105251_10102054 3300009011 Bacteria 1311
766 Ga0105251_10110775 3300009011 Bacteria 1251
767 Ga0105251_10117327 3300009011 Bacteria 1210
768 Ga0105251_10163685 3300009011 Bacteria 1003
769 Ga0105251_10172621 3300009011 Bacteria 974
770 Ga0105251_10197120 3300009011 Bacteria 907
771 Ga0105244_10015476 3300009036 Bacteria 4374
772 Ga0105244_10018351 3300009036 Bacteria 3926
773 Ga0105244_10028299 3300009036 Bacteria 3008
774 Ga0105244_10051247 3300009036 Bacteria 2104
775 Ga0105244_10061556 3300009036 Bacteria 1888
776 Ga0105244_10117479 3300009036 Bacteria 1290
777 Ga0105244_10147254 3300009036 Bacteria 1129
778 Ga0105244_10147256 3300009036 Bacteria 1129
779 Ga0105244_10243091 3300009036 Bacteria 840
780 Ga0105250_10000429 3300009092 Bacteria 30738
781 Ga0105250_10001011 3300009092 Bacteria 16287
782 Ga0105250_10001873 3300009092 Bacteria 10933
783 Ga0105250_10006995 3300009092 Bacteria 4875
784 Ga0105250_10021127 3300009092 Bacteria 2628
785 Ga0105250_10079017 3300009092 Bacteria 1333
786 Ga0105250_10086987 3300009092 Bacteria 1269
787 Ga0105250_10089428 3300009092 Bacteria 1251
788 Ga0105250_10104016 3300009092 Bacteria 1160
789 Ga0105250_10176664 3300009092 Bacteria 895
790 Ga0105250_10234897 3300009092 Bacteria 780
791 Ga0105240_10003945 3300009093 Bacteria 22922
792 Ga0105240_10028244 3300009093 Bacteria 7329
793 Ga0105240_10046199 3300009093 Bacteria 5519
794 Ga0105240_10061281 3300009093 Bacteria 4688
795 Ga0105240_10084275 3300009093 Bacteria 3898
796 Ga0105240_10118621 3300009093 Bacteria 3188
797 Ga0105240_10127654 3300009093 Bacteria 3054
798 Ga0105240_10266269 3300009093 Bacteria 1975
799 Ga0105240_10285115 3300009093 Bacteria 1896
800 Ga0105240_10321604 3300009093 Bacteria 1763
801 Ga0105240_10389827 3300009093 Bacteria 1571
802 Ga0105240_10430869 3300009093 Bacteria 1480
803 Ga0105240_10558908 3300009093 Bacteria 1265
804 Ga0105240_10872058 3300009093 Bacteria 970
805 Ga0105240_10930410 3300009093 Bacteria 933
806 Ga0111539_10016296 3300009094 Bacteria 9217
807 Ga0111539_10261586 3300009094 Bacteria 2014
808 Ga0111539_10616300 3300009094 Bacteria 1264
809 Ga0111539_10687435 3300009094 Bacteria 1191
810 Ga0105245_10016847 3300009098 Bacteria 6380
811 Ga0105245_10043502 3300009098 Bacteria 4006
812 Ga0105245_10097601 3300009098 Bacteria 2714
813 Ga0105245_11148656 3300009098 Bacteria 824
814 Ga0105247_10014245 3300009101 Bacteria 4772
815 Ga0105247_10158604 3300009101 Bacteria 1496
816 Ga0105247_10173586 3300009101 Bacteria 1435
817 Ga0114129_10090756 3300009147 Bacteria 4234
818 Ga0105243_10000248 3300009148 Bacteria 62037
819 Ga0105243_10007089 3300009148 Bacteria 8622
820 Ga0105243_10016441 3300009148 Bacteria 5595
821 Ga0105243_10056174 3300009148 Bacteria 3129
822 Ga0105243_10058416 3300009148 Bacteria 3074
823 Ga0105243_10065022 3300009148 Bacteria 2929
824 Ga0105243_10078444 3300009148 Bacteria 2689
825 Ga0105243_10082803 3300009148 Bacteria 2623
826 Ga0105243_10339164 3300009148 Bacteria 1376
827 Ga0105243_10401365 3300009148 Bacteria 1274
828 Ga0105243_10408690 3300009148 Bacteria 1263
829 Ga0105243_10566174 3300009148 Bacteria 1088
830 Ga0105241_10056984 3300009174 Bacteria 2997
831 Ga0105241_10062554 3300009174 Bacteria 2870
832 Ga0105241_10323527 3300009174 Bacteria 1331
833 Ga0105241_10539600 3300009174 Bacteria 1046
834 Ga0105241_10933744 3300009174 Bacteria 808
835 Ga0105242_10011101 3300009176 Bacteria 6922
836 Ga0105242_10029633 3300009176 Bacteria 4365
837 Ga0105242_10219074 3300009176 Bacteria 1700
838 Ga0105242_10296680 3300009176 Bacteria 1474
839 Ga0105242_10302885 3300009176 Bacteria 1459
840 Ga0105242_10363527 3300009176 Bacteria 1340
841 Ga0105248_10004652 3300009177 Bacteria 15188
842 Ga0105248_10174730 3300009177 Bacteria 2421
843 Ga0105248_10330094 3300009177 Bacteria 1718
844 Ga0105248_10398756 3300009177 Bacteria 1549
845 Ga0105248_10647977 3300009177 Bacteria 1192
846 Ga0105248_10947454 3300009177 Bacteria 972
847 Ga0105237_10004215 3300009545 Bacteria 16743
848 Ga0105237_10019864 3300009545 Bacteria 6936
849 Ga0105237_10023654 3300009545 Bacteria 6293
850 Ga0105237_10029982 3300009545 Bacteria 5526
851 Ga0105237_10039485 3300009545 Bacteria 4765
852 Ga0105237_10164814 3300009545 Bacteria 2215
853 Ga0105237_10230648 3300009545 Bacteria 1852
854 Ga0105237_10394553 3300009545 Bacteria 1388
855 Ga0105237_10427240 3300009545 Bacteria 1330
856 Ga0105238_10001522 3300009551 Bacteria 23226
857 Ga0105238_10055311 3300009551 Bacteria 3984
858 Ga0105238_10070225 3300009551 Bacteria 3502
859 Ga0105238_10074461 3300009551 Bacteria 3388
860 Ga0105238_10088308 3300009551 Bacteria 3086
861 Ga0105238_10092066 3300009551 Bacteria 3019
862 Ga0105238_10135101 3300009551 Bacteria 2444
863 Ga0105238_10235630 3300009551 Bacteria 1807
864 Ga0105238_10408500 3300009551 Bacteria 1351
865 Ga0105238_10481239 3300009551 Bacteria 1241
866 Ga0105238_10510569 3300009551 Bacteria 1204
867 Ga0105238_10555026 3300009551 Bacteria 1153
868 Ga0105249_10000859 3300009553 Bacteria 27081
869 Ga0105249_10039669 3300009553 Bacteria 4275
870 Ga0105249_10089031 3300009553 Bacteria 2884
871 Ga0105249_10103094 3300009553 Bacteria 2686
872 Ga0105249_10104233 3300009553 Bacteria 2672
873 Ga0105032_100739 3300009979 Bacteria 3117
874 Ga0099796_10096586 3300010159 Bacteria 1106
875 Ga0105239_10013634 3300010375 Bacteria 9023
876 Ga0105239_10014369 3300010375 Bacteria 8786
877 Ga0105239_10028268 3300010375 Bacteria 6168
878 Ga0105239_10138610 3300010375 Bacteria 2710
879 Ga0105239_10143278 3300010375 Bacteria 2664
880 Ga0105239_10177615 3300010375 Bacteria 2382
881 Ga0105239_10270198 3300010375 Bacteria 1912
882 Ga0105239_11282310 3300010375 Bacteria 845
883 Ga0105246_10056409 3300011119 Bacteria 2715
884 Ga0105246_10143839 3300011119 Bacteria 1797
885 Ga0105246_10297059 3300011119 Bacteria 1302
886 Ga0105246_10468730 3300011119 Bacteria 1062
887 Ga0105246_10471011 3300011119 Bacteria 1060
888 Ga0105246_10471991 3300011119 Bacteria 1059
889 Ga0105246_10483584 3300011119 Bacteria 1048
890 Ga0157317_1000765 3300012475 Bacteria 1532
891 Ga0157336_1000289 3300012477 Bacteria 2228
892 Ga0157318_1000289 3300012482 Bacteria 2007
893 Ga0157322_1002512 3300012490 Bacteria 1041
894 Ga0157322_1003846 3300012490 Bacteria 946
895 Ga0157335_1000457 3300012492 Bacteria 1867
896 Ga0157319_1000047 3300012497 Bacteria 17084
897 Ga0157319_1000383 3300012497 Bacteria 2030
898 Ga0157314_1002013 3300012500 Bacteria 1410
899 Ga0157342_1008123 3300012507 Bacteria 1033
900 Ga0157315_1001315 3300012508 Bacteria 1360
901 Ga0157316_1011361 3300012510 Bacteria 834
902 Ga0157327_1000231 3300012512 Bacteria 2824
903 Ga0157326_1004315 3300012513 Bacteria 1493
904 Ga0157326_1005961 3300012513 Bacteria 1296
905 Ga0157373_10004374 3300013100 Bacteria 10647
906 Ga0157373_10025258 3300013100 Bacteria 4299
907 Ga0157373_10026424 3300013100 Bacteria 4193
908 Ga0157373_10087303 3300013100 Bacteria 2198
909 Ga0157373_10188334 3300013100 Bacteria 1454
910 Ga0157371_10000710 3300013102 Bacteria 39002
911 Ga0157371_10005586 3300013102 Bacteria 10564
912 Ga0157371_10021095 3300013102 Bacteria 4788
913 Ga0157371_10063002 3300013102 Bacteria 2628
914 Ga0157371_10072372 3300013102 Bacteria 2441
915 Ga0157371_10362512 3300013102 Bacteria 1056
916 Ga0157371_10532517 3300013102 Bacteria 870
917 Ga0157370_10009078 3300013104 Bacteria 10662
918 Ga0157370_10018567 3300013104 Bacteria 6990
919 Ga0157370_10020339 3300013104 Bacteria 6629
920 Ga0157370_10074593 3300013104 Bacteria 3200
921 Ga0157370_10077397 3300013104 Bacteria 3133
922 Ga0157370_10095138 3300013104 Bacteria 2795
923 Ga0157370_10109919 3300013104 Bacteria 2577
924 Ga0157370_10257516 3300013104 Bacteria 1613
925 Ga0157370_10291884 3300013104 Bacteria 1506
926 Ga0157370_10415030 3300013104 Bacteria 1239
927 Ga0157369_10012054 3300013105 Bacteria 9817
928 Ga0157369_10014756 3300013105 Bacteria 8815
929 Ga0157369_10041518 3300013105 Bacteria 5020
930 Ga0157369_10047440 3300013105 Bacteria 4664
931 Ga0157369_10052190 3300013105 Bacteria 4425
932 Ga0157369_10056080 3300013105 Bacteria 4252
933 Ga0157369_10063626 3300013105 Bacteria 3974
934 Ga0157369_10079398 3300013105 Bacteria 3514
935 Ga0157369_10128907 3300013105 Bacteria 2681
936 Ga0157369_10167362 3300013105 Bacteria 2317
937 Ga0157369_10541084 3300013105 Bacteria 1204
938 Ga0157369_10557050 3300013105 Bacteria 1185
939 Ga0157374_10001397 3300013296 Bacteria 20481
940 Ga0157374_10015766 3300013296 Bacteria 6636
941 Ga0157374_10027429 3300013296 Bacteria 5138
942 Ga0157374_10046997 3300013296 Bacteria 4000
943 Ga0157374_10149620 3300013296 Bacteria 2269
944 Ga0157374_10221607 3300013296 Bacteria 1856
945 Ga0157374_10240866 3300013296 Bacteria 1779
946 Ga0157374_10277777 3300013296 Bacteria 1653
947 Ga0157374_10297741 3300013296 Bacteria 1596
948 Ga0157374_10834748 3300013296 Bacteria 938
949 Ga0157378_10004819 3300013297 Bacteria 11823
950 Ga0157378_10013591 3300013297 Bacteria 7121
951 Ga0157378_10059853 3300013297 Bacteria 3399
952 Ga0157378_10537660 3300013297 Bacteria 1172
953 Ga0163162_10011889 3300013306 Bacteria 8491
954 Ga0163162_10301447 3300013306 Bacteria 1734
955 Ga0163162_10483704 3300013306 Bacteria 1369
956 Ga0157372_10007032 3300013307 Bacteria 11985
957 Ga0157372_10010403 3300013307 Bacteria 9889
958 Ga0157372_10010548 3300013307 Bacteria 9826
959 Ga0157372_10017321 3300013307 Bacteria 7736
960 Ga0157372_10036644 3300013307 Bacteria 5407
961 Ga0157372_10152350 3300013307 Bacteria 2669
962 Ga0157372_10246432 3300013307 Bacteria 2073
963 Ga0157372_10290065 3300013307 Bacteria 1903
964 Ga0157372_10433244 3300013307 Bacteria 1533
965 Ga0157375_10014426 3300013308 Bacteria 7049
966 Ga0157375_10066773 3300013308 Bacteria 3592
967 Ga0157375_10093868 3300013308 Bacteria 3067
968 Ga0157375_10145649 3300013308 Bacteria 2499
969 Ga0157375_10238274 3300013308 Bacteria 1979
970 Ga0157375_10323515 3300013308 Bacteria 1707
971 Ga0157375_11023227 3300013308 Bacteria 965
972 Ga0163163_10053479 3300014325 Bacteria 3986
973 Ga0163163_10058700 3300014325 Bacteria 3805
974 Ga0163163_10096865 3300014325 Bacteria 2971
975 Ga0163163_10102473 3300014325 Bacteria 2886
976 Ga0163163_10138883 3300014325 Bacteria 2472
977 Ga0163163_10756905 3300014325 Bacteria 1035
978 Ga0163163_10794273 3300014325 Bacteria 1010
979 Ga0157380_10027107 3300014326 Bacteria 4355
980 Ga0157380_10045061 3300014326 Bacteria 3459
981 Ga0157380_10094996 3300014326 Bacteria 2469
982 Ga0157380_10809762 3300014326 Bacteria 954
983 Ga0182008_10004539 3300014497 Bacteria 8101
984 Ga0182008_10005790 3300014497 Bacteria 6992
985 Ga0182008_10024262 3300014497 Bacteria 3089
986 Ga0182008_10045661 3300014497 Bacteria 2178
987 Ga0182008_10056782 3300014497 Bacteria 1933
988 Ga0182008_10267650 3300014497 Bacteria 885
989 Ga0157377_10000420 3300014745 Bacteria 18352
990 Ga0157377_10083741 3300014745 Bacteria 1869
991 Ga0157377_10403478 3300014745 Bacteria 932
992 Ga0157379_10002229 3300014968 Bacteria 16129
993 Ga0157379_10012936 3300014968 Bacteria 7300
994 Ga0157379_10045858 3300014968 Bacteria 3902
995 Ga0157379_10050437 3300014968 Bacteria 3715
996 Ga0157379_10081922 3300014968 Bacteria 2891
997 Ga0157379_10267211 3300014968 Bacteria 1555
998 Ga0157379_10380594 3300014968 Bacteria 1295
999 Ga0157379_10575343 3300014968 Bacteria 1050
1000 Ga0157376_10017966 3300014969 Bacteria 5409
1001 Ga0157376_10107378 3300014969 Bacteria 2450
1002 Ga0157376_10532517 3300014969 Bacteria 1160
1003 Ga0182006_1000186 3300015261 Bacteria 64784
1004 Ga0182006_1003658 3300015261 Bacteria 7804
1005 Ga0182006_1007795 3300015261 Bacteria 4881
1006 Ga0182006_1008556 3300015261 Bacteria 4637
1007 Ga0182006_1009176 3300015261 Bacteria 4445
1008 Ga0182006_1010089 3300015261 Bacteria 4210
1009 Ga0182006_1013810 3300015261 Bacteria 3494
1010 Ga0182006_1026098 3300015261 Bacteria 2394
1011 Ga0182006_1036842 3300015261 Bacteria 1943
1012 Ga0182006_1140711 3300015261 Bacteria 824
1013 Ga0182007_10000202 3300015262 Bacteria 40165
1014 Ga0182007_10004689 3300015262 Bacteria 6163
1015 Ga0182007_10018209 3300015262 Bacteria 2548
1016 Ga0182007_10035953 3300015262 Bacteria 1668
1017 Ga0182007_10154696 3300015262 Bacteria 781
1018 Ga0182005_1001566 3300015265 Bacteria 9037
1019 Ga0182005_1001571 3300015265 Bacteria 9020
1020 Ga0182005_1002982 3300015265 Bacteria 5861
1021 Ga0182005_1007115 3300015265 Bacteria 3377
1022 Ga0182005_1039083 3300015265 Bacteria 1291
1023 Ga0182005_1043182 3300015265 Bacteria 1225
1024 Ga0182005_1058249 3300015265 Bacteria 1054
1025 Ga0183362_10014 3300015683 Bacteria 40122
1026 Ga0183360_10001 3300015689 Bacteria 3943671
1027 Ga0183361_10015 3300016635 Bacteria 166772
1028 Ga0183361_11043 3300016635 Bacteria 1368
1029 Ga0163161_10044327 3300017792 Bacteria 3204
1030 Ga0163161_10057093 3300017792 Bacteria 2836
1031 Ga0163161_10068372 3300017792 Bacteria 2595
1032 Ga0163161_10089105 3300017792 Bacteria 2281
1033 Ga0163161_10124402 3300017792 Bacteria 1940
1034 Ga0163161_10150572 3300017792 Bacteria 1768
1035 Ga0163161_10333708 3300017792 Bacteria 1201
1036 Ga0163161_10601609 3300017792 Bacteria 906
1037 Ga0184593_100839 3300019179 Bacteria 1669
1038 Ga0197907_10126445 3300020069 Bacteria 6432
1039 Ga0197907_10276287 3300020069 Bacteria 8484
1040 Ga0197907_10464023 3300020069 Bacteria 3861
1041 Ga0206356_10084425 3300020070 Bacteria 4866
1042 Ga0206356_11000981 3300020070 Bacteria 10025
1043 Ga0206356_11570777 3300020070 Bacteria 2668
1044 Ga0206349_1813039 3300020075 Bacteria 11017
1045 Ga0206355_1003085 3300020076 Bacteria 7491
1046 Ga0206355_1487813 3300020076 Bacteria 4294
1047 Ga0206355_1531200 3300020076 Bacteria 4443
1048 Ga0206351_10620683 3300020077 Bacteria 1421
1049 Ga0206351_10629243 3300020077 Bacteria 1802
1050 Ga0206351_10898479 3300020077 Bacteria 10613
1051 Ga0206352_10541187 3300020078 Bacteria 954
1052 Ga0206350_10154136 3300020080 Bacteria 6815
1053 Ga0206350_10703408 3300020080 Bacteria 2976
1054 Ga0206350_11381018 3300020080 Bacteria 1088
1055 Ga0206354_10999262 3300020081 Bacteria 3114
1056 Ga0206354_11062004 3300020081 Bacteria 4352
1057 Ga0206353_10101101 3300020082 Bacteria 2019
1058 Ga0206353_11264784 3300020082 Bacteria 963
1059 Ga0154015_1005695 3300020610 Bacteria 1832
1060 Ga0154015_1082036 3300020610 Bacteria 1613
1061 Ga0154015_1218269 3300020610 Bacteria 11158
1062 Ga0213873_10136919 3300021358 Bacteria 729
1063 Ga0213872_10001174 3300021361 Bacteria 17803
1064 Ga0213872_10002302 3300021361 Bacteria 11392
1065 Ga0213872_10002796 3300021361 Bacteria 9989
1066 Ga0213872_10003575 3300021361 Bacteria 8560
1067 Ga0213872_10013483 3300021361 Bacteria 3829
1068 Ga0213872_10013711 3300021361 Bacteria 3793
1069 Ga0213872_10038758 3300021361 Bacteria 2174
1070 Ga0213872_10093952 3300021361 Bacteria 1340
1071 Ga0213872_10128669 3300021361 Bacteria 1116
1072 Ga0213874_10013432 3300021377 Bacteria 2121
1073 Ga0224712_10000449 3300022467 Bacteria 8219
1074 Ga0224712_10020815 3300022467 Bacteria 2234
1075 Ga0256744_116427 3300023309 Bacteria 2472
1076 Ga0209435_100041 3300025206 Bacteria 105577
1077 Ga0209435_100186 3300025206 Bacteria 18475
1078 Ga0209435_100191 3300025206 Bacteria 17985
1079 Ga0209435_100715 3300025206 Bacteria 5614
1080 Ga0209760_100117 3300025207 Bacteria 57229
1081 Ga0209760_101366 3300025207 Bacteria 2619
1082 Ga0209436_101414 3300025208 Bacteria 8429
1083 Ga0209436_101521 3300025208 Bacteria 7947
1084 Ga0209436_110490 3300025208 Bacteria 1691
1085 Ga0209784_100060 3300025224 Bacteria 164838
1086 Ga0209784_100290 3300025224 Bacteria 27838
1087 Ga0209784_100890 3300025224 Bacteria 6158
1088 Ga0209784_101598 3300025224 Bacteria 2828
1089 Ga0209566_100075 3300025225 Bacteria 164838
1090 Ga0209566_100422 3300025225 Bacteria 32606
1091 Ga0209566_100606 3300025225 Bacteria 22462
1092 Ga0209566_101665 3300025225 Bacteria 5609
1093 Ga0209566_102009 3300025225 Bacteria 4299
1094 Ga0209674_100067 3300025226 Bacteria 253824
1095 Ga0209674_100100 3300025226 Bacteria 164838
1096 Ga0209674_100310 3300025226 Bacteria 32606
1097 Ga0209674_102782 3300025226 Bacteria 3532
1098 Ga0209674_103534 3300025226 Bacteria 2833
1099 Ga0209674_104429 3300025226 Bacteria 2291
1100 Ga0209672_100073 3300025228 Bacteria 166621
1101 Ga0209672_100291 3300025228 Bacteria 34939
1102 Ga0209672_100717 3300025228 Bacteria 16431
1103 Ga0209672_100718 3300025228 Bacteria 16386
1104 Ga0209672_102940 3300025228 Bacteria 3783
1105 Ga0209147_100060 3300025229 Bacteria 249588
1106 Ga0209147_100090 3300025229 Bacteria 176176
1107 Ga0209147_100093 3300025229 Bacteria 167196
1108 Ga0209147_100096 3300025229 Bacteria 164838
1109 Ga0209147_100853 3300025229 Bacteria 14271
1110 Ga0209147_102542 3300025229 Bacteria 4404
1111 Ga0209147_103483 3300025229 Bacteria 3042
1112 Ga0209563_100011 3300025230 Bacteria 1187808
1113 Ga0209563_100068 3300025230 Bacteria 254802
1114 Ga0209563_100088 3300025230 Bacteria 175375
1115 Ga0209563_100195 3300025230 Bacteria 33338
1116 Ga0209563_100200 3300025230 Bacteria 32606
1117 Ga0209563_100889 3300025230 Bacteria 8850
1118 Ga0209563_103486 3300025230 Bacteria 3236
1119 Ga0209563_114285 3300025230 Bacteria 1023
1120 Ga0207427_101665 3300025231 Bacteria 7455
1121 Ga0207427_103268 3300025231 Bacteria 3528
1122 Ga0209437_100639 3300025233 Bacteria 20468
1123 Ga0209437_100749 3300025233 Bacteria 15960
1124 Ga0209437_101208 3300025233 Bacteria 7455
1125 Ga0209258_100130 3300025242 Bacteria 176078
1126 Ga0209258_100140 3300025242 Bacteria 167245
1127 Ga0209258_100141 3300025242 Bacteria 166385
1128 Ga0209258_100387 3300025242 Bacteria 56263
1129 Ga0209258_100793 3300025242 Bacteria 18779
1130 Ga0209258_102011 3300025242 Bacteria 5860
1131 Ga0209258_102012 3300025242 Bacteria 5860
1132 Ga0209258_103442 3300025242 Bacteria 3412
1133 Ga0209258_104059 3300025242 Bacteria 2899
1134 Ga0207425_1000117 3300025245 Bacteria 74911
1135 Ga0207425_1000767 3300025245 Bacteria 16556
1136 Ga0207425_1001042 3300025245 Bacteria 12856
1137 Ga0207425_1001095 3300025245 Bacteria 12292
1138 Ga0207425_1001259 3300025245 Bacteria 11072
1139 Ga0207425_1004830 3300025245 Bacteria 3956
1140 Ga0207425_1006106 3300025245 Bacteria 3335
1141 Ga0207425_1007941 3300025245 Bacteria 2756
1142 Ga0207425_1011687 3300025245 Bacteria 2084
1143 Ga0207425_1011925 3300025245 Bacteria 2056
1144 Ga0207425_1027415 3300025245 Bacteria 1162
1145 Ga0209646_1000144 3300025246 Bacteria 105691
1146 Ga0209646_1000246 3300025246 Bacteria 55219
1147 Ga0209646_1000348 3300025246 Bacteria 33896
1148 Ga0209646_1000434 3300025246 Bacteria 23139
1149 Ga0209646_1000740 3300025246 Bacteria 11471
1150 Ga0209646_1001041 3300025246 Bacteria 8366
1151 Ga0209026_1000004 3300025250 Bacteria 949012
1152 Ga0209026_1000159 3300025250 Bacteria 105691
1153 Ga0209026_1004204 3300025250 Bacteria 4388
1154 Ga0209026_1006910 3300025250 Bacteria 2668
1155 Ga0209026_1008075 3300025250 Bacteria 2254
1156 Ga0209677_100043 3300025253 Bacteria 222331
1157 Ga0209677_100057 3300025253 Bacteria 164838
1158 Ga0209677_101729 3300025253 Bacteria 9091
1159 Ga0209677_104488 3300025253 Bacteria 4000
1160 Ga0209677_106079 3300025253 Bacteria 2966
1161 Ga0209677_109258 3300025253 Bacteria 1794
1162 Ga0209148_1000140 3300025254 Bacteria 166819
1163 Ga0209148_1000323 3300025254 Bacteria 66396
1164 Ga0209148_1000666 3300025254 Bacteria 29479
1165 Ga0209148_1000990 3300025254 Bacteria 18287
1166 Ga0209148_1003649 3300025254 Bacteria 4113
1167 Ga0209148_1004793 3300025254 Bacteria 3237
1168 Ga0209148_1025879 3300025254 Bacteria 915
1169 Ga0209759_1000001 3300025256 Bacteria 2799452
1170 Ga0209759_1000979 3300025256 Bacteria 19760
1171 Ga0209759_1002023 3300025256 Bacteria 9609
1172 Ga0209759_1004194 3300025256 Bacteria 5468
1173 Ga0209759_1004226 3300025256 Bacteria 5436
1174 Ga0209759_1005734 3300025256 Bacteria 4281
1175 Ga0209759_1005917 3300025256 Bacteria 4182
1176 Ga0209759_1006000 3300025256 Bacteria 4146
1177 Ga0209759_1011404 3300025256 Bacteria 2529
1178 Ga0209759_1013942 3300025256 Bacteria 2149
1179 Ga0209759_1019813 3300025256 Bacteria 1583
1180 Ga0209759_1021433 3300025256 Bacteria 1470
1181 Ga0209129_1000011 3300025258 Bacteria 568657
1182 Ga0209129_1000204 3300025258 Bacteria 69584
1183 Ga0209129_1001020 3300025258 Bacteria 16691
1184 Ga0209129_1001630 3300025258 Bacteria 12174
1185 Ga0209129_1009319 3300025258 Bacteria 2604
1186 Ga0209129_1009411 3300025258 Bacteria 2577
1187 Ga0209233_1000133 3300025261 Bacteria 202716
1188 Ga0209233_1000612 3300025261 Bacteria 18261
1189 Ga0209233_1007243 3300025261 Bacteria 3528
1190 Ga0209233_1023462 3300025261 Bacteria 1562
1191 Ga0209565_1000001 3300025263 Bacteria 2950419
1192 Ga0209565_1000101 3300025263 Bacteria 129092
1193 Ga0209565_1000870 3300025263 Bacteria 16660
1194 Ga0209565_1002110 3300025263 Bacteria 7576
1195 Ga0209565_1002835 3300025263 Bacteria 5965
1196 Ga0209565_1003275 3300025263 Bacteria 5332
1197 Ga0209565_1006443 3300025263 Bacteria 3290
1198 Ga0209565_1006554 3300025263 Bacteria 3253
1199 Ga0209565_1008022 3300025263 Bacteria 2793
1200 Ga0209565_1008373 3300025263 Bacteria 2709
1201 Ga0209565_1032081 3300025263 Bacteria 1017
1202 Ga0207666_1005435 3300025271 Bacteria 1629
1203 Ga0209455_1000119 3300025272 Bacteria 174994
1204 Ga0209455_1000125 3300025272 Bacteria 166819
1205 Ga0209455_1000303 3300025272 Bacteria 50385
1206 Ga0209455_1000915 3300025272 Bacteria 15288
1207 Ga0209455_1001203 3300025272 Bacteria 12356
1208 Ga0209455_1005403 3300025272 Bacteria 3955
1209 Ga0209673_1000001 3300025273 Bacteria 3176258
1210 Ga0209673_1000204 3300025273 Bacteria 119618
1211 Ga0209673_1000463 3300025273 Bacteria 68460
1212 Ga0209673_1000687 3300025273 Bacteria 48530
1213 Ga0209673_1001644 3300025273 Bacteria 19348
1214 Ga0209673_1003465 3300025273 Bacteria 9278
1215 Ga0209673_1004929 3300025273 Bacteria 6945
1216 Ga0209673_1005984 3300025273 Bacteria 5985
1217 Ga0209673_1008361 3300025273 Bacteria 4614
1218 Ga0209673_1011655 3300025273 Bacteria 3607
1219 Ga0209673_1013310 3300025273 Bacteria 3253
1220 Ga0209673_1013335 3300025273 Bacteria 3249
1221 Ga0209673_1018215 3300025273 Bacteria 2563
1222 Ga0209130_1000146 3300025284 Bacteria 111777
1223 Ga0209130_1002153 3300025284 Bacteria 10397
1224 Ga0209130_1002838 3300025284 Bacteria 8041
1225 Ga0209130_1003943 3300025284 Bacteria 5943
1226 Ga0209130_1003951 3300025284 Bacteria 5937
1227 Ga0209130_1011762 3300025284 Bacteria 2327
1228 Ga0209130_1012392 3300025284 Bacteria 2234
1229 Ga0209130_1017695 3300025284 Bacteria 1691
1230 Ga0209675_1000001 3300025291 Bacteria 2950293
1231 Ga0209675_1000015 3300025291 Bacteria 403517
1232 Ga0209675_1000121 3300025291 Bacteria 107684
1233 Ga0209675_1000186 3300025291 Bacteria 68471
1234 Ga0209675_1002952 3300025291 Bacteria 8387
1235 Ga0209675_1004701 3300025291 Bacteria 5985
1236 Ga0209675_1007235 3300025291 Bacteria 4296
1237 Ga0209675_1009571 3300025291 Bacteria 3407
1238 Ga0209675_1009879 3300025291 Bacteria 3319
1239 Ga0209675_1013004 3300025291 Bacteria 2637
1240 Ga0209675_1022604 3300025291 Bacteria 1648
1241 Ga0209676_1000073 3300025292 Bacteria 305947
1242 Ga0209676_1001219 3300025292 Bacteria 27305
1243 Ga0209676_1001412 3300025292 Bacteria 23058
1244 Ga0209676_1001936 3300025292 Bacteria 16690
1245 Ga0209676_1004908 3300025292 Bacteria 7207
1246 Ga0209676_1007526 3300025292 Bacteria 5083
1247 Ga0209676_1007865 3300025292 Bacteria 4898
1248 Ga0209676_1011169 3300025292 Bacteria 3651
1249 Ga0209676_1014157 3300025292 Bacteria 3017
1250 Ga0209676_1014712 3300025292 Bacteria 2926
1251 Ga0209676_1028341 3300025292 Bacteria 1745
1252 Ga0209676_1038935 3300025292 Bacteria 1356
1253 Ga0209676_1041385 3300025292 Bacteria 1288
1254 Ga0209025_1000002 3300025294 Bacteria 1393142
1255 Ga0209025_1000006 3300025294 Bacteria 1153444
1256 Ga0209025_1000198 3300025294 Bacteria 146276
1257 Ga0209025_1001281 3300025294 Bacteria 34537
1258 Ga0209025_1014320 3300025294 Bacteria 4889
1259 Ga0209025_1014425 3300025294 Bacteria 4856
1260 Ga0209025_1015058 3300025294 Bacteria 4696
1261 Ga0209025_1017025 3300025294 Bacteria 4232
1262 Ga0209025_1021549 3300025294 Bacteria 3466
1263 Ga0209025_1025048 3300025294 Bacteria 3052
1264 Ga0209025_1027439 3300025294 Bacteria 2824
1265 Ga0209025_1027656 3300025294 Bacteria 2806
1266 Ga0209025_1029328 3300025294 Bacteria 2665
1267 Ga0209025_1035567 3300025294 Bacteria 2248
1268 Ga0209025_1041826 3300025294 Bacteria 1956
1269 Ga0209025_1051209 3300025294 Bacteria 1643
1270 Ga0209025_1059482 3300025294 Bacteria 1442
1271 Ga0209564_1000001 3300025295 Bacteria 3176258
1272 Ga0209564_1000008 3300025295 Bacteria 953227
1273 Ga0209564_1000027 3300025295 Bacteria 518458
1274 Ga0209564_1000037 3300025295 Bacteria 414794
1275 Ga0209564_1000230 3300025295 Bacteria 123814
1276 Ga0209564_1002159 3300025295 Bacteria 16581
1277 Ga0209564_1004754 3300025295 Bacteria 8120
1278 Ga0209564_1006016 3300025295 Bacteria 6698
1279 Ga0209564_1006926 3300025295 Bacteria 5964
1280 Ga0209564_1007105 3300025295 Bacteria 5849
1281 Ga0209564_1007309 3300025295 Bacteria 5730
1282 Ga0209564_1010601 3300025295 Bacteria 4222
1283 Ga0209564_1013777 3300025295 Bacteria 3407
1284 Ga0209564_1024005 3300025295 Bacteria 2097
1285 Ga0209564_1025208 3300025295 Bacteria 2009
1286 Ga0209758_1000003 3300025297 Bacteria 1398533
1287 Ga0209758_1000295 3300025297 Bacteria 97968
1288 Ga0209758_1000442 3300025297 Bacteria 69581
1289 Ga0209758_1006572 3300025297 Bacteria 8264
1290 Ga0209758_1006647 3300025297 Bacteria 8182
1291 Ga0209758_1006747 3300025297 Bacteria 8074
1292 Ga0209758_1011259 3300025297 Bacteria 5207
1293 Ga0209758_1014771 3300025297 Bacteria 4118
1294 Ga0209758_1017275 3300025297 Bacteria 3605
1295 Ga0209758_1024345 3300025297 Bacteria 2701
1296 Ga0209050_1000008 3300025298 Bacteria 1144179
1297 Ga0209050_1000052 3300025298 Bacteria 351785
1298 Ga0209050_1000292 3300025298 Bacteria 106140
1299 Ga0209050_1001097 3300025298 Bacteria 32856
1300 Ga0209050_1002030 3300025298 Bacteria 18760
1301 Ga0209050_1002318 3300025298 Bacteria 16744
1302 Ga0209050_1002464 3300025298 Bacteria 15772
1303 Ga0209050_1003984 3300025298 Bacteria 10415
1304 Ga0209050_1007102 3300025298 Bacteria 6400
1305 Ga0209050_1008688 3300025298 Bacteria 5360
1306 Ga0209050_1008716 3300025298 Bacteria 5347
1307 Ga0209050_1017496 3300025298 Bacteria 2852
1308 Ga0209050_1017757 3300025298 Bacteria 2811
1309 Ga0209050_1024305 3300025298 Bacteria 2101
1310 Ga0209050_1024472 3300025298 Bacteria 2087
1311 Ga0209050_1037795 3300025298 Bacteria 1386
1312 Ga0209050_1042052 3300025298 Bacteria 1252
1313 Ga0209050_1045415 3300025298 Bacteria 1165
1314 Ga0209050_1046662 3300025298 Bacteria 1136
1315 Ga0209256_1000045 3300025299 Bacteria 325506
1316 Ga0209256_1000168 3300025299 Bacteria 132040
1317 Ga0209256_1000347 3300025299 Bacteria 75262
1318 Ga0209256_1002133 3300025299 Bacteria 17115
1319 Ga0209256_1002493 3300025299 Bacteria 14890
1320 Ga0209256_1004685 3300025299 Bacteria 8390
1321 Ga0209256_1005253 3300025299 Bacteria 7562
1322 Ga0209256_1006716 3300025299 Bacteria 5964
1323 Ga0209256_1006866 3300025299 Bacteria 5849
1324 Ga0209256_1007679 3300025299 Bacteria 5240
1325 Ga0209256_1012344 3300025299 Bacteria 3290
1326 Ga0209256_1036875 3300025299 Bacteria 1279
1327 Ga0207426_1001110 3300025302 Bacteria 24727
1328 Ga0207426_1002317 3300025302 Bacteria 12467
1329 Ga0207426_1002480 3300025302 Bacteria 11738
1330 Ga0207426_1005297 3300025302 Bacteria 5937
1331 Ga0207426_1005398 3300025302 Bacteria 5849
1332 Ga0207426_1005868 3300025302 Bacteria 5475
1333 Ga0207426_1010324 3300025302 Bacteria 3631
1334 Ga0209051_1000004 3300025303 Bacteria 1155596
1335 Ga0209051_1000005 3300025303 Bacteria 1142353
1336 Ga0209051_1003269 3300025303 Bacteria 10749
1337 Ga0209051_1003409 3300025303 Bacteria 10436
1338 Ga0209051_1003886 3300025303 Bacteria 9546
1339 Ga0209051_1004652 3300025303 Bacteria 8359
1340 Ga0209051_1005726 3300025303 Bacteria 7174
1341 Ga0209051_1009985 3300025303 Bacteria 4835
1342 Ga0209051_1010189 3300025303 Bacteria 4778
1343 Ga0209051_1013191 3300025303 Bacteria 3948
1344 Ga0209051_1015302 3300025303 Bacteria 3535
1345 Ga0209051_1019200 3300025303 Bacteria 2993
1346 Ga0209051_1021880 3300025303 Bacteria 2706
1347 Ga0209051_1022225 3300025303 Bacteria 2675
1348 Ga0209051_1028019 3300025303 Bacteria 2233
1349 Ga0209051_1060489 3300025303 Bacteria 1195
1350 Ga0209051_1076672 3300025303 Bacteria 981
1351 Ga0209257_1000015 3300025304 Bacteria 908141
1352 Ga0209257_1000031 3300025304 Bacteria 688770
1353 Ga0209257_1000047 3300025304 Bacteria 460507
1354 Ga0209257_1000295 3300025304 Bacteria 109542
1355 Ga0209257_1002681 3300025304 Bacteria 17054
1356 Ga0209257_1002723 3300025304 Bacteria 16800
1357 Ga0209257_1002823 3300025304 Bacteria 16317
1358 Ga0209257_1004915 3300025304 Bacteria 9839
1359 Ga0209257_1005866 3300025304 Bacteria 8304
1360 Ga0209257_1005952 3300025304 Bacteria 8189
1361 Ga0209257_1008039 3300025304 Bacteria 6142
1362 Ga0209257_1013612 3300025304 Bacteria 3592
1363 Ga0209257_1018291 3300025304 Bacteria 2706
1364 Ga0209257_1018425 3300025304 Bacteria 2686
1365 Ga0209257_1025381 3300025304 Bacteria 2026
1366 Ga0209257_1073957 3300025304 Bacteria 891
1367 Ga0207697_10029768 3300025315 Bacteria 2235
1368 Ga0207656_10000010 3300025321 Bacteria 192224
1369 Ga0207656_10006797 3300025321 Bacteria 4135
1370 Ga0207656_10013288 3300025321 Bacteria 3144
1371 Ga0207656_10062293 3300025321 Bacteria 1639
1372 Ga0207656_10071946 3300025321 Bacteria 1538
1373 Ga0207696_1000986 3300025711 Bacteria 17176
1374 Ga0207696_1001013 3300025711 Bacteria 16826
1375 Ga0207696_1001151 3300025711 Bacteria 15218
1376 Ga0207696_1001495 3300025711 Bacteria 12577
1377 Ga0207696_1002359 3300025711 Bacteria 9334
1378 Ga0207696_1003354 3300025711 Bacteria 7354
1379 Ga0207696_1003709 3300025711 Bacteria 6846
1380 Ga0207696_1006933 3300025711 Bacteria 4495
1381 Ga0207696_1016351 3300025711 Bacteria 2484
1382 Ga0207696_1019611 3300025711 Bacteria 2197
1383 Ga0207655_1001460 3300025728 Bacteria 21844
1384 Ga0207655_1003094 3300025728 Bacteria 12643
1385 Ga0207655_1003120 3300025728 Bacteria 12563
1386 Ga0207655_1003763 3300025728 Bacteria 11119
1387 Ga0207655_1006903 3300025728 Bacteria 7447
1388 Ga0207655_1007789 3300025728 Bacteria 6902
1389 Ga0207655_1008829 3300025728 Bacteria 6337
1390 Ga0207655_1010082 3300025728 Bacteria 5777
1391 Ga0207655_1012838 3300025728 Bacteria 4854
1392 Ga0207655_1017941 3300025728 Bacteria 3788
1393 Ga0207655_1018405 3300025728 Bacteria 3706
1394 Ga0207655_1030773 3300025728 Bacteria 2488
1395 Ga0207655_1041197 3300025728 Bacteria 1982
1396 Ga0207655_1076800 3300025728 Bacteria 1220
1397 Ga0207655_1084316 3300025728 Bacteria 1137
1398 Ga0207655_1090869 3300025728 Bacteria 1075
1399 Ga0207655_1093717 3300025728 Bacteria 1051
1400 Ga0207655_1113502 3300025728 Bacteria 911
1401 Ga0207713_1000294 3300025735 Bacteria 57476
1402 Ga0207713_1001159 3300025735 Bacteria 22276
1403 Ga0207713_1001989 3300025735 Bacteria 15373
1404 Ga0207713_1006017 3300025735 Bacteria 7480
1405 Ga0207713_1007150 3300025735 Bacteria 6659
1406 Ga0207713_1016558 3300025735 Bacteria 3737
1407 Ga0207713_1018455 3300025735 Bacteria 3454
1408 Ga0207713_1018555 3300025735 Bacteria 3439
1409 Ga0207713_1023621 3300025735 Bacteria 2889
1410 Ga0207713_1026133 3300025735 Bacteria 2682
1411 Ga0207713_1033501 3300025735 Bacteria 2243
1412 Ga0207713_1035877 3300025735 Bacteria 2135
1413 Ga0207713_1037508 3300025735 Bacteria 2066
1414 Ga0207713_1120368 3300025735 Bacteria 881
1415 Ga0207682_10022616 3300025893 Bacteria 2478
1416 Ga0207682_10034084 3300025893 Bacteria 2052
1417 Ga0207682_10051091 3300025893 Bacteria 1711
1418 Ga0207692_10089599 3300025898 Bacteria 1665
1419 Ga0207642_10019626 3300025899 Bacteria 2621
1420 Ga0207642_10055370 3300025899 Bacteria 1814
1421 Ga0207642_10154028 3300025899 Bacteria 1227
1422 Ga0207710_10000021 3300025900 Bacteria 336166
1423 Ga0207710_10158885 3300025900 Bacteria 1100
1424 Ga0207688_10041707 3300025901 Bacteria 2554
1425 Ga0207688_10042705 3300025901 Bacteria 2524
1426 Ga0207688_10060092 3300025901 Bacteria 2141
1427 Ga0207688_10071820 3300025901 Bacteria 1966
1428 Ga0207680_10015370 3300025903 Bacteria 3994
1429 Ga0207680_10015569 3300025903 Bacteria 3971
1430 Ga0207680_10016617 3300025903 Bacteria 3868
1431 Ga0207680_10567673 3300025903 Bacteria 811
1432 Ga0207647_10005195 3300025904 Bacteria 9579
1433 Ga0207647_10022181 3300025904 Bacteria 4223
1434 Ga0207647_10065166 3300025904 Bacteria 2212
1435 Ga0207647_10071478 3300025904 Bacteria 2093
1436 Ga0207647_10124988 3300025904 Bacteria 1514
1437 Ga0207685_10000611 3300025905 Bacteria 6255
1438 Ga0207685_10042212 3300025905 Bacteria 1711
1439 Ga0207699_10020171 3300025906 Bacteria 3567
1440 Ga0207699_10149882 3300025906 Bacteria 1542
1441 Ga0207645_10019136 3300025907 Bacteria 4496
1442 Ga0207645_10065340 3300025907 Bacteria 2325
1443 Ga0207643_10059061 3300025908 Bacteria 2188
1444 Ga0207643_10162080 3300025908 Bacteria 1346
1445 Ga0207643_10338280 3300025908 Bacteria 943
1446 Ga0207705_10021241 3300025909 Bacteria 4630
1447 Ga0207705_10052423 3300025909 Bacteria 2937
1448 Ga0207705_10095672 3300025909 Bacteria 2179
1449 Ga0207705_10178469 3300025909 Bacteria 1602
1450 Ga0207705_10201973 3300025909 Bacteria 1506
1451 Ga0207684_10178046 3300025910 Bacteria 1833
1452 Ga0207684_10229093 3300025910 Bacteria 1603
1453 Ga0207654_10003945 3300025911 Bacteria 7469
1454 Ga0207654_10041412 3300025911 Bacteria 2601
1455 Ga0207654_10126982 3300025911 Bacteria 1609
1456 Ga0207707_10036275 3300025912 Bacteria 4312
1457 Ga0207707_10157658 3300025912 Bacteria 1985
1458 Ga0207707_10256374 3300025912 Bacteria 1518
1459 Ga0207695_10000929 3300025913 Bacteria 52349
1460 Ga0207695_10004556 3300025913 Bacteria 18843
1461 Ga0207695_10006996 3300025913 Bacteria 14471
1462 Ga0207695_10010308 3300025913 Bacteria 11442
1463 Ga0207695_10014990 3300025913 Bacteria 9145
1464 Ga0207695_10042668 3300025913 Bacteria 4841
1465 Ga0207695_10055074 3300025913 Bacteria 4148
1466 Ga0207695_10059323 3300025913 Bacteria 3968
1467 Ga0207695_10072393 3300025913 Bacteria 3517
1468 Ga0207695_10142963 3300025913 Bacteria 2339
1469 Ga0207695_10149283 3300025913 Bacteria 2278
1470 Ga0207695_10159878 3300025913 Bacteria 2185
1471 Ga0207695_10191723 3300025913 Bacteria 1961
1472 Ga0207695_10270299 3300025913 Bacteria 1595
1473 Ga0207695_10309846 3300025913 Bacteria 1469
1474 Ga0207695_10322704 3300025913 Bacteria 1434
1475 Ga0207695_10336245 3300025913 Bacteria 1398
1476 Ga0207695_10341593 3300025913 Bacteria 1385
1477 Ga0207695_10569167 3300025913 Bacteria 1014
1478 Ga0207695_10574072 3300025913 Bacteria 1009
1479 Ga0207671_10002745 3300025914 Bacteria 18394
1480 Ga0207671_10011222 3300025914 Bacteria 7310
1481 Ga0207671_10014095 3300025914 Bacteria 6336
1482 Ga0207671_10020608 3300025914 Bacteria 5015
1483 Ga0207671_10048974 3300025914 Bacteria 3127
1484 Ga0207671_10074837 3300025914 Bacteria 2532
1485 Ga0207671_10075831 3300025914 Bacteria 2516
1486 Ga0207671_10086216 3300025914 Bacteria 2360
1487 Ga0207671_10097900 3300025914 Bacteria 2218
1488 Ga0207671_10136439 3300025914 Bacteria 1887
1489 Ga0207693_10001213 3300025915 Bacteria 22999
1490 Ga0207693_10039591 3300025915 Bacteria 3712
1491 Ga0207663_10013914 3300025916 Bacteria 4390
1492 Ga0207660_10018127 3300025917 Bacteria 4688
1493 Ga0207660_10067750 3300025917 Bacteria 2587
1494 Ga0207660_10170530 3300025917 Bacteria 1684
1495 Ga0207662_10057775 3300025918 Bacteria 2320
1496 Ga0207662_10408244 3300025918 Bacteria 922
1497 Ga0207657_10006550 3300025919 Bacteria 12056
1498 Ga0207657_10015852 3300025919 Bacteria 7282
1499 Ga0207657_10042849 3300025919 Bacteria 3990
1500 Ga0207657_10057054 3300025919 Bacteria 3367
1501 Ga0207657_10065832 3300025919 Bacteria 3087
1502 Ga0207657_10083898 3300025919 Bacteria 2672
1503 Ga0207657_10094047 3300025919 Bacteria 2496
1504 Ga0207657_10158281 3300025919 Bacteria 1841
1505 Ga0207657_10232603 3300025919 Bacteria 1473
1506 Ga0207657_10458564 3300025919 Bacteria 1000
1507 Ga0207649_10000041 3300025920 Bacteria 117781
1508 Ga0207649_10000400 3300025920 Bacteria 32409
1509 Ga0207649_10015303 3300025920 Bacteria 4311
1510 Ga0207649_10082979 3300025920 Bacteria 2079
1511 Ga0207649_10640878 3300025920 Bacteria 820
1512 Ga0207652_10037372 3300025921 Bacteria 4110
1513 Ga0207652_10083698 3300025921 Bacteria 2793
1514 Ga0207652_10386460 3300025921 Bacteria 1263
1515 Ga0207681_10001418 3300025923 Bacteria 15459
1516 Ga0207681_10027574 3300025923 Bacteria 3673
1517 Ga0207681_10043264 3300025923 Bacteria 3013
1518 Ga0207681_10079282 3300025923 Bacteria 2313
1519 Ga0207681_10096481 3300025923 Bacteria 2123
1520 Ga0207681_10150913 3300025923 Bacteria 1741
1521 Ga0207681_10155028 3300025923 Bacteria 1720
1522 Ga0207681_10464844 3300025923 Bacteria 1031
1523 Ga0207694_10001706 3300025924 Bacteria 18377
1524 Ga0207694_10013926 3300025924 Bacteria 6064
1525 Ga0207694_10022624 3300025924 Bacteria 4769
1526 Ga0207694_10031994 3300025924 Bacteria 4023
1527 Ga0207694_10035665 3300025924 Bacteria 3816
1528 Ga0207694_10065792 3300025924 Bacteria 2827
1529 Ga0207694_10269413 3300025924 Bacteria 1397
1530 Ga0207694_10269629 3300025924 Bacteria 1396
1531 Ga0207694_10339905 3300025924 Bacteria 1241
1532 Ga0207650_10014980 3300025925 Bacteria 5392
1533 Ga0207650_10043288 3300025925 Bacteria 3304
1534 Ga0207650_10108986 3300025925 Bacteria 2141
1535 Ga0207650_10112964 3300025925 Bacteria 2105
1536 Ga0207650_10245312 3300025925 Bacteria 1448
1537 Ga0207650_10367451 3300025925 Bacteria 1186
1538 Ga0207650_10871059 3300025925 Bacteria 764
1539 Ga0207659_10019205 3300025926 Bacteria 4493
1540 Ga0207659_10080834 3300025926 Bacteria 2402
1541 Ga0207659_10164476 3300025926 Bacteria 1745
1542 Ga0207659_10226348 3300025926 Bacteria 1506
1543 Ga0207659_10271207 3300025926 Bacteria 1384
1544 Ga0207659_10345350 3300025926 Bacteria 1233
1545 Ga0207659_10412056 3300025926 Bacteria 1132
1546 Ga0207659_10476383 3300025926 Bacteria 1054
1547 Ga0207659_10792164 3300025926 Bacteria 814
1548 Ga0207687_10025583 3300025927 Bacteria 3949
1549 Ga0207687_10173392 3300025927 Bacteria 1665
1550 Ga0207687_10195312 3300025927 Bacteria 1578
1551 Ga0207687_10330763 3300025927 Bacteria 1236
1552 Ga0207687_10462377 3300025927 Bacteria 1054
1553 Ga0207700_10001626 3300025928 Bacteria 12759
1554 Ga0207700_10078524 3300025928 Bacteria 2568
1555 Ga0207700_10087507 3300025928 Bacteria 2450
1556 Ga0207664_10001424 3300025929 Bacteria 15744
1557 Ga0207664_10028011 3300025929 Bacteria 4278
1558 Ga0207664_10373784 3300025929 Bacteria 1264
1559 Ga0207664_10696954 3300025929 Bacteria 913
1560 Ga0207644_10016309 3300025931 Bacteria 4997
1561 Ga0207644_10019953 3300025931 Bacteria 4552
1562 Ga0207644_10028855 3300025931 Bacteria 3845
1563 Ga0207644_10055596 3300025931 Bacteria 2853
1564 Ga0207644_10055718 3300025931 Bacteria 2850
1565 Ga0207644_10106420 3300025931 Bacteria 2115
1566 Ga0207644_10283200 3300025931 Bacteria 1331
1567 Ga0207644_10310403 3300025931 Bacteria 1273
1568 Ga0207690_10000040 3300025932 Bacteria 130300
1569 Ga0207690_10005623 3300025932 Bacteria 7407
1570 Ga0207690_10041702 3300025932 Bacteria 3010
1571 Ga0207690_10048838 3300025932 Bacteria 2817
1572 Ga0207690_10119859 3300025932 Bacteria 1909
1573 Ga0207690_10172704 3300025932 Bacteria 1621
1574 Ga0207690_10241797 3300025932 Bacteria 1391
1575 Ga0207706_10034769 3300025933 Bacteria 4484
1576 Ga0207706_10049444 3300025933 Bacteria 3715
1577 Ga0207706_10050422 3300025933 Bacteria 3678
1578 Ga0207706_10081816 3300025933 Bacteria 2838
1579 Ga0207706_10093523 3300025933 Bacteria 2644
1580 Ga0207706_10096000 3300025933 Bacteria 2607
1581 Ga0207706_10127577 3300025933 Bacteria 2237
1582 Ga0207706_10454239 3300025933 Bacteria 1108
1583 Ga0207686_10002281 3300025934 Bacteria 10533
1584 Ga0207686_10004082 3300025934 Bacteria 7838
1585 Ga0207686_10006427 3300025934 Bacteria 6325
1586 Ga0207686_10015230 3300025934 Bacteria 4296
1587 Ga0207686_10027328 3300025934 Bacteria 3340
1588 Ga0207686_10150003 3300025934 Bacteria 1622
1589 Ga0207709_10000023 3300025935 Bacteria 369407
1590 Ga0207709_10000152 3300025935 Bacteria 93738
1591 Ga0207709_10000421 3300025935 Bacteria 41092
1592 Ga0207709_10000880 3300025935 Bacteria 22835
1593 Ga0207709_10007814 3300025935 Bacteria 5927
1594 Ga0207709_10008524 3300025935 Bacteria 5669
1595 Ga0207709_10010798 3300025935 Bacteria 5029
1596 Ga0207709_10206622 3300025935 Bacteria 1406
1597 Ga0207709_10243058 3300025935 Bacteria 1311
1598 Ga0207709_10284672 3300025935 Bacteria 1222
1599 Ga0207709_10360007 3300025935 Bacteria 1101
1600 Ga0207709_10535833 3300025935 Bacteria 919
1601 Ga0207670_10144337 3300025936 Bacteria 1758
1602 Ga0207669_10011311 3300025937 Bacteria 4336
1603 Ga0207669_10031107 3300025937 Bacteria 2977
1604 Ga0207669_10098372 3300025937 Bacteria 1926
1605 Ga0207669_10280983 3300025937 Bacteria 1255
1606 Ga0207704_10013293 3300025938 Bacteria 4115
1607 Ga0207704_10461118 3300025938 Bacteria 1016
1608 Ga0207665_10136361 3300025939 Bacteria 1746
1609 Ga0207691_10022595 3300025940 Bacteria 5931
1610 Ga0207691_10076816 3300025940 Bacteria 3009
1611 Ga0207691_10078790 3300025940 Bacteria 2965
1612 Ga0207691_10165374 3300025940 Bacteria 1939
1613 Ga0207691_10610141 3300025940 Bacteria 923
1614 Ga0207711_10022069 3300025941 Bacteria 5320
1615 Ga0207711_10024697 3300025941 Bacteria 5039
1616 Ga0207711_10028988 3300025941 Bacteria 4665
1617 Ga0207711_10283501 3300025941 Bacteria 1526
1618 Ga0207711_10363858 3300025941 Bacteria 1340
1619 Ga0207711_10370579 3300025941 Bacteria 1328
1620 Ga0207711_10376310 3300025941 Bacteria 1317
1621 Ga0207711_10618678 3300025941 Bacteria 1010
1622 Ga0207689_10012387 3300025942 Bacteria 7294
1623 Ga0207689_10026708 3300025942 Bacteria 4836
1624 Ga0207689_10034462 3300025942 Bacteria 4206
1625 Ga0207689_10095725 3300025942 Bacteria 2439
1626 Ga0207661_10127555 3300025944 Bacteria 2175
1627 Ga0207661_10154507 3300025944 Bacteria 1986
1628 Ga0207661_10698784 3300025944 Bacteria 933
1629 Ga0207679_10000032 3300025945 Bacteria 158845
1630 Ga0207679_10000081 3300025945 Bacteria 84888
1631 Ga0207679_10001142 3300025945 Bacteria 16924
1632 Ga0207679_10005047 3300025945 Bacteria 8253
1633 Ga0207679_10018738 3300025945 Bacteria 4643
1634 Ga0207679_10078880 3300025945 Bacteria 2509
1635 Ga0207679_10299150 3300025945 Bacteria 1386
1636 Ga0207679_10402135 3300025945 Bacteria 1205
1637 Ga0207667_10004875 3300025949 Bacteria 16389
1638 Ga0207667_10005112 3300025949 Bacteria 16018
1639 Ga0207667_10023256 3300025949 Bacteria 6824
1640 Ga0207667_10024497 3300025949 Bacteria 6625
1641 Ga0207667_10123035 3300025949 Bacteria 2673
1642 Ga0207667_10339047 3300025949 Bacteria 1534
1643 Ga0207667_10355079 3300025949 Bacteria 1495
1644 Ga0207667_10471226 3300025949 Bacteria 1275
1645 Ga0207651_10041558 3300025960 Bacteria 3053
1646 Ga0207651_10071942 3300025960 Bacteria 2453
1647 Ga0207651_10093868 3300025960 Bacteria 2204
1648 Ga0207651_10205702 3300025960 Bacteria 1581
1649 Ga0207651_10295197 3300025960 Bacteria 1345
1650 Ga0207651_10530231 3300025960 Bacteria 1021
1651 Ga0207712_10000715 3300025961 Bacteria 25589
1652 Ga0207712_10008980 3300025961 Bacteria 6321
1653 Ga0207712_10017230 3300025961 Bacteria 4690
1654 Ga0207712_10051790 3300025961 Bacteria 2873
1655 Ga0207712_10094578 3300025961 Bacteria 2208
1656 Ga0207712_10164226 3300025961 Bacteria 1729
1657 Ga0207712_10806836 3300025961 Bacteria 825
1658 Ga0207668_10023613 3300025972 Bacteria 3955
1659 Ga0207668_10048418 3300025972 Bacteria 2917
1660 Ga0207668_10057549 3300025972 Bacteria 2712
1661 Ga0207668_10405545 3300025972 Bacteria 1153
1662 Ga0207668_10757820 3300025972 Bacteria 857
1663 Ga0207640_10006255 3300025981 Bacteria 6528
1664 Ga0207640_10024619 3300025981 Bacteria 3634
1665 Ga0207640_10027602 3300025981 Bacteria 3461
1666 Ga0207640_10060779 3300025981 Bacteria 2499
1667 Ga0207640_10104424 3300025981 Bacteria 1994
1668 Ga0207640_10241127 3300025981 Bacteria 1397
1669 Ga0207658_10002284 3300025986 Bacteria 14158
1670 Ga0207658_10005412 3300025986 Bacteria 8753
1671 Ga0207658_10006036 3300025986 Bacteria 8272
1672 Ga0207658_10021398 3300025986 Bacteria 4489
1673 Ga0207658_10080258 3300025986 Bacteria 2498
1674 Ga0207658_10201434 3300025986 Bacteria 1662
1675 Ga0207658_10438354 3300025986 Bacteria 1155
1676 Ga0207658_10688208 3300025986 Bacteria 924
1677 Ga0207677_10017168 3300026023 Bacteria 4308
1678 Ga0207677_10046409 3300026023 Bacteria 2909
1679 Ga0207677_10048123 3300026023 Bacteria 2869
1680 Ga0207677_10059025 3300026023 Bacteria 2644
1681 Ga0207703_10002762 3300026035 Bacteria 15033
1682 Ga0207703_10007128 3300026035 Bacteria 8894
1683 Ga0207703_10017084 3300026035 Bacteria 5658
1684 Ga0207703_10148635 3300026035 Bacteria 2041
1685 Ga0207703_10237748 3300026035 Bacteria 1636
1686 Ga0207703_10317908 3300026035 Bacteria 1425
1687 Ga0207703_10334158 3300026035 Bacteria 1391
1688 Ga0207703_10650561 3300026035 Bacteria 1000
1689 Ga0207639_10000396 3300026041 Bacteria 30047
1690 Ga0207639_10060207 3300026041 Bacteria 2929
1691 Ga0207639_10288840 3300026041 Bacteria 1445
1692 Ga0207639_10484971 3300026041 Bacteria 1127
1693 Ga0207639_10641885 3300026041 Bacteria 982
1694 Ga0207678_10004336 3300026067 Bacteria 12735
1695 Ga0207678_10019676 3300026067 Bacteria 5936
1696 Ga0207678_10021697 3300026067 Bacteria 5631
1697 Ga0207678_10040548 3300026067 Bacteria 4038
1698 Ga0207678_10045124 3300026067 Bacteria 3811
1699 Ga0207678_10080010 3300026067 Bacteria 2798
1700 Ga0207678_10092895 3300026067 Bacteria 2579
1701 Ga0207678_10096602 3300026067 Bacteria 2525
1702 Ga0207678_10115983 3300026067 Bacteria 2285
1703 Ga0207678_10127772 3300026067 Bacteria 2168
1704 Ga0207678_10356376 3300026067 Bacteria 1262
1705 Ga0207708_10053315 3300026075 Bacteria 3082
1706 Ga0207702_10002227 3300026078 Bacteria 18591
1707 Ga0207702_10005063 3300026078 Bacteria 11575
1708 Ga0207702_10041370 3300026078 Bacteria 3864
1709 Ga0207702_10117812 3300026078 Bacteria 2372
1710 Ga0207702_10143005 3300026078 Bacteria 2167
1711 Ga0207702_10168181 3300026078 Bacteria 2008
1712 Ga0207702_10207911 3300026078 Bacteria 1818
1713 Ga0207702_10238979 3300026078 Bacteria 1701
1714 Ga0207702_10329227 3300026078 Bacteria 1456
1715 Ga0207702_10606184 3300026078 Bacteria 1075
1716 Ga0207702_10828289 3300026078 Bacteria 915
1717 Ga0207641_10006999 3300026088 Bacteria 9434
1718 Ga0207641_10014271 3300026088 Bacteria 6510
1719 Ga0207641_10055272 3300026088 Bacteria 3370
1720 Ga0207641_10098303 3300026088 Bacteria 2573
1721 Ga0207641_10189536 3300026088 Bacteria 1889
1722 Ga0207641_10307790 3300026088 Bacteria 1499
1723 Ga0207648_10020968 3300026089 Bacteria 5883
1724 Ga0207648_10021848 3300026089 Bacteria 5749
1725 Ga0207648_10028030 3300026089 Bacteria 4997
1726 Ga0207648_10051162 3300026089 Bacteria 3611
1727 Ga0207648_10055639 3300026089 Bacteria 3453
1728 Ga0207648_10082707 3300026089 Bacteria 2800
1729 Ga0207648_10130852 3300026089 Bacteria 2209
1730 Ga0207648_10206558 3300026089 Bacteria 1743
1731 Ga0207648_10228806 3300026089 Bacteria 1654
1732 Ga0207648_10259003 3300026089 Bacteria 1552
1733 Ga0207648_10267236 3300026089 Bacteria 1527
1734 Ga0207648_10290167 3300026089 Bacteria 1465
1735 Ga0207676_10020130 3300026095 Bacteria 4877
1736 Ga0207676_10037550 3300026095 Bacteria 3692
1737 Ga0207676_10488851 3300026095 Bacteria 1167
1738 Ga0207676_10666255 3300026095 Bacteria 1005
1739 Ga0207676_11283270 3300026095 Bacteria 727
1740 Ga0207674_10012636 3300026116 Bacteria 9438
1741 Ga0207674_10021420 3300026116 Bacteria 6959
1742 Ga0207674_10044100 3300026116 Bacteria 4595
1743 Ga0207674_10047838 3300026116 Bacteria 4382
1744 Ga0207674_10066091 3300026116 Bacteria 3643
1745 Ga0207674_10079818 3300026116 Bacteria 3275
1746 Ga0207674_10102998 3300026116 Bacteria 2834
1747 Ga0207674_10113859 3300026116 Bacteria 2678
1748 Ga0207674_10564841 3300026116 Bacteria 1099
1749 Ga0207674_10777643 3300026116 Bacteria 924
1750 Ga0207675_100032434 3300026118 Bacteria 4866
1751 Ga0207675_100055603 3300026118 Bacteria 3692
1752 Ga0207675_100060097 3300026118 Bacteria 3548
1753 Ga0207675_100066500 3300026118 Bacteria 3370
1754 Ga0207675_100077105 3300026118 Bacteria 3122
1755 Ga0207675_100155177 3300026118 Bacteria 2181
1756 Ga0207675_100178318 3300026118 Bacteria 2034
1757 Ga0207675_100218674 3300026118 Bacteria 1835
1758 Ga0207683_10038985 3300026121 Bacteria 4143
1759 Ga0207683_10060355 3300026121 Bacteria 3333
1760 Ga0207683_10080294 3300026121 Bacteria 2893
1761 Ga0207683_10090688 3300026121 Bacteria 2722
1762 Ga0207698_10012103 3300026142 Bacteria 5629
1763 Ga0207698_10020183 3300026142 Bacteria 4581
1764 Ga0207698_10061462 3300026142 Bacteria 2928
1765 Ga0207698_10100002 3300026142 Bacteria 2400
1766 Ga0207698_10125231 3300026142 Bacteria 2184
1767 Ga0207698_10227871 3300026142 Bacteria 1689
1768 Ga0209281_1000072 3300027111 Bacteria 273114
1769 Ga0209281_1001178 3300027111 Bacteria 18091
1770 Ga0209281_1002730 3300027111 Bacteria 6622
1771 Ga0209281_1009907 3300027111 Bacteria 2211
1772 Ga0209281_1010375 3300027111 Bacteria 2136
1773 Ga0209973_1000237 3300027252 Bacteria 3768
1774 Ga0209973_1000651 3300027252 Bacteria 2724
1775 Ga0209389_1000020 3300027296 Bacteria 172003
1776 Ga0209389_1028914 3300027296 Bacteria 4730
1777 Ga0209371_1000038 3300027312 Bacteria 361802
1778 Ga0209371_1000983 3300027312 Bacteria 21944
1779 Ga0209371_1001398 3300027312 Bacteria 16566
1780 Ga0209371_1001408 3300027312 Bacteria 16504
1781 Ga0209371_1003035 3300027312 Bacteria 8651
1782 Ga0209371_1005236 3300027312 Bacteria 5239
1783 Ga0209371_1005302 3300027312 Bacteria 5184
1784 Ga0209371_1010553 3300027312 Bacteria 2824
1785 Ga0209371_1011462 3300027312 Bacteria 2631
1786 Ga0209969_1007040 3300027360 Bacteria 1587
1787 Ga0209969_1029654 3300027360 Bacteria 834
1788 Ga0209967_1003102 3300027364 Bacteria 2180
1789 Ga0209981_1001130 3300027378 Bacteria 3379
1790 Ga0209981_1002814 3300027378 Bacteria 2231
1791 Ga0209996_1000589 3300027395 Bacteria 4395
1792 Ga0209996_1004645 3300027395 Bacteria 1749
1793 Ga0209996_1015142 3300027395 Bacteria 1051
1794 Ga0209984_1000331 3300027424 Bacteria 5343
1795 Ga0210000_1020083 3300027462 Bacteria 1018
1796 Ga0209995_1001072 3300027471 Bacteria 4212
1797 Ga0209995_1002467 3300027471 Bacteria 2923
1798 Ga0209995_1006510 3300027471 Bacteria 1876
1799 Ga0209995_1013553 3300027471 Bacteria 1336
1800 Ga0209968_1000400 3300027526 Bacteria 7076
1801 Ga0209999_1000995 3300027543 Bacteria 4791
1802 Ga0209999_1001100 3300027543 Bacteria 4614
1803 Ga0209999_1035985 3300027543 Bacteria 924
1804 Ga0209982_1000593 3300027552 Bacteria 4548
1805 Ga0209982_1000883 3300027552 Bacteria 3934
1806 Ga0209982_1004681 3300027552 Bacteria 1967
1807 Ga0209970_1000399 3300027614 Bacteria 7347
1808 Ga0209970_1001887 3300027614 Bacteria 3618
1809 Ga0209970_1005372 3300027614 Bacteria 2115
1810 Ga0210002_1002230 3300027617 Bacteria 2800
1811 Ga0209983_1001182 3300027665 Bacteria 5765
1812 Ga0209983_1002694 3300027665 Bacteria 3855
1813 Ga0209983_1006330 3300027665 Bacteria 2436
1814 Ga0209983_1009605 3300027665 Bacteria 1978
1815 Ga0209983_1018273 3300027665 Bacteria 1455
1816 Ga0209282_1000014 3300027666 Bacteria 207318
1817 Ga0209282_1000137 3300027666 Bacteria 43092
1818 Ga0209282_1017523 3300027666 Bacteria 4556
1819 Ga0209282_1046786 3300027666 Bacteria 2519
1820 Ga0209971_1000964 3300027682 Bacteria 7400
1821 Ga0209971_1001747 3300027682 Bacteria 5335
1822 Ga0209971_1005245 3300027682 Bacteria 3080
1823 Ga0209966_1000297 3300027695 Bacteria 16504
1824 Ga0209813_10146388 3300027866 Bacteria 843
1825 Ga0209974_10000928 3300027876 Bacteria 10208
1826 Ga0209974_10003613 3300027876 Bacteria 5556
1827 Ga0209974_10005081 3300027876 Bacteria 4646
1828 Ga0209974_10006186 3300027876 Bacteria 4192
1829 Ga0207428_10008621 3300027907 Bacteria 9207
1830 Ga0207428_10016333 3300027907 Bacteria 6387
1831 Ga0207428_10052786 3300027907 Bacteria 3244
1832 Ga0207428_10253123 3300027907 Bacteria 1313
1833 Ga0207428_10278515 3300027907 Bacteria 1242
1834 Ga0268266_10001238 3300028379 Bacteria 31222
1835 Ga0268266_10010675 3300028379 Bacteria 8003
1836 Ga0268266_10022996 3300028379 Bacteria 5304
1837 Ga0268266_10026919 3300028379 Bacteria 4892
1838 Ga0268266_10037806 3300028379 Bacteria 4109
1839 Ga0268266_10045726 3300028379 Bacteria 3745
1840 Ga0268266_10058723 3300028379 Bacteria 3312
1841 Ga0268266_10103994 3300028379 Bacteria 2507
1842 Ga0268266_10109533 3300028379 Bacteria 2446
1843 Ga0268266_10144187 3300028379 Bacteria 2139
1844 Ga0268266_10224445 3300028379 Bacteria 1728
1845 Ga0268266_10329596 3300028379 Bacteria 1430
1846 Ga0268266_10338225 3300028379 Bacteria 1412
1847 Ga0268266_10348076 3300028379 Bacteria 1392
1848 Ga0268266_10460263 3300028379 Bacteria 1210
1849 Ga0268265_10026744 3300028380 Bacteria 4107
1850 Ga0268265_10066160 3300028380 Bacteria 2793
1851 Ga0268265_10078592 3300028380 Bacteria 2595
1852 Ga0268265_10195224 3300028380 Bacteria 1751
1853 Ga0268265_10201756 3300028380 Bacteria 1726
1854 Ga0268264_10002141 3300028381 Bacteria 17621
1855 Ga0268264_10031940 3300028381 Bacteria 4319
1856 Ga0268264_10038596 3300028381 Bacteria 3942
1857 Ga0268264_10045122 3300028381 Bacteria 3659
1858 Ga0268264_10150689 3300028381 Bacteria 2085
1859 Ga0268264_10408088 3300028381 Bacteria 1307
1860 Ga0268264_10760999 3300028381 Bacteria 965
1861 Ga0265334_10135597 3300028573 Bacteria 874
1862 Ga0265318_10000228 3300028577 Bacteria 48687
1863 Ga0307517_10012098 3300028786 Bacteria 11891
1864 Ga0307517_10104273 3300028786 Bacteria 2210
1865 Ga0307517_10176061 3300028786 Bacteria 1393
1866 Ga0307517_10269518 3300028786 Bacteria 980
1867 Ga0307515_10000672 3300028794 Bacteria 78835
1868 Ga0307515_10001585 3300028794 Bacteria 50742
1869 Ga0307515_10011782 3300028794 Bacteria 16548
1870 Ga0307515_10011833 3300028794 Bacteria 16504
1871 Ga0307515_10038449 3300028794 Bacteria 7654
1872 Ga0307515_10043121 3300028794 Bacteria 7026
1873 Ga0307515_10050896 3300028794 Bacteria 6190
1874 Ga0307515_10070127 3300028794 Bacteria 4776
1875 Ga0307515_10081289 3300028794 Bacteria 4211
1876 Ga0307515_10221730 3300028794 Bacteria 1707
1877 Ga0307515_10284135 3300028794 Bacteria 1358
1878 Ga0307515_10297096 3300028794 Bacteria 1304
1879 Ga0307515_10333589 3300028794 Bacteria 1174
1880 Ga0307515_10552049 3300028794 Bacteria 762
1881 Ga0265338_10004458 3300028800 Bacteria 18890
1882 Ga0265338_10011072 3300028800 Bacteria 10461
1883 Ga0265338_10076408 3300028800 Bacteria 2837
1884 Ga0265338_10443456 3300028800 Bacteria 920
1885 Ga0265324_10009870 3300029957 Bacteria 3711
1886 Ga0265324_10032918 3300029957 Bacteria 1811
1887 Ga0268256_1000038 3300030500 Bacteria 361762
1888 Ga0268256_1000914 3300030500 Bacteria 20368
1889 Ga0268256_1001199 3300030500 Bacteria 16566
1890 Ga0268256_1001205 3300030500 Bacteria 16504
1891 Ga0268256_1002721 3300030500 Bacteria 8651
1892 Ga0268256_1004068 3300030500 Bacteria 6263
1893 Ga0268256_1005099 3300030500 Bacteria 5240
1894 Ga0268256_1019867 3300030500 Bacteria 1826
1895 Ga0268256_1030003 3300030500 Bacteria 1323
1896 Ga0268256_1042817 3300030500 Bacteria 1003
1897 Ga0307512_10052499 3300030522 Bacteria 3249
1898 Ga0307512_10121491 3300030522 Bacteria 1676
1899 Ga0316177_1013731 3300030731 Bacteria 2760
1900 Ga0316177_1035072 3300030731 Bacteria 1115
1901 Ga0316177_1045360 3300030731 Bacteria 1129
1902 Ga0316177_1088114 3300030731 Bacteria 6350
1903 Ga0316176_1055008 3300030732 Bacteria 4987
1904 Ga0316176_1126945 3300030732 Bacteria 3197
1905 Ga0314311_1059830 3300030733 Bacteria 6738
1906 Ga0314311_1238023 3300030733 Bacteria 2001
1907 Ga0316178_1082999 3300030735 Bacteria 1564
1908 Ga0316180_1046416 3300030736 Bacteria 3795
1909 Ga0316183_1043923 3300030742 Bacteria 3239
1910 Ga0316183_1084751 3300030742 Bacteria 2883
1911 Ga0316183_1123727 3300030742 Bacteria 1423
1912 Ga0316183_1180741 3300030742 Bacteria 1313
1913 Ga0316181_1073208 3300030744 Bacteria 2741
1914 Ga0316181_1106969 3300030744 Bacteria 4023
1915 Ga0316182_1170981 3300030745 Bacteria 2372
1916 Ga0265763_1001774 3300030763 Bacteria 1586
1917 Ga0265766_1000692 3300030863 Bacteria 1505
1918 Ga0265770_1019770 3300030878 Bacteria 1059
1919 Ga0265330_10000043 3300031235 Bacteria 116829
1920 Ga0265330_10001236 3300031235 Bacteria 14987
1921 Ga0265332_10000018 3300031238 Bacteria 224913
1922 Ga0265332_10002063 3300031238 Bacteria 10510
1923 Ga0265332_10002429 3300031238 Bacteria 9513
1924 Ga0265332_10031107 3300031238 Bacteria 2329
1925 Ga0265328_10001204 3300031239 Bacteria 11982
1926 Ga0265328_10014120 3300031239 Bacteria 3149
1927 Ga0265328_10014916 3300031239 Bacteria 3051
1928 Ga0265328_10043978 3300031239 Bacteria 1643
1929 Ga0265328_10124460 3300031239 Bacteria 963
1930 Ga0265325_10037968 3300031241 Bacteria 2543
1931 Ga0265325_10090055 3300031241 Bacteria 1514
1932 Ga0265340_10021359 3300031247 Bacteria 3321
1933 Ga0265340_10062128 3300031247 Bacteria 1785
1934 Ga0265340_10108860 3300031247 Bacteria 1282
1935 Ga0265339_10014268 3300031249 Bacteria 4792
1936 Ga0265331_10000050 3300031250 Bacteria 181286
1937 Ga0265331_10003895 3300031250 Bacteria 9434
1938 Ga0265331_10005250 3300031250 Bacteria 7844
1939 Ga0265331_10009629 3300031250 Bacteria 5411
1940 Ga0265331_10015964 3300031250 Bacteria 3951
1941 Ga0265331_10028103 3300031250 Bacteria 2814
1942 Ga0265327_10000020 3300031251 Bacteria 424552
1943 Ga0265327_10000109 3300031251 Bacteria 181275
1944 Ga0265327_10000161 3300031251 Bacteria 144768
1945 Ga0265327_10001331 3300031251 Bacteria 32073
1946 Ga0265327_10008647 3300031251 Bacteria 7539
1947 Ga0265327_10020861 3300031251 Bacteria 3975
1948 Ga0265327_10028174 3300031251 Bacteria 3217
1949 Ga0265327_10156596 3300031251 Bacteria 1055
1950 Ga0265316_10024063 3300031344 Bacteria 5112
1951 Ga0307513_10000066 3300031456 Bacteria 141617
1952 Ga0307513_10009971 3300031456 Bacteria 11983
1953 Ga0307513_10045162 3300031456 Bacteria 4817
1954 Ga0307513_10054041 3300031456 Bacteria 4310
1955 Ga0307513_10060560 3300031456 Bacteria 4013
1956 Ga0307513_10061523 3300031456 Bacteria 3974
1957 Ga0307513_10135732 3300031456 Bacteria 2396
1958 Ga0307513_10180220 3300031456 Bacteria 1977
1959 Ga0307513_10190405 3300031456 Bacteria 1904
1960 Ga0307513_10193284 3300031456 Bacteria 1884
1961 Ga0307513_10206251 3300031456 Bacteria 1801
1962 Ga0307513_10256504 3300031456 Bacteria 1541
1963 Ga0307513_10301957 3300031456 Bacteria 1367
1964 Ga0307513_10482734 3300031456 Bacteria 959
1965 Ga0307509_10006255 3300031507 Bacteria 16094
1966 Ga0307509_10067896 3300031507 Bacteria 3732
1967 Ga0307509_10071053 3300031507 Bacteria 3632
1968 Ga0307509_10141996 3300031507 Bacteria 2334
1969 Ga0307509_10356357 3300031507 Bacteria 1184
1970 Ga0307408_100000089 3300031548 Bacteria 100712
1971 Ga0307408_100000911 3300031548 Bacteria 23101
1972 Ga0307408_100020277 3300031548 Bacteria 4485
1973 Ga0307408_100040708 3300031548 Bacteria 3291
1974 Ga0307408_100048129 3300031548 Bacteria 3056
1975 Ga0307408_100092388 3300031548 Bacteria 2287
1976 Ga0307408_100127414 3300031548 Bacteria 1981
1977 Ga0307408_100160835 3300031548 Bacteria 1783
1978 Ga0307408_100240460 3300031548 Bacteria 1488
1979 Ga0307408_100427280 3300031548 Bacteria 1144
1980 Ga0307408_100515184 3300031548 Bacteria 1049
1981 Ga0307408_100684186 3300031548 Bacteria 920
1982 Ga0307408_100720427 3300031548 Bacteria 898
1983 Ga0307408_100784450 3300031548 Bacteria 863
1984 Ga0265313_10025575 3300031595 Bacteria 3123
1985 Ga0307508_10003204 3300031616 Bacteria 16727
1986 Ga0307508_10014730 3300031616 Bacteria 7131
1987 Ga0307508_10031774 3300031616 Bacteria 4771
1988 Ga0307508_10157260 3300031616 Bacteria 1877
1989 Ga0307514_10002098 3300031649 Bacteria 21504
1990 Ga0307514_10306502 3300031649 Bacteria 884
1991 Ga0316575_10028016 3300031665 Bacteria 2194
1992 Ga0316575_10065509 3300031665 Bacteria 1455
1993 Ga0316575_10077266 3300031665 Bacteria 1341
1994 Ga0316575_10125991 3300031665 Bacteria 1049
1995 Ga0316579_10001300 3300031691 Bacteria 9013
1996 Ga0316579_10002293 3300031691 Bacteria 7218
1997 Ga0316579_10019256 3300031691 Bacteria 3014
1998 Ga0316579_10025223 3300031691 Bacteria 2682
1999 Ga0316579_10102455 3300031691 Bacteria 1371
2000 Ga0316579_10109645 3300031691 Bacteria 1325
2001 Ga0265314_10000126 3300031711 Bacteria 116852
2002 Ga0265314_10010858 3300031711 Bacteria 7569
2003 Ga0316576_10017216 3300031727 Bacteria 4904
2004 Ga0316576_10022230 3300031727 Bacteria 4402
2005 Ga0316576_10073113 3300031727 Bacteria 2532
2006 Ga0316578_10000241 3300031728 Bacteria 16205
2007 Ga0316578_10005618 3300031728 Bacteria 6103
2008 Ga0316578_10026809 3300031728 Bacteria 3251
2009 Ga0316578_10033290 3300031728 Bacteria 2951
2010 Ga0316578_10041170 3300031728 Bacteria 2675
2011 Ga0307516_10000048 3300031730 Bacteria 130378
2012 Ga0307516_10000439 3300031730 Bacteria 54705
2013 Ga0307516_10015709 3300031730 Bacteria 7959
2014 Ga0307516_10022658 3300031730 Bacteria 6448
2015 Ga0307516_10026131 3300031730 Bacteria 5935
2016 Ga0307516_10029631 3300031730 Bacteria 5532
2017 Ga0307516_10060839 3300031730 Bacteria 3668
2018 Ga0307516_10368208 3300031730 Bacteria 1100
2019 Ga0307516_10393276 3300031730 Bacteria 1046
2020 Ga0307405_10006387 3300031731 Bacteria 5795
2021 Ga0307405_10013658 3300031731 Bacteria 4337
2022 Ga0307405_10229491 3300031731 Bacteria 1367
2023 Ga0307405_10254854 3300031731 Bacteria 1307
2024 Ga0307405_10563102 3300031731 Bacteria 924
2025 Ga0316577_10027484 3300031733 Bacteria 3172
2026 Ga0316577_10028434 3300031733 Bacteria 3119
2027 Ga0316577_10034258 3300031733 Bacteria 2838
2028 Ga0316577_10057496 3300031733 Bacteria 2172
2029 Ga0316577_10075924 3300031733 Bacteria 1876
2030 Ga0316577_10190436 3300031733 Bacteria 1159
2031 Ga0307413_10010652 3300031824 Bacteria 4475
2032 Ga0307413_10031579 3300031824 Bacteria 2991
2033 Ga0307413_10096570 3300031824 Bacteria 1940
2034 Ga0307413_10206278 3300031824 Bacteria 1423
2035 Ga0307413_10832442 3300031824 Bacteria 778
2036 Ga0307410_10036837 3300031852 Bacteria 3189
2037 Ga0307410_10821968 3300031852 Bacteria 791
2038 Ga0307406_10014028 3300031901 Bacteria 4603
2039 Ga0307406_10036154 3300031901 Bacteria 3041
2040 Ga0307406_10042504 3300031901 Bacteria 2837
2041 Ga0307406_10475879 3300031901 Bacteria 1007
2042 Ga0307406_10561281 3300031901 Bacteria 936
2043 Ga0307406_10638299 3300031901 Bacteria 882
2044 Ga0307407_10209452 3300031903 Bacteria 1311
2045 Ga0307407_10489990 3300031903 Bacteria 899
2046 Ga0307412_10000505 3300031911 Bacteria 23321
2047 Ga0307412_10017396 3300031911 Bacteria 4302
2048 Ga0307412_10041167 3300031911 Bacteria 2993
2049 Ga0307412_10057603 3300031911 Bacteria 2595
2050 Ga0307412_10137101 3300031911 Bacteria 1787
2051 Ga0307412_10163924 3300031911 Bacteria 1655
2052 Ga0307412_10664831 3300031911 Bacteria 890
2053 Ga0307409_100002394 3300031995 Bacteria 9778
2054 Ga0307409_100023232 3300031995 Bacteria 4291
2055 Ga0307409_100078354 3300031995 Bacteria 2658
2056 Ga0307409_100081436 3300031995 Bacteria 2617
2057 Ga0307416_100004760 3300032002 Bacteria 8239
2058 Ga0307416_100032384 3300032002 Bacteria 3949
2059 Ga0307416_100134976 3300032002 Bacteria 2230
2060 Ga0307416_100185596 3300032002 Bacteria 1954
2061 Ga0307416_100185645 3300032002 Bacteria 1954
2062 Ga0307416_100276036 3300032002 Bacteria 1654
2063 Ga0307416_100332252 3300032002 Bacteria 1528
2064 Ga0307416_100453671 3300032002 Bacteria 1335
2065 Ga0307416_100691172 3300032002 Bacteria 1108
2066 Ga0307416_100709687 3300032002 Bacteria 1095
2067 Ga0307416_100776847 3300032002 Bacteria 1052
2068 Ga0307414_10006142 3300032004 Bacteria 6673
2069 Ga0307414_10014078 3300032004 Bacteria 4780
2070 Ga0307414_10029702 3300032004 Bacteria 3561
2071 Ga0307414_10037091 3300032004 Bacteria 3260
2072 Ga0307414_10037252 3300032004 Bacteria 3254
2073 Ga0307414_10043481 3300032004 Bacteria 3060
2074 Ga0307414_10127905 3300032004 Bacteria 1966
2075 Ga0307414_10168422 3300032004 Bacteria 1748
2076 Ga0307414_10306429 3300032004 Bacteria 1346
2077 Ga0307414_10327962 3300032004 Bacteria 1305
2078 Ga0307414_10358180 3300032004 Bacteria 1254
2079 Ga0307411_10005049 3300032005 Bacteria 6424
2080 Ga0307411_10104384 3300032005 Bacteria 2012
2081 Ga0307411_10216553 3300032005 Bacteria 1482
2082 Ga0307411_10222747 3300032005 Bacteria 1464
2083 Ga0307411_10232377 3300032005 Bacteria 1438
2084 Ga0307411_10336029 3300032005 Bacteria 1226
2085 Ga0307415_100030680 3300032126 Bacteria 3454
2086 Ga0307415_100109499 3300032126 Bacteria 2046
2087 Ga0307415_100376168 3300032126 Bacteria 1204
2088 Ga0316583_10008755 3300032133 Bacteria 3651
2089 Ga0316583_10010383 3300032133 Bacteria 3357
2090 Ga0316583_10012061 3300032133 Bacteria 3118
2091 Ga0316583_10055951 3300032133 Bacteria 1386
2092 Ga0316585_10008481 3300032137 Bacteria 2984
2093 Ga0316585_10036291 3300032137 Bacteria 1562
2094 Ga0316585_10091138 3300032137 Bacteria 996
2095 Ga0316580_10002424 3300032139 Bacteria 5121
2096 Ga0316580_10012872 3300032139 Bacteria 2549
2097 Ga0316580_10045538 3300032139 Bacteria 1353
2098 Ga0316593_10001008 3300032168 Bacteria 5835
2099 Ga0316593_10001054 3300032168 Bacteria 5757
2100 Ga0316593_10001157 3300032168 Bacteria 5608
2101 Ga0316593_10001330 3300032168 Bacteria 5401
2102 Ga0316593_10001533 3300032168 Bacteria 5131
2103 Ga0316593_10001680 3300032168 Bacteria 4989
2104 Ga0316593_10001686 3300032168 Bacteria 4977
2105 Ga0316593_10001713 3300032168 Bacteria 4956
2106 Ga0316593_10002297 3300032168 Bacteria 4487
2107 Ga0316593_10004121 3300032168 Bacteria 3692
2108 Ga0316593_10004761 3300032168 Bacteria 3517
2109 Ga0316593_10005618 3300032168 Bacteria 3324
2110 Ga0316593_10011003 3300032168 Bacteria 2617
2111 Ga0316593_10012084 3300032168 Bacteria 2527
2112 Ga0316593_10012613 3300032168 Bacteria 2484
2113 Ga0316593_10032779 3300032168 Bacteria 1698
2114 Ga0316593_10039062 3300032168 Bacteria 1573
2115 Ga0316593_10047330 3300032168 Bacteria 1445
2116 Ga0316593_10086092 3300032168 Bacteria 1102
2117 Ga0316593_10116300 3300032168 Bacteria 958
2118 Ga0307507_10016833 3300033179 Bacteria 8463
2119 Ga0307507_10197177 3300033179 Bacteria 1401
2120 Ga0307510_10085086 3300033180 Bacteria 3041
2121 Ga0307510_10170717 3300033180 Bacteria 1754
2122 Ga0316592_1000037 3300033524 Bacteria 10506
2123 Ga0316592_1000343 3300033524 Bacteria 6079
2124 Ga0316592_1000481 3300033524 Bacteria 5553
2125 Ga0316592_1000905 3300033524 Bacteria 4500
2126 Ga0316592_1005192 3300033524 Bacteria 2461
2127 Ga0316592_1005922 3300033524 Bacteria 2340
2128 Ga0316592_1017145 3300033524 Bacteria 1518
2129 Ga0316592_1043275 3300033524 Bacteria 999
2130 Ga0316586_1000160 3300033527 Bacteria 5462
2131 Ga0316586_1000205 3300033527 Bacteria 5020
2132 Ga0316586_1000331 3300033527 Bacteria 4381
2133 Ga0316586_1000360 3300033527 Bacteria 4267
2134 Ga0316586_1000524 3300033527 Bacteria 3763
2135 Ga0316586_1000950 3300033527 Bacteria 3087
2136 Ga0316586_1001851 3300033527 Bacteria 2538
2137 Ga0316586_1003535 3300033527 Bacteria 2059
2138 Ga0316588_1000465 3300033528 Bacteria 5461
2139 Ga0316588_1000602 3300033528 Bacteria 5134
2140 Ga0316588_1001285 3300033528 Bacteria 4042
2141 Ga0316588_1001673 3300033528 Bacteria 3707
2142 Ga0316588_1002197 3300033528 Bacteria 3372
2143 Ga0316588_1005712 3300033528 Bacteria 2444
2144 Ga0316588_1048918 3300033528 Bacteria 1023
2145 Ga0316587_1000088 3300033529 Bacteria 6457
2146 Ga0316587_1000712 3300033529 Bacteria 3609
2147 Ga0316587_1000826 3300033529 Bacteria 3455
2148 Ga0316587_1001179 3300033529 Bacteria 3122
2149 Ga0316587_1001187 3300033529 Bacteria 3116
2150 Ga0316587_1001236 3300033529 Bacteria 3074
2151 Ga0316587_1007363 3300033529 Bacteria 1708
2152 Ga0316596_1000019 3300033541 Bacteria 14934
2153 Ga0316596_1000020 3300033541 Bacteria 14748
2154 Ga0316596_1000175 3300033541 Bacteria 9183
2155 Ga0316596_1000180 3300033541 Bacteria 9086
2156 Ga0316596_1000739 3300033541 Bacteria 5974
2157 Ga0316596_1001469 3300033541 Bacteria 4766
2158 Ga0316596_1003395 3300033541 Bacteria 3486
2159 Ga0316596_1003606 3300033541 Bacteria 3411
2160 Ga0316596_1003794 3300033541 Bacteria 3342
2161 Ga0316596_1007006 3300033541 Bacteria 2648
2162 Ga0316596_1007093 3300033541 Bacteria 2636
2163 Ga0316596_1010500 3300033541 Bacteria 2242
2164 Ga0316596_1025728 3300033541 Bacteria 1515
2165 Ga0316596_1075650 3300033541 Bacteria 903
2166 Ga0316596_1076546 3300033541 Bacteria 898
2167 Ga0316212_1006842 3300033547 Bacteria 1651
2168 Ga0373950_0039719 3300034818 Bacteria 897
2169 Ga0373929_0084202 3300035085 Bacteria 780
2170 Ga0373934_0001702 3300035086 Bacteria 8075
2171 Ga0373940_0083738 3300035088 Bacteria 947
2172 Ga0373936_0002759 3300035113 Bacteria 6546
2173 Ga0373936_0106226 3300035113 Bacteria 1189
2174 Ga0373939_0000177 3300035114 Bacteria 17668
2175 Ga0373939_0019559 3300035114 Bacteria 1829
2176 Ga0373939_0309493 3300035114 Bacteria 632
2177 Ga0373945_0073808 3300035116 Bacteria 1296
2178 Ga0373953_0005967 3300035117 Bacteria 3989
2179 Ga0373954_0001595 3300035118 Bacteria 9259
2180 Ga0373954_0148407 3300035118 Bacteria 1145
2181 Ga0373956_0001547 3300035119 Bacteria 9491
2182 Ga0373956_0004706 3300035119 Bacteria 5453
2183 Ga0373956_0049608 3300035119 Bacteria 1883
2184 Ga0373956_0077024 3300035119 Bacteria 1527
2185 Ga0373957_0020027 3300035120 Bacteria 2360
2186 Ga0373955_0033277 3300035172 Bacteria 2713
2187 Ga0373955_0147670 3300035172 Bacteria 1382
2188 Ga0373955_0206378 3300035172 Bacteria 1171
2189 Ga0373961_0124661 3300035241 Bacteria 857
2190 Ga0373962_0061277 3300035242 Bacteria 1106
2191 Ga0316574_0001814 3300035398 Bacteria 10384
2192 Ga0316574_0006051 3300035398 Bacteria 6504
2193 Ga0316574_0018347 3300035398 Bacteria 4110
2194 Ga0316574_0030135 3300035398 Bacteria 3283
2195 Ga0316574_0031371 3300035398 Bacteria 3223
2196 Ga0316574_0064814 3300035398 Bacteria 2299
2197 Ga0373924_0001903 3300035410 Bacteria 6933
2198 Ga0373931_0012290 3300035691 Bacteria 4145
2199 Ga0373931_0335996 3300035691 Bacteria 942
2200 Ga0373935_0019952 3300035692 Bacteria 4091
2201 Ga0373935_0050564 3300035692 Bacteria 2638
2202 Ga0373927_0012993 3300035695 Bacteria 5537
2203 Ga0373927_0037294 3300035695 Bacteria 3160
2204 Ga0373927_0181210 3300035695 Bacteria 1382
2205 Ga0373933_0158832 3300035724 Bacteria 1435
2206 Ga0373947_0257184 3300035725 Bacteria 1156
2207 Ga0373947_0374663 3300035725 Bacteria 957
2208 Ga0373947_0509151 3300035725 Bacteria 818
2209 Ga0373937_0001885 3300036401 Bacteria 17619
2210 Ga0373937_0024571 3300036401 Bacteria 5437
2211 Ga0373937_0038981 3300036401 Bacteria 4329
2212 Ga0373937_0115724 3300036401 Bacteria 2497
2213 Ga0373937_0677315 3300036401 Bacteria 977
2214 Ga0316582_0009358 3300036647 Bacteria 5315
2215 Ga0316582_0012499 3300036647 Bacteria 4742
2216 Ga0316582_0034937 3300036647 Bacteria 3100
2217 Ga0316582_0037931 3300036647 Bacteria 2991
2218 Ga0316582_0038029 3300036647 Bacteria 2988
2219 Ga0316582_0046396 3300036647 Bacteria 2739
2220 Ga0316582_0053126 3300036647 Bacteria 2576
2221 Ga0316582_0059534 3300036647 Bacteria 2446
2222 Ga0316582_0128222 3300036647 Bacteria 1702
2223 Ga0316582_0152126 3300036647 Bacteria 1564
2224 Ga0316582_0215530 3300036647 Bacteria 1312
2225 Ga0316584_0003506 3300036712 Bacteria 10226
2226 Ga0316584_0006256 3300036712 Bacteria 8067
2227 Ga0316584_0035668 3300036712 Bacteria 3691
2228 Ga0316584_0046567 3300036712 Bacteria 3239
2229 Ga0316584_0068626 3300036712 Bacteria 2657
2230 Ga0316584_0076455 3300036712 Bacteria 2509
2231 Ga0316584_0189113 3300036712 Bacteria 1522
2232 Ga0316584_0338310 3300036712 Bacteria 1082
2233 Ga0316584_0415751 3300036712 Bacteria 956
2234 Ga0373925_0013245 3300037068 Bacteria 5967
2235 Ga0373925_0029884 3300037068 Bacteria 3997
2236 Ga0373925_0106448 3300037068 Bacteria 2162
2237 Ga0373925_0113235 3300037068 Bacteria 2098
2238 Ga0373925_0132144 3300037068 Bacteria 1947
2239 Ga0395899_0000078 3300037312 Bacteria 174141
2240 Ga0395899_0002718 3300037312 Bacteria 14259
2241 Ga0395899_0002866 3300037312 Bacteria 13868
2242 Ga0395899_0005833 3300037312 Bacteria 9559
2243 Ga0395899_0028671 3300037312 Bacteria 4190
2244 Ga0395899_0043190 3300037312 Bacteria 3363
2245 Ga0395899_0079269 3300037312 Bacteria 2391
2246 Ga0395899_0261286 3300037312 Bacteria 1184
2247 Ga0395899_0268389 3300037312 Bacteria 1164
2248 Ga0395899_0341135 3300037312 Bacteria 1004
2249 Ga0395900_0000542 3300037418 Bacteria 52856
2250 Ga0395900_0004137 3300037418 Bacteria 15446
2251 Ga0395900_0059651 3300037418 Bacteria 3928
2252 Ga0395900_0082284 3300037418 Bacteria 3307
2253 Ga0395900_0108339 3300037418 Bacteria 2854
2254 Ga0395900_0114062 3300037418 Bacteria 2773
2255 Ga0395900_0118612 3300037418 Bacteria 2715
2256 Ga0395900_0194391 3300037418 Bacteria 2056
2257 Ga0395900_0225365 3300037418 Bacteria 1887
2258 Ga0395900_0340419 3300037418 Bacteria 1475
2259 Ga0395900_0343460 3300037418 Bacteria 1468
2260 Ga0395900_0352768 3300037418 Bacteria 1444
2261 Ga0395900_0535820 3300037418 Bacteria 1117
2262 Ga0395900_0583781 3300037418 Bacteria 1059
2263 Ga0395900_0668078 3300037418 Bacteria 974
2264 Ga0395898_0004844 3300037466 Bacteria 14625
2265 Ga0395898_0005792 3300037466 Bacteria 13291
2266 Ga0395898_0016725 3300037466 Bacteria 7496
2267 Ga0395898_0045954 3300037466 Bacteria 4290
2268 Ga0395898_0067954 3300037466 Bacteria 3449
2269 Ga0395898_0145136 3300037466 Bacteria 2271
2270 Ga0395898_0152270 3300037466 Bacteria 2212
2271 Ga0395898_0188549 3300037466 Bacteria 1970
2272 Ga0395898_0215439 3300037466 Bacteria 1831
2273 Ga0395898_0262474 3300037466 Bacteria 1647
2274 Ga0395898_0284147 3300037466 Bacteria 1578
2275 Ga0395905_0003008 3300037471 Bacteria 18269
2276 Ga0395905_0007900 3300037471 Bacteria 10523
2277 Ga0395905_0013357 3300037471 Bacteria 7869
2278 Ga0395905_0015366 3300037471 Bacteria 7275
2279 Ga0395905_0016271 3300037471 Bacteria 7066
2280 Ga0395905_0025382 3300037471 Bacteria 5588
2281 Ga0395905_0025945 3300037471 Bacteria 5524
2282 Ga0395905_0032091 3300037471 Bacteria 4941
2283 Ga0395905_0038750 3300037471 Bacteria 4470
2284 Ga0395905_0049982 3300037471 Bacteria 3918
2285 Ga0395905_0061348 3300037471 Bacteria 3517
2286 Ga0395905_0069743 3300037471 Bacteria 3292
2287 Ga0395905_0070304 3300037471 Bacteria 3279
2288 Ga0395905_0172135 3300037471 Bacteria 2034
2289 Ga0395905_0197631 3300037471 Bacteria 1885
2290 Ga0395905_0210641 3300037471 Bacteria 1821
2291 Ga0395905_0211120 3300037471 Bacteria 1819
2292 Ga0395905_0214547 3300037471 Bacteria 1802
2293 Ga0395905_0365664 3300037471 Bacteria 1335
2294 Ga0395905_0645296 3300037471 Bacteria 960
2295 Ga0395905_0676195 3300037471 Bacteria 934
2296 Ga0395905_0682232 3300037471 Bacteria 930
2297 Ga0316581_0000596 3300037588 Bacteria 7146
2298 Ga0316581_0088740 3300037588 Bacteria 952
2299 Ga0436364_1476474 3300037853 Bacteria 3091
2300 Ga0395901_0001551 3300038443 Bacteria 23807
2301 Ga0395901_0004460 3300038443 Bacteria 14123
2302 Ga0395901_0005665 3300038443 Bacteria 12640
2303 Ga0395901_0052878 3300038443 Bacteria 4221
2304 Ga0395901_0094399 3300038443 Bacteria 3133
2305 Ga0395901_0118869 3300038443 Bacteria 2777
2306 Ga0395901_0165200 3300038443 Bacteria 2324
2307 Ga0395901_0263988 3300038443 Bacteria 1791
2308 Ga0395901_0378939 3300038443 Bacteria 1456
2309 Ga0395901_0450770 3300038443 Bacteria 1316
2310 Ga0395901_0542737 3300038443 Bacteria 1179
2311 Ga0237819_00741 3300038705 Bacteria 10516
2312 Ga0237819_00830 3300038705 Bacteria 9758
2313 Ga0237819_05183 3300038705 Bacteria 2068
2314 Ga0400484_14537 3300038725 Bacteria 1797
2315 Ga0400484_42754 3300038725 Bacteria 7163
2316 Ga0400484_44930 3300038725 Bacteria 6905
2317 Ga0400490_06365 3300038726 Bacteria 1122
2318 Ga0400490_14561 3300038726 Bacteria 6337
2319 Ga0400490_23159 3300038726 Bacteria 7559
2320 Ga0400490_23793 3300038726 Bacteria 7125
2321 Ga0400490_34376 3300038726 Bacteria 2844
2322 Ga0400490_48054 3300038726 Bacteria 3644
2323 Ga0400491_01726 3300038727 Bacteria 2982
2324 Ga0400491_05075 3300038727 Bacteria 1066
2325 Ga0400485_05553 3300038735 Bacteria 5178
2326 Ga0400485_10260 3300038735 Bacteria 1388
2327 Ga0400485_22368 3300038735 Bacteria 1591
2328 Ga0400488_03593 3300038741 Bacteria 2867
2329 Ga0400488_39782 3300038741 Bacteria 1351
2330 Ga0400488_44048 3300038741 Bacteria 1522
2331 Ga0400488_59732 3300038741 Bacteria 1106
2332 Ga0400486_00562 3300038742 Bacteria 15572
2333 Ga0400486_06077 3300038742 Bacteria 21460
2334 Ga0400486_08483 3300038742 Bacteria 6499
2335 Ga0400486_20964 3300038742 Bacteria 3156
2336 Ga0400483_036904 3300039062 Bacteria 2620
2337 Ga0400483_044792 3300039062 Bacteria 2913
2338 Ga0400483_065923 3300039062 Bacteria 2592
2339 Ga0400483_072918 3300039062 Bacteria 1126
2340 Ga0400483_077033 3300039062 Bacteria 5585
2341 Ga0400483_093445 3300039062 Bacteria 3306
2342 Ga0400483_097852 3300039062 Bacteria 1365
2343 Ga0400483_112750 3300039062 Bacteria 10896
2344 Ga0400483_177360 3300039062 Bacteria 4697
2345 Ga0400483_184072 3300039062 Bacteria 4393
2346 Ga0400483_196379 3300039062 Bacteria 14768
2347 Ga0400483_242812 3300039062 Bacteria 3419
2348 Ga0400483_284829 3300039062 Bacteria 6887
2349 Ga0400483_287945 3300039062 Bacteria 2075
2350 Ga0400489_04938 3300039093 Bacteria 1372
2351 Ga0400489_13021 3300039093 Bacteria 2206
2352 Ga0400487_11086 3300039110 Bacteria 4129
2353 Ga0400487_19871 3300039110 Bacteria 2531
2354 Ga0400487_24868 3300039110 Bacteria 2532
2355 Ga0400487_42317 3300039110 Bacteria 6965
2356 Ga0400487_48323 3300039110 Bacteria 2133
2357 Ga0400487_61079 3300039110 Bacteria 7283
2358 Ga0436365_0618827 3300039437 Bacteria 2517
2359 Ga0436365_0984881 3300039437 Bacteria 941
2360 Ga0436365_1808852 3300039437 Bacteria 1531
2361 Ga0436365_1933986 3300039437 Bacteria 3887
2362 Ga0436360_0247559 3300039438 Bacteria 1098
2363 Ga0436360_0532400 3300039438 Bacteria 2538
2364 Ga0436361_0085139 3300039447 Bacteria 2466
2365 Ga0436361_0167298 3300039447 Bacteria 2079
2366 Ga0436361_0169447 3300039447 Bacteria 1372
2367 Ga0436361_0312153 3300039447 Bacteria 3976
2368 Ga0436361_0336197 3300039447 Bacteria 15741
2369 Ga0436361_0426137 3300039447 Bacteria 1593
2370 Ga0436361_0504201 3300039447 Bacteria 19088
2371 Ga0436361_0590883 3300039447 Bacteria 20872
2372 Ga0436361_0693112 3300039447 Bacteria 19122
2373 Ga0436361_0706474 3300039447 Bacteria 2710
2374 Ga0436361_0708121 3300039447 Bacteria 900
2375 Ga0436361_0712914 3300039447 Bacteria 1293
2376 Ga0436361_0823903 3300039447 Bacteria 2647
2377 Ga0436361_0946169 3300039447 Bacteria 1282
2378 Ga0436361_1024452 3300039447 Bacteria 1242
2379 Ga0436361_1038070 3300039447 Bacteria 9794
2380 Ga0436361_1173153 3300039447 Bacteria 3328
2381 Ga0436363_1295886 3300039450 Bacteria 780
2382 Ga0436363_1436445 3300039450 Bacteria 8017
2383 Ga0436362_0483546 3300039453 Bacteria 5201
2384 Ga0436362_0671535 3300039453 Bacteria 953
2385 Ga0436362_1143657 3300039453 Bacteria 2240
2386 Ga0439436_0002495 3300041404 Bacteria 5539
2387 Ga0439436_0009101 3300041404 Bacteria 3045
2388 Ga0439436_0016476 3300041404 Bacteria 2216
2389 Ga0439438_005852 3300041405 Bacteria 4455
2390 Ga0439439_0012844 3300041406 Bacteria 2025
2391 Ga0439439_0025248 3300041406 Bacteria 1495
2392 Ga0439439_0057830 3300041406 Bacteria 1026
2393 Ga0439439_0058191 3300041406 Bacteria 1023
2394 Ga0439447_011662 3300041407 Bacteria 2554
2395 Ga0439447_035275 3300041407 Bacteria 1241
2396 Ga0439453_0011980 3300041408 Bacteria 1454
2397 Ga0439461_0002207 3300041410 Bacteria 3091
2398 Ga0439466_0011018 3300041411 Bacteria 3352
2399 Ga0439466_0024415 3300041411 Bacteria 2119
2400 Ga0439466_0107948 3300041411 Bacteria 864
2401 Ga0439465_0003075 3300041413 Bacteria 5458
2402 Ga0439465_0005063 3300041413 Bacteria 4229
2403 Ga0439465_0008385 3300041413 Bacteria 3262
2404 Ga0439465_0018740 3300041413 Bacteria 2162
2405 Ga0451787_527582 3300041441 Bacteria 855
2406 Ga0451791_1642111 3300041451 Bacteria 1104
2407 Ga0451793_0696706 3300041452 Bacteria 1478
2408 Ga0451797_0264651 3300041453 Bacteria 1157
2409 Ga0451797_0277581 3300041453 Bacteria 1377
2410 Ga0451795_0048191 3300041456 Bacteria 963
2411 Ga0451795_0204267 3300041456 Bacteria 1425
2412 Ga0451800_0124581 3300041459 Bacteria 6009
2413 Ga0451800_1565474 3300041459 Bacteria 875
2414 Ga0451802_0167517 3300041460 Bacteria 1364
2415 Ga0451802_1482025 3300041460 Bacteria 2194
2416 Ga0451806_385064 3300041462 Bacteria 9086
2417 Ga0451804_1083353 3300041463 Bacteria 4670
2418 Ga0451807_0262198 3300041486 Bacteria 4504
2419 Ga0451807_0857467 3300041486 Bacteria 4217
2420 Ga0451837_0533322 3300041494 Bacteria 946
2421 Ga0451837_1551383 3300041494 Bacteria 1161
2422 Ga0451837_1611358 3300041494 Bacteria 1209
2423 Ga0451841_0887743 3300041498 Bacteria 1173
2424 Ga0451841_1119244 3300041498 Bacteria 1224
2425 Ga0451849_0140794 3300041505 Bacteria 878
2426 Ga0451849_1346764 3300041505 Bacteria 939
2427 Ga0451843_0484181 3300041509 Bacteria 1048
2428 Ga0451843_1345421 3300041509 Bacteria 1024
2429 Ga0451843_1524044 3300041509 Bacteria 930
2430 Ga0451853_2151806 3300041512 Bacteria 3291
2431 Ga0451853_3241757 3300041512 Bacteria 1163
2432 Ga0439431_0003590 3300041997 Bacteria 3422
2433 Ga0439431_0008078 3300041997 Bacteria 2359
2434 Ga0439431_0008398 3300041997 Bacteria 2321
2435 Ga0439431_0051945 3300041997 Bacteria 1064
2436 Ga0439431_0066549 3300041997 Bacteria 955
2437 Ga0439433_0003667 3300041999 Bacteria 3297
2438 Ga0439433_0013165 3300041999 Bacteria 1816
2439 Ga0439442_031902 3300042002 Bacteria 1101
2440 Ga0439445_0001711 3300042004 Bacteria 4821
2441 Ga0439445_0003170 3300042004 Bacteria 3685
2442 Ga0439445_0034571 3300042004 Bacteria 1325
2443 Ga0439448_0001040 3300042005 Bacteria 6941
2444 Ga0439448_0063792 3300042005 Bacteria 1221
2445 Ga0439448_0117717 3300042005 Bacteria 910
2446 Ga0439432_005986 3300042006 Bacteria 4363
2447 Ga0439432_010297 3300042006 Bacteria 3243
2448 Ga0439449_0002305 3300042007 Bacteria 7473
2449 Ga0439449_0006857 3300042007 Bacteria 4341
2450 Ga0439449_0008391 3300042007 Bacteria 3927
2451 Ga0439449_0012119 3300042007 Bacteria 3240
2452 Ga0439449_0059627 3300042007 Bacteria 1409
2453 Ga0439449_0144178 3300042007 Bacteria 887
2454 Ga0439452_010388 3300042010 Bacteria 2709
2455 Ga0439452_020072 3300042010 Bacteria 1757
2456 Ga0439452_028931 3300042010 Bacteria 1378
2457 Ga0439454_031026 3300042011 Bacteria 838
2458 Ga0439455_0005674 3300042012 Bacteria 2549
2459 Ga0439455_0024449 3300042012 Bacteria 1461
2460 Ga0450911_001203 3300042115 Bacteria 6315
2461 Ga0450919_000204 3300042121 Bacteria 6554
2462 Ga0450920_000570 3300042122 Bacteria 5865
2463 Ga0450920_008268 3300042122 Bacteria 1900
2464 Ga0450921_001349 3300042123 Bacteria 1464
2465 Ga0450921_002858 3300042123 Bacteria 1180
2466 Ga0450923_004529 3300042125 Bacteria 2185
2467 Ga0450923_041005 3300042125 Bacteria 973
2468 Ga0450890_000883 3300042127 Bacteria 4345
2469 Ga0450891_000057 3300042129 Bacteria 8862
2470 Ga0450892_000259 3300042130 Bacteria 6316
2471 Ga0450895_005337 3300042132 Bacteria 1034
2472 Ga0450896_005860 3300042133 Bacteria 1681
2473 Ga0450896_019530 3300042133 Bacteria 987
2474 Ga0450904_001503 3300042139 Bacteria 3217
2475 Ga0450904_002138 3300042139 Bacteria 2448
2476 Ga0450905_023289 3300042142 Bacteria 924
2477 Ga0450906_003636 3300042145 Bacteria 3292
2478 Ga0439446_0032801 3300042156 Bacteria 1508
2479 Ga0439446_0083216 3300042156 Bacteria 994
2480 Ga0439458_0024362 3300042157 Bacteria 1415
2481 Ga0439458_0027720 3300042157 Bacteria 1337
2482 Ga0439458_0096294 3300042157 Bacteria 765
2483 Ga0450908_006323 3300042184 Bacteria 2253
2484 Ga0450909_005867 3300042185 Bacteria 1771
2485 Ga0439434_0011201 3300042435 Bacteria 2648
2486 Ga0439444_0010546 3300042437 Bacteria 1478
2487 Ga0439459_0005142 3300042438 Bacteria 2136
2488 Ga0439460_0006240 3300042461 Bacteria 2951
2489 Ga0450918_000638 3300042531 Bacteria 7508
2490 Ga0450918_001428 3300042531 Bacteria 4750
2491 Ga0450918_013913 3300042531 Bacteria 1399
2492 Ga0450893_0002829 3300042532 Bacteria 2721
2493 Ga0450893_0020269 3300042532 Bacteria 1141
2494 Ga0450901_008036 3300042533 Bacteria 1086
2495 Ga0451577_0018616 3300042876 Bacteria 6395
2496 Ga0451577_0022858 3300042876 Bacteria 5707
2497 Ga0451577_0034775 3300042876 Bacteria 4541
2498 Ga0451577_0040268 3300042876 Bacteria 4196
2499 Ga0451577_0080236 3300042876 Bacteria 2909
2500 Ga0451577_0095880 3300042876 Bacteria 2649
2501 Ga0451577_0108531 3300042876 Bacteria 2481
2502 Ga0451577_0143622 3300042876 Bacteria 2145
2503 Ga0451577_0165901 3300042876 Bacteria 1990
2504 Ga0451577_0171958 3300042876 Bacteria 1952
2505 Ga0466969_0000859 3300044656 Bacteria 16462
2506 Ga0466969_0005824 3300044656 Bacteria 6549
2507 Ga0466969_0007725 3300044656 Bacteria 5717
2508 Ga0466969_0010294 3300044656 Bacteria 4960
2509 Ga0466969_0013172 3300044656 Bacteria 4357
2510 Ga0466969_0019552 3300044656 Bacteria 3519
2511 Ga0466969_0131324 3300044656 Bacteria 1161
2512 Ga0466972_0005095 3300044658 Bacteria 6583
2513 Ga0466972_0042445 3300044658 Bacteria 2211
2514 Ga0466972_0094195 3300044658 Bacteria 1419
2515 Ga0466973_0018308 3300044659 Bacteria 6675
2516 Ga0466977_0012392 3300044666 Bacteria 4967
2517 Ga0453683_0196790 3300044673 Bacteria 1280
2518 Ga0466965_0002098 3300044683 Bacteria 8364
2519 Ga0466965_0003067 3300044683 Bacteria 7277
2520 Ga0466965_0003272 3300044683 Bacteria 7086
2521 Ga0466965_0024466 3300044683 Bacteria 2921
2522 Ga0466965_0111141 3300044683 Bacteria 1408
2523 Ga0466965_0111530 3300044683 Bacteria 1406
2524 Ga0466965_0162500 3300044683 Bacteria 1171
2525 Ga0466966_0007868 3300044684 Bacteria 7055
2526 Ga0466966_0028392 3300044684 Bacteria 3644
2527 Ga0466966_0039346 3300044684 Bacteria 3045
2528 Ga0466966_0046057 3300044684 Bacteria 2786
2529 Ga0466966_0108486 3300044684 Bacteria 1712
2530 Ga0466966_0175797 3300044684 Bacteria 1300
2531 Ga0466966_0250641 3300044684 Bacteria 1066
2532 Ga0466966_0266667 3300044684 Bacteria 1031
2533 Ga0466966_0353777 3300044684 Bacteria 882
2534 Ga0466966_0415892 3300044684 Bacteria 808
2535 Ga0466961_0027751 3300044693 Bacteria 3641
2536 Ga0466961_0037792 3300044693 Bacteria 3096
2537 Ga0466961_0039006 3300044693 Bacteria 3045
2538 Ga0466961_0052166 3300044693 Bacteria 2610
2539 Ga0466961_0057220 3300044693 Bacteria 2482
2540 Ga0466961_0104296 3300044693 Bacteria 1785
2541 Ga0466963_0009556 3300044694 Bacteria 5842
2542 Ga0466963_0039053 3300044694 Bacteria 3107
2543 Ga0466963_0122706 3300044694 Bacteria 1789
2544 Ga0466963_0214722 3300044694 Bacteria 1347
2545 Ga0466964_0003612 3300044706 Bacteria 5653
2546 Ga0466964_0003855 3300044706 Bacteria 5505
2547 Ga0466964_0048520 3300044706 Bacteria 1736
2548 Ga0453684_0010662 3300044712 Bacteria 15649
2549 Ga0453684_0060229 3300044712 Bacteria 4886
2550 Ga0453684_0065899 3300044712 Bacteria 4615
2551 Ga0453684_0067677 3300044712 Bacteria 4540
2552 Ga0453684_0135701 3300044712 Bacteria 2946
2553 Ga0453684_0153086 3300044712 Bacteria 2737
2554 Ga0453684_0162566 3300044712 Bacteria 2639
2555 Ga0453684_0175065 3300044712 Bacteria 2525
2556 Ga0453684_0211925 3300044712 Bacteria 2251
2557 Ga0453684_0251065 3300044712 Bacteria 2031
2558 Ga0453684_0386267 3300044712 Bacteria 1571
2559 Ga0453684_0404442 3300044712 Bacteria 1528
2560 Ga0453684_0771485 3300044712 Bacteria 1039
2561 Ga0453684_0792490 3300044712 Bacteria 1022
2562 Ga0466971_0003236 3300044719 Bacteria 6953
2563 Ga0466971_0011241 3300044719 Bacteria 3921
2564 Ga0466971_0148255 3300044719 Bacteria 1094
2565 Ga0466971_0176954 3300044719 Bacteria 1002
2566 Ga0466968_0004267 3300044735 Bacteria 5334
2567 Ga0466968_0025947 3300044735 Bacteria 2402
2568 Ga0466968_0079539 3300044735 Bacteria 1438
2569 Ga0466968_0140572 3300044735 Bacteria 1104
2570 Ga0466970_0010068 3300044765 Bacteria 4790
2571 Ga0466970_0107948 3300044765 Bacteria 1519
2572 Ga0466970_0121056 3300044765 Bacteria 1433
2573 Ga0466970_0163880 3300044765 Bacteria 1230
2574 Ga0466957_0014157 3300044842 Bacteria 4641
2575 Ga0466957_0021202 3300044842 Bacteria 3827
2576 Ga0466957_0125045 3300044842 Bacteria 1642
2577 Ga0466957_0157332 3300044842 Bacteria 1474
2578 Ga0466957_0262336 3300044842 Bacteria 1151
2579 Ga0466957_0361593 3300044842 Bacteria 986
2580 Ga0466957_0378773 3300044842 Bacteria 964
2581 Ga0466960_0010183 3300044901 Bacteria 3901
2582 Ga0466960_0022858 3300044901 Bacteria 2800
2583 Ga0466960_0040184 3300044901 Bacteria 2210
2584 Ga0466960_0048640 3300044901 Bacteria 2038
2585 Ga0466960_0113226 3300044901 Bacteria 1412
2586 Ga0466960_0277730 3300044901 Bacteria 938
2587 Ga0466960_0427517 3300044901 Bacteria 766
2588 Ga0466959_0006647 3300045049 Bacteria 8035
2589 Ga0466959_0009161 3300045049 Bacteria 7029
2590 Ga0466959_0013561 3300045049 Bacteria 5908
2591 Ga0466959_0024121 3300045049 Bacteria 4503
2592 Ga0466959_0074239 3300045049 Bacteria 2459
2593 Ga0466959_0219086 3300045049 Bacteria 1320
2594 Ga0466959_0370416 3300045049 Bacteria 975
2595 Ga0451576_0000741 3300045051 Bacteria 65303
2596 Ga0451576_0003062 3300045051 Bacteria 23512
2597 Ga0451576_0020903 3300045051 Bacteria 7123
2598 Ga0451576_0025541 3300045051 Bacteria 6363
2599 Ga0451576_0031250 3300045051 Bacteria 5680
2600 Ga0451576_0031555 3300045051 Bacteria 5647
2601 Ga0451576_0076746 3300045051 Bacteria 3477
2602 Ga0451576_1038278 3300045051 Bacteria 859
2603 Ga0466958_0002024 3300045836 Bacteria 9996
2604 Ga0466958_0009193 3300045836 Bacteria 5497
2605 Ga0466958_0021653 3300045836 Bacteria 3759
2606 Ga0466958_0034070 3300045836 Bacteria 3036
2607 Ga0466967_0474047 3300045976 Bacteria 1225
2608 Ga0466967_0549631 3300045976 Bacteria 1136
2609 Ga0495617_001026 3300046452 Bacteria 12853
2610 Ga0495617_001948 3300046452 Bacteria 8651
2611 Ga0495617_004204 3300046452 Bacteria 5264
2612 Ga0495617_075029 3300046452 Bacteria 1110
2613 Ga0495627_000182 3300046453 Bacteria 70385
2614 Ga0495627_005010 3300046453 Bacteria 5423
2615 Ga0495627_050205 3300046453 Bacteria 1257
2616 Ga0495592_0017503 3300046454 Bacteria 5444
2617 Ga0495592_0017992 3300046454 Bacteria 5368
2618 Ga0495592_0036070 3300046454 Bacteria 3724
2619 Ga0495592_0056442 3300046454 Bacteria 2902
2620 Ga0495592_0081418 3300046454 Bacteria 2340
2621 Ga0495603_0002356 3300046455 Bacteria 11090
2622 Ga0495603_0007446 3300046455 Bacteria 6583
2623 Ga0495603_0025195 3300046455 Bacteria 3597
2624 Ga0495603_0042696 3300046455 Bacteria 2710
2625 Ga0495603_0046431 3300046455 Bacteria 2588
2626 Ga0495603_0136477 3300046455 Bacteria 1427
2627 Ga0495590_0000020 3300046457 Bacteria 212352
2628 Ga0495590_0005309 3300046457 Bacteria 5113
2629 Ga0495591_004568 3300046458 Bacteria 6709
2630 Ga0495591_007415 3300046458 Bacteria 4665
2631 Ga0495591_007919 3300046458 Bacteria 4430
2632 Ga0495591_008200 3300046458 Bacteria 4305
2633 Ga0495591_056370 3300046458 Bacteria 1056
2634 Ga0495629_0006590 3300046459 Bacteria 8601
2635 Ga0495629_0025297 3300046459 Bacteria 4221
2636 Ga0495629_0026766 3300046459 Bacteria 4095
2637 Ga0495629_0028245 3300046459 Bacteria 3982
2638 Ga0495629_0047753 3300046459 Bacteria 3002
2639 Ga0495629_0123766 3300046459 Bacteria 1801
2640 Ga0495629_0124917 3300046459 Bacteria 1793
2641 Ga0495629_0179547 3300046459 Bacteria 1467
2642 Ga0495638_0010010 3300046460 Bacteria 6610
2643 Ga0495638_0010721 3300046460 Bacteria 6343
2644 Ga0495638_0029373 3300046460 Bacteria 3545
2645 Ga0495638_0032034 3300046460 Bacteria 3373
2646 Ga0495638_0036071 3300046460 Bacteria 3151
2647 Ga0495638_0042928 3300046460 Bacteria 2855
2648 Ga0495638_0112063 3300046460 Bacteria 1619
2649 Ga0495638_0233293 3300046460 Bacteria 1022
2650 Ga0495641_0034399 3300046461 Bacteria 2395
2651 Ga0495651_0000262 3300046462 Bacteria 41024
2652 Ga0495651_0012535 3300046462 Bacteria 6540
2653 Ga0495651_0363312 3300046462 Bacteria 953
2654 Ga0495651_0405697 3300046462 Bacteria 889
2655 Ga0495653_0003544 3300046463 Bacteria 12573
2656 Ga0495653_0006482 3300046463 Bacteria 9597
2657 Ga0495653_0025764 3300046463 Bacteria 4718
2658 Ga0495653_0042103 3300046463 Bacteria 3559
2659 Ga0495653_0060701 3300046463 Bacteria 2863
2660 Ga0495653_0067768 3300046463 Bacteria 2678
2661 Ga0495653_0155740 3300046463 Bacteria 1591
2662 Ga0495653_0401414 3300046463 Bacteria 871
2663 Ga0495650_0004288 3300046471 Bacteria 9846
2664 Ga0495650_0004799 3300046471 Bacteria 9068
2665 Ga0495650_0008022 3300046471 Bacteria 6240
2666 Ga0495650_0009500 3300046471 Bacteria 5522
2667 Ga0495650_0010515 3300046471 Bacteria 5156
2668 Ga0495650_0017326 3300046471 Bacteria 3614
2669 Ga0495650_0017475 3300046471 Bacteria 3595
2670 Ga0495650_0017995 3300046471 Bacteria 3525
2671 Ga0495650_0039990 3300046471 Bacteria 2018
2672 Ga0495650_0071140 3300046471 Bacteria 1364
2673 Ga0495650_0082680 3300046471 Bacteria 1235
2674 Ga0495580_0002666 3300046472 Bacteria 15486
2675 Ga0495580_0008648 3300046472 Bacteria 8072
2676 Ga0495580_0009966 3300046472 Bacteria 7430
2677 Ga0495580_0024354 3300046472 Bacteria 4433
2678 Ga0495580_0047362 3300046472 Bacteria 3047
2679 Ga0495580_0051891 3300046472 Bacteria 2898
2680 Ga0495580_0267421 3300046472 Bacteria 1168
2681 Ga0495580_0396087 3300046472 Bacteria 931
2682 Ga0495582_0013331 3300046473 Bacteria 4524
2683 Ga0495582_0018313 3300046473 Bacteria 3831
2684 Ga0495582_0021204 3300046473 Bacteria 3557
2685 Ga0495582_0057328 3300046473 Bacteria 2147
2686 Ga0495582_0152636 3300046473 Bacteria 1312
2687 Ga0495605_0002653 3300046474 Bacteria 10946
2688 Ga0495605_0003232 3300046474 Bacteria 9782
2689 Ga0495605_0003346 3300046474 Bacteria 9586
2690 Ga0495605_0008384 3300046474 Bacteria 5844
2691 Ga0495605_0013410 3300046474 Bacteria 4516
2692 Ga0495605_0013696 3300046474 Bacteria 4456
2693 Ga0495605_0016298 3300046474 Bacteria 4024
2694 Ga0495605_0017644 3300046474 Bacteria 3839
2695 Ga0495605_0021467 3300046474 Bacteria 3420
2696 Ga0495605_0127367 3300046474 Bacteria 1150
2697 Ga0495639_0024830 3300046475 Bacteria 2639
2698 Ga0495639_0124777 3300046475 Bacteria 1230
2699 Ga0495662_0108904 3300046476 Bacteria 1357
2700 Ga0495662_0244700 3300046476 Bacteria 883
2701 Ga0495664_0017670 3300046477 Bacteria 4078
2702 Ga0495664_0079473 3300046477 Bacteria 1965
2703 Ga0495584_0002812 3300046491 Bacteria 9712
2704 Ga0495584_0007925 3300046491 Bacteria 5523
2705 Ga0495584_0011818 3300046491 Bacteria 4463
2706 Ga0495584_0018163 3300046491 Bacteria 3575
2707 Ga0495584_0020283 3300046491 Bacteria 3378
2708 Ga0495584_0028642 3300046491 Bacteria 2823
2709 Ga0495584_0031277 3300046491 Bacteria 2694
2710 Ga0495584_0172216 3300046491 Bacteria 1100
2711 Ga0495585_0012012 3300046492 Bacteria 5110
2712 Ga0495585_0015837 3300046492 Bacteria 4377
2713 Ga0495585_0020976 3300046492 Bacteria 3752
2714 Ga0495585_0035023 3300046492 Bacteria 2839
2715 Ga0495585_0060098 3300046492 Bacteria 2092
2716 Ga0495585_0086385 3300046492 Bacteria 1694
2717 Ga0495594_0031927 3300046499 Bacteria 2857
2718 Ga0495594_0141860 3300046499 Bacteria 1363
2719 Ga0495594_0180907 3300046499 Bacteria 1200
2720 Ga0495596_0005141 3300046500 Bacteria 6230
2721 Ga0495596_0005175 3300046500 Bacteria 6209
2722 Ga0495596_0011320 3300046500 Bacteria 3852
2723 Ga0495596_0016679 3300046500 Bacteria 3048
2724 Ga0495596_0021654 3300046500 Bacteria 2621
2725 Ga0495596_0024896 3300046500 Bacteria 2421
2726 Ga0495596_0079213 3300046500 Bacteria 1275
2727 Ga0495596_0097094 3300046500 Bacteria 1144
2728 Ga0495596_0196920 3300046500 Bacteria 783
2729 Ga0495607_0004301 3300046501 Bacteria 10512
2730 Ga0495607_0006925 3300046501 Bacteria 7904
2731 Ga0495607_0013138 3300046501 Bacteria 5436
2732 Ga0495607_0015517 3300046501 Bacteria 4935
2733 Ga0495607_0020526 3300046501 Bacteria 4175
2734 Ga0495607_0038288 3300046501 Bacteria 2873
2735 Ga0495607_0045652 3300046501 Bacteria 2575
2736 Ga0495607_0071401 3300046501 Bacteria 1936
2737 Ga0495607_0077195 3300046501 Bacteria 1840
2738 Ga0495607_0255605 3300046501 Bacteria 841
2739 Ga0495583_0000310 3300046506 Bacteria 77200
2740 Ga0495583_0000517 3300046506 Bacteria 55159
2741 Ga0495583_0006309 3300046506 Bacteria 7786
2742 Ga0495583_0008161 3300046506 Bacteria 6441
2743 Ga0495583_0008580 3300046506 Bacteria 6225
2744 Ga0495583_0008959 3300046506 Bacteria 6037
2745 Ga0495583_0013755 3300046506 Bacteria 4495
2746 Ga0495583_0014761 3300046506 Bacteria 4287
2747 Ga0495583_0022711 3300046506 Bacteria 3192
2748 Ga0495583_0028893 3300046506 Bacteria 2719
2749 Ga0495583_0040027 3300046506 Bacteria 2204
2750 Ga0495583_0115709 3300046506 Bacteria 1133
2751 Ga0495606_0000600 3300046507 Bacteria 57013
2752 Ga0495606_0007181 3300046507 Bacteria 10052
2753 Ga0495606_0013036 3300046507 Bacteria 6605
2754 Ga0495606_0018493 3300046507 Bacteria 5221
2755 Ga0495606_0019502 3300046507 Bacteria 5042
2756 Ga0495606_0020178 3300046507 Bacteria 4925
2757 Ga0495606_0023944 3300046507 Bacteria 4412
2758 Ga0495606_0039988 3300046507 Bacteria 3154
2759 Ga0495606_0065259 3300046507 Bacteria 2313
2760 Ga0495606_0075642 3300046507 Bacteria 2106
2761 Ga0495606_0111727 3300046507 Bacteria 1647
2762 Ga0495606_0121584 3300046507 Bacteria 1562
2763 Ga0495606_0134123 3300046507 Bacteria 1468
2764 Ga0495608_0007277 3300046511 Bacteria 7825
2765 Ga0495608_0018080 3300046511 Bacteria 4870
2766 Ga0495608_0064168 3300046511 Bacteria 2408
2767 Ga0495608_0072568 3300046511 Bacteria 2245
2768 Ga0495610_0003877 3300046512 Bacteria 11361
2769 Ga0495610_0009271 3300046512 Bacteria 6237
2770 Ga0495610_0010097 3300046512 Bacteria 5895
2771 Ga0495610_0020302 3300046512 Bacteria 3691
2772 Ga0495610_0023962 3300046512 Bacteria 3303
2773 Ga0495610_0027750 3300046512 Bacteria 3003
2774 Ga0495610_0029280 3300046512 Bacteria 2902
2775 Ga0495610_0049149 3300046512 Bacteria 2066
2776 Ga0495610_0062659 3300046512 Bacteria 1763
2777 Ga0495610_0149401 3300046512 Bacteria 998
2778 Ga0495610_0167808 3300046512 Bacteria 923
2779 Ga0495616_0001374 3300046513 Bacteria 16949
2780 Ga0495616_0002539 3300046513 Bacteria 12051
2781 Ga0495616_0020539 3300046513 Bacteria 3590
2782 Ga0495616_0022828 3300046513 Bacteria 3374
2783 Ga0495616_0033072 3300046513 Bacteria 2697
2784 Ga0495616_0040238 3300046513 Bacteria 2389
2785 Ga0495616_0047106 3300046513 Bacteria 2172
2786 Ga0495616_0053842 3300046513 Bacteria 1998
2787 Ga0495618_0009815 3300046514 Bacteria 5789
2788 Ga0495618_0015048 3300046514 Bacteria 4718
2789 Ga0495618_0075097 3300046514 Bacteria 2153
2790 Ga0495618_0210642 3300046514 Bacteria 1228
2791 Ga0495620_0011229 3300046515 Bacteria 4681
2792 Ga0495620_0012783 3300046515 Bacteria 4319
2793 Ga0495620_0012958 3300046515 Bacteria 4284
2794 Ga0495620_0136758 3300046515 Bacteria 959
2795 Ga0495628_0009854 3300046516 Bacteria 8139
2796 Ga0495628_0015894 3300046516 Bacteria 6281
2797 Ga0495628_0030115 3300046516 Bacteria 4395
2798 Ga0495628_0059703 3300046516 Bacteria 2993
2799 Ga0495628_0117062 3300046516 Bacteria 2046
2800 Ga0495628_0126383 3300046516 Bacteria 1959
2801 Ga0495628_0173274 3300046516 Bacteria 1635
2802 Ga0495628_0296058 3300046516 Bacteria 1199
2803 Ga0495628_0364392 3300046516 Bacteria 1060
2804 Ga0495630_0001591 3300046517 Bacteria 15790
2805 Ga0495630_0020703 3300046517 Bacteria 4852
2806 Ga0495630_0021769 3300046517 Bacteria 4735
2807 Ga0495630_0069269 3300046517 Bacteria 2653
2808 Ga0495630_0375755 3300046517 Bacteria 1088
2809 Ga0495631_0000496 3300046518 Bacteria 26216
2810 Ga0495632_0024421 3300046519 Bacteria 3210
2811 Ga0495632_0033158 3300046519 Bacteria 2653
2812 Ga0495632_0045773 3300046519 Bacteria 2178
2813 Ga0495637_0001714 3300046520 Bacteria 12614
2814 Ga0495637_0013614 3300046520 Bacteria 3857
2815 Ga0495637_0032333 3300046520 Bacteria 2305
2816 Ga0495637_0125980 3300046520 Bacteria 982
2817 Ga0495643_0010644 3300046522 Bacteria 5651
2818 Ga0495643_0013033 3300046522 Bacteria 4994
2819 Ga0495643_0023583 3300046522 Bacteria 3497
2820 Ga0495643_0031793 3300046522 Bacteria 2934
2821 Ga0495643_0032093 3300046522 Bacteria 2917
2822 Ga0495643_0036366 3300046522 Bacteria 2705
2823 Ga0495643_0037230 3300046522 Bacteria 2670
2824 Ga0495643_0039034 3300046522 Bacteria 2598
2825 Ga0495643_0042163 3300046522 Bacteria 2486
2826 Ga0495644_0009868 3300046523 Bacteria 3675
2827 Ga0495644_0057810 3300046523 Bacteria 1458
2828 Ga0495644_0104124 3300046523 Bacteria 1074
2829 Ga0495644_0111588 3300046523 Bacteria 1037
2830 Ga0495648_0013276 3300046524 Bacteria 6100
2831 Ga0495648_0014819 3300046524 Bacteria 5680
2832 Ga0495648_0034037 3300046524 Bacteria 3321
2833 Ga0495648_0042742 3300046524 Bacteria 2848
2834 Ga0495648_0049584 3300046524 Bacteria 2572
2835 Ga0495648_0053446 3300046524 Bacteria 2447
2836 Ga0495648_0108321 3300046524 Bacteria 1517
2837 Ga0495648_0202150 3300046524 Bacteria 993
2838 Ga0495648_0315751 3300046524 Bacteria 726
2839 Ga0495663_0002005 3300046525 Bacteria 6261
2840 Ga0495663_0026187 3300046525 Bacteria 1706
2841 Ga0495663_0033047 3300046525 Bacteria 1543
2842 Ga0495663_0051515 3300046525 Bacteria 1276
2843 Ga0495663_0055830 3300046525 Bacteria 1232
2844 Ga0495666_0003087 3300046526 Bacteria 8370
2845 Ga0495666_0012848 3300046526 Bacteria 4173
2846 Ga0495666_0014922 3300046526 Bacteria 3867
2847 Ga0495666_0030164 3300046526 Bacteria 2663
2848 Ga0495642_0004349 3300046528 Bacteria 5500
2849 Ga0495642_0015953 3300046528 Bacteria 2924
2850 Ga0495642_0021122 3300046528 Bacteria 2559
2851 Ga0495642_0045877 3300046528 Bacteria 1786
2852 Ga0495642_0127470 3300046528 Bacteria 1094
2853 Ga0495642_0143355 3300046528 Bacteria 1032
2854 Ga0495652_0019580 3300046529 Bacteria 6025
2855 Ga0495652_0022553 3300046529 Bacteria 5585
2856 Ga0495652_0073582 3300046529 Bacteria 2845
2857 Ga0495652_0075882 3300046529 Bacteria 2790
2858 Ga0495652_0122940 3300046529 Bacteria 2066
2859 Ga0495654_0000115 3300046530 Bacteria 91440
2860 Ga0495654_0022442 3300046530 Bacteria 3277
2861 Ga0495654_0039369 3300046530 Bacteria 2360
2862 Ga0495654_0044431 3300046530 Bacteria 2197
2863 Ga0495654_0058914 3300046530 Bacteria 1851
2864 Ga0495665_0005644 3300046531 Bacteria 6749
2865 Ga0495665_0031552 3300046531 Bacteria 2835
2866 Ga0495665_0058850 3300046531 Bacteria 2028
2867 Ga0495665_0085709 3300046531 Bacteria 1655
2868 Ga0495640_0007216 3300046533 Bacteria 8751
2869 Ga0495640_0035349 3300046533 Bacteria 3536
2870 Ga0495640_0038635 3300046533 Bacteria 3356
2871 Ga0495640_0049724 3300046533 Bacteria 2889
2872 Ga0495640_0172376 3300046533 Bacteria 1382
2873 Ga0495586_0017712 3300046535 Bacteria 3789
2874 Ga0495586_0027002 3300046535 Bacteria 3072
2875 Ga0495586_0027185 3300046535 Bacteria 3061
2876 Ga0495586_0035595 3300046535 Bacteria 2675
2877 Ga0495586_0079643 3300046535 Bacteria 1799
2878 Ga0495586_0084971 3300046535 Bacteria 1743
2879 Ga0495586_0213591 3300046535 Bacteria 1095
2880 Ga0495587_0012352 3300046536 Bacteria 5379
2881 Ga0495587_0015602 3300046536 Bacteria 4739
2882 Ga0495587_0052325 3300046536 Bacteria 2409
2883 Ga0495587_0096951 3300046536 Bacteria 1700
2884 Ga0495587_0124547 3300046536 Bacteria 1475
2885 Ga0495598_0001815 3300046537 Bacteria 4295
2886 Ga0495598_0004279 3300046537 Bacteria 3081
2887 Ga0495609_0002112 3300046538 Bacteria 12496
2888 Ga0495609_0003741 3300046538 Bacteria 8588
2889 Ga0495609_0005231 3300046538 Bacteria 6903
2890 Ga0495609_0006941 3300046538 Bacteria 5715
2891 Ga0495609_0007322 3300046538 Bacteria 5523
2892 Ga0495609_0009863 3300046538 Bacteria 4604
2893 Ga0495609_0010454 3300046538 Bacteria 4448
2894 Ga0495609_0010718 3300046538 Bacteria 4385
2895 Ga0495609_0023809 3300046538 Bacteria 2811
2896 Ga0495609_0024419 3300046538 Bacteria 2773
2897 Ga0495609_0040698 3300046538 Bacteria 2090
2898 Ga0495621_0001211 3300046539 Bacteria 6643
2899 Ga0495621_0023035 3300046539 Bacteria 2069
2900 Ga0495621_0050264 3300046539 Bacteria 1490
2901 Ga0495621_0195584 3300046539 Bacteria 812
2902 Ga0495597_0000060 3300046542 Bacteria 92172
2903 Ga0495597_0007608 3300046542 Bacteria 5483
2904 Ga0495597_0008648 3300046542 Bacteria 5090
2905 Ga0495597_0009678 3300046542 Bacteria 4749
2906 Ga0495597_0012910 3300046542 Bacteria 4016
2907 Ga0495597_0014560 3300046542 Bacteria 3741
2908 Ga0495597_0016240 3300046542 Bacteria 3517
2909 Ga0495597_0017705 3300046542 Bacteria 3348
2910 Ga0495597_0097177 3300046542 Bacteria 1244
2911 Ga0495597_0168106 3300046542 Bacteria 891
2912 Ga0495645_0000876 3300046543 Bacteria 20530
2913 Ga0495645_0006837 3300046543 Bacteria 7926
2914 Ga0495645_0054356 3300046543 Bacteria 2909
2915 Ga0495645_0082400 3300046543 Bacteria 2307
2916 Ga0495645_0297605 3300046543 Bacteria 1055
2917 Ga0495645_0380367 3300046543 Bacteria 903
2918 Ga0495622_0010681 3300046557 Bacteria 4235
2919 Ga0495622_0011082 3300046557 Bacteria 4161
2920 Ga0495622_0031478 3300046557 Bacteria 2478
2921 Ga0495622_0046758 3300046557 Bacteria 2011
2922 Ga0495622_0078688 3300046557 Bacteria 1518
2923 Ga0495622_0092997 3300046557 Bacteria 1384
2924 Ga0495622_0129444 3300046557 Bacteria 1150
2925 Ga0495633_0007144 3300046558 Bacteria 6480
2926 Ga0495633_0016754 3300046558 Bacteria 3768
2927 Ga0495633_0035933 3300046558 Bacteria 2376
2928 Ga0495633_0077264 3300046558 Bacteria 1550
2929 Ga0495633_0150457 3300046558 Bacteria 1075
2930 Ga0495633_0152692 3300046558 Bacteria 1066
2931 Ga0495667_0024516 3300046559 Bacteria 4062
2932 Ga0495667_0036408 3300046559 Bacteria 3285
2933 Ga0495667_0324928 3300046559 Bacteria 973
2934 Ga0495656_0006272 3300046615 Bacteria 4164
2935 Ga0495656_0006613 3300046615 Bacteria 4069
2936 Ga0495656_0011224 3300046615 Bacteria 3285
2937 Ga0495656_0017118 3300046615 Bacteria 2761
2938 Ga0495656_0032400 3300046615 Bacteria 2126
2939 Ga0495656_0084401 3300046615 Bacteria 1440
2940 Ga0495656_0086999 3300046615 Bacteria 1422
2941 Ga0495656_0222821 3300046615 Bacteria 943
2942 Ga0495656_0308816 3300046615 Bacteria 812
2943 Ga0495668_0007707 3300046616 Bacteria 6842
2944 Ga0495668_0012732 3300046616 Bacteria 4983
2945 Ga0495668_0019984 3300046616 Bacteria 3852
2946 Ga0495668_0020876 3300046616 Bacteria 3761
2947 Ga0495668_0025580 3300046616 Bacteria 3353
2948 Ga0495668_0028258 3300046616 Bacteria 3172
2949 Ga0495668_0035408 3300046616 Bacteria 2798
2950 Ga0495668_0094506 3300046616 Bacteria 1636
2951 Ga0495634_0018015 3300046642 Bacteria 5032
2952 Ga0495634_0019079 3300046642 Bacteria 4874
2953 Ga0495634_0065165 3300046642 Bacteria 2415
2954 Ga0495634_0162625 3300046642 Bacteria 1406
2955 Ga0495634_0203111 3300046642 Bacteria 1230
2956 Ga0495611_0013452 3300046648 Bacteria 3484
2957 Ga0495611_0023806 3300046648 Bacteria 2659
2958 Ga0495611_0026624 3300046648 Bacteria 2523
2959 Ga0495611_0035256 3300046648 Bacteria 2215
2960 Ga0495611_0103487 3300046648 Bacteria 1323
2961 Ga0495611_0103893 3300046648 Bacteria 1321
2962 Ga0495611_0129066 3300046648 Bacteria 1179
2963 Ga0495611_0269165 3300046648 Bacteria 788
2964 Ga0495625_0017817 3300046660 Bacteria 5551
2965 Ga0495625_0020104 3300046660 Bacteria 5160
2966 Ga0495625_0022675 3300046660 Bacteria 4809
2967 Ga0495625_0022811 3300046660 Bacteria 4791
2968 Ga0495625_0026926 3300046660 Bacteria 4335
2969 Ga0495625_0033113 3300046660 Bacteria 3824
2970 Ga0495625_0038358 3300046660 Bacteria 3508
2971 Ga0495625_0044283 3300046660 Bacteria 3223
2972 Ga0495625_0093155 3300046660 Bacteria 2080
2973 Ga0495625_0228704 3300046660 Bacteria 1215
2974 Ga0495625_0323500 3300046660 Bacteria 981
2975 Ga0495635_0014432 3300046663 Bacteria 5526
2976 Ga0495635_0016191 3300046663 Bacteria 5204
2977 Ga0495635_0049363 3300046663 Bacteria 2900
2978 Ga0495659_0012574 3300046664 Bacteria 2744
2979 Ga0495659_0014643 3300046664 Bacteria 2570
2980 Ga0495661_0010615 3300046665 Bacteria 6280
2981 Ga0495661_0010669 3300046665 Bacteria 6258
2982 Ga0495661_0011570 3300046665 Bacteria 5982
2983 Ga0495661_0013210 3300046665 Bacteria 5553
2984 Ga0495661_0013697 3300046665 Bacteria 5442
2985 Ga0495661_0018478 3300046665 Bacteria 4584
2986 Ga0495661_0019336 3300046665 Bacteria 4465
2987 Ga0495661_0022427 3300046665 Bacteria 4107
2988 Ga0495661_0024058 3300046665 Bacteria 3945
2989 Ga0495661_0037189 3300046665 Bacteria 3040
2990 Ga0495661_0049136 3300046665 Bacteria 2559
2991 Ga0495661_0311011 3300046665 Bacteria 785
2992 Ga0495588_0010876 3300046674 Bacteria 4252
2993 Ga0495588_0039051 3300046674 Bacteria 2417
2994 Ga0495588_0084039 3300046674 Bacteria 1663
2995 Ga0495588_0108226 3300046674 Bacteria 1463
2996 Ga0495588_0144360 3300046674 Bacteria 1257
2997 Ga0495588_0356894 3300046674 Bacteria 768
2998 Ga0495657_0024064 3300046675 Bacteria 4342
2999 Ga0495657_0038350 3300046675 Bacteria 3298
3000 Ga0495657_0082039 3300046675 Bacteria 2084
3001 Ga0495599_0018423 3300046678 Bacteria 4350
3002 Ga0495599_0039843 3300046678 Bacteria 2951
3003 Ga0495599_0080121 3300046678 Bacteria 2039
3004 Ga0495599_0103472 3300046678 Bacteria 1774
3005 Ga0495599_0335749 3300046678 Bacteria 908
3006 Ga0495623_0023807 3300046679 Bacteria 3950
3007 Ga0495623_0149049 3300046679 Bacteria 1384
3008 Ga0495623_0211305 3300046679 Bacteria 1110
3009 Ga0495646_0016730 3300046680 Bacteria 4656
3010 Ga0495646_0052255 3300046680 Bacteria 2469
3011 Ga0495646_0061659 3300046680 Bacteria 2232
3012 Ga0495646_0251087 3300046680 Bacteria 947
3013 Ga0495647_0008534 3300046681 Bacteria 3446
3014 Ga0495658_0062255 3300046683 Bacteria 2144
3015 Ga0495658_0101065 3300046683 Bacteria 1721
3016 Ga0495658_0162966 3300046683 Bacteria 1376
3017 Ga0495658_0282610 3300046683 Bacteria 1047
3018 Ga0495669_0021103 3300046684 Bacteria 2824
3019 Ga0495669_0021848 3300046684 Bacteria 2780
3020 Ga0495669_0026297 3300046684 Bacteria 2543
3021 Ga0495669_0042853 3300046684 Bacteria 2013
3022 Ga0495669_0050421 3300046684 Bacteria 1866
3023 Ga0495669_0126004 3300046684 Bacteria 1203
3024 Ga0495613_0024317 3300046689 Bacteria 4512
3025 Ga0495613_0041905 3300046689 Bacteria 3388
3026 Ga0495613_0487358 3300046689 Bacteria 831
3027 Ga0495624_0011204 3300046690 Bacteria 6168
3028 Ga0495624_0163200 3300046690 Bacteria 1360
3029 Ga0495624_0177515 3300046690 Bacteria 1298
3030 Ga0495624_0219798 3300046690 Bacteria 1152
3031 Ga0495624_0283511 3300046690 Bacteria 1000
3032 Ga0495624_0318387 3300046690 Bacteria 937
3033 Ga0495670_0015440 3300046691 Bacteria 3752
3034 Ga0495670_0040136 3300046691 Bacteria 2334
3035 Ga0495670_0170528 3300046691 Bacteria 1146
3036 Ga0495671_0008146 3300046692 Bacteria 5913
3037 Ga0495671_0029072 3300046692 Bacteria 2841
3038 Ga0495671_0042709 3300046692 Bacteria 2277
3039 Ga0495671_0066286 3300046692 Bacteria 1777
3040 Ga0495671_0082798 3300046692 Bacteria 1572
3041 Ga0495671_0090741 3300046692 Bacteria 1495
3042 Ga0495671_0111330 3300046692 Bacteria 1337
3043 Ga0495649_0014801 3300046694 Bacteria 4457
3044 Ga0495649_0020320 3300046694 Bacteria 3726
3045 Ga0495649_0024341 3300046694 Bacteria 3376
3046 Ga0495649_0026348 3300046694 Bacteria 3233
3047 Ga0495649_0026842 3300046694 Bacteria 3198
3048 Ga0495649_0040459 3300046694 Bacteria 2553
3049 Ga0495649_0083596 3300046694 Bacteria 1705
3050 Ga0495649_0128855 3300046694 Bacteria 1335
3051 Ga0495589_0005345 3300046794 Bacteria 6776
3052 Ga0495589_0014565 3300046794 Bacteria 4046
3053 Ga0495589_0022141 3300046794 Bacteria 3245
3054 Ga0495589_0023941 3300046794 Bacteria 3106
3055 Ga0495589_0059302 3300046794 Bacteria 1881
3056 Ga0495600_0020912 3300046809 Bacteria 4187
3057 Ga0495600_0026041 3300046809 Bacteria 3772
3058 Ga0495600_0064540 3300046809 Bacteria 2393
3059 Ga0495600_0165931 3300046809 Bacteria 1426
3060 Ga0495660_0003674 3300046810 Bacteria 9441
3061 Ga0495660_0016570 3300046810 Bacteria 4248
3062 Ga0495660_0023488 3300046810 Bacteria 3516
3063 Ga0495660_0030863 3300046810 Bacteria 3017
3064 Ga0495660_0100634 3300046810 Bacteria 1488
3065 Ga0495660_0217380 3300046810 Bacteria 903
3066 Ga0495660_0238660 3300046810 Bacteria 848
3067 Ga0495581_0011795 3300047315 Bacteria 5059
3068 Ga0495581_0012682 3300047315 Bacteria 4882
3069 Ga0495581_0029554 3300047315 Bacteria 3176
3070 Ga0495581_0032726 3300047315 Bacteria 3010
3071 Ga0495581_0032971 3300047315 Bacteria 2998
3072 Ga0495581_0084242 3300047315 Bacteria 1842
3073 Ga0495604_0060131 3300047317 Bacteria 2910
3074 Ga0495604_0060212 3300047317 Bacteria 2908
3075 Ga0495604_0100103 3300047317 Bacteria 2131
3076 Ga0495604_0105415 3300047317 Bacteria 2063
3077 Ga0495604_0320725 3300047317 Bacteria 1035
3078 Ga0495604_0321765 3300047317 Bacteria 1033
3079 Ga0495636_0006088 3300047318 Bacteria 4736
3080 Ga0495636_0006698 3300047318 Bacteria 4530
3081 Ga0495636_0007040 3300047318 Bacteria 4424
3082 Ga0495636_0010004 3300047318 Bacteria 3738
3083 Ga0495636_0010674 3300047318 Bacteria 3630
3084 Ga0495636_0027217 3300047318 Bacteria 2329
3085 Ga0495636_0044352 3300047318 Bacteria 1851
3086 Ga0495674_0030234 3300047319 Bacteria 4926
3087 Ga0495674_0035014 3300047319 Bacteria 4533
3088 Ga0495674_0035609 3300047319 Bacteria 4489
3089 Ga0495674_0073837 3300047319 Bacteria 2938
3090 Ga0495674_0074547 3300047319 Bacteria 2922
3091 Ga0495674_0106813 3300047319 Bacteria 2376
3092 Ga0495674_0321555 3300047319 Bacteria 1260
3093 Ga0495672_0000201 3300047320 Bacteria 85476
3094 Ga0495672_0006232 3300047320 Bacteria 9300
3095 Ga0495672_0017725 3300047320 Bacteria 4753
3096 Ga0495672_0019097 3300047320 Bacteria 4531
3097 Ga0495672_0020418 3300047320 Bacteria 4343
3098 Ga0495672_0026706 3300047320 Bacteria 3679
3099 Ga0495672_0035703 3300047320 Bacteria 3060
3100 Ga0495672_0077299 3300047320 Bacteria 1866
3101 Ga0495672_0204111 3300047320 Bacteria 986
3102 Ga0495676_0028869 3300047321 Bacteria 4730
3103 Ga0495676_0040228 3300047321 Bacteria 3860
3104 Ga0495676_0046788 3300047321 Bacteria 3506
3105 Ga0495676_0063290 3300047321 Bacteria 2884
3106 Ga0495676_0130647 3300047321 Bacteria 1813
3107 Ga0495680_0039804 3300047322 Bacteria 3747
3108 Ga0495680_0052699 3300047322 Bacteria 3170
3109 Ga0495680_0057028 3300047322 Bacteria 3022
3110 Ga0495680_0058733 3300047322 Bacteria 2971
3111 Ga0495680_0082750 3300047322 Bacteria 2421
3112 Ga0495683_0007469 3300047323 Bacteria 5907
3113 Ga0495683_0010512 3300047323 Bacteria 4887
3114 Ga0495683_0025191 3300047323 Bacteria 3050
3115 Ga0495683_0026862 3300047323 Bacteria 2946
3116 Ga0495683_0027703 3300047323 Bacteria 2897
3117 Ga0495683_0032458 3300047323 Bacteria 2659
3118 Ga0495683_0041185 3300047323 Bacteria 2331
3119 Ga0495683_0095300 3300047323 Bacteria 1437
3120 Ga0495683_0137259 3300047323 Bacteria 1148
3121 Ga0495687_000370 3300047443 Bacteria 56035
3122 Ga0495687_004642 3300047443 Bacteria 9168
3123 Ga0495687_007822 3300047443 Bacteria 6222
3124 Ga0495687_014326 3300047443 Bacteria 4086
3125 Ga0495687_014570 3300047443 Bacteria 4039
3126 Ga0495687_018540 3300047443 Bacteria 3438
3127 Ga0495687_023948 3300047443 Bacteria 2910
3128 Ga0495687_024856 3300047443 Bacteria 2840
3129 Ga0495687_027249 3300047443 Bacteria 2676
3130 Ga0495687_033356 3300047443 Bacteria 2336
3131 Ga0495687_060018 3300047443 Bacteria 1570
3132 Ga0495687_076261 3300047443 Bacteria 1327
3133 Ga0495675_0000381 3300047444 Bacteria 30587
3134 Ga0495675_0016828 3300047444 Bacteria 4624
3135 Ga0495675_0027749 3300047444 Bacteria 3608
3136 Ga0495675_0040028 3300047444 Bacteria 2986
3137 Ga0495677_0006314 3300047445 Bacteria 4477
3138 Ga0495677_0006510 3300047445 Bacteria 4412
3139 Ga0495677_0010503 3300047445 Bacteria 3398
3140 Ga0495677_0014987 3300047445 Bacteria 2819
3141 Ga0495677_0016825 3300047445 Bacteria 2651
3142 Ga0495677_0031277 3300047445 Bacteria 1937
3143 Ga0495677_0105601 3300047445 Bacteria 1068
3144 Ga0495679_002067 3300047446 Bacteria 10601
3145 Ga0495679_005329 3300047446 Bacteria 5716
3146 Ga0495679_005684 3300047446 Bacteria 5498
3147 Ga0495679_006772 3300047446 Bacteria 4876
3148 Ga0495679_008823 3300047446 Bacteria 4069
3149 Ga0495685_001143 3300047447 Bacteria 8102
3150 Ga0495685_008666 3300047447 Bacteria 3383
3151 Ga0495685_011186 3300047447 Bacteria 3023
3152 Ga0495685_079285 3300047447 Bacteria 1094
3153 Ga0495673_0000185 3300047469 Bacteria 100703
3154 Ga0495673_0000338 3300047469 Bacteria 59988
3155 Ga0495673_0002607 3300047469 Bacteria 12542
3156 Ga0495673_0019890 3300047469 Bacteria 3354
3157 Ga0495673_0027453 3300047469 Bacteria 2709
3158 Ga0495673_0040685 3300047469 Bacteria 2097
3159 Ga0495681_0027050 3300047470 Bacteria 2974
3160 Ga0495681_0030651 3300047470 Bacteria 2735
3161 Ga0495681_0031178 3300047470 Bacteria 2703
3162 Ga0495681_0042189 3300047470 Bacteria 2210
3163 Ga0495681_0089324 3300047470 Bacteria 1363
3164 Ga0495681_0152050 3300047470 Bacteria 970
3165 Ga0495681_0165249 3300047470 Bacteria 919
3166 Ga0495684_0095557 3300047471 Bacteria 2250
3167 Ga0495684_0176834 3300047471 Bacteria 1584
3168 Ga0495684_0286106 3300047471 Bacteria 1188
3169 Ga0495686_0005000 3300047472 Bacteria 10648
3170 Ga0495686_0013056 3300047472 Bacteria 5784
3171 Ga0495686_0026449 3300047472 Bacteria 3795
3172 Ga0495686_0035426 3300047472 Bacteria 3208
3173 Ga0495686_0041880 3300047472 Bacteria 2914
3174 Ga0495686_0041982 3300047472 Bacteria 2910
3175 Ga0495593_0012462 3300047673 Bacteria 4859
3176 Ga0495593_0015440 3300047673 Bacteria 4324
3177 Ga0495593_0016602 3300047673 Bacteria 4150
3178 Ga0495593_0027458 3300047673 Bacteria 3133
3179 Ga0495593_0032681 3300047673 Bacteria 2835
3180 Ga0495593_0043547 3300047673 Bacteria 2405
3181 Ga0495593_0061774 3300047673 Bacteria 1959
3182 Ga0495593_0099747 3300047673 Bacteria 1490
3183 Ga0495593_0132172 3300047673 Bacteria 1266
3184 Ga0495602_0045589 3300048088 Bacteria 3966
3185 Ga0495602_0053905 3300048088 Bacteria 3556
3186 Ga0495602_0058801 3300048088 Bacteria 3362
3187 Ga0495602_0072298 3300048088 Bacteria 2941
3188 Ga0495602_0121132 3300048088 Bacteria 2104
3189 Ga0495614_0022910 3300048089 Bacteria 2692
3190 Ga0495614_0097232 3300048089 Bacteria 1284
3191 Ga0495614_0140874 3300048089 Bacteria 1071
3192 Ga0495615_0009603 3300048090 Bacteria 1909
3193 Ga0495615_0033722 3300048090 Bacteria 1242
3194 Ga0495626_0003909 3300048091 Bacteria 9334
3195 Ga0495626_0010744 3300048091 Bacteria 4868
3196 Ga0495626_0011243 3300048091 Bacteria 4741
3197 Ga0495626_0012906 3300048091 Bacteria 4359
3198 Ga0495626_0016437 3300048091 Bacteria 3756
3199 Ga0495626_0018386 3300048091 Bacteria 3509
3200 Ga0495626_0025216 3300048091 Bacteria 2909
3201 Ga0495626_0136430 3300048091 Bacteria 1043
3202 Ga0495626_0147376 3300048091 Bacteria 994
3203 Ga0496100_0003980 3300048903 Bacteria 7766
3204 Ga0496100_0036717 3300048903 Bacteria 3093
3205 Ga0496100_0141653 3300048903 Bacteria 1705
3206 Ga0496100_0198603 3300048903 Bacteria 1460
3207 Ga0496100_0271806 3300048903 Bacteria 1260
3208 Ga0496100_0280373 3300048903 Bacteria 1242
3209 Ga0496101_0018106 3300048904 Bacteria 4783
3210 Ga0496101_0026210 3300048904 Bacteria 4052
3211 Ga0496101_0098087 3300048904 Bacteria 2189
3212 Ga0496101_0284420 3300048904 Bacteria 1293
3213 Ga0496102_0020726 3300048905 Bacteria 5809
3214 Ga0496102_0022040 3300048905 Bacteria 5641
3215 Ga0496102_0022350 3300048905 Bacteria 5604
3216 Ga0496102_0025358 3300048905 Bacteria 5277
3217 Ga0496102_0036709 3300048905 Bacteria 4416
3218 Ga0496102_0055017 3300048905 Bacteria 3629
3219 Ga0496102_0068828 3300048905 Bacteria 3248
3220 Ga0496102_0123498 3300048905 Bacteria 2419
3221 Ga0496102_0145376 3300048905 Bacteria 2225
3222 Ga0496102_0604783 3300048905 Bacteria 1019
3223 Ga0496103_0020863 3300048906 Bacteria 3939
3224 Ga0496103_0024738 3300048906 Bacteria 3624
3225 Ga0496103_0038048 3300048906 Bacteria 2950
3226 Ga0496103_0056865 3300048906 Bacteria 2428
3227 Ga0496103_0231519 3300048906 Bacteria 1188
3228 Ga0496103_0257027 3300048906 Bacteria 1124
3229 Ga0496104_0049965 3300048907 Bacteria 3945
3230 Ga0496104_0061014 3300048907 Bacteria 3573
3231 Ga0496104_0077952 3300048907 Bacteria 3157
3232 Ga0496104_0087748 3300048907 Bacteria 2971
3233 Ga0496104_0392711 3300048907 Bacteria 1299
3234 Ga0496104_0527948 3300048907 Bacteria 1091
3235 Ga0496105_0011636 3300048908 Bacteria 6961
3236 Ga0496106_0003262 3300048909 Bacteria 12136
3237 Ga0496106_0017852 3300048909 Bacteria 5246
3238 Ga0496106_0019769 3300048909 Bacteria 4994
3239 Ga0496106_0021873 3300048909 Bacteria 4750
3240 Ga0496106_0056405 3300048909 Bacteria 2969
3241 Ga0496106_0141518 3300048909 Bacteria 1892
3242 Ga0496106_0269798 3300048909 Bacteria 1362
3243 Ga0496107_0003267 3300048910 Bacteria 10805
3244 Ga0496107_0030232 3300048910 Bacteria 3860
3245 Ga0496107_0047964 3300048910 Bacteria 3076
3246 Ga0496107_0222776 3300048910 Bacteria 1403
3247 Ga0496107_0487539 3300048910 Bacteria 914
3248 Ga0496108_0047837 3300048911 Bacteria 3575
3249 Ga0496108_0052115 3300048911 Bacteria 3428
3250 Ga0496108_0062034 3300048911 Bacteria 3147
3251 Ga0496108_0081123 3300048911 Bacteria 2749
3252 Ga0496108_0143804 3300048911 Bacteria 2055
3253 Ga0496109_0015279 3300048912 Bacteria 6685
3254 Ga0496109_0029720 3300048912 Bacteria 4896
3255 Ga0496109_0050661 3300048912 Bacteria 3781
3256 Ga0496109_0067177 3300048912 Bacteria 3284
3257 Ga0496109_0161087 3300048912 Bacteria 2102
3258 Ga0496109_0541334 3300048912 Bacteria 1098
3259 Ga0496109_0642102 3300048912 Bacteria 998
3260 Ga0496110_0007834 3300048913 Bacteria 8558
3261 Ga0496110_0023385 3300048913 Bacteria 5254
3262 Ga0496110_0270807 3300048913 Bacteria 1546
3263 Ga0496110_0316521 3300048913 Bacteria 1421
3264 Ga0496110_0889679 3300048913 Bacteria 796
3265 Ga0496111_0021878 3300048914 Bacteria 4469
3266 Ga0496111_0029471 3300048914 Bacteria 3898
3267 Ga0496111_0063099 3300048914 Bacteria 2687
3268 Ga0496111_0154032 3300048914 Bacteria 1705
3269 Ga0496112_0044154 3300048915 Bacteria 4366
3270 Ga0496112_0059935 3300048915 Bacteria 3750
3271 Ga0496112_0123048 3300048915 Bacteria 2564
3272 Ga0496112_0934315 3300048915 Bacteria 789
3273 Ga0496113_0027320 3300048916 Bacteria 4090
3274 Ga0496113_0034039 3300048916 Bacteria 3714
3275 Ga0496113_0035860 3300048916 Bacteria 3630
3276 Ga0496113_0053981 3300048916 Bacteria 3006
3277 Ga0496113_0066079 3300048916 Bacteria 2738
3278 Ga0496113_0209784 3300048916 Bacteria 1550
3279 Ga0496114_0006354 3300048917 Bacteria 9297
3280 Ga0496114_0067920 3300048917 Bacteria 2991
3281 Ga0496114_0114033 3300048917 Bacteria 2317
3282 Ga0496114_0172129 3300048917 Bacteria 1887
3283 Ga0496114_0406489 3300048917 Bacteria 1206
3284 Ga0496115_0052206 3300048918 Bacteria 3279
3285 Ga0496115_0085501 3300048918 Bacteria 2573
3286 Ga0496115_0288753 3300048918 Bacteria 1346
3287 Ga0496115_0308419 3300048918 Bacteria 1296
3288 Ga0496115_0314979 3300048918 Bacteria 1281
3289 Ga0496115_0315466 3300048918 Bacteria 1280
3290 Ga0496115_0415541 3300048918 Bacteria 1090
3291 Ga0496116_0010680 3300048919 Bacteria 7674
3292 Ga0496116_0017705 3300048919 Bacteria 5520
3293 Ga0496116_0045572 3300048919 Bacteria 2967
3294 Ga0496116_0074748 3300048919 Bacteria 2130
3295 Ga0496116_0159026 3300048919 Bacteria 1242
3296 Ga0496116_0196626 3300048919 Bacteria 1060
3297 Ga0496116_0236458 3300048919 Bacteria 921
3298 Ga0496116_0253181 3300048919 Bacteria 875
3299 Ga0496117_0000005 3300048920 Bacteria 777468
3300 Ga0496117_0017925 3300048920 Bacteria 5894
3301 Ga0496117_0022053 3300048920 Bacteria 5120
3302 Ga0496117_0041990 3300048920 Bacteria 3342
3303 Ga0496117_0047215 3300048920 Bacteria 3090
3304 Ga0496117_0051351 3300048920 Bacteria 2915
3305 Ga0496117_0057807 3300048920 Bacteria 2690
3306 Ga0496117_0066174 3300048920 Bacteria 2452
3307 Ga0496117_0098224 3300048920 Bacteria 1862
3308 Ga0496117_0110429 3300048920 Bacteria 1714
3309 Ga0496117_0126613 3300048920 Bacteria 1557
3310 Ga0496117_0178289 3300048920 Bacteria 1224
3311 Ga0496117_0280542 3300048920 Bacteria 892
3312 Ga0496118_0000022 3300048921 Bacteria 438602
3313 Ga0496118_0023217 3300048921 Bacteria 5393
3314 Ga0496118_0038754 3300048921 Bacteria 3814
3315 Ga0496118_0045578 3300048921 Bacteria 3421
3316 Ga0496118_0046667 3300048921 Bacteria 3366
3317 Ga0496118_0056046 3300048921 Bacteria 2966
3318 Ga0496118_0057908 3300048921 Bacteria 2900
3319 Ga0496118_0062438 3300048921 Bacteria 2750
3320 Ga0496118_0104986 3300048921 Bacteria 1895
3321 Ga0496118_0167946 3300048921 Bacteria 1345
3322 Ga0496118_0222227 3300048921 Bacteria 1098
3323 Ga0496119_0006879 3300048922 Bacteria 10383
3324 Ga0496119_0007226 3300048922 Bacteria 10054
3325 Ga0496119_0009096 3300048922 Bacteria 8602
3326 Ga0496119_0016770 3300048922 Bacteria 5549
3327 Ga0496119_0102285 3300048922 Bacteria 1607
3328 Ga0496120_0000480 3300048923 Bacteria 62598
3329 Ga0496120_0008280 3300048923 Bacteria 7587
3330 Ga0496120_0012742 3300048923 Bacteria 5701
3331 Ga0496120_0047097 3300048923 Bacteria 2487
3332 Ga0496120_0150048 3300048923 Bacteria 1173
3333 Ga0496121_0014988 3300048924 Bacteria 8161
3334 Ga0496121_0018787 3300048924 Bacteria 6945
3335 Ga0496121_0025394 3300048924 Bacteria 5622
3336 Ga0496121_0027385 3300048924 Bacteria 5334
3337 Ga0496121_0036769 3300048924 Bacteria 4358
3338 Ga0496121_0075787 3300048924 Bacteria 2685
3339 Ga0496121_0080977 3300048924 Bacteria 2571
3340 Ga0496121_0106736 3300048924 Bacteria 2146
3341 Ga0496121_0107297 3300048924 Bacteria 2139
3342 Ga0496121_0159310 3300048924 Bacteria 1652
3343 Ga0496121_0187641 3300048924 Bacteria 1485
3344 Ga0496121_0193136 3300048924 Bacteria 1458
3345 Ga0496121_0454455 3300048924 Bacteria 824
3346 Ga0496122_0002979 3300048925 Bacteria 23054
3347 Ga0496122_0013788 3300048925 Bacteria 7876
3348 Ga0496122_0018124 3300048925 Bacteria 6522
3349 Ga0496122_0023046 3300048925 Bacteria 5509
3350 Ga0496122_0026262 3300048925 Bacteria 5026
3351 Ga0496122_0029575 3300048925 Bacteria 4617
3352 Ga0496122_0059460 3300048925 Bacteria 2821
3353 Ga0496122_0106855 3300048925 Bacteria 1851
3354 Ga0496122_0179960 3300048925 Bacteria 1262
3355 Ga0496122_0238505 3300048925 Bacteria 1027
3356 Ga0496122_0255647 3300048925 Bacteria 976
3357 Ga0496123_0007909 3300048926 Bacteria 9875
3358 Ga0496123_0013659 3300048926 Bacteria 6791
3359 Ga0496123_0019197 3300048926 Bacteria 5396
3360 Ga0496123_0031651 3300048926 Bacteria 3845
3361 Ga0496123_0039166 3300048926 Bacteria 3318
3362 Ga0496123_0048983 3300048926 Bacteria 2837
3363 Ga0496123_0086762 3300048926 Bacteria 1875
3364 Ga0496123_0134169 3300048926 Bacteria 1365
3365 Ga0496123_0163309 3300048926 Bacteria 1184
3366 Ga0496123_0181132 3300048926 Bacteria 1100
3367 Ga0496124_0000604 3300048927 Bacteria 60274
3368 Ga0496124_0000894 3300048927 Bacteria 48157
3369 Ga0496124_0023156 3300048927 Bacteria 5677
3370 Ga0496124_0026194 3300048927 Bacteria 5263
3371 Ga0496124_0044280 3300048927 Bacteria 3820
3372 Ga0496124_0047252 3300048927 Bacteria 3683
3373 Ga0496124_0049152 3300048927 Bacteria 3599
3374 Ga0496124_0056123 3300048927 Bacteria 3323
3375 Ga0496124_0076927 3300048927 Bacteria 2753
3376 Ga0496124_0080717 3300048927 Bacteria 2675
3377 Ga0496124_0084354 3300048927 Bacteria 2605
3378 Ga0496125_0003719 3300048928 Bacteria 18202
3379 Ga0496125_0011999 3300048928 Bacteria 8627
3380 Ga0496125_0032226 3300048928 Bacteria 4658
3381 Ga0496125_0032425 3300048928 Bacteria 4641
3382 Ga0496125_0032447 3300048928 Bacteria 4639
3383 Ga0496125_0047998 3300048928 Bacteria 3564
3384 Ga0496125_0057872 3300048928 Bacteria 3135
3385 Ga0496125_0063503 3300048928 Bacteria 2944
3386 Ga0496125_0064828 3300048928 Bacteria 2899
3387 Ga0496125_0144008 3300048928 Bacteria 1651
3388 Ga0496125_0147835 3300048928 Bacteria 1620
3389 Ga0496125_0392503 3300048928 Bacteria 814
3390 Ga0496125_0430368 3300048928 Bacteria 762
3391 Ga0496126_0011436 3300048929 Bacteria 9186
3392 Ga0496126_0016992 3300048929 Bacteria 7259
3393 Ga0496126_0022180 3300048929 Bacteria 6184
3394 Ga0496126_0031527 3300048929 Bacteria 5006
3395 Ga0496126_0062581 3300048929 Bacteria 3338
3396 Ga0496126_0161525 3300048929 Bacteria 1914
3397 Ga0496126_0294798 3300048929 Bacteria 1340
3398 Ga0496126_0464825 3300048929 Bacteria 1016
3399 Ga0501306_000150 3300049127 Bacteria 4359
3400 Ga0501306_000253 3300049127 Bacteria 3720
3401 Ga0501306_000856 3300049127 Bacteria 2604
3402 Ga0501306_003789 3300049127 Bacteria 1652
3403 Ga0501306_011502 3300049127 Bacteria 1129
3404 Ga0501306_027135 3300049127 Bacteria 832
3405 Ga0501308_000175 3300049128 Bacteria 3509
3406 Ga0501308_000353 3300049128 Bacteria 2890
3407 Ga0501308_000398 3300049128 Bacteria 2773
3408 Ga0501308_000757 3300049128 Bacteria 2289
3409 Ga0501308_001692 3300049128 Bacteria 1821
3410 Ga0501308_002855 3300049128 Bacteria 1551
3411 Ga0501308_018572 3300049128 Bacteria 852
3412 Ga0501308_021790 3300049128 Bacteria 807
3413 Ga0501309_000132 3300049129 Bacteria 4630
3414 Ga0501309_002460 3300049129 Bacteria 1997
3415 Ga0501309_003159 3300049129 Bacteria 1846
3416 Ga0501310_000172 3300049130 Bacteria 6263
3417 Ga0501310_000687 3300049130 Bacteria 2995
3418 Ga0501310_000893 3300049130 Bacteria 2657
3419 Ga0501310_001364 3300049130 Bacteria 2207
3420 Ga0501310_007107 3300049130 Bacteria 1191
3421 Ga0501310_010741 3300049130 Bacteria 1026
3422 Ga0501304_000078 3300049160 Bacteria 3406
3423 Ga0501304_000372 3300049160 Bacteria 2222
3424 Ga0501305_000417 3300049161 Bacteria 3439
3425 Ga0501305_002034 3300049161 Bacteria 2112
3426 Ga0501305_002434 3300049161 Bacteria 2007
3427 Ga0501305_003350 3300049161 Bacteria 1806
3428 Ga0501305_006645 3300049161 Bacteria 1443
3429 Ga0501305_019395 3300049161 Bacteria 992
3430 Ga0501305_024328 3300049161 Bacteria 912
3431 Ga0501307_000085 3300049162 Bacteria 4135
3432 Ga0501307_000892 3300049162 Bacteria 2295
3433 Ga0501307_000903 3300049162 Bacteria 2286
3434 Ga0501307_001372 3300049162 Bacteria 2039
3435 Ga0501307_002597 3300049162 Bacteria 1698
3436 Ga0501307_002889 3300049162 Bacteria 1642
3437 Ga0501307_004585 3300049162 Bacteria 1419
3438 Ga0501307_012616 3300049162 Bacteria 1008
3439 Ga0501307_023881 3300049162 Bacteria 813
3440 Ga0495678_003816 3300049459 Bacteria 9088
3441 Ga0495678_006847 3300049459 Bacteria 5992
3442 Ga0495678_006998 3300049459 Bacteria 5916
3443 Ga0495678_019973 3300049459 Bacteria 2976
3444 Ga0495678_020357 3300049459 Bacteria 2940
3445 Ga0495678_043615 3300049459 Bacteria 1779
3446 Ga0495678_046681 3300049459 Bacteria 1700
3447 Ga0495678_088088 3300049459 Bacteria 1099
3448 Ga0495678_119004 3300049459 Bacteria 889
3449 Ga0495682_0009381 3300049460 Bacteria 3819
3450 Ga0495682_0018830 3300049460 Bacteria 2599
3451 Ga0495682_0035921 3300049460 Bacteria 1824
3452 Ga0501292_005697 3300049515 Bacteria 1745
3453 Ga0501297_008029 3300049520 Bacteria 1157
3454 Ga0501300_001467 3300049523 Bacteria 3536
3455 Ga0501311_000165 3300049527 Bacteria 3696
3456 Ga0501311_000380 3300049527 Bacteria 3004
3457 Ga0501311_004924 3300049527 Bacteria 1441
3458 Ga0501312_000192 3300049528 Bacteria 4152
3459 Ga0501312_002197 3300049528 Bacteria 2076
3460 Ga0501312_010614 3300049528 Bacteria 1237
3461 Ga0501313_000484 3300049529 Bacteria 2753
3462 Ga0501313_006744 3300049529 Bacteria 1250
3463 Ga0501313_010359 3300049529 Bacteria 1061
3464 Ga0501314_000031 3300049530 Bacteria 6403
3465 Ga0501314_000322 3300049530 Bacteria 2841
3466 Ga0501314_006096 3300049530 Bacteria 1042
3467 Ga0501314_006471 3300049530 Bacteria 1021
3468 Ga0501314_015228 3300049530 Bacteria 759
3469 Ga0501315_000244 3300049531 Bacteria 3399
3470 Ga0501315_000515 3300049531 Bacteria 2726
3471 Ga0501315_000556 3300049531 Bacteria 2665
3472 Ga0501315_000797 3300049531 Bacteria 2387
3473 Ga0501315_000984 3300049531 Bacteria 2253
3474 Ga0501315_009750 3300049531 Bacteria 1141
3475 Ga0501316_000938 3300049532 Bacteria 2285
3476 Ga0501316_004242 3300049532 Bacteria 1431
3477 Ga0501317_000846 3300049533 Bacteria 2397
3478 Ga0501317_002378 3300049533 Bacteria 1771
3479 Ga0501317_009579 3300049533 Bacteria 1141
3480 Ga0501318_000363 3300049534 Bacteria 2758
3481 Ga0501318_001865 3300049534 Bacteria 1741
3482 Ga0501318_002453 3300049534 Bacteria 1607
3483 Ga0501318_003900 3300049534 Bacteria 1400
3484 Ga0501318_010148 3300049534 Bacteria 1040
3485 Ga0501319_000343 3300049535 Bacteria 2096
3486 Ga0501320_000653 3300049536 Bacteria 2151
3487 Ga0501320_007529 3300049536 Bacteria 1050
3488 Ga0501320_020398 3300049536 Bacteria 763
3489 Ga0501321_001359 3300049537 Bacteria 1925
3490 Ga0501321_004187 3300049537 Bacteria 1366
3491 Ga0501322_001695 3300049538 Bacteria 1273
3492 Ga0501323_000376 3300049539 Bacteria 3202
3493 Ga0501323_000513 3300049539 Bacteria 2914
3494 Ga0501323_000940 3300049539 Bacteria 2394
3495 Ga0501323_001711 3300049539 Bacteria 2013
3496 Ga0501323_003438 3300049539 Bacteria 1617
3497 Ga0501323_015540 3300049539 Bacteria 962
3498 Ga0501323_018085 3300049539 Bacteria 910
3499 Ga0501324_000146 3300049540 Bacteria 3029
3500 Ga0501325_000418 3300049541 Bacteria 1990
3501 Ga0501340_001965 3300049556 Bacteria 1158
3502 Ga0501031_0001681 3300049568 Bacteria 13893
3503 Ga0501031_0003823 3300049568 Bacteria 9687
3504 Ga0501031_0021734 3300049568 Bacteria 4182
3505 Ga0501031_0028632 3300049568 Bacteria 3632
3506 Ga0501031_0047534 3300049568 Bacteria 2797
3507 Ga0501031_0065381 3300049568 Bacteria 2369
3508 Ga0501031_0094229 3300049568 Bacteria 1954
3509 Ga0501032_0000036 3300049569 Bacteria 117044
3510 Ga0501032_0001142 3300049569 Bacteria 21266
3511 Ga0501032_0005990 3300049569 Bacteria 8970
3512 Ga0501032_0008553 3300049569 Bacteria 7466
3513 Ga0501032_0012075 3300049569 Bacteria 6184
3514 Ga0501032_0073945 3300049569 Bacteria 2271
3515 Ga0501032_0135991 3300049569 Bacteria 1620
3516 Ga0501033_0001208 3300049570 Bacteria 23221
3517 Ga0501033_0001755 3300049570 Bacteria 18965
3518 Ga0501033_0001957 3300049570 Bacteria 17927
3519 Ga0501033_0001959 3300049570 Bacteria 17922
3520 Ga0501033_0002077 3300049570 Bacteria 17392
3521 Ga0501033_0021027 3300049570 Bacteria 4925
3522 Ga0501033_0049121 3300049570 Bacteria 3132
3523 Ga0501033_0092691 3300049570 Bacteria 2209
3524 Ga0501033_0102030 3300049570 Bacteria 2093
3525 Ga0501033_0138394 3300049570 Bacteria 1761
3526 Ga0501034_0017688 3300049571 Bacteria 7310
3527 Ga0501034_0023139 3300049571 Bacteria 6332
3528 Ga0501034_0026567 3300049571 Bacteria 5895
3529 Ga0501034_0034857 3300049571 Bacteria 5103
3530 Ga0501034_0040480 3300049571 Bacteria 4717
3531 Ga0501034_0040683 3300049571 Bacteria 4704
3532 Ga0501034_0050695 3300049571 Bacteria 4186
3533 Ga0501034_0060042 3300049571 Bacteria 3819
3534 Ga0501034_0072781 3300049571 Bacteria 3445
3535 Ga0501034_0088473 3300049571 Bacteria 3095
3536 Ga0501034_0109493 3300049571 Bacteria 2753
3537 Ga0501034_0174721 3300049571 Bacteria 2114
3538 Ga0501034_0187632 3300049571 Bacteria 2030
3539 Ga0501034_0312495 3300049571 Bacteria 1505
3540 Ga0501034_0315527 3300049571 Bacteria 1497
3541 Ga0501034_0320118 3300049571 Bacteria 1484
3542 Ga0501034_0675798 3300049571 Bacteria 933
3543 Ga0501036_0000512 3300049572 Bacteria 27832
3544 Ga0501036_0009568 3300049572 Bacteria 7973
3545 Ga0501036_0077910 3300049572 Bacteria 2804
3546 Ga0501036_0079022 3300049572 Bacteria 2783
3547 Ga0501036_0149559 3300049572 Bacteria 1969
3548 Ga0501036_0271532 3300049572 Bacteria 1420
3549 Ga0501036_0285854 3300049572 Bacteria 1380
3550 Ga0501036_0430796 3300049572 Bacteria 1099
3551 Ga0501037_0001523 3300049573 Bacteria 16903
3552 Ga0501037_0002990 3300049573 Bacteria 12280
3553 Ga0501037_0005394 3300049573 Bacteria 9311
3554 Ga0501037_0013116 3300049573 Bacteria 6110
3555 Ga0501037_0029882 3300049573 Bacteria 4026
3556 Ga0501037_0032830 3300049573 Bacteria 3835
3557 Ga0501037_0054640 3300049573 Bacteria 2921
3558 Ga0501037_0162619 3300049573 Bacteria 1591
3559 Ga0501037_0316367 3300049573 Bacteria 1081
3560 Ga0501037_0339784 3300049573 Bacteria 1037
3561 Ga0501038_0001466 3300049574 Bacteria 21705
3562 Ga0501038_0010394 3300049574 Bacteria 8508
3563 Ga0501038_0014781 3300049574 Bacteria 7111
3564 Ga0501038_0039430 3300049574 Bacteria 4131
3565 Ga0501038_0045240 3300049574 Bacteria 3822
3566 Ga0501038_0069415 3300049574 Bacteria 2993
3567 Ga0501038_0073369 3300049574 Bacteria 2898
3568 Ga0501038_0127040 3300049574 Bacteria 2097
3569 Ga0501038_0207818 3300049574 Bacteria 1568
3570 Ga0501038_0372579 3300049574 Bacteria 1109
3571 Ga0501039_0002729 3300049575 Bacteria 13161
3572 Ga0501039_0002806 3300049575 Bacteria 13021
3573 Ga0501039_0141088 3300049575 Bacteria 1892
3574 Ga0501039_0146817 3300049575 Bacteria 1853
3575 Ga0501039_0310175 3300049575 Bacteria 1240
3576 Ga0501040_0000218 3300049576 Bacteria 33403
3577 Ga0501041_0265846 3300049577 Bacteria 1079
3578 Ga0501042_0000726 3300049578 Bacteria 17845
3579 Ga0501042_0291432 3300049578 Bacteria 1179
3580 Ga0501043_0000049 3300049579 Bacteria 107569
3581 Ga0501043_0000157 3300049579 Bacteria 62190
3582 Ga0501043_0015137 3300049579 Bacteria 6036
3583 Ga0501043_0045254 3300049579 Bacteria 3461
3584 Ga0501043_0050918 3300049579 Bacteria 3255
3585 Ga0501043_0054355 3300049579 Bacteria 3144
3586 Ga0501043_0058046 3300049579 Bacteria 3038
3587 Ga0501043_0077210 3300049579 Bacteria 2617
3588 Ga0501043_0162916 3300049579 Bacteria 1742
3589 Ga0501043_0307099 3300049579 Bacteria 1211
3590 Ga0501043_0308295 3300049579 Bacteria 1208
3591 Ga0501043_0398761 3300049579 Bacteria 1040
3592 Ga0501046_0000120 3300049580 Bacteria 83103
3593 Ga0501046_0002470 3300049580 Bacteria 17348
3594 Ga0501046_0006637 3300049580 Bacteria 10222
3595 Ga0501046_0054211 3300049580 Bacteria 3155
3596 Ga0501046_0308890 3300049580 Bacteria 1153
3597 Ga0501047_0003888 3300049581 Bacteria 14041
3598 Ga0501047_0008217 3300049581 Bacteria 9850
3599 Ga0501047_0022771 3300049581 Bacteria 6015
3600 Ga0501047_0030277 3300049581 Bacteria 5219
3601 Ga0501047_0436741 3300049581 Bacteria 1139
3602 Ga0501048_0019080 3300049582 Bacteria 5037
3603 Ga0501048_0038565 3300049582 Bacteria 3427
3604 Ga0501048_0097071 3300049582 Bacteria 2079
3605 Ga0501067_0000278 3300049583 Bacteria 27992
3606 Ga0501067_0047129 3300049583 Bacteria 2391
3607 Ga0501067_0080951 3300049583 Bacteria 1800
3608 Ga0501068_0008291 3300049584 Bacteria 5776
3609 Ga0501068_0021114 3300049584 Bacteria 3801
3610 Ga0501068_0032722 3300049584 Bacteria 3092
3611 Ga0501068_0065039 3300049584 Bacteria 2219
3612 Ga0501068_0362549 3300049584 Bacteria 932
3613 Ga0501069_0043763 3300049585 Bacteria 2479
3614 Ga0501070_0072265 3300049586 Bacteria 2856
3615 Ga0501070_0375209 3300049586 Bacteria 1152
3616 Ga0501071_0025062 3300049587 Bacteria 4176
3617 Ga0501072_0494935 3300049588 Bacteria 967
3618 Ga0501073_0000031 3300049589 Bacteria 114348
3619 Ga0501073_0001779 3300049589 Bacteria 16021
3620 Ga0501073_0020942 3300049589 Bacteria 4716
3621 Ga0501073_0069117 3300049589 Bacteria 2461
3622 Ga0501077_0019433 3300049593 Bacteria 4297
3623 Ga0501198_000098 3300049649 Bacteria 16882
3624 Ga0501222_000123 3300049662 Bacteria 16880
3625 Ga0501222_009361 3300049662 Bacteria 1296
3626 Ga0501227_001669 3300049665 Bacteria 4945
3627 Ga0501227_109528 3300049665 Bacteria 739
3628 Ga0501235_032018 3300049669 Bacteria 1189
3629 Ga0501249_024981 3300049679 Bacteria 1317
3630 Ga0501221_001711 3300049704 Bacteria 3652
3631 Ga0501079_0001448 3300049741 Bacteria 16783
3632 Ga0501079_0075068 3300049741 Bacteria 2614
3633 Ga0501080_0004044 3300049742 Bacteria 12986
3634 Ga0501080_0009449 3300049742 Bacteria 8894
3635 Ga0501080_0014943 3300049742 Bacteria 7147
3636 Ga0501080_0035081 3300049742 Bacteria 4683
3637 Ga0501080_0046677 3300049742 Bacteria 4032
3638 Ga0501083_0026263 3300049744 Bacteria 4026
3639 Ga0501083_0036098 3300049744 Bacteria 3373
3640 Ga0501083_0228381 3300049744 Bacteria 1212
3641 Ga0501083_0297516 3300049744 Bacteria 1050
3642 Ga0501262_001632 3300049759 Bacteria 2516
3643 Ga0501269_001393 3300049766 Bacteria 3164
3644 Ga0501276_006502 3300049773 Bacteria 921
3645 Ga0501279_001934 3300049775 Bacteria 2732
3646 Ga0501283_024661 3300049779 Bacteria 981
3647 Ga0501035_0000671 3300049822 Bacteria 37548
3648 Ga0501035_0004008 3300049822 Bacteria 14050
3649 Ga0501035_0024357 3300049822 Bacteria 5551
3650 Ga0501035_0026283 3300049822 Bacteria 5327
3651 Ga0501035_0030233 3300049822 Bacteria 4938
3652 Ga0501035_0032626 3300049822 Bacteria 4737
3653 Ga0501035_0035341 3300049822 Bacteria 4535
3654 Ga0501035_0035964 3300049822 Bacteria 4492
3655 Ga0501035_0047407 3300049822 Bacteria 3857
3656 Ga0501035_0053573 3300049822 Bacteria 3607
3657 Ga0501035_0076652 3300049822 Bacteria 2956
3658 Ga0501035_0136817 3300049822 Bacteria 2132
3659 Ga0501035_0260617 3300049822 Bacteria 1470
3660 Ga0501044_0000747 3300049823 Bacteria 39287
3661 Ga0501044_0003394 3300049823 Bacteria 17947
3662 Ga0501044_0007466 3300049823 Bacteria 12023
3663 Ga0501044_0015445 3300049823 Bacteria 8224
3664 Ga0501044_0016454 3300049823 Bacteria 7938
3665 Ga0501044_0023361 3300049823 Bacteria 6576
3666 Ga0501044_0024454 3300049823 Bacteria 6410
3667 Ga0501044_0036693 3300049823 Bacteria 5126
3668 Ga0501044_0049018 3300049823 Bacteria 4360
3669 Ga0501044_0066905 3300049823 Bacteria 3662
3670 Ga0501044_0312522 3300049823 Bacteria 1497
3671 Ga0501044_0446026 3300049823 Bacteria 1201
3672 Ga0501045_0002614 3300049824 Bacteria 12259
3673 Ga0501045_0020789 3300049824 Bacteria 4690
3674 Ga0501045_0285388 3300049824 Bacteria 1229
3675 Ga0501045_0423376 3300049824 Bacteria 990
3676 Ga0501226_000391 3300049853 Bacteria 6350
3677 nmdc:mga03683_108417_c1 3300050489 Bacteria 1226
3678 nmdc:mga03683_12404_c1 3300050489 Bacteria 3112
3679 nmdc:mga03683_153975_c1 3300050489 Bacteria 1039
3680 nmdc:mga03683_29512_c1 3300050489 Bacteria 2187
3681 nmdc:mga03n38_138718_c1 3300050490 Bacteria 1213
3682 nmdc:mga03n38_39814_c1 3300050490 Bacteria 2039
3683 nmdc:mga03n38_7208_c1 3300050490 Bacteria 3920
3684 nmdc:mga03n38_8620_c1 3300050490 Bacteria 3668
3685 nmdc:mga00v17_1799_c1 3300050491 Bacteria 11108
3686 nmdc:mga00v17_20109_c1 3300050491 Bacteria 3821
3687 nmdc:mga00v17_209501_c1 3300050491 Bacteria 1261
3688 nmdc:mga00v17_388972_c1 3300050491 Bacteria 906
3689 nmdc:mga00v17_64031_c1 3300050491 Bacteria 2265
3690 nmdc:mga0yw44_149437_c1 3300050492 Bacteria 1523
3691 nmdc:mga0yw44_473035_c1 3300050492 Bacteria 850
3692 nmdc:mga0yw44_48117_c1 3300050492 Bacteria 2570
3693 nmdc:mga0yw44_8441_c1 3300050492 Bacteria 5133
3694 nmdc:mga0k408_10237_c1 3300050493 Bacteria 5069
3695 nmdc:mga0k408_164334_c1 3300050493 Bacteria 1323
3696 nmdc:mga0k408_17121_c1 3300050493 Bacteria 4033
3697 nmdc:mga0k408_208321_c1 3300050493 Bacteria 1167
3698 nmdc:mga0k408_246629_c1 3300050493 Bacteria 1067
3699 nmdc:mga0k408_295785_c1 3300050493 Bacteria 966
3700 nmdc:mga0k408_32661_c1 3300050493 Bacteria 2417
3701 nmdc:mga0k408_356679_c1 3300050493 Bacteria 872
3702 nmdc:mga0k408_36153_c1 3300050493 Bacteria 1586
3703 nmdc:mga0k408_36436_c1 3300050493 Bacteria 2824
3704 nmdc:mga0k408_39362_c1 3300050493 Bacteria 2716
3705 nmdc:mga0k408_422093_c1 3300050493 Bacteria 793
3706 nmdc:mga0k408_50017_c1 3300050493 Bacteria 2419
3707 nmdc:mga0k408_50095_c1 3300050493 Bacteria 2418
3708 nmdc:mga0k408_57763_c1 3300050493 Bacteria 1964
3709 nmdc:mga0k408_74656_c1 3300050493 Bacteria 1981
3710 nmdc:mga06z11_123845_c1 3300050494 Bacteria 1445
3711 nmdc:mga06z11_443725_c1 3300050494 Bacteria 784
3712 nmdc:mga04h51_102386_c1 3300050495 Bacteria 1045
3713 nmdc:mga04h51_26754_c1 3300050495 Bacteria 1786
3714 nmdc:mga07m45_101062_c1 3300050496 Bacteria 1656
3715 nmdc:mga07m45_10461_c1 3300050496 Bacteria 4847
3716 nmdc:mga07m45_19594_c1 3300050496 Bacteria 3667
3717 nmdc:mga07m45_22363_c1 3300050496 Bacteria 3451
3718 nmdc:mga07m45_237046_c1 3300050496 Bacteria 1062
3719 nmdc:mga07m45_28088_c1 3300050496 Bacteria 3105
3720 nmdc:mga07m45_3600_c1 3300050496 Bacteria 7218
3721 nmdc:mga07m45_5926_c1 3300050496 Bacteria 6133
3722 nmdc:mga07m45_6587_c1 3300050496 Bacteria 5884
3723 nmdc:mga07m45_7669_c1 3300050496 Bacteria 5522
3724 nmdc:mga07m45_94205_c1 3300050496 Bacteria 1717
3725 nmdc:mga05p37_47362_c1 3300050507 Bacteria 5287
3726 nmdc:mga05p37_547061_c1 3300050507 Bacteria 1319
3727 nmdc:mga09592_47092_c1 3300050508 Bacteria 3633
3728 nmdc:mga0qj67_163109_c1 3300050509 Bacteria 1809
3729 nmdc:mga0qj67_20252_c1 3300050509 Bacteria 5091
3730 nmdc:mga0qj67_51910_c1 3300050509 Bacteria 3244
3731 nmdc:mga0qj67_678179_c1 3300050509 Bacteria 821
3732 nmdc:mga06r32_111253_c1 3300050510 Bacteria 2695
3733 nmdc:mga06r32_177482_c1 3300050510 Bacteria 2115
3734 nmdc:mga06r32_196088_c1 3300050510 Bacteria 2007
3735 nmdc:mga06r32_335270_c1 3300050510 Bacteria 1497
3736 nmdc:mga06r32_555607_c1 3300050510 Bacteria 1122
3737 nmdc:mga08y16_102572_c1 3300050511 Bacteria 2979
3738 nmdc:mga08y16_14232_c1 3300050511 Bacteria 8373
3739 nmdc:mga08y16_271837_c1 3300050511 Bacteria 1749
3740 nmdc:mga08y16_412990_c1 3300050511 Bacteria 1380
3741 nmdc:mga08y16_749650_c1 3300050511 Bacteria 973
3742 nmdc:mga0n895_295721_c1 3300050512 Bacteria 1641
3743 nmdc:mga0n895_359498_c1 3300050512 Bacteria 1474
3744 nmdc:mga0n895_984286_c1 3300050512 Bacteria 825
3745 nmdc:mga0sz30_141896_c1 3300050516 Bacteria 1061
3746 nmdc:mga0sz30_163755_c1 3300050516 Bacteria 985
3747 nmdc:mga0sz30_7083_c1 3300050516 Bacteria 4194
3748 Ga0495601_0108510 3300053077 Bacteria 1796
3749 Ga0495612_0046715 3300053078 Bacteria 1774
3750 Ga0495655_0003437 3300053083 Bacteria 2613
3751 Ga0495595_0008781 3300053084 Bacteria 4161
3752 Ga0495619_0445007 3300053085 Bacteria 893
3753 Ga0500578_0027920 3300053086 Bacteria 3624
3754 Ga0500644_0038571 3300053088 Bacteria 1569
3755 Ga0500644_0052758 3300053088 Bacteria 1401
3756 Ga0500583_0020251 3300053092 Bacteria 2743
3757 Ga0500651_0005311 3300053093 Bacteria 7342
3758 Ga0500651_0017573 3300053093 Bacteria 4416
3759 Ga0500651_0040140 3300053093 Bacteria 2948
3760 Ga0500651_0511474 3300053093 Bacteria 661
3761 Ga0500641_0059964 3300053096 Bacteria 1583
3762 Ga0500556_0001832 3300053104 Bacteria 7761
3763 Ga0500592_004051 3300053116 Bacteria 2338
3764 Ga0500593_019737 3300053117 Bacteria 2950
3765 Ga0500594_0002841 3300053118 Bacteria 3778
3766 Ga0500594_0004592 3300053118 Bacteria 3045
3767 Ga0500608_120592 3300053122 Bacteria 1190
3768 Ga0500617_016862 3300053124 Bacteria 3160
3769 Ga0500618_004294 3300053125 Bacteria 4610
3770 Ga0500642_0107327 3300053130 Bacteria 1302
3771 Ga0500652_001479 3300053131 Bacteria 7245
3772 Ga0500658_0020285 3300053134 Bacteria 2507
3773 Ga0500659_0029531 3300053135 Bacteria 2994
3774 Ga0500559_0001032 3300053136 Bacteria 17050
3775 Ga0500559_0019299 3300053136 Bacteria 2881
3776 Ga0500586_009344 3300053145 Bacteria 2716
3777 Ga0500588_0002151 3300053146 Bacteria 3943
3778 Ga0500600_0037485 3300053149 Bacteria 2810
3779 Ga0500604_0061730 3300053151 Bacteria 1178
3780 Ga0500616_0013250 3300053153 Bacteria 4795
3781 Ga0500622_0003393 3300053156 Bacteria 10713
3782 Ga0500622_0006410 3300053156 Bacteria 6827
3783 Ga0500622_0014639 3300053156 Bacteria 4206
3784 Ga0500627_0050446 3300053158 Bacteria 1813
3785 Ga0500627_0122427 3300053158 Bacteria 1174
3786 Ga0500627_0183937 3300053158 Bacteria 940
3787 Ga0500633_0030189 3300053160 Bacteria 1741
3788 Ga0500634_0005374 3300053161 Bacteria 6070
3789 Ga0500634_0045572 3300053161 Bacteria 2373
3790 Ga0500636_0070815 3300053177 Bacteria 2022
3791 Ga0500636_0122043 3300053177 Bacteria 1461
3792 Ga0500645_004722 3300053730 Bacteria 5164
3793 Ga0500645_007257 3300053730 Bacteria 3876
3794 Ga0500645_010915 3300053730 Bacteria 2984
3795 Ga0500645_039202 3300053730 Bacteria 1404
3796 Ga0501084_0011095 3300054114 Bacteria 7462
3797 Ga0501084_0072936 3300054114 Bacteria 2875
3798 Ga0587084_002879 3300059477 Bacteria 1840
3799 Ga0587084_017762 3300059477 Bacteria 1030
3800 Ga0587093_007947 3300059478 Bacteria 1195
3801 Ga0587093_015006 3300059478 Bacteria 973
3802 Ga0587066_010093 3300059490 Bacteria 1354
3803 Ga0587070_001377 3300059491 Bacteria 2490
3804 Ga0587070_012783 3300059491 Bacteria 1283
3805 Ga0587070_052789 3300059491 Bacteria 817
3806 Ga0587073_0000405 3300059492 Bacteria 3811
3807 Ga0587073_0002616 3300059492 Bacteria 2339
3808 Ga0587077_000807 3300059493 Bacteria 3018
3809 Ga0587077_003827 3300059493 Bacteria 1928
3810 Ga0587077_004297 3300059493 Bacteria 1862
3811 Ga0587077_009688 3300059493 Bacteria 1469
3812 Ga0587077_013862 3300059493 Bacteria 1316
3813 Ga0587077_028871 3300059493 Bacteria 1042
3814 Ga0587077_046446 3300059493 Bacteria 892
3815 Ga0587080_004622 3300059503 Bacteria 1802
3816 Ga0587080_005825 3300059503 Bacteria 1673
3817 Ga0587080_011247 3300059503 Bacteria 1334
3818 Ga0587082_000814 3300059504 Bacteria 2909
3819 Ga0587082_001355 3300059504 Bacteria 2511
3820 Ga0587082_002029 3300059504 Bacteria 2221
3821 Ga0587082_019793 3300059504 Bacteria 1084
3822 Ga0587083_0001894 3300059505 Bacteria 2480
3823 Ga0587083_0004307 3300059505 Bacteria 1968
3824 Ga0587083_0004898 3300059505 Bacteria 1896
3825 Ga0587083_0024176 3300059505 Bacteria 1153
3826 Ga0587086_001217 3300059507 Bacteria 2160
3827 Ga0587088_001211 3300059508 Bacteria 2602
3828 Ga0587088_001458 3300059508 Bacteria 2461
3829 Ga0587089_011624 3300059509 Bacteria 1112
3830 Ga0587090_001097 3300059510 Bacteria 2624
3831 Ga0587090_002031 3300059510 Bacteria 2164
3832 Ga0587090_002303 3300059510 Bacteria 2083
3833 Ga0587090_006081 3300059510 Bacteria 1538
3834 Ga0587091_014264 3300059511 Bacteria 1291
3835 Ga0587091_040963 3300059511 Bacteria 913
3836 Ga0587095_000498 3300059514 Bacteria 2037
3837 Ga0587095_003751 3300059514 Bacteria 1086
3838 Ga0587106_001410 3300059605 Bacteria 2120
3839 Ga0587106_004584 3300059605 Bacteria 1528
3840 Ga0587106_010952 3300059605 Bacteria 1186
3841 Ga0587125_000703 3300059607 Bacteria 2131
3842 Ga0587125_005831 3300059607 Bacteria 1145
3843 Ga0587129_000218 3300059608 Bacteria 2334
3844 Ga0587099_000546 3300059622 Bacteria 2224
3845 Ga0587101_000225 3300059623 Bacteria 3438
3846 Ga0587101_000524 3300059623 Bacteria 2775
3847 Ga0587109_002097 3300059624 Bacteria 2474
3848 Ga0587109_006463 3300059624 Bacteria 1733
3849 Ga0587115_001636 3300059626 Bacteria 2104
3850 Ga0587117_022001 3300059627 Bacteria 898
3851 Ga0587128_000783 3300059630 Bacteria 2666
3852 Ga0587128_015607 3300059630 Bacteria 1103
3853 Ga0587062_000594 3300059639 Bacteria 2656
3854 Ga0587062_000622 3300059639 Bacteria 2617
3855 Ga0587062_014842 3300059639 Bacteria 1033
3856 Ga0587067_000326 3300059640 Bacteria 3925
3857 Ga0587067_007367 3300059640 Bacteria 1569
3858 Ga0587067_012491 3300059640 Bacteria 1327
3859 Ga0587068_000021 3300059641 Bacteria 8758
3860 Ga0587068_001485 3300059641 Bacteria 2645
3861 Ga0587068_005435 3300059641 Bacteria 1738
3862 Ga0587068_009144 3300059641 Bacteria 1452
3863 Ga0587068_010320 3300059641 Bacteria 1391
3864 Ga0587068_011420 3300059641 Bacteria 1340
3865 Ga0587068_013653 3300059641 Bacteria 1256
3866 Ga0587068_031883 3300059641 Bacteria 918
3867 Ga0587069_000151 3300059642 Bacteria 4141
3868 Ga0587069_000438 3300059642 Bacteria 3112
3869 Ga0587069_000921 3300059642 Bacteria 2494
3870 Ga0587069_024149 3300059642 Bacteria 935
3871 Ga0587072_000009 3300059643 Bacteria 12860
3872 Ga0587072_000838 3300059643 Bacteria 3457
3873 Ga0587075_016214 3300059644 Bacteria 1056
3874 Ga0587075_017486 3300059644 Bacteria 1031
3875 Ga0587076_000769 3300059645 Bacteria 2890
3876 Ga0587076_001775 3300059645 Bacteria 2283
3877 Ga0587076_003423 3300059645 Bacteria 1890
3878 Ga0587076_006767 3300059645 Bacteria 1541
3879 Ga0587076_021259 3300059645 Bacteria 1073
3880 Ga0587078_000345 3300059646 Bacteria 3317
3881 Ga0587078_003722 3300059646 Bacteria 1563
3882 Ga0587078_005707 3300059646 Bacteria 1336
3883 Ga0587079_000007 3300059647 Bacteria 11479
3884 Ga0587079_000436 3300059647 Bacteria 3627
3885 Ga0587079_001317 3300059647 Bacteria 2737
3886 Ga0587079_001499 3300059647 Bacteria 2636
3887 Ga0587079_025314 3300059647 Bacteria 1101
3888 Ga0587102_000233 3300059649 Bacteria 2805
3889 Ga0587102_002470 3300059649 Bacteria 1431
3890 Ga0587102_015863 3300059649 Bacteria 804
3891 Ga0587104_000385 3300059650 Bacteria 1820
3892 Ga0587105_000154 3300059651 Bacteria 2244
3893 Ga0587105_000319 3300059651 Bacteria 1861
3894 Ga0587107_000129 3300059652 Bacteria 3794
3895 Ga0587107_000469 3300059652 Bacteria 2649
3896 Ga0587108_000129 3300059653 Bacteria 3147
3897 Ga0587108_000215 3300059653 Bacteria 2673
3898 Ga0587124_000554 3300059660 Bacteria 2104
3899 Ga0587124_007875 3300059660 Bacteria 904
3900 Ga0587096_00059 3300060247 Bacteria 1920
3901 Ga0587071_000779 3300060344 Bacteria 3530
3902 Ga0587071_001459 3300060344 Bacteria 2959
3903 Ga0587071_002543 3300060344 Bacteria 2490
3904 Ga0587071_053619 3300060344 Bacteria 840
3905 Ga0587111_0001912 3300060346 Bacteria 2654
3906 Ga0587111_0022929 3300060346 Bacteria 1217
3907 Ga0587111_0038873 3300060346 Bacteria 1006
3908 Ga0587111_0042323 3300060346 Bacteria 976
3909 Ga0501082_0049449 3300060353 Bacteria 3626
3910 Ga0501082_0058739 3300060353 Bacteria 3314
3911 Ga0501082_0376416 3300060353 Bacteria 1239
3912 Ga0466962_0013638 3300061719 Bacteria 3911
3913 Ga0466962_0016604 3300061719 Bacteria 3550
3914 Ga0466962_0172470 3300061719 Bacteria 1053
3915 Ga0466962_0177699 3300061719 Bacteria 1037
3916 Ga0530510_0171641 3300061734 Bacteria 1606

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_11283270 Ga0207676_112832701 200
2 3300046462 Ga0495651_0363312 Ga0495651_0363312_23_634 202
3 3300046511 Ga0495608_0072568 Ga0495608_0072568_23_634 202
4 3300046524 Ga0495648_0315751 Ga0495648_0315751_87_710 202
5 3300047317 Ga0495604_0105415 Ga0495604_0105415_23_634 202
6 3300035114 Ga0373939_0309493 Ga0373939_0309493_11_622 203
7 3300044719 Ga0466971_0148255 Ga0466971_0148255_405_1079 204
8 3300049128 Ga0501308_018572 Ga0501308_018572_14_709 205
9 3300049161 Ga0501305_024328 Ga0501305_024328_126_821 205
10 3300049162 Ga0501307_012616 Ga0501307_012616_198_893 205
11 3300049539 Ga0501323_018085 Ga0501323_018085_62_679 205
12 3300044712 Ga0453684_0060229 Ga0453684_0060229_1996_2706 206
13 3300025292 Ga0209676_1014712 Ga0209676_10147126 208
14 3300048917 Ga0496114_0114033 Ga0496114_0114033_209_907 208
15 3300053093 Ga0500651_0511474 Ga0500651_0511474_13_639 208
16 3300061719 Ga0466962_0172470 Ga0466962_0172470_262_972 208
17 3300028786 Ga0307517_10104273 Ga0307517_101042733 209
18 3300049574 Ga0501038_0207818 Ga0501038_0207818_15_647 209
19 3300003399 JGI26136J50244_100632 JGI26136J50244_1006321 210
20 3300003771 Ga0055526_1006995 Ga0055526_10069957 210
21 3300003781 Ga0055536_1017482 Ga0055536_10174822 210
22 3300003784 Ga0055534_1003739 Ga0055534_10037396 210
23 3300003790 Ga0055528_1017429 Ga0055528_10174294 210
24 3300003791 Ga0055530_10012163 Ga0055530_100121632 210
25 3300003794 Ga0055531_10020406 Ga0055531_100204062 210
26 3300025273 Ga0209673_1011655 Ga0209673_10116556 210
27 3300025284 Ga0209130_1017695 Ga0209130_10176951 210
28 3300025291 Ga0209675_1013004 Ga0209675_10130043 210
29 3300025292 Ga0209676_1028341 Ga0209676_10283412 210
30 3300025292 Ga0209676_1038935 Ga0209676_10389352 210
31 3300025292 Ga0209676_1041385 Ga0209676_10413851 210
32 3300025294 Ga0209025_1014320 Ga0209025_10143202 210
33 3300025295 Ga0209564_1004754 Ga0209564_10047544 210
34 3300025298 Ga0209050_1003984 Ga0209050_10039846 210
35 3300025298 Ga0209050_1042052 Ga0209050_10420522 210
36 3300025299 Ga0209256_1036875 Ga0209256_10368752 210
37 3300025303 Ga0209051_1028019 Ga0209051_10280192 210
38 3300025304 Ga0209257_1002723 Ga0209257_10027236 210
39 3300025304 Ga0209257_1005952 Ga0209257_10059525 210
40 3300025304 Ga0209257_1025381 Ga0209257_10253813 210
41 3300027360 Ga0209969_1029654 Ga0209969_10296541 210
42 3300027378 Ga0209981_1001130 Ga0209981_10011303 210
43 3300027395 Ga0209996_1000589 Ga0209996_10005899 210
44 3300027471 Ga0209995_1001072 Ga0209995_10010724 210
45 3300027526 Ga0209968_1000400 Ga0209968_10004006 210
46 3300027543 Ga0209999_1000995 Ga0209999_10009954 210
47 3300027614 Ga0209970_1000399 Ga0209970_10003994 210
48 3300027665 Ga0209983_1018273 Ga0209983_10182732 210
49 3300027695 Ga0209966_1000297 Ga0209966_100029710 210
50 3300032004 Ga0307414_10014078 Ga0307414_100140786 210
51 3300046660 Ga0495625_0017817 Ga0495625_0017817_1854_2561 210
52 3300049530 Ga0501314_015228 Ga0501314_015228_29_724 210
53 3300049579 Ga0501043_0045254 Ga0501043_0045254_2263_2961 210
54 3300006177 Ga0075362_10002336 Ga0075362_100023364 211
55 3300006195 Ga0075366_10046781 Ga0075366_100467813 211
56 3300031456 Ga0307513_10000066 Ga0307513_1000006626 211
57 3300031730 Ga0307516_10015709 Ga0307516_100157095 211
58 3300037312 Ga0395899_0261286 Ga0395899_0261286_355_1050 211
59 3300037471 Ga0395905_0025945 Ga0395905_0025945_1940_2638 211
60 3300038443 Ga0395901_0378939 Ga0395901_0378939_469_1164 211
61 3300041451 Ga0451791_1642111 Ga0451791_1642111_111_806 211
62 3300044712 Ga0453684_0251065 Ga0453684_0251065_839_1546 211
63 3300045976 Ga0466967_0474047 Ga0466967_0474047_479_1174 211
64 3300050493 nmdc:mga0k408_10237_c1 nmdc:mga0k408_10237_c1_2496_3206 211
65 3300053093 Ga0500651_0017573 Ga0500651_0017573_1787_2482 211
66 3300001915 JGI24741J21665_1002533 JGI24741J21665_10025336 212
67 3300001979 JGI24740J21852_10018878 JGI24740J21852_100188782 212
68 3300001979 JGI24740J21852_10020966 JGI24740J21852_100209662 212
69 3300002705 JGI25156J39149_1006435 JGI25156J39149_10064354 212
70 3300002738 JGI25154J39366_1002655 JGI25154J39366_10026554 212
71 3300003479 Ga0006556J51387_1016726 Ga0006556J51387_10167269 212
72 3300003558 Ga0006558J51389_1020499 Ga0006558J51389_10204994 212
73 3300003565 Ga0006560J51390_1014141 Ga0006560J51390_10141419 212
74 3300003578 Ga0006562J51391_1022410 Ga0006562J51391_10224104 212
75 3300003752 Ga0055539_1001825 Ga0055539_10018252 212
76 3300003756 Ga0055533_1005172 Ga0055533_10051721 212
77 3300003758 Ga0055532_1000810 Ga0055532_10008106 212
78 3300003759 Ga0055525_1001045 Ga0055525_10010455 212
79 3300003760 Ga0055527_1000854 Ga0055527_10008544 212
80 3300003761 Ga0055535_1001602 Ga0055535_10016026 212
81 3300003762 Ga0055542_1004878 Ga0055542_10048785 212
82 3300003763 Ga0055529_1001175 Ga0055529_10011756 212
83 3300005337 Ga0070682_100365698 Ga0070682_1003656981 212
84 3300005339 Ga0070660_100042216 Ga0070660_1000422163 212
85 3300005344 Ga0070661_100012369 Ga0070661_1000123694 212
86 3300005366 Ga0070659_100039486 Ga0070659_1000394862 212
87 3300005455 Ga0070663_100002790 Ga0070663_1000027905 212
88 3300005564 Ga0070664_100000356 Ga0070664_1000003566 212
89 3300005577 Ga0068857_100006407 Ga0068857_1000064076 212
90 3300005578 Ga0068854_100008705 Ga0068854_1000087054 212
91 3300005614 Ga0068856_100017010 Ga0068856_1000170104 212
92 3300005616 Ga0068852_100075479 Ga0068852_1000754792 212
93 3300009093 Ga0105240_10285115 Ga0105240_102851151 212
94 3300013100 Ga0157373_10004374 Ga0157373_100043746 212
95 3300013102 Ga0157371_10005586 Ga0157371_100055866 212
96 3300013104 Ga0157370_10009078 Ga0157370_100090786 212
97 3300013105 Ga0157369_10014756 Ga0157369_100147565 212
98 3300015261 Ga0182006_1007795 Ga0182006_10077956 212
99 3300020069 Ga0197907_10276287 Ga0197907_102762876 212
100 3300020070 Ga0206356_11570777 Ga0206356_115707771 212
101 3300020076 Ga0206355_1003085 Ga0206355_10030856 212
102 3300020077 Ga0206351_10898479 Ga0206351_108984796 212
103 3300020080 Ga0206350_11381018 Ga0206350_113810181 212
104 3300020610 Ga0154015_1218269 Ga0154015_12182695 212
105 3300025224 Ga0209784_100290 Ga0209784_10029016 212
106 3300025224 Ga0209784_100890 Ga0209784_1008902 212
107 3300025224 Ga0209784_101598 Ga0209784_1015981 212
108 3300025225 Ga0209566_100422 Ga0209566_10042219 212
109 3300025225 Ga0209566_101665 Ga0209566_1016654 212
110 3300025225 Ga0209566_102009 Ga0209566_1020094 212
111 3300025226 Ga0209674_100310 Ga0209674_10031019 212
112 3300025226 Ga0209674_103534 Ga0209674_1035341 212
113 3300025228 Ga0209672_100291 Ga0209672_10029119 212
114 3300025229 Ga0209147_100090 Ga0209147_100090173 212
115 3300025230 Ga0209563_100200 Ga0209563_10020019 212
116 3300025230 Ga0209563_114285 Ga0209563_1142851 212
117 3300025242 Ga0209258_100130 Ga0209258_100130172 212
118 3300025246 Ga0209646_1000348 Ga0209646_100034810 212
119 3300025250 Ga0209026_1006910 Ga0209026_10069104 212
120 3300025253 Ga0209677_100043 Ga0209677_100043228 212
121 3300025253 Ga0209677_109258 Ga0209677_1092582 212
122 3300025254 Ga0209148_1003649 Ga0209148_10036496 212
123 3300025254 Ga0209148_1004793 Ga0209148_10047936 212
124 3300025256 Ga0209759_1013942 Ga0209759_10139421 212
125 3300025256 Ga0209759_1021433 Ga0209759_10214331 212
126 3300025272 Ga0209455_1000119 Ga0209455_100011910 212
127 3300025913 Ga0207695_10010308 Ga0207695_100103085 212
128 3300025919 Ga0207657_10094047 Ga0207657_100940472 212
129 3300025920 Ga0207649_10000400 Ga0207649_100004006 212
130 3300025932 Ga0207690_10005623 Ga0207690_100056232 212
131 3300025945 Ga0207679_10000032 Ga0207679_100000326 212
132 3300025981 Ga0207640_10006255 Ga0207640_100062556 212
133 3300026067 Ga0207678_10019676 Ga0207678_100196764 212
134 3300026078 Ga0207702_10005063 Ga0207702_100050636 212
135 3300026116 Ga0207674_10012636 Ga0207674_100126365 212
136 3300026142 Ga0207698_10061462 Ga0207698_100614624 212
137 3300037312 Ga0395899_0002718 Ga0395899_0002718_632_1327 212
138 3300037312 Ga0395899_0043190 Ga0395899_0043190_1968_2663 212
139 3300037418 Ga0395900_0082284 Ga0395900_0082284_1622_2317 212
140 3300037418 Ga0395900_0225365 Ga0395900_0225365_245_940 212
141 3300037466 Ga0395898_0145136 Ga0395898_0145136_368_1063 212
142 3300038443 Ga0395901_0004460 Ga0395901_0004460_1850_2545 212
143 3300046474 Ga0495605_0016298 Ga0495605_0016298_2898_3539 212
144 3300046506 Ga0495583_0022711 Ga0495583_0022711_2538_3176 212
145 3300046557 Ga0495622_0031478 Ga0495622_0031478_11_661 212
146 3300048918 Ga0496115_0308419 Ga0496115_0308419_468_1163 212
147 3300049128 Ga0501308_021790 Ga0501308_021790_23_718 212
148 3300049161 Ga0501305_003350 Ga0501305_003350_391_1086 212
149 3300049528 Ga0501312_010614 Ga0501312_010614_53_748 212
150 3300049541 Ga0501325_000418 Ga0501325_000418_1129_1824 212
151 3300059477 Ga0587084_017762 Ga0587084_017762_284_982 212
152 3300059492 Ga0587073_0000405 Ga0587073_0000405_711_1406 212
153 3300059505 Ga0587083_0001894 Ga0587083_0001894_356_1051 212
154 3300059605 Ga0587106_001410 Ga0587106_001410_1259_1954 212
155 3300059640 Ga0587067_007367 Ga0587067_007367_266_961 212
156 3300059642 Ga0587069_000151 Ga0587069_000151_950_1645 212
157 3300059643 Ga0587072_000009 Ga0587072_000009_1934_2629 212
158 3300059646 Ga0587078_005707 Ga0587078_005707_424_1119 212
159 3300059647 Ga0587079_001499 Ga0587079_001499_683_1378 212
160 3300059652 Ga0587107_000469 Ga0587107_000469_710_1405 212
161 3300005288 Ga0065714_10010780 Ga0065714_100107802 213
162 3300009148 Ga0105243_10401365 Ga0105243_104013651 213
163 3300014497 Ga0182008_10004539 Ga0182008_100045394 213
164 3300015261 Ga0182006_1000186 Ga0182006_10001866 213
165 3300015262 Ga0182007_10000202 Ga0182007_100002026 213
166 3300015265 Ga0182005_1001571 Ga0182005_10015716 213
167 3300017792 Ga0163161_10124402 Ga0163161_101244023 213
168 3300042876 Ga0451577_0080236 Ga0451577_0080236_1811_2506 213
169 3300044712 Ga0453684_0065899 Ga0453684_0065899_2058_2753 213
170 3300046530 Ga0495654_0022442 Ga0495654_0022442_726_1421 213
171 3300046557 Ga0495622_0078688 Ga0495622_0078688_797_1492 213
172 3300048920 Ga0496117_0000005 Ga0496117_0000005_431240_431935 213
173 3300048921 Ga0496118_0000022 Ga0496118_0000022_6668_7363 213
174 3300048924 Ga0496121_0014988 Ga0496121_0014988_1180_1875 213
175 3300048925 Ga0496122_0026262 Ga0496122_0026262_1746_2441 213
176 3300048927 Ga0496124_0076927 Ga0496124_0076927_1714_2409 213
177 3300048928 Ga0496125_0011999 Ga0496125_0011999_1992_2687 213
178 3300048929 Ga0496126_0294798 Ga0496126_0294798_584_1279 213
179 3300025921 Ga0207652_10386460 Ga0207652_103864602 214
180 3300041997 Ga0439431_0003590 Ga0439431_0003590_2159_2854 214
181 3300042012 Ga0439455_0005674 Ga0439455_0005674_293_997 214
182 3300046471 Ga0495650_0017475 Ga0495650_0017475_1902_2609 215
183 3300005467 Ga0070706_100138334 Ga0070706_1001383342 216
184 3300006051 Ga0075364_10032496 Ga0075364_100324963 216
185 3300025910 Ga0207684_10229093 Ga0207684_102290932 216
186 3300050491 nmdc:mga00v17_1799_c1 nmdc:mga00v17_1799_c1_2005_2700 216
187 3300049533 Ga0501317_009579 Ga0501317_009579_464_1123 217
188 3300032139 Ga0316580_10045538 Ga0316580_100455382 218
189 3300037471 Ga0395905_0016271 Ga0395905_0016271_863_1570 219
190 3300039062 Ga0400483_065923 Ga0400483_065923_1405_2109 219
191 3300044683 Ga0466965_0162500 Ga0466965_0162500_174_881 219
192 3300044901 Ga0466960_0010183 Ga0466960_0010183_1742_2449 219
193 3300049779 Ga0501283_024661 Ga0501283_024661_16_720 219
194 3300003781 Ga0055536_1000672 Ga0055536_100067214 220
195 3300003784 Ga0055534_1008408 Ga0055534_10084084 220
196 3300005338 Ga0068868_100085371 Ga0068868_1000853711 220
197 3300005355 Ga0070671_100080855 Ga0070671_1000808554 220
198 3300005456 Ga0070678_100071087 Ga0070678_1000710871 220
199 3300005548 Ga0070665_100157559 Ga0070665_1001575593 220
200 3300005841 Ga0068863_100042406 Ga0068863_1000424066 220
201 3300009101 Ga0105247_10158604 Ga0105247_101586041 220
202 3300013296 Ga0157374_10221607 Ga0157374_102216071 220
203 3300013307 Ga0157372_10007032 Ga0157372_100070326 220
204 3300013308 Ga0157375_10093868 Ga0157375_100938683 220
205 3300025292 Ga0209676_1001412 Ga0209676_100141215 220
206 3300025294 Ga0209025_1029328 Ga0209025_10293284 220
207 3300025295 Ga0209564_1025208 Ga0209564_10252084 220
208 3300025931 Ga0207644_10028855 Ga0207644_100288557 220
209 3300026088 Ga0207641_10189536 Ga0207641_101895361 220
210 3300028379 Ga0268266_10144187 Ga0268266_101441873 220
211 3300028794 Ga0307515_10070127 Ga0307515_100701274 220
212 3300031824 Ga0307413_10832442 Ga0307413_108324421 220
213 3300046543 Ga0495645_0082400 Ga0495645_0082400_1451_2179 220
214 3300050493 nmdc:mga0k408_295785_c1 nmdc:mga0k408_295785_c1_81_791 220
215 3300059507 Ga0587086_001217 Ga0587086_001217_1440_2135 220
216 3300059510 Ga0587090_002303 Ga0587090_002303_1357_2052 220
217 3300059660 Ga0587124_007875 Ga0587124_007875_186_881 220
218 3300060344 Ga0587071_002543 Ga0587071_002543_479_1174 220
219 3300002704 JGI25155J39150_1000033 JGI25155J39150_100003388 221
220 3300002705 JGI25156J39149_1000043 JGI25156J39149_100004388 221
221 3300002738 JGI25154J39366_1000062 JGI25154J39366_10000626 221
222 3300002741 JGI25157J39369_1000060 JGI25157J39369_100006088 221
223 3300002774 JGI25150J39212_1007173 JGI25150J39212_10071733 221
224 3300002774 JGI25150J39212_1008078 JGI25150J39212_10080783 221
225 3300002987 JGI25159J45721_1008095 JGI25159J45721_10080952 221
226 3300002987 JGI25159J45721_1008470 JGI25159J45721_10084706 221
227 3300003187 JGI25151J46595_10049203 JGI25151J46595_100492031 221
228 3300003187 JGI25151J46595_10056919 JGI25151J46595_100569192 221
229 3300003187 JGI25151J46595_10058489 JGI25151J46595_100584891 221
230 3300003354 JGI25160J50197_1013215 JGI25160J50197_10132152 221
231 3300003354 JGI25160J50197_1027842 JGI25160J50197_10278422 221
232 3300003374 JGI25161J50226_1001064 JGI25161J50226_10010645 221
233 3300003771 Ga0055526_1013133 Ga0055526_10131334 221
234 3300003773 Ga0055537_1006936 Ga0055537_10069361 221
235 3300003773 Ga0055537_1020411 Ga0055537_10204111 221
236 3300003775 Ga0055524_1004310 Ga0055524_10043104 221
237 3300003781 Ga0055536_1014497 Ga0055536_10144971 221
238 3300003784 Ga0055534_1007419 Ga0055534_10074194 221
239 3300003790 Ga0055528_1003799 Ga0055528_10037994 221
240 3300003791 Ga0055530_10014192 Ga0055530_100141921 221
241 3300003791 Ga0055530_10016596 Ga0055530_100165964 221
242 3300003792 Ga0055540_1002657 Ga0055540_10026575 221
243 3300003794 Ga0055531_10013115 Ga0055531_100131154 221
244 3300004625 Ga0055543_1000308 Ga0055543_10003083 221
245 3300005262 Ga0065165_1036732 Ga0065165_10367322 221
246 3300005327 Ga0070658_10308330 Ga0070658_103083301 221
247 3300005331 Ga0070670_100035940 Ga0070670_1000359404 221
248 3300005467 Ga0070706_100176493 Ga0070706_1001764932 221
249 3300005468 Ga0070707_100027492 Ga0070707_1000274925 221
250 3300005844 Ga0068862_100123369 Ga0068862_1001233693 221
251 3300006038 Ga0075365_10065768 Ga0075365_100657683 221
252 3300006051 Ga0075364_10039645 Ga0075364_100396456 221
253 3300006177 Ga0075362_10032123 Ga0075362_100321232 221
254 3300006237 Ga0097621_100078941 Ga0097621_1000789416 221
255 3300006880 Ga0075429_100150353 Ga0075429_1001503532 221
256 3300012513 Ga0157326_1004315 Ga0157326_10043152 221
257 3300014968 Ga0157379_10575343 Ga0157379_105753432 221
258 3300025206 Ga0209435_100041 Ga0209435_10004188 221
259 3300025245 Ga0207425_1004830 Ga0207425_10048304 221
260 3300025245 Ga0207425_1011687 Ga0207425_10116873 221
261 3300025246 Ga0209646_1000144 Ga0209646_100014488 221
262 3300025250 Ga0209026_1000159 Ga0209026_100015988 221
263 3300025256 Ga0209759_1000001 Ga0209759_10000012617 221
264 3300025258 Ga0209129_1001020 Ga0209129_10010206 221
265 3300025258 Ga0209129_1009411 Ga0209129_10094112 221
266 3300025263 Ga0209565_1000101 Ga0209565_1000101102 221
267 3300025263 Ga0209565_1008022 Ga0209565_10080221 221
268 3300025273 Ga0209673_1000687 Ga0209673_10006876 221
269 3300025284 Ga0209130_1000146 Ga0209130_10001466 221
270 3300025291 Ga0209675_1000121 Ga0209675_10001216 221
271 3300025292 Ga0209676_1000073 Ga0209676_1000073107 221
272 3300025292 Ga0209676_1007865 Ga0209676_10078656 221
273 3300025294 Ga0209025_1027439 Ga0209025_10274396 221
274 3300025294 Ga0209025_1035567 Ga0209025_10355672 221
275 3300025294 Ga0209025_1041826 Ga0209025_10418262 221
276 3300025295 Ga0209564_1007309 Ga0209564_10073096 221
277 3300025295 Ga0209564_1010601 Ga0209564_10106016 221
278 3300025295 Ga0209564_1024005 Ga0209564_10240053 221
279 3300025297 Ga0209758_1024345 Ga0209758_10243453 221
280 3300025298 Ga0209050_1000008 Ga0209050_1000008956 221
281 3300025298 Ga0209050_1037795 Ga0209050_10377952 221
282 3300025298 Ga0209050_1045415 Ga0209050_10454152 221
283 3300025299 Ga0209256_1000168 Ga0209256_10001686 221
284 3300025302 Ga0207426_1002317 Ga0207426_10023176 221
285 3300025302 Ga0207426_1010324 Ga0207426_10103246 221
286 3300025303 Ga0209051_1000005 Ga0209051_1000005956 221
287 3300025304 Ga0209257_1000031 Ga0209257_1000031546 221
288 3300025304 Ga0209257_1018425 Ga0209257_10184252 221
289 3300026041 Ga0207639_10288840 Ga0207639_102888402 221
290 3300028380 Ga0268265_10078592 Ga0268265_100785922 221
291 3300028794 Ga0307515_10001585 Ga0307515_1000158546 221
292 3300028794 Ga0307515_10011833 Ga0307515_1001183310 221
293 3300031456 Ga0307513_10009971 Ga0307513_100099716 221
294 3300031548 Ga0307408_100048129 Ga0307408_1000481292 221
295 3300031731 Ga0307405_10563102 Ga0307405_105631022 221
296 3300031901 Ga0307406_10042504 Ga0307406_100425045 221
297 3300039447 Ga0436361_0504201 Ga0436361_0504201_1902_2597 221
298 3300042876 Ga0451577_0034775 Ga0451577_0034775_1825_2526 221
299 3300044712 Ga0453684_0162566 Ga0453684_0162566_1617_2327 221
300 3300047673 Ga0495593_0132172 Ga0495593_0132172_185_853 221
301 3300048912 Ga0496109_0050661 Ga0496109_0050661_1268_1996 221
302 3300048913 Ga0496110_0270807 Ga0496110_0270807_309_1037 221
303 3300049515 Ga0501292_005697 Ga0501292_005697_948_1658 221
304 3300049527 Ga0501311_004924 Ga0501311_004924_20_685 221
305 3300049534 Ga0501318_010148 Ga0501318_010148_147_857 221
306 3300049759 Ga0501262_001632 Ga0501262_001632_181_891 221
307 3300050491 nmdc:mga00v17_20109_c1 nmdc:mga00v17_20109_c1_984_1679 221
308 3300050496 nmdc:mga07m45_94205_c1 nmdc:mga07m45_94205_c1_976_1683 221
309 3300050508 nmdc:mga09592_47092_c1 nmdc:mga09592_47092_c1_612_1322 221
310 3300053088 Ga0500644_0038571 Ga0500644_0038571_508_1203 221
311 3300053096 Ga0500641_0059964 Ga0500641_0059964_652_1347 221
312 3300053117 Ga0500593_019737 Ga0500593_019737_1890_2585 221
313 3300053730 Ga0500645_007257 Ga0500645_007257_1709_2404 221
314 3300053730 Ga0500645_010915 Ga0500645_010915_1908_2603 221
315 3300009011 Ga0105251_10023967 Ga0105251_100239674 222
316 3300009036 Ga0105244_10243091 Ga0105244_102430911 222
317 3300009092 Ga0105250_10001873 Ga0105250_100018735 222
318 3300009553 Ga0105249_10000859 Ga0105249_100008592 222
319 3300009553 Ga0105249_10089031 Ga0105249_100890314 222
320 3300025711 Ga0207696_1006933 Ga0207696_10069336 222
321 3300025728 Ga0207655_1007789 Ga0207655_10077894 222
322 3300025961 Ga0207712_10000715 Ga0207712_100007159 222
323 3300035398 Ga0316574_0018347 Ga0316574_0018347_20_688 222
324 3300036647 Ga0316582_0152126 Ga0316582_0152126_396_1067 223
325 3300041494 Ga0451837_0533322 Ga0451837_0533322_40_729 223
326 3300005444 Ga0070694_100033358 Ga0070694_1000333583 224
327 3300006846 Ga0075430_100062166 Ga0075430_1000621666 224
328 3300006847 Ga0075431_100168183 Ga0075431_1001681832 224
329 3300035113 Ga0373936_0106226 Ga0373936_0106226_135_818 224
330 3300044658 Ga0466972_0094195 Ga0466972_0094195_117_800 224
331 3300044901 Ga0466960_0040184 Ga0466960_0040184_34_717 224
332 3300050509 nmdc:mga0qj67_20252_c1 nmdc:mga0qj67_20252_c1_326_1027 224
333 3300050510 nmdc:mga06r32_177482_c1 nmdc:mga06r32_177482_c1_1325_2023 224
334 3300060353 Ga0501082_0376416 Ga0501082_0376416_386_1060 224
335 iso_pu_bacteria 2734482258 2735818159 224
336 3300003771 Ga0055526_1041603 Ga0055526_10416031 225
337 3300005289 Ga0065704_10083470 Ga0065704_100834706 225
338 3300006195 Ga0075366_10387477 Ga0075366_103874771 225
339 3300006946 Ga0079104_1000460 Ga0079104_100046027 225
340 3300009092 Ga0105250_10000429 Ga0105250_100004296 225
341 3300009148 Ga0105243_10007089 Ga0105243_100070896 225
342 3300025711 Ga0207696_1001013 Ga0207696_10010139 225
343 3300025935 Ga0207709_10000152 Ga0207709_1000015266 225
344 3300027111 Ga0209281_1000072 Ga0209281_1000072108 225
345 3300031548 Ga0307408_100127414 Ga0307408_1001274141 225
346 3300031901 Ga0307406_10638299 Ga0307406_106382991 225
347 3300044735 Ga0466968_0025947 Ga0466968_0025947_90_797 225
348 iso_pu_bacteria 2643221554 2643789310 225
349 iso_pu_bacteria 2643221638 2644212915 225
350 iso_pu_bacteria 2547132130 2547502368 226
351 iso_pu_bacteria 2571042365 2572253351 226
352 iso_pu_bacteria 2576861471 2578459534 226
353 iso_pu_bacteria 2643221559 2643816192 226
354 iso_pu_bacteria 2643221573 2643882150 226
355 iso_pu_bacteria 2643221579 2643906483 226
356 iso_pu_bacteria 2643221581 2643916680 226
357 iso_pu_bacteria 2643221586 2643938255 226
358 iso_pu_bacteria 2643221593 2643973939 226
359 iso_pu_bacteria 2643221612 2644077792 226
360 iso_pu_bacteria 2643221644 2644248151 226
361 iso_pu_bacteria 2643221720 2644660758 226
362 iso_pu_bacteria 2643221727 2644697186 226
363 iso_pu_bacteria 2643221728 2644698649 226
364 iso_pu_bacteria 2747842428 2747951344 226
365 iso_pu_bacteria 2747842501 2748019959 226
366 iso_pu_bacteria 2765235840 2765577772 226
367 iso_pu_bacteria 2816332141 2816519978 226
368 iso_pu_bacteria 2818991457 2819659594 226
369 iso_pu_bacteria 2842391507 2842395679 226
370 iso_pu_bacteria 2842757796 2842759728 226
371 iso_pu_bacteria 2852649853 2852653089 226
372 iso_pu_bacteria 2852684882 2852689573 226
373 iso_pu_bacteria 2857442823 2857445073 226
374 iso_pu_bacteria 2874220319 2874220377 226
375 iso_pu_bacteria 2919089067 2919091647 226
376 iso_pu_bacteria 2919130084 2919134550 226
377 iso_pu_bacteria 2919134579 2919134946 226
378 iso_pu_bacteria 2923516293 2923519239 226
379 iso_pu_bacteria 2928496128 2928498467 226
380 iso_pu_bacteria 2929195423 2929198929 226
381 iso_pu_bacteria 2931380184 2931381966 226
382 iso_pu_bacteria 2937610967 2937611268 226
383 iso_pu_bacteria 2939589442 2939591848 226
384 iso_pu_bacteria 2939622612 2939626775 226
385 iso_pu_bacteria 2939626828 2939631141 226
386 iso_pu_bacteria 2941475908 2941477289 226
387 iso_pu_bacteria 2941489479 2941490087 226
388 iso_pu_bacteria 2952252522 2952256186 226
389 iso_pu_bacteria 2961047084 2961047142 226
390 iso_pu_bacteria 2961064222 2961068512 226
391 iso_pu_bacteria 2974307012 2974309987 226
392 iso_pu_bacteria 2977247770 2977250722 226
393 iso_pu_bacteria 2984514374 2984514793 226
394 iso_pu_bacteria 2995948881 2995950353 226
395 iso_pu_bacteria 8002869464 8002871434 226
396 iso_pu_bacteria 8003014200 8003015013 226
397 iso_pu_bacteria 8021622325 8021626536 226
398 iso_pu_bacteria 8021626552 8021627112 226
399 iso_pu_bacteria 8021648035 8021650795 226
400 iso_pu_bacteria 8057160832 8057163885 226
401 3300005293 Ga0065715_10050774 Ga0065715_100507742 227
402 3300005339 Ga0070660_100064011 Ga0070660_1000640113 227
403 3300005354 Ga0070675_100056757 Ga0070675_1000567573 227
404 3300005457 Ga0070662_100242269 Ga0070662_1002422691 227
405 3300005458 Ga0070681_10315981 Ga0070681_103159812 227
406 3300005530 Ga0070679_100112579 Ga0070679_1001125793 227
407 3300005547 Ga0070693_100037395 Ga0070693_1000373954 227
408 3300005564 Ga0070664_100189170 Ga0070664_1001891702 227
409 3300013105 Ga0157369_10047440 Ga0157369_100474406 227
410 3300013308 Ga0157375_10238274 Ga0157375_102382741 227
411 3300025909 Ga0207705_10201973 Ga0207705_102019732 227
412 3300025919 Ga0207657_10057054 Ga0207657_100570543 227
413 3300025933 Ga0207706_10127577 Ga0207706_101275772 227
414 3300026078 Ga0207702_10238979 Ga0207702_102389792 227
415 3300034818 Ga0373950_0039719 Ga0373950_0039719_175_870 227
416 3300037418 Ga0395900_0059651 Ga0395900_0059651_1928_2620 227
417 3300038443 Ga0395901_0450770 Ga0395901_0450770_396_1088 227
418 3300038726 Ga0400490_48054 Ga0400490_48054_950_1633 227
419 3300044712 Ga0453684_0386267 Ga0453684_0386267_396_1079 227
420 3300049531 Ga0501315_000797 Ga0501315_000797_1626_2318 227
421 3300049534 Ga0501318_002453 Ga0501318_002453_540_1232 227
422 3300049539 Ga0501323_003438 Ga0501323_003438_519_1211 227
423 iso_pu_bacteria 2501025501 2501074016 227
424 iso_pu_bacteria 2501025502 2501084148 227
425 iso_pu_bacteria 2501025504 2501414325 227
426 iso_pu_bacteria 2508501125 2509132498 227
427 iso_pu_bacteria 2510065045 2510252613 227
428 iso_pu_bacteria 2510065053 2510285499 227
429 iso_pu_bacteria 2510065055 2510296081 227
430 iso_pu_bacteria 2510065058 2510313648 227
431 iso_pu_bacteria 2510917013 2511093299 227
432 iso_pu_bacteria 2510917014 2511099747 227
433 iso_pu_bacteria 2510917015 2511102482 227
434 iso_pu_bacteria 2511231002 2511245781 227
435 iso_pu_bacteria 2511231003 2511247429 227
436 iso_pu_bacteria 2511231004 2511253608 227
437 iso_pu_bacteria 2511231006 2511265621 227
438 iso_pu_bacteria 2511231006 2511265635 227
439 iso_pu_bacteria 2511231007 2511269500 227
440 iso_pu_bacteria 2511231008 2511278104 227
441 iso_pu_bacteria 2511231010 2511291656 227
442 iso_pu_bacteria 2511231011 2511294279 227
443 iso_pu_bacteria 2511231012 2511299300 227
444 iso_pu_bacteria 2511231014 2511312682 227
445 iso_pu_bacteria 2511231015 2511321189 227
446 iso_pu_bacteria 2511231016 2511325840 227
447 iso_pu_bacteria 2511231017 2511332023 227
448 iso_pu_bacteria 2511231018 2511339309 227
449 iso_pu_bacteria 2511231019 2511345358 227
450 iso_pu_bacteria 2511231020 2511353094 227
451 iso_pu_bacteria 2511231021 2511359666 227
452 iso_pu_bacteria 2511231022 2511364576 227
453 iso_pu_bacteria 2511231023 2511369321 227
454 iso_pu_bacteria 2511231024 2511372736 227
455 iso_pu_bacteria 2511231031 2511414700 227
456 iso_pu_bacteria 2511231156 2511827303 227
457 iso_pu_bacteria 2512047018 2512327899 227
458 iso_pu_bacteria 2512047030 2512348471 227
459 iso_pu_bacteria 2513020051 2513228106 227
460 iso_pu_bacteria 2513237082 2513558317 227
461 iso_pu_bacteria 2513237083 2513566179 227
462 iso_pu_bacteria 2513237150 2513957868 227
463 iso_pu_bacteria 2513237151 2513962562 227
464 iso_pu_bacteria 2513237165 2514045817 227
465 iso_pu_bacteria 2513237166 2514054872 227
466 iso_pu_bacteria 2515154122 2515686469 227
467 iso_pu_bacteria 2515154123 2515692607 227
468 iso_pu_bacteria 2515154189 2516025154 227
469 iso_pu_bacteria 2519103095 2519457485 227
470 iso_pu_bacteria 2524614729 2525558540 227
471 iso_pu_bacteria 2526164713 2527080923 227
472 iso_pu_bacteria 2547132374 2548501915 227
473 iso_pu_bacteria 2548876994 2550696710 227
474 iso_pu_bacteria 2551306352 2552746168 227
475 iso_pu_bacteria 2554235132 2554813057 227
476 iso_pu_bacteria 2554235231 2555249105 227
477 iso_pu_bacteria 2554235341 2555672489 227
478 iso_pu_bacteria 2562617112 2563061492 227
479 iso_pu_bacteria 2582580891 2583794995 227
480 iso_pu_bacteria 2582581311 2585295833 227
481 iso_pu_bacteria 2585428057 2587730938 227
482 iso_pu_bacteria 2585428058 2587737154 227
483 iso_pu_bacteria 2585428062 2587760252 227
484 iso_pu_bacteria 2588253510 2588295870 227
485 iso_pu_bacteria 2596583598 2597031679 227
486 iso_pu_bacteria 2597489887 2597860551 227
487 iso_pu_bacteria 2597489888 2597866304 227
488 iso_pu_bacteria 2597489889 2597872149 227
489 iso_pu_bacteria 2599185155 2599329221 227
490 iso_pu_bacteria 2599185160 2599358540 227
491 iso_pu_bacteria 2599185161 2599364855 227
492 iso_pu_bacteria 2599185162 2599371177 227
493 iso_pu_bacteria 2599185163 2599377543 227
494 iso_pu_bacteria 2599185164 2599383820 227
495 iso_pu_bacteria 2599185165 2599390082 227
496 iso_pu_bacteria 2599185166 2599396402 227
497 iso_pu_bacteria 2599185167 2599401209 227
498 iso_pu_bacteria 2599185168 2599408591 227
499 iso_pu_bacteria 2599185169 2599413660 227
500 iso_pu_bacteria 2599185178 2599448144 227
501 iso_pu_bacteria 2599185179 2599452938 227
502 iso_pu_bacteria 2599185181 2599465526 227
503 iso_pu_bacteria 2599185182 2599471805 227
504 iso_pu_bacteria 2599185185 2599488088 227
505 iso_pu_bacteria 2599185186 2599494341 227
506 iso_pu_bacteria 2599185188 2599505426 227
507 iso_pu_bacteria 2599185189 2599509687 227
508 iso_pu_bacteria 2599185190 2599516287 227
509 iso_pu_bacteria 2599185191 2599520100 227
510 iso_pu_bacteria 2599185212 2599617046 227
511 iso_pu_bacteria 2599185214 2599621305 227
512 iso_pu_bacteria 2599185226 2599675324 227
513 iso_pu_bacteria 2599185227 2599678078 227
514 iso_pu_bacteria 2599185229 2599690816 227
515 iso_pu_bacteria 2599185239 2599742142 227
516 iso_pu_bacteria 2599185240 2599749289 227
517 iso_pu_bacteria 2599185248 2599773779 227
518 iso_pu_bacteria 2599185257 2599807284 227
519 iso_pu_bacteria 2599185288 2599881543 227
520 iso_pu_bacteria 2599185289 2599890121 227
521 iso_pu_bacteria 2599185290 2599895741 227
522 iso_pu_bacteria 2599185291 2599902015 227
523 iso_pu_bacteria 2599185292 2599907803 227
524 iso_pu_bacteria 2599185300 2599935149 227
525 iso_pu_bacteria 2599185302 2599946430 227
526 iso_pu_bacteria 2599185303 2599951941 227
527 iso_pu_bacteria 2599185304 2599957741 227
528 iso_pu_bacteria 2599185305 2599963836 227
529 iso_pu_bacteria 2599185306 2599969883 227
530 iso_pu_bacteria 2599185307 2599973983 227
531 iso_pu_bacteria 2599185308 2599981440 227
532 iso_pu_bacteria 2599185309 2599986966 227
533 iso_pu_bacteria 2599185310 2599992327 227
534 iso_pu_bacteria 2599185311 2599997991 227
535 iso_pu_bacteria 2599185312 2600003266 227
536 iso_pu_bacteria 2599185313 2600009342 227
537 iso_pu_bacteria 2599185314 2600015260 227
538 iso_pu_bacteria 2599185315 2600021548 227
539 iso_pu_bacteria 2599185316 2600027224 227
540 iso_pu_bacteria 2599185317 2600033091 227
541 iso_pu_bacteria 2599185318 2600039356 227
542 iso_pu_bacteria 2599185319 2600045253 227
543 iso_pu_bacteria 2599185320 2600050673 227
544 iso_pu_bacteria 2599185321 2600056708 227
545 iso_pu_bacteria 2599185322 2600062862 227
546 iso_pu_bacteria 2599185323 2600068733 227
547 iso_pu_bacteria 2599185324 2600074775 227
548 iso_pu_bacteria 2599185325 2600080642 227
549 iso_pu_bacteria 2599185355 2600211408 227
550 iso_pu_bacteria 2599185356 2600211700 227
551 iso_pu_bacteria 2600254930 2600362345 227
552 iso_pu_bacteria 2600254931 2600368500 227
553 iso_pu_bacteria 2600254954 2600442885 227
554 iso_pu_bacteria 2600255067 2600815519 227
555 iso_pu_bacteria 2600255254 2601526325 227
556 iso_pu_bacteria 2600255255 2601531349 227
557 iso_pu_bacteria 2600255280 2601618207 227
558 iso_pu_bacteria 2600255281 2601623216 227
559 iso_pu_bacteria 2600255283 2601628580 227
560 iso_pu_bacteria 2600255287 2601646609 227
561 iso_pu_bacteria 2600255288 2601651622 227
562 iso_pu_bacteria 2600255289 2601656630 227
563 iso_pu_bacteria 2600255290 2601661636 227
564 iso_pu_bacteria 2600255291 2601666568 227
565 iso_pu_bacteria 2600255292 2601667100 227
566 iso_pu_bacteria 2600255296 2601693758 227
567 iso_pu_bacteria 2600255298 2601699504 227
568 iso_pu_bacteria 2600255299 2601704439 227
569 iso_pu_bacteria 2600255300 2601709438 227
570 iso_pu_bacteria 2600255301 2601714454 227
571 iso_pu_bacteria 2600255302 2601719486 227
572 iso_pu_bacteria 2600255303 2601724387 227
573 iso_pu_bacteria 2600255304 2601729408 227
574 iso_pu_bacteria 2600255305 2601734431 227
575 iso_pu_bacteria 2600255306 2601739445 227
576 iso_pu_bacteria 2600255307 2601744542 227
577 iso_pu_bacteria 2600255309 2601755073 227
578 iso_pu_bacteria 2600255313 2601771874 227
579 iso_pu_bacteria 2600255318 2601801190 227
580 iso_pu_bacteria 2600255389 2602007926 227
581 iso_pu_bacteria 2600255392 2602022364 227
582 iso_pu_bacteria 2602042052 2603659232 227
583 iso_pu_bacteria 2602042053 2603664125 227
584 iso_pu_bacteria 2602042103 2603836781 227
585 iso_pu_bacteria 2602042104 2603841884 227
586 iso_pu_bacteria 2602042105 2603846957 227
587 iso_pu_bacteria 2602042106 2603852004 227
588 iso_pu_bacteria 2602042110 2603869599 227
589 iso_pu_bacteria 2602042111 2603874751 227
590 iso_pu_bacteria 2603880178 2606046785 227
591 iso_pu_bacteria 2603880184 2606068555 227
592 iso_pu_bacteria 2603880185 2606073291 227
593 iso_pu_bacteria 2603880199 2606126152 227
594 iso_pu_bacteria 2603880202 2606144457 227
595 iso_pu_bacteria 2603880211 2606174674 227
596 iso_pu_bacteria 2606217733 2608385445 227
597 iso_pu_bacteria 2619619299 2621297160 227
598 iso_pu_bacteria 2623620443 2624483077 227
599 iso_pu_bacteria 2623620446 2624494609 227
600 iso_pu_bacteria 2627854209 2630650596 227
601 iso_pu_bacteria 2643221544 2643746713 227
602 iso_pu_bacteria 2643221556 2643799320 227
603 iso_pu_bacteria 2643221565 2643845055 227
604 iso_pu_bacteria 2643221569 2643864010 227
605 iso_pu_bacteria 2643221570 2643866454 227
606 iso_pu_bacteria 2643221571 2643870749 227
607 iso_pu_bacteria 2643221585 2643933850 227
608 iso_pu_bacteria 2643221589 2643957749 227
609 iso_pu_bacteria 2643221592 2643971582 227
610 iso_pu_bacteria 2643221594 2643980181 227
611 iso_pu_bacteria 2643221596 2643991867 227
612 iso_pu_bacteria 2643221602 2644025865 227
613 iso_pu_bacteria 2643221609 2644057305 227
614 iso_pu_bacteria 2643221611 2644072598 227
615 iso_pu_bacteria 2643221621 2644122596 227
616 iso_pu_bacteria 2643221625 2644142858 227
617 iso_pu_bacteria 2643221628 2644161148 227
618 iso_pu_bacteria 2643221633 2644188221 227
619 iso_pu_bacteria 2643221639 2644218925 227
620 iso_pu_bacteria 2643221645 2644251649 227
621 iso_pu_bacteria 2643221646 2644257050 227
622 iso_pu_bacteria 2643221648 2644275771 227
623 iso_pu_bacteria 2643221650 2644286035 227
624 iso_pu_bacteria 2643221652 2644293262 227
625 iso_pu_bacteria 2643221654 2644305928 227
626 iso_pu_bacteria 2643221656 2644315344 227
627 iso_pu_bacteria 2643221658 2644325614 227
628 iso_pu_bacteria 2643221664 2644356006 227
629 iso_pu_bacteria 2643221665 2644364226 227
630 iso_pu_bacteria 2643221672 2644400999 227
631 iso_pu_bacteria 2643221683 2644469698 227
632 iso_pu_bacteria 2643221684 2644472510 227
633 iso_pu_bacteria 2643221713 2644621362 227
634 iso_pu_bacteria 2643221717 2644647266 227
635 iso_pu_bacteria 2651869719 2652546273 227
636 iso_pu_bacteria 2667528170 2671094256 227
637 iso_pu_bacteria 2667528171 2671100592 227
638 iso_pu_bacteria 2667528176 2671129768 227
639 iso_pu_bacteria 2671180172 2671773158 227
640 iso_pu_bacteria 2675903046 2676410332 227
641 iso_pu_bacteria 2675903129 2676745844 227
642 iso_pu_bacteria 2675903420 2677899103 227
643 iso_pu_bacteria 2675903507 2678229940 227
644 iso_pu_bacteria 2675903515 2678265818 227
645 iso_pu_bacteria 2711768613 2713478643 227
646 iso_pu_bacteria 2713897149 2715759521 227
647 iso_pu_bacteria 2718217991 2719641711 227
648 iso_pu_bacteria 2721755523 2722881272 227
649 iso_pu_bacteria 2721755607 2723251040 227
650 iso_pu_bacteria 2728369097 2729147964 227
651 iso_pu_bacteria 2738541265 2738673098 227
652 iso_pu_bacteria 2738541271 2738690933 227
653 iso_pu_bacteria 2738541277 2738723136 227
654 iso_pu_bacteria 2738541280 2738738192 227
655 iso_pu_bacteria 2738541282 2738751491 227
656 iso_pu_bacteria 2738541294 2738810094 227
657 iso_pu_bacteria 2738541296 2738824059 227
658 iso_pu_bacteria 2738541297 2738826688 227
659 iso_pu_bacteria 2738541298 2738836450 227
660 iso_pu_bacteria 2738541300 2738843002 227
661 iso_pu_bacteria 2738541303 2738860532 227
662 iso_pu_bacteria 2738541306 2738877980 227
663 iso_pu_bacteria 2738541307 2738882598 227
664 iso_pu_bacteria 2738541309 2738897454 227
665 iso_pu_bacteria 2738541337 2739057947 227
666 iso_pu_bacteria 2738541357 2739150485 227
667 iso_pu_bacteria 2738543002 2739189686 227
668 iso_pu_bacteria 2738543003 2739192404 227
669 iso_pu_bacteria 2738543004 2739200432 227
670 iso_pu_bacteria 2738543008 2739224573 227
671 iso_pu_bacteria 2738543012 2739241569 227
672 iso_pu_bacteria 2738543013 2739249838 227
673 iso_pu_bacteria 2738543015 2739262115 227
674 iso_pu_bacteria 2738543016 2739266930 227
675 iso_pu_bacteria 2738543018 2739273750 227
676 iso_pu_bacteria 2738543019 2739283867 227
677 iso_pu_bacteria 2738543020 2739287289 227
678 iso_pu_bacteria 2738543021 2739292602 227
679 iso_pu_bacteria 2738543025 2739315032 227
680 iso_pu_bacteria 2738543026 2739318881 227
681 iso_pu_bacteria 2738543029 2739337122 227
682 iso_pu_bacteria 2738543030 2739342794 227
683 iso_pu_bacteria 2739367655 2739611137 227
684 iso_pu_bacteria 2740892503 2743740105 227
685 iso_pu_bacteria 2744054620 2745007052 227
686 iso_pu_bacteria 2744054655 2745162452 227
687 iso_pu_bacteria 2751185846 2753569824 227
688 iso_pu_bacteria 2765235841 2765586297 227
689 iso_pu_bacteria 2773857670 2774121978 227
690 iso_pu_bacteria 2773857672 2774129640 227
691 iso_pu_bacteria 2773857673 2774138574 227
692 iso_pu_bacteria 2784132063 2784262153 227
693 iso_pu_bacteria 2784132072 2784317995 227
694 iso_pu_bacteria 2791355137 2792840102 227
695 iso_pu_bacteria 2791355520 2794598512 227
696 iso_pu_bacteria 2806310737 2807410531 227
697 iso_pu_bacteria 2806310745 2807458876 227
698 iso_pu_bacteria 2808606361 2808858850 227
699 iso_pu_bacteria 2808606373 2808906448 227
700 iso_pu_bacteria 2808606376 2808927263 227
701 iso_pu_bacteria 2808606377 2808932399 227
702 iso_pu_bacteria 2808606378 2808938658 227
703 iso_pu_bacteria 2808606380 2808949382 227
704 iso_pu_bacteria 2808606381 2808954520 227
705 iso_pu_bacteria 2808606382 2808961302 227
706 iso_pu_bacteria 2808606383 2808967348 227
707 iso_pu_bacteria 2808606385 2808977415 227
708 iso_pu_bacteria 2808606388 2808992927 227
709 iso_pu_bacteria 2808606389 2809002179 227
710 iso_pu_bacteria 2808606390 2809009398 227
711 iso_pu_bacteria 2808606391 2809016553 227
712 iso_pu_bacteria 2808606395 2809033353 227
713 iso_pu_bacteria 2808606418 2809145969 227
714 iso_pu_bacteria 2808606445 2809219106 227
715 iso_pu_bacteria 2811994881 2812369112 227
716 iso_pu_bacteria 2816332133 2816471127 227
717 iso_pu_bacteria 2816332253 2817259675 227
718 iso_pu_bacteria 2816332256 2817277344 227
719 iso_pu_bacteria 2816332286 2817453510 227
720 iso_pu_bacteria 2816332298 2817493722 227
721 iso_pu_bacteria 2818991445 2819594377 227
722 iso_pu_bacteria 2818991446 2819602807 227
723 iso_pu_bacteria 2818991452 2819636765 227
724 iso_pu_bacteria 2818991456 2819659375 227
725 iso_pu_bacteria 2818991464 2819706258 227
726 iso_pu_bacteria 2821131069 2821136288 227
727 iso_pu_bacteria 2823421272 2823421952 227
728 iso_pu_bacteria 2825651385 2825655434 227
729 iso_pu_bacteria 2831265667 2831270163 227
730 iso_pu_bacteria 2831864461 2831866804 227
731 iso_pu_bacteria 2834028612 2834033083 227
732 iso_pu_bacteria 2834641062 2834642635 227
733 iso_pu_bacteria 2838054893 2838061790 227
734 iso_pu_bacteria 2839138175 2839144747 227
735 iso_pu_bacteria 2842677519 2842681453 227
736 iso_pu_bacteria 2842711865 2842717716 227
737 iso_pu_bacteria 2842718218 2842722040 227
738 iso_pu_bacteria 2842733646 2842737336 227
739 iso_pu_bacteria 2842747753 2842749928 227
740 iso_pu_bacteria 2842805378 2842810199 227
741 iso_pu_bacteria 2842826826 2842828970 227
742 iso_pu_bacteria 2842837860 2842840591 227
743 iso_pu_bacteria 2842854478 2842859253 227
744 iso_pu_bacteria 2844665904 2844666664 227
745 iso_pu_bacteria 2846033681 2846034358 227
746 iso_pu_bacteria 2852612431 2852617977 227
747 iso_pu_bacteria 2852657418 2852663307 227
748 iso_pu_bacteria 2852667396 2852673035 227
749 iso_pu_bacteria 2855730933 2855731279 227
750 iso_pu_bacteria 2855767633 2855767967 227
751 iso_pu_bacteria 2856287931 2856289438 227
752 iso_pu_bacteria 2857357740 2857362310 227
753 iso_pu_bacteria 2857537821 2857538160 227
754 iso_pu_bacteria 2857542790 2857543657 227
755 iso_pu_bacteria 2857547612 2857548996 227
756 iso_pu_bacteria 2857553236 2857556364 227
757 iso_pu_bacteria 2857558681 2857563380 227
758 iso_pu_bacteria 2857564685 2857567911 227
759 iso_pu_bacteria 2857576091 2857580939 227
760 iso_pu_bacteria 2858950400 2858951968 227
761 iso_pu_bacteria 2860339153 2860344069 227
762 iso_pu_bacteria 2860867994 2860872701 227
763 iso_pu_bacteria 2863421361 2863426526 227
764 iso_pu_bacteria 2870068957 2870069432 227
765 iso_pu_bacteria 2878029506 2878035015 227
766 iso_pu_bacteria 2880230671 2880235657 227
767 iso_pu_bacteria 2881412998 2881416755 227
768 iso_pu_bacteria 2881927736 2881931572 227
769 iso_pu_bacteria 2883087390 2883095550 227
770 iso_pu_bacteria 2884811622 2884814295 227
771 iso_pu_bacteria 2884836552 2884840774 227
772 iso_pu_bacteria 2884852848 2884857630 227
773 iso_pu_bacteria 2885080285 2885080586 227
774 iso_pu_bacteria 2885192300 2885195787 227
775 iso_pu_bacteria 2885198086 2885201413 227
776 iso_pu_bacteria 2885211737 2885215067 227
777 iso_pu_bacteria 2885266251 2885269561 227
778 iso_pu_bacteria 2885270888 2885272329 227
779 iso_pu_bacteria 2887375801 2887376446 227
780 iso_pu_bacteria 2887630918 2887633761 227
781 iso_pu_bacteria 2894414249 2894416029 227
782 iso_pu_bacteria 2895511927 2895516233 227
783 iso_pu_bacteria 2896154374 2896158570 227
784 iso_pu_bacteria 2899924645 2899927927 227
785 iso_pu_bacteria 2900577576 2900581885 227
786 iso_pu_bacteria 2902682994 2902690497 227
787 iso_pu_bacteria 2904424332 2904427828 227
788 iso_pu_bacteria 2904434214 2904438953 227
789 iso_pu_bacteria 2904449895 2904454249 227
790 iso_pu_bacteria 2904456579 2904462990 227
791 iso_pu_bacteria 2904483920 2904490084 227
792 iso_pu_bacteria 2904518522 2904522482 227
793 iso_pu_bacteria 2904541872 2904545841 227
794 iso_pu_bacteria 2904550169 2904554223 227
795 iso_pu_bacteria 2904564687 2904569310 227
796 iso_pu_bacteria 2904571731 2904576853 227
797 iso_pu_bacteria 2904615490 2904616946 227
798 iso_pu_bacteria 2908446538 2908452240 227
799 iso_pu_bacteria 2912963787 2912968569 227
800 iso_pu_bacteria 2913036834 2913042225 227
801 iso_pu_bacteria 2916699645 2916700357 227
802 iso_pu_bacteria 2917070673 2917076375 227
803 iso_pu_bacteria 2917832318 2917834728 227
804 iso_pu_bacteria 2919063839 2919067607 227
805 iso_pu_bacteria 2919125081 2919127252 227
806 iso_pu_bacteria 2919155634 2919158567 227
807 iso_pu_bacteria 2919456309 2919461573 227
808 iso_pu_bacteria 2919462493 2919467939 227
809 iso_pu_bacteria 2919476304 2919476871 227
810 iso_pu_bacteria 2919481497 2919486050 227
811 iso_pu_bacteria 2919501602 2919506580 227
812 iso_pu_bacteria 2919506607 2919509712 227
813 iso_pu_bacteria 2919527303 2919534298 227
814 iso_pu_bacteria 2919697872 2919701275 227
815 iso_pu_bacteria 2923153595 2923159195 227
816 iso_pu_bacteria 2923519811 2923523193 227
817 iso_pu_bacteria 2923586266 2923591173 227
818 iso_pu_bacteria 2926063275 2926068255 227
819 iso_pu_bacteria 2928037797 2928042449 227
820 iso_pu_bacteria 2928044640 2928048474 227
821 iso_pu_bacteria 2928051484 2928054799 227
822 iso_pu_bacteria 2928058823 2928063760 227
823 iso_pu_bacteria 2928064002 2928068218 227
824 iso_pu_bacteria 2928070936 2928073893 227
825 iso_pu_bacteria 2928084124 2928086173 227
826 iso_pu_bacteria 2928157003 2928163019 227
827 iso_pu_bacteria 2928163908 2928170780 227
828 iso_pu_bacteria 2928170801 2928179015 227
829 iso_pu_bacteria 2928515477 2928516613 227
830 iso_pu_bacteria 2928536128 2928541987 227
831 iso_pu_bacteria 2929144301 2929149611 227
832 iso_pu_bacteria 2929160207 2929161027 227
833 iso_pu_bacteria 2929189879 2929194813 227
834 iso_pu_bacteria 2929520902 2929525001 227
835 iso_pu_bacteria 2931369376 2931372983 227
836 iso_pu_bacteria 2931390751 2931396090 227
837 iso_pu_bacteria 2931396565 2931397733 227
838 iso_pu_bacteria 2932410948 2932416622 227
839 iso_pu_bacteria 2932416698 2932422366 227
840 iso_pu_bacteria 2932422444 2932426048 227
841 iso_pu_bacteria 2935353572 2935359906 227
842 iso_pu_bacteria 2939636861 2939641997 227
843 iso_pu_bacteria 2939651529 2939654518 227
844 iso_pu_bacteria 2941479691 2941485904 227
845 iso_pu_bacteria 2945909444 2945915906 227
846 iso_pu_bacteria 2945928738 2945931243 227
847 iso_pu_bacteria 2945934425 2945934598 227
848 iso_pu_bacteria 2945945610 2945950141 227
849 iso_pu_bacteria 2945961074 2945966461 227
850 iso_pu_bacteria 2945984333 2945988662 227
851 iso_pu_bacteria 2946006987 2946007279 227
852 iso_pu_bacteria 2946027586 2946033318 227
853 iso_pu_bacteria 2947233263 2947234094 227
854 iso_pu_bacteria 2954767861 2954770387 227
855 iso_pu_bacteria 2969304461 2969309842 227
856 iso_pu_bacteria 2974298342 2974301959 227
857 iso_pu_bacteria 2974320154 2974321845 227
858 iso_pu_bacteria 2981990288 2981996134 227
859 iso_pu_bacteria 2984286254 2984286953 227
860 iso_pu_bacteria 2984499530 2984500473 227
861 iso_pu_bacteria 2984504281 2984506987 227
862 iso_pu_bacteria 2988728565 2988731157 227
863 iso_pu_bacteria 2989392574 2989393071 227
864 iso_pu_bacteria 2990703756 2990704843 227
865 iso_pu_bacteria 2990710928 2990714497 227
866 iso_pu_bacteria 2998344455 2998344598 227
867 iso_pu_bacteria 3007395558 3007398842 227
868 iso_pu_bacteria 3007419365 3007425383 227
869 iso_pu_bacteria 3007511990 3007516860 227
870 iso_pu_bacteria 3007619802 3007621553 227
871 iso_pu_bacteria 3007803356 3007808977 227
872 iso_pu_bacteria 3007855910 3007860272 227
873 iso_pu_bacteria 3007861166 3007866529 227
874 iso_pu_bacteria 3007866637 3007867081 227
875 iso_pu_bacteria 3007872151 3007873885 227
876 iso_pu_bacteria 637000220 637322927 227
877 iso_pu_bacteria 640427133 640486731 227
878 iso_pu_bacteria 641736151 642427604 227
879 iso_pu_bacteria 641736154 642418351 227
880 iso_pu_bacteria 642555112 642594647 227
881 iso_pu_bacteria 644736347 644749276 227
882 iso_pu_bacteria 651053060 651174582 227
883 iso_pu_bacteria 8001522603 8001524051 227
884 iso_pu_bacteria 8002392321 8002396152 227
885 iso_pu_bacteria 8002745576 8002747952 227
886 iso_pu_bacteria 8003955200 8003962462 227
887 iso_pu_bacteria 8011350971 8011355287 227
888 iso_pu_bacteria 8015687852 8015693283 227
889 iso_pu_bacteria 8016728285 8016730946 227
890 iso_pu_bacteria 8018845410 8018847899 227
891 iso_pu_bacteria 8019769354 8019771146 227
892 iso_pu_bacteria 8019775933 8019780543 227
893 iso_pu_bacteria 8020807995 8020813887 227
894 iso_pu_bacteria 8020938398 8020939077 227
895 iso_pu_bacteria 8020945358 8020947792 227
896 iso_pu_bacteria 8020953355 8020953376 227
897 iso_pu_bacteria 8021120328 8021127483 227
898 iso_pu_bacteria 8034962539 8034966814 227
899 iso_pu_bacteria 8039098773 8039100031 227
900 iso_pu_bacteria 8040167225 8040171464 227
901 iso_pu_bacteria 8040173305 8040174078 227
902 iso_pu_bacteria 8047673197 8047676177 227
903 iso_pu_bacteria 8048746797 8048747957 227
904 iso_pu_bacteria 8052494512 8052499512 227
905 iso_pu_bacteria 8054285046 8054290263 227
906 iso_pu_bacteria 8054347763 8054352845 227
907 iso_pu_bacteria 8054503363 8054508589 227
908 iso_pu_bacteria 8054929484 8054933478 227
909 iso_pu_bacteria 8055225921 8055227077 227
910 iso_pu_bacteria 8055266321 8055269393 227
911 iso_pu_bacteria 8055301274 8055307445 227
912 iso_pu_bacteria 8055770955 8055776533 227
913 iso_pu_bacteria 8055817908 8055823564 227
914 iso_pu_bacteria 8055878733 8055883998 227
915 iso_pu_bacteria 8056115690 8056115824 227
916 iso_pu_bacteria 8056120720 8056121217 227
917 iso_pu_bacteria 8056125926 8056131277 227
918 iso_pu_bacteria 8056131705 8056136994 227
919 iso_pu_bacteria 8056137416 8056137934 227
920 iso_pu_bacteria 8056143049 8056148432 227
921 iso_pu_bacteria 8056148874 8056151818 227
922 iso_pu_bacteria 8056155041 8056156486 227
923 iso_pu_bacteria 8056161164 8056163289 227
924 iso_pu_bacteria 8056172158 8056172169 227
925 iso_pu_bacteria 8056177738 8056179354 227
926 iso_pu_bacteria 8056569372 8056572116 227
927 iso_pu_bacteria 8057798959 8057803954 227
928 3300005355 Ga0070671_100503577 Ga0070671_1005035772 228
929 3300005435 Ga0070714_100091839 Ga0070714_1000918391 228
930 3300005435 Ga0070714_100115809 Ga0070714_1001158092 228
931 3300005436 Ga0070713_100030888 Ga0070713_1000308886 228
932 3300005439 Ga0070711_100050127 Ga0070711_1000501275 228
933 3300005614 Ga0068856_100114691 Ga0068856_1001146913 228
934 3300006028 Ga0070717_10008147 Ga0070717_100081476 228
935 3300006163 Ga0070715_10070390 Ga0070715_100703901 228
936 3300006175 Ga0070712_100080569 Ga0070712_1000805692 228
937 3300006195 Ga0075366_10425100 Ga0075366_104251002 228
938 3300007076 Ga0075435_100252679 Ga0075435_1002526793 228
939 3300009979 Ga0105032_100739 Ga0105032_1007391 228
940 3300021358 Ga0213873_10136919 Ga0213873_101369191 228
941 3300021377 Ga0213874_10013432 Ga0213874_100134323 228
942 3300025905 Ga0207685_10042212 Ga0207685_100422121 228
943 3300025906 Ga0207699_10020171 Ga0207699_100201713 228
944 3300025915 Ga0207693_10039591 Ga0207693_100395913 228
945 3300025928 Ga0207700_10078524 Ga0207700_100785245 228
946 3300025929 Ga0207664_10001424 Ga0207664_100014249 228
947 3300025939 Ga0207665_10136361 Ga0207665_101363611 228
948 3300026078 Ga0207702_10168181 Ga0207702_101681812 228
949 3300026078 Ga0207702_10828289 Ga0207702_108282892 228
950 3300027252 Ga0209973_1000651 Ga0209973_10006515 228
951 3300027360 Ga0209969_1007040 Ga0209969_10070401 228
952 3300027364 Ga0209967_1003102 Ga0209967_10031021 228
953 3300027471 Ga0209995_1013553 Ga0209995_10135532 228
954 3300027543 Ga0209999_1035985 Ga0209999_10359851 228
955 3300027552 Ga0209982_1004681 Ga0209982_10046812 228
956 3300027614 Ga0209970_1001887 Ga0209970_10018874 228
957 3300027617 Ga0210002_1002230 Ga0210002_10022302 228
958 3300027665 Ga0209983_1001182 Ga0209983_10011824 228
959 3300027682 Ga0209971_1001747 Ga0209971_10017475 228
960 3300031548 Ga0307408_100784450 Ga0307408_1007844502 228
961 3300032005 Ga0307411_10232377 Ga0307411_102323772 228
962 3300035398 Ga0316574_0006051 Ga0316574_0006051_2986_3672 228
963 3300036647 Ga0316582_0215530 Ga0316582_0215530_425_1111 228
964 3300039437 Ga0436365_0618827 Ga0436365_0618827_1076_1762 228
965 3300039437 Ga0436365_0984881 Ga0436365_0984881_99_785 228
966 3300039438 Ga0436360_0247559 Ga0436360_0247559_196_882 228
967 3300039447 Ga0436361_0085139 Ga0436361_0085139_1323_2009 228
968 3300039447 Ga0436361_0708121 Ga0436361_0708121_161_856 228
969 3300039450 Ga0436363_1436445 Ga0436363_1436445_5482_6168 228
970 3300039453 Ga0436362_0483546 Ga0436362_0483546_1712_2398 228
971 3300039453 Ga0436362_1143657 Ga0436362_1143657_688_1374 228
972 3300044693 Ga0466961_0052166 Ga0466961_0052166_44_733 228
973 3300044712 Ga0453684_0792490 Ga0453684_0792490_44_733 228
974 3300046674 Ga0495588_0084039 Ga0495588_0084039_178_864 228
975 3300048904 Ga0496101_0284420 Ga0496101_0284420_342_1028 228
976 3300049568 Ga0501031_0065381 Ga0501031_0065381_1423_2118 228
977 3300049571 Ga0501034_0088473 Ga0501034_0088473_1881_2576 228
978 3300049573 Ga0501037_0162619 Ga0501037_0162619_436_1131 228
979 3300049574 Ga0501038_0039430 Ga0501038_0039430_1654_2349 228
980 3300049584 Ga0501068_0362549 Ga0501068_0362549_213_908 228
981 3300049586 Ga0501070_0072265 Ga0501070_0072265_283_978 228
982 3300049662 Ga0501222_009361 Ga0501222_009361_464_1165 228
983 3300049822 Ga0501035_0035341 Ga0501035_0035341_2046_2741 228
984 3300050493 nmdc:mga0k408_422093_c1 nmdc:mga0k408_422093_c1_40_726 228
985 3300050493 nmdc:mga0k408_74656_c1 nmdc:mga0k408_74656_c1_1246_1932 228
986 3300002773 JGI25152J39213_1001911 JGI25152J39213_10019114 229
987 3300002774 JGI25150J39212_1001072 JGI25150J39212_10010724 229
988 3300003187 JGI25151J46595_10008142 JGI25151J46595_100081424 229
989 3300003187 JGI25151J46595_10009416 JGI25151J46595_100094164 229
990 3300003215 JGI25153J46596_10003805 JGI25153J46596_100038054 229
991 3300003215 JGI25153J46596_10005611 JGI25153J46596_100056114 229
992 3300003215 JGI25153J46596_10045449 JGI25153J46596_100454491 229
993 3300003771 Ga0055526_1008227 Ga0055526_10082274 229
994 3300003773 Ga0055537_1003514 Ga0055537_10035144 229
995 3300003775 Ga0055524_1006155 Ga0055524_10061554 229
996 3300003781 Ga0055536_1030613 Ga0055536_10306131 229
997 3300003784 Ga0055534_1003215 Ga0055534_10032154 229
998 3300003784 Ga0055534_1003658 Ga0055534_10036585 229
999 3300003790 Ga0055528_1006600 Ga0055528_10066004 229
1000 3300003790 Ga0055528_1007487 Ga0055528_10074876 229
1001 3300003794 Ga0055531_10009310 Ga0055531_100093103 229
1002 3300003794 Ga0055531_10013410 Ga0055531_100134103 229
1003 3300003856 Ga0058692_1003260 Ga0058692_10032605 229
1004 3300003856 Ga0058692_1003324 Ga0058692_10033246 229
1005 3300004785 Ga0058858_1366593 Ga0058858_13665931 229
1006 3300004803 Ga0058862_12845279 Ga0058862_128452794 229
1007 3300005289 Ga0065704_10083997 Ga0065704_100839974 229
1008 3300005289 Ga0065704_10148391 Ga0065704_101483912 229
1009 3300005293 Ga0065715_10198104 Ga0065715_101981042 229
1010 3300005295 Ga0065707_10094071 Ga0065707_100940713 229
1011 3300005330 Ga0070690_100632237 Ga0070690_1006322371 229
1012 3300005331 Ga0070670_100008976 Ga0070670_1000089765 229
1013 3300005331 Ga0070670_100273814 Ga0070670_1002738141 229
1014 3300005331 Ga0070670_100422365 Ga0070670_1004223651 229
1015 3300005333 Ga0070677_10031308 Ga0070677_100313084 229
1016 3300005335 Ga0070666_10039409 Ga0070666_100394092 229
1017 3300005336 Ga0070680_100248523 Ga0070680_1002485231 229
1018 3300005338 Ga0068868_100034412 Ga0068868_1000344122 229
1019 3300005344 Ga0070661_100647423 Ga0070661_1006474231 229
1020 3300005347 Ga0070668_100014264 Ga0070668_1000142645 229
1021 3300005347 Ga0070668_100042424 Ga0070668_1000424243 229
1022 3300005353 Ga0070669_100191468 Ga0070669_1001914682 229
1023 3300005353 Ga0070669_100301475 Ga0070669_1003014752 229
1024 3300005353 Ga0070669_100448007 Ga0070669_1004480071 229
1025 3300005354 Ga0070675_100061728 Ga0070675_1000617283 229
1026 3300005354 Ga0070675_100405037 Ga0070675_1004050372 229
1027 3300005355 Ga0070671_100019286 Ga0070671_1000192864 229
1028 3300005355 Ga0070671_100023893 Ga0070671_1000238931 229
1029 3300005355 Ga0070671_100027806 Ga0070671_1000278064 229
1030 3300005356 Ga0070674_100028598 Ga0070674_1000285984 229
1031 3300005364 Ga0070673_100038659 Ga0070673_1000386593 229
1032 3300005367 Ga0070667_100036835 Ga0070667_1000368354 229
1033 3300005434 Ga0070709_10025539 Ga0070709_100255391 229
1034 3300005435 Ga0070714_100207729 Ga0070714_1002077292 229
1035 3300005436 Ga0070713_100003527 Ga0070713_1000035273 229
1036 3300005436 Ga0070713_100067816 Ga0070713_1000678164 229
1037 3300005437 Ga0070710_10004507 Ga0070710_100045073 229
1038 3300005439 Ga0070711_100003541 Ga0070711_1000035414 229
1039 3300005440 Ga0070705_100026206 Ga0070705_1000262064 229
1040 3300005456 Ga0070678_100001065 Ga0070678_1000010654 229
1041 3300005456 Ga0070678_100020058 Ga0070678_1000200583 229
1042 3300005456 Ga0070678_100235399 Ga0070678_1002353991 229
1043 3300005458 Ga0070681_10239425 Ga0070681_102394252 229
1044 3300005459 Ga0068867_100079076 Ga0068867_1000790762 229
1045 3300005471 Ga0070698_100099864 Ga0070698_1000998646 229
1046 3300005535 Ga0070684_100071158 Ga0070684_1000711582 229
1047 3300005539 Ga0068853_100287991 Ga0068853_1002879913 229
1048 3300005543 Ga0070672_100511513 Ga0070672_1005115132 229
1049 3300005547 Ga0070693_100008770 Ga0070693_1000087704 229
1050 3300005548 Ga0070665_100016625 Ga0070665_1000166254 229
1051 3300005548 Ga0070665_100076166 Ga0070665_1000761661 229
1052 3300005549 Ga0070704_100074190 Ga0070704_1000741902 229
1053 3300005564 Ga0070664_100210034 Ga0070664_1002100343 229
1054 3300005564 Ga0070664_100529728 Ga0070664_1005297282 229
1055 3300005578 Ga0068854_100330975 Ga0068854_1003309752 229
1056 3300005618 Ga0068864_100602194 Ga0068864_1006021941 229
1057 3300005718 Ga0068866_10022564 Ga0068866_100225643 229
1058 3300005719 Ga0068861_100260788 Ga0068861_1002607883 229
1059 3300005841 Ga0068863_100011275 Ga0068863_1000112756 229
1060 3300005841 Ga0068863_100144359 Ga0068863_1001443593 229
1061 3300005842 Ga0068858_100036312 Ga0068858_1000363126 229
1062 3300005843 Ga0068860_100016232 Ga0068860_1000162326 229
1063 3300005844 Ga0068862_100156360 Ga0068862_1001563602 229
1064 3300006038 Ga0075365_10020475 Ga0075365_100204756 229
1065 3300006048 Ga0075363_100369406 Ga0075363_1003694061 229
1066 3300006051 Ga0075364_10041952 Ga0075364_100419524 229
1067 3300006163 Ga0070715_10009837 Ga0070715_100098373 229
1068 3300006175 Ga0070712_100017901 Ga0070712_1000179016 229
1069 3300006178 Ga0075367_10089712 Ga0075367_100897123 229
1070 3300006237 Ga0097621_100002428 Ga0097621_1000024286 229
1071 3300006358 Ga0068871_100030676 Ga0068871_1000306764 229
1072 3300006358 Ga0068871_100281463 Ga0068871_1002814632 229
1073 3300006844 Ga0075428_100049471 Ga0075428_1000494714 229
1074 3300006847 Ga0075431_100083964 Ga0075431_1000839643 229
1075 3300006881 Ga0068865_100013447 Ga0068865_1000134472 229
1076 3300006948 Ga0099826_10291196 Ga0099826_102911961 229
1077 3300009011 Ga0105251_10009588 Ga0105251_100095886 229
1078 3300009011 Ga0105251_10010315 Ga0105251_100103154 229
1079 3300009036 Ga0105244_10051247 Ga0105244_100512473 229
1080 3300009036 Ga0105244_10061556 Ga0105244_100615561 229
1081 3300009092 Ga0105250_10001011 Ga0105250_100010116 229
1082 3300009093 Ga0105240_10046199 Ga0105240_100461994 229
1083 3300009093 Ga0105240_10266269 Ga0105240_102662693 229
1084 3300009094 Ga0111539_10016296 Ga0111539_100162964 229
1085 3300009098 Ga0105245_10016847 Ga0105245_100168474 229
1086 3300009098 Ga0105245_11148656 Ga0105245_111486562 229
1087 3300009148 Ga0105243_10065022 Ga0105243_100650223 229
1088 3300009174 Ga0105241_10056984 Ga0105241_100569842 229
1089 3300009176 Ga0105242_10029633 Ga0105242_100296334 229
1090 3300009177 Ga0105248_10004652 Ga0105248_100046528 229
1091 3300009177 Ga0105248_10947454 Ga0105248_109474541 229
1092 3300009551 Ga0105238_10408500 Ga0105238_104085002 229
1093 3300010375 Ga0105239_10013634 Ga0105239_100136345 229
1094 3300010375 Ga0105239_10177615 Ga0105239_101776153 229
1095 3300012475 Ga0157317_1000765 Ga0157317_10007652 229
1096 3300012477 Ga0157336_1000289 Ga0157336_10002893 229
1097 3300012482 Ga0157318_1000289 Ga0157318_10002891 229
1098 3300012490 Ga0157322_1002512 Ga0157322_10025121 229
1099 3300012490 Ga0157322_1003846 Ga0157322_10038461 229
1100 3300012492 Ga0157335_1000457 Ga0157335_10004572 229
1101 3300012497 Ga0157319_1000383 Ga0157319_10003831 229
1102 3300012500 Ga0157314_1002013 Ga0157314_10020132 229
1103 3300012507 Ga0157342_1008123 Ga0157342_10081231 229
1104 3300012508 Ga0157315_1001315 Ga0157315_10013152 229
1105 3300012510 Ga0157316_1011361 Ga0157316_10113612 229
1106 3300012512 Ga0157327_1000231 Ga0157327_10002313 229
1107 3300012513 Ga0157326_1005961 Ga0157326_10059612 229
1108 3300013102 Ga0157371_10063002 Ga0157371_100630023 229
1109 3300013102 Ga0157371_10362512 Ga0157371_103625121 229
1110 3300013104 Ga0157370_10109919 Ga0157370_101099192 229
1111 3300013104 Ga0157370_10415030 Ga0157370_104150302 229
1112 3300013105 Ga0157369_10128907 Ga0157369_101289074 229
1113 3300013296 Ga0157374_10015766 Ga0157374_100157664 229
1114 3300013296 Ga0157374_10297741 Ga0157374_102977411 229
1115 3300013296 Ga0157374_10834748 Ga0157374_108347481 229
1116 3300013297 Ga0157378_10013591 Ga0157378_100135916 229
1117 3300013306 Ga0163162_10011889 Ga0163162_100118893 229
1118 3300013306 Ga0163162_10301447 Ga0163162_103014472 229
1119 3300013307 Ga0157372_10433244 Ga0157372_104332442 229
1120 3300013308 Ga0157375_10014426 Ga0157375_100144265 229
1121 3300013308 Ga0157375_10145649 Ga0157375_101456493 229
1122 3300014325 Ga0163163_10058700 Ga0163163_100587005 229
1123 3300014325 Ga0163163_10102473 Ga0163163_101024732 229
1124 3300014326 Ga0157380_10809762 Ga0157380_108097621 229
1125 3300014497 Ga0182008_10024262 Ga0182008_100242626 229
1126 3300014497 Ga0182008_10045661 Ga0182008_100456613 229
1127 3300014968 Ga0157379_10002229 Ga0157379_100022296 229
1128 3300014968 Ga0157379_10012936 Ga0157379_100129366 229
1129 3300014968 Ga0157379_10045858 Ga0157379_100458583 229
1130 3300014969 Ga0157376_10017966 Ga0157376_100179664 229
1131 3300015261 Ga0182006_1009176 Ga0182006_10091764 229
1132 3300015262 Ga0182007_10004689 Ga0182007_100046896 229
1133 3300015265 Ga0182005_1002982 Ga0182005_10029826 229
1134 3300015265 Ga0182005_1007115 Ga0182005_10071156 229
1135 3300015689 Ga0183360_10001 Ga0183360_100012738 229
1136 3300016635 Ga0183361_11043 Ga0183361_110432 229
1137 3300017792 Ga0163161_10044327 Ga0163161_100443273 229
1138 3300020075 Ga0206349_1813039 Ga0206349_181303910 229
1139 3300023309 Ga0256744_116427 Ga0256744_1164272 229
1140 3300025245 Ga0207425_1000117 Ga0207425_100011752 229
1141 3300025245 Ga0207425_1001259 Ga0207425_10012595 229
1142 3300025245 Ga0207425_1006106 Ga0207425_10061061 229
1143 3300025245 Ga0207425_1011925 Ga0207425_10119252 229
1144 3300025258 Ga0209129_1000011 Ga0209129_1000011329 229
1145 3300025258 Ga0209129_1001630 Ga0209129_10016306 229
1146 3300025263 Ga0209565_1000001 Ga0209565_10000011135 229
1147 3300025263 Ga0209565_1000870 Ga0209565_10008709 229
1148 3300025273 Ga0209673_1000001 Ga0209673_10000011135 229
1149 3300025273 Ga0209673_1000204 Ga0209673_10002046 229
1150 3300025284 Ga0209130_1011762 Ga0209130_10117624 229
1151 3300025291 Ga0209675_1000001 Ga0209675_10000011398 229
1152 3300025291 Ga0209675_1000015 Ga0209675_100001547 229
1153 3300025292 Ga0209676_1001936 Ga0209676_10019366 229
1154 3300025292 Ga0209676_1004908 Ga0209676_10049084 229
1155 3300025294 Ga0209025_1000002 Ga0209025_1000002469 229
1156 3300025294 Ga0209025_1000006 Ga0209025_100000633 229
1157 3300025295 Ga0209564_1000001 Ga0209564_10000011560 229
1158 3300025295 Ga0209564_1000037 Ga0209564_1000037321 229
1159 3300025297 Ga0209758_1000003 Ga0209758_1000003476 229
1160 3300025297 Ga0209758_1000295 Ga0209758_100029573 229
1161 3300025297 Ga0209758_1014771 Ga0209758_10147716 229
1162 3300025298 Ga0209050_1007102 Ga0209050_10071026 229
1163 3300025298 Ga0209050_1008716 Ga0209050_10087164 229
1164 3300025299 Ga0209256_1002493 Ga0209256_10024938 229
1165 3300025299 Ga0209256_1007679 Ga0209256_10076794 229
1166 3300025303 Ga0209051_1004652 Ga0209051_10046526 229
1167 3300025304 Ga0209257_1002823 Ga0209257_10028239 229
1168 3300025304 Ga0209257_1008039 Ga0209257_10080394 229
1169 3300025711 Ga0207696_1000986 Ga0207696_10009863 229
1170 3300025735 Ga0207713_1000294 Ga0207713_100029426 229
1171 3300025735 Ga0207713_1018555 Ga0207713_10185553 229
1172 3300025893 Ga0207682_10034084 Ga0207682_100340841 229
1173 3300025893 Ga0207682_10051091 Ga0207682_100510912 229
1174 3300025898 Ga0207692_10089599 Ga0207692_100895993 229
1175 3300025903 Ga0207680_10015370 Ga0207680_100153702 229
1176 3300025905 Ga0207685_10000611 Ga0207685_100006114 229
1177 3300025906 Ga0207699_10149882 Ga0207699_101498822 229
1178 3300025912 Ga0207707_10256374 Ga0207707_102563742 229
1179 3300025913 Ga0207695_10191723 Ga0207695_101917232 229
1180 3300025913 Ga0207695_10270299 Ga0207695_102702992 229
1181 3300025915 Ga0207693_10001213 Ga0207693_1000121317 229
1182 3300025916 Ga0207663_10013914 Ga0207663_100139144 229
1183 3300025917 Ga0207660_10170530 Ga0207660_101705302 229
1184 3300025923 Ga0207681_10096481 Ga0207681_100964813 229
1185 3300025923 Ga0207681_10464844 Ga0207681_104648442 229
1186 3300025925 Ga0207650_10014980 Ga0207650_100149804 229
1187 3300025925 Ga0207650_10367451 Ga0207650_103674512 229
1188 3300025925 Ga0207650_10871059 Ga0207650_108710591 229
1189 3300025926 Ga0207659_10164476 Ga0207659_101644762 229
1190 3300025926 Ga0207659_10476383 Ga0207659_104763831 229
1191 3300025927 Ga0207687_10173392 Ga0207687_101733923 229
1192 3300025927 Ga0207687_10330763 Ga0207687_103307631 229
1193 3300025928 Ga0207700_10001626 Ga0207700_100016266 229
1194 3300025928 Ga0207700_10087507 Ga0207700_100875072 229
1195 3300025929 Ga0207664_10696954 Ga0207664_106969541 229
1196 3300025931 Ga0207644_10016309 Ga0207644_100163094 229
1197 3300025931 Ga0207644_10019953 Ga0207644_100199534 229
1198 3300025934 Ga0207686_10015230 Ga0207686_100152304 229
1199 3300025935 Ga0207709_10000421 Ga0207709_1000042112 229
1200 3300025937 Ga0207669_10280983 Ga0207669_102809832 229
1201 3300025938 Ga0207704_10013293 Ga0207704_100132934 229
1202 3300025940 Ga0207691_10022595 Ga0207691_100225956 229
1203 3300025941 Ga0207711_10022069 Ga0207711_100220696 229
1204 3300025941 Ga0207711_10618678 Ga0207711_106186781 229
1205 3300025944 Ga0207661_10698784 Ga0207661_106987841 229
1206 3300025945 Ga0207679_10402135 Ga0207679_104021352 229
1207 3300025949 Ga0207667_10355079 Ga0207667_103550792 229
1208 3300025960 Ga0207651_10041558 Ga0207651_100415584 229
1209 3300025972 Ga0207668_10057549 Ga0207668_100575496 229
1210 3300025981 Ga0207640_10241127 Ga0207640_102411272 229
1211 3300025986 Ga0207658_10006036 Ga0207658_100060364 229
1212 3300026023 Ga0207677_10048123 Ga0207677_100481234 229
1213 3300026035 Ga0207703_10237748 Ga0207703_102377483 229
1214 3300026041 Ga0207639_10484971 Ga0207639_104849712 229
1215 3300026078 Ga0207702_10041370 Ga0207702_100413702 229
1216 3300026088 Ga0207641_10014271 Ga0207641_100142714 229
1217 3300026089 Ga0207648_10021848 Ga0207648_100218483 229
1218 3300026095 Ga0207676_10037550 Ga0207676_100375503 229
1219 3300026095 Ga0207676_10666255 Ga0207676_106662552 229
1220 3300026116 Ga0207674_10564841 Ga0207674_105648412 229
1221 3300026118 Ga0207675_100066500 Ga0207675_1000665003 229
1222 3300026121 Ga0207683_10038985 Ga0207683_100389854 229
1223 3300026121 Ga0207683_10060355 Ga0207683_100603553 229
1224 3300026121 Ga0207683_10080294 Ga0207683_100802943 229
1225 3300027312 Ga0209371_1001398 Ga0209371_10013989 229
1226 3300027312 Ga0209371_1001408 Ga0209371_10014089 229
1227 3300027395 Ga0209996_1015142 Ga0209996_10151422 229
1228 3300027907 Ga0207428_10016333 Ga0207428_100163337 229
1229 3300027907 Ga0207428_10278515 Ga0207428_102785151 229
1230 3300028379 Ga0268266_10037806 Ga0268266_100378066 229
1231 3300028379 Ga0268266_10058723 Ga0268266_100587233 229
1232 3300028380 Ga0268265_10066160 Ga0268265_100661604 229
1233 3300028381 Ga0268264_10031940 Ga0268264_100319406 229
1234 3300028794 Ga0307515_10297096 Ga0307515_102970962 229
1235 3300030500 Ga0268256_1001199 Ga0268256_10011996 229
1236 3300030500 Ga0268256_1001205 Ga0268256_10012056 229
1237 3300030731 Ga0316177_1088114 Ga0316177_10881147 229
1238 3300030732 Ga0316176_1126945 Ga0316176_11269456 229
1239 3300030733 Ga0314311_1238023 Ga0314311_12380232 229
1240 3300030742 Ga0316183_1043923 Ga0316183_10439233 229
1241 3300030742 Ga0316183_1123727 Ga0316183_11237271 229
1242 3300030744 Ga0316181_1073208 Ga0316181_10732082 229
1243 3300030763 Ga0265763_1001774 Ga0265763_10017741 229
1244 3300031239 Ga0265328_10124460 Ga0265328_101244602 229
1245 3300031250 Ga0265331_10003895 Ga0265331_100038955 229
1246 3300031456 Ga0307513_10301957 Ga0307513_103019572 229
1247 3300031548 Ga0307408_100020277 Ga0307408_1000202775 229
1248 3300031616 Ga0307508_10031774 Ga0307508_100317744 229
1249 3300031733 Ga0316577_10057496 Ga0316577_100574963 229
1250 3300031824 Ga0307413_10010652 Ga0307413_100106522 229
1251 3300031824 Ga0307413_10031579 Ga0307413_100315792 229
1252 3300031824 Ga0307413_10096570 Ga0307413_100965701 229
1253 3300031852 Ga0307410_10821968 Ga0307410_108219681 229
1254 3300031901 Ga0307406_10014028 Ga0307406_100140284 229
1255 3300031901 Ga0307406_10561281 Ga0307406_105612812 229
1256 3300031903 Ga0307407_10209452 Ga0307407_102094521 229
1257 3300031911 Ga0307412_10664831 Ga0307412_106648311 229
1258 3300032002 Ga0307416_100453671 Ga0307416_1004536712 229
1259 3300032004 Ga0307414_10029702 Ga0307414_100297023 229
1260 3300032004 Ga0307414_10037091 Ga0307414_100370913 229
1261 3300032004 Ga0307414_10037252 Ga0307414_100372523 229
1262 3300032004 Ga0307414_10043481 Ga0307414_100434813 229
1263 3300032004 Ga0307414_10127905 Ga0307414_101279053 229
1264 3300032004 Ga0307414_10168422 Ga0307414_101684222 229
1265 3300032004 Ga0307414_10327962 Ga0307414_103279622 229
1266 3300032004 Ga0307414_10358180 Ga0307414_103581801 229
1267 3300032168 Ga0316593_10039062 Ga0316593_100390622 229
1268 3300033527 Ga0316586_1000160 Ga0316586_10001604 229
1269 3300033527 Ga0316586_1000360 Ga0316586_10003607 229
1270 3300033541 Ga0316596_1000739 Ga0316596_10007396 229
1271 3300035692 Ga0373935_0019952 Ga0373935_0019952_482_1171 229
1272 3300035695 Ga0373927_0012993 Ga0373927_0012993_3279_3968 229
1273 3300036401 Ga0373937_0038981 Ga0373937_0038981_1535_2224 229
1274 3300036647 Ga0316582_0059534 Ga0316582_0059534_1146_1835 229
1275 3300036712 Ga0316584_0006256 Ga0316584_0006256_6776_7465 229
1276 3300037068 Ga0373925_0113235 Ga0373925_0113235_611_1300 229
1277 3300037466 Ga0395898_0152270 Ga0395898_0152270_1072_1770 229
1278 3300037471 Ga0395905_0013357 Ga0395905_0013357_6878_7576 229
1279 3300037471 Ga0395905_0069743 Ga0395905_0069743_45_743 229
1280 3300038443 Ga0395901_0165200 Ga0395901_0165200_119_817 229
1281 3300038705 Ga0237819_00830 Ga0237819_00830_6878_7576 229
1282 3300038705 Ga0237819_05183 Ga0237819_05183_839_1537 229
1283 3300038725 Ga0400484_14537 Ga0400484_14537_142_831 229
1284 3300039450 Ga0436363_1295886 Ga0436363_1295886_79_768 229
1285 3300041404 Ga0439436_0016476 Ga0439436_0016476_180_878 229
1286 3300041406 Ga0439439_0025248 Ga0439439_0025248_369_1067 229
1287 3300041406 Ga0439439_0057830 Ga0439439_0057830_192_890 229
1288 3300041413 Ga0439465_0003075 Ga0439465_0003075_2143_2841 229
1289 3300041413 Ga0439465_0005063 Ga0439465_0005063_223_921 229
1290 3300041413 Ga0439465_0018740 Ga0439465_0018740_900_1598 229
1291 3300041452 Ga0451793_0696706 Ga0451793_0696706_416_1114 229
1292 3300041453 Ga0451797_0264651 Ga0451797_0264651_346_1044 229
1293 3300041459 Ga0451800_0124581 Ga0451800_0124581_3325_4023 229
1294 3300041462 Ga0451806_385064 Ga0451806_385064_6399_7097 229
1295 3300041463 Ga0451804_1083353 Ga0451804_1083353_1986_2684 229
1296 3300041486 Ga0451807_0857467 Ga0451807_0857467_1255_1953 229
1297 3300041494 Ga0451837_1551383 Ga0451837_1551383_321_1019 229
1298 3300041494 Ga0451837_1611358 Ga0451837_1611358_444_1142 229
1299 3300041505 Ga0451849_1346764 Ga0451849_1346764_161_850 229
1300 3300041509 Ga0451843_1345421 Ga0451843_1345421_256_954 229
1301 3300041512 Ga0451853_2151806 Ga0451853_2151806_2467_3156 229
1302 3300041997 Ga0439431_0008078 Ga0439431_0008078_1150_1848 229
1303 3300041999 Ga0439433_0013165 Ga0439433_0013165_556_1254 229
1304 3300042004 Ga0439445_0001711 Ga0439445_0001711_1999_2697 229
1305 3300042004 Ga0439445_0034571 Ga0439445_0034571_27_725 229
1306 3300042007 Ga0439449_0002305 Ga0439449_0002305_4746_5444 229
1307 3300042007 Ga0439449_0008391 Ga0439449_0008391_755_1453 229
1308 3300042007 Ga0439449_0059627 Ga0439449_0059627_501_1199 229
1309 3300042142 Ga0450905_023289 Ga0450905_023289_68_775 229
1310 3300042533 Ga0450901_008036 Ga0450901_008036_188_886 229
1311 3300042876 Ga0451577_0040268 Ga0451577_0040268_680_1378 229
1312 3300044656 Ga0466969_0000859 Ga0466969_0000859_13855_14544 229
1313 3300044684 Ga0466966_0415892 Ga0466966_0415892_99_788 229
1314 3300044694 Ga0466963_0214722 Ga0466963_0214722_118_807 229
1315 3300045049 Ga0466959_0006647 Ga0466959_0006647_6261_6950 229
1316 3300045049 Ga0466959_0013561 Ga0466959_0013561_1032_1721 229
1317 3300045051 Ga0451576_1038278 Ga0451576_1038278_132_821 229
1318 3300046460 Ga0495638_0032034 Ga0495638_0032034_512_1210 229
1319 3300046460 Ga0495638_0036071 Ga0495638_0036071_1886_2584 229
1320 3300046472 Ga0495580_0396087 Ga0495580_0396087_55_744 229
1321 3300046500 Ga0495596_0097094 Ga0495596_0097094_206_895 229
1322 3300046514 Ga0495618_0075097 Ga0495618_0075097_80_769 229
1323 3300046516 Ga0495628_0126383 Ga0495628_0126383_783_1472 229
1324 3300046525 Ga0495663_0002005 Ga0495663_0002005_3429_4127 229
1325 3300046525 Ga0495663_0051515 Ga0495663_0051515_395_1093 229
1326 3300046525 Ga0495663_0055830 Ga0495663_0055830_149_847 229
1327 3300046537 Ga0495598_0001815 Ga0495598_0001815_1849_2547 229
1328 3300046539 Ga0495621_0050264 Ga0495621_0050264_273_971 229
1329 3300046539 Ga0495621_0195584 Ga0495621_0195584_71_775 229
1330 3300046557 Ga0495622_0129444 Ga0495622_0129444_285_974 229
1331 3300046615 Ga0495656_0011224 Ga0495656_0011224_678_1376 229
1332 3300046615 Ga0495656_0017118 Ga0495656_0017118_1007_1705 229
1333 3300046615 Ga0495656_0222821 Ga0495656_0222821_202_900 229
1334 3300046616 Ga0495668_0019984 Ga0495668_0019984_784_1482 229
1335 3300046660 Ga0495625_0033113 Ga0495625_0033113_1182_1880 229
1336 3300046664 Ga0495659_0014643 Ga0495659_0014643_728_1426 229
1337 3300046683 Ga0495658_0162966 Ga0495658_0162966_650_1339 229
1338 3300046692 Ga0495671_0066286 Ga0495671_0066286_884_1582 229
1339 3300047318 Ga0495636_0010004 Ga0495636_0010004_1248_1946 229
1340 3300047318 Ga0495636_0027217 Ga0495636_0027217_1194_1892 229
1341 3300047318 Ga0495636_0044352 Ga0495636_0044352_234_932 229
1342 3300047319 Ga0495674_0074547 Ga0495674_0074547_1567_2256 229
1343 3300047320 Ga0495672_0006232 Ga0495672_0006232_2267_2965 229
1344 3300047445 Ga0495677_0014987 Ga0495677_0014987_2025_2723 229
1345 3300047472 Ga0495686_0026449 Ga0495686_0026449_1681_2379 229
1346 3300048090 Ga0495615_0033722 Ga0495615_0033722_120_818 229
1347 3300048903 Ga0496100_0003980 Ga0496100_0003980_634_1323 229
1348 3300048903 Ga0496100_0280373 Ga0496100_0280373_339_1037 229
1349 3300048904 Ga0496101_0018106 Ga0496101_0018106_2258_2947 229
1350 3300048905 Ga0496102_0020726 Ga0496102_0020726_3291_3989 229
1351 3300048905 Ga0496102_0055017 Ga0496102_0055017_1602_2291 229
1352 3300048907 Ga0496104_0061014 Ga0496104_0061014_768_1457 229
1353 3300048908 Ga0496105_0011636 Ga0496105_0011636_4610_5299 229
1354 3300048909 Ga0496106_0019769 Ga0496106_0019769_3016_3705 229
1355 3300048909 Ga0496106_0021873 Ga0496106_0021873_1672_2370 229
1356 3300048910 Ga0496107_0003267 Ga0496107_0003267_8477_9166 229
1357 3300048911 Ga0496108_0047837 Ga0496108_0047837_2605_3303 229
1358 3300048911 Ga0496108_0062034 Ga0496108_0062034_1391_2089 229
1359 3300048911 Ga0496108_0081123 Ga0496108_0081123_1650_2339 229
1360 3300048912 Ga0496109_0015279 Ga0496109_0015279_1552_2241 229
1361 3300048912 Ga0496109_0029720 Ga0496109_0029720_2181_2879 229
1362 3300048912 Ga0496109_0067177 Ga0496109_0067177_1092_1790 229
1363 3300048913 Ga0496110_0007834 Ga0496110_0007834_6579_7268 229
1364 3300048913 Ga0496110_0023385 Ga0496110_0023385_2084_2782 229
1365 3300048914 Ga0496111_0021878 Ga0496111_0021878_2118_2807 229
1366 3300048914 Ga0496111_0029471 Ga0496111_0029471_596_1294 229
1367 3300048915 Ga0496112_0044154 Ga0496112_0044154_1595_2284 229
1368 3300048915 Ga0496112_0123048 Ga0496112_0123048_1717_2415 229
1369 3300048916 Ga0496113_0034039 Ga0496113_0034039_1220_1918 229
1370 3300048916 Ga0496113_0053981 Ga0496113_0053981_2151_2849 229
1371 3300048917 Ga0496114_0006354 Ga0496114_0006354_1984_2682 229
1372 3300048917 Ga0496114_0067920 Ga0496114_0067920_2263_2952 229
1373 3300048918 Ga0496115_0052206 Ga0496115_0052206_2096_2785 229
1374 3300048918 Ga0496115_0288753 Ga0496115_0288753_65_763 229
1375 3300048920 Ga0496117_0017925 Ga0496117_0017925_2021_2719 229
1376 3300048920 Ga0496117_0022053 Ga0496117_0022053_2231_2929 229
1377 3300048921 Ga0496118_0023217 Ga0496118_0023217_4619_5317 229
1378 3300048921 Ga0496118_0046667 Ga0496118_0046667_724_1422 229
1379 3300048922 Ga0496119_0007226 Ga0496119_0007226_6424_7122 229
1380 3300048922 Ga0496119_0009096 Ga0496119_0009096_5017_5715 229
1381 3300048923 Ga0496120_0000480 Ga0496120_0000480_5700_6398 229
1382 3300048923 Ga0496120_0012742 Ga0496120_0012742_2983_3681 229
1383 3300048924 Ga0496121_0018787 Ga0496121_0018787_2978_3676 229
1384 3300048924 Ga0496121_0159310 Ga0496121_0159310_398_1096 229
1385 3300048925 Ga0496122_0023046 Ga0496122_0023046_2781_3479 229
1386 3300048925 Ga0496122_0106855 Ga0496122_0106855_557_1255 229
1387 3300048926 Ga0496123_0019197 Ga0496123_0019197_2031_2729 229
1388 3300048926 Ga0496123_0039166 Ga0496123_0039166_370_1068 229
1389 3300048927 Ga0496124_0023156 Ga0496124_0023156_2949_3647 229
1390 3300048929 Ga0496126_0161525 Ga0496126_0161525_1125_1814 229
1391 3300049128 Ga0501308_001692 Ga0501308_001692_115_813 229
1392 3300049130 Ga0501310_000893 Ga0501310_000893_306_1004 229
1393 3300049162 Ga0501307_002889 Ga0501307_002889_44_742 229
1394 3300049162 Ga0501307_004585 Ga0501307_004585_507_1196 229
1395 3300049529 Ga0501313_006744 Ga0501313_006744_498_1187 229
1396 3300049539 Ga0501323_000376 Ga0501323_000376_1909_2598 229
1397 3300049539 Ga0501323_000513 Ga0501323_000513_2188_2877 229
1398 3300049568 Ga0501031_0028632 Ga0501031_0028632_781_1479 229
1399 3300049570 Ga0501033_0002077 Ga0501033_0002077_5300_5992 229
1400 3300049570 Ga0501033_0021027 Ga0501033_0021027_601_1299 229
1401 3300049571 Ga0501034_0017688 Ga0501034_0017688_6210_6908 229
1402 3300049571 Ga0501034_0040480 Ga0501034_0040480_2088_2786 229
1403 3300049571 Ga0501034_0072781 Ga0501034_0072781_2260_2952 229
1404 3300049571 Ga0501034_0109493 Ga0501034_0109493_1789_2487 229
1405 3300049572 Ga0501036_0079022 Ga0501036_0079022_1053_1745 229
1406 3300049573 Ga0501037_0002990 Ga0501037_0002990_1740_2432 229
1407 3300049573 Ga0501037_0013116 Ga0501037_0013116_1989_2687 229
1408 3300049574 Ga0501038_0069415 Ga0501038_0069415_1537_2229 229
1409 3300049575 Ga0501039_0146817 Ga0501039_0146817_89_781 229
1410 3300049579 Ga0501043_0058046 Ga0501043_0058046_1906_2604 229
1411 3300049581 Ga0501047_0436741 Ga0501047_0436741_424_1122 229
1412 3300049583 Ga0501067_0080951 Ga0501067_0080951_836_1528 229
1413 3300049584 Ga0501068_0021114 Ga0501068_0021114_13_705 229
1414 3300049589 Ga0501073_0001779 Ga0501073_0001779_1706_2398 229
1415 3300049589 Ga0501073_0069117 Ga0501073_0069117_319_1017 229
1416 3300049741 Ga0501079_0075068 Ga0501079_0075068_1500_2192 229
1417 3300049742 Ga0501080_0009449 Ga0501080_0009449_6111_6803 229
1418 3300049742 Ga0501080_0046677 Ga0501080_0046677_912_1610 229
1419 3300049744 Ga0501083_0026263 Ga0501083_0026263_1561_2253 229
1420 3300049822 Ga0501035_0024357 Ga0501035_0024357_2254_2946 229
1421 3300049823 Ga0501044_0016454 Ga0501044_0016454_4110_4808 229
1422 3300049824 Ga0501045_0285388 Ga0501045_0285388_483_1181 229
1423 3300050493 nmdc:mga0k408_50017_c1 nmdc:mga0k408_50017_c1_1402_2091 229
1424 3300050509 nmdc:mga0qj67_678179_c1 nmdc:mga0qj67_678179_c1_12_707 229
1425 3300050510 nmdc:mga06r32_335270_c1 nmdc:mga06r32_335270_c1_196_885 229
1426 3300050511 nmdc:mga08y16_14232_c1 nmdc:mga08y16_14232_c1_2139_2846 229
1427 3300050512 nmdc:mga0n895_984286_c1 nmdc:mga0n895_984286_c1_64_771 229
1428 3300053161 Ga0500634_0005374 Ga0500634_0005374_1986_2684 229
1429 3300053177 Ga0500636_0122043 Ga0500636_0122043_493_1182 229
1430 3300054114 Ga0501084_0072936 Ga0501084_0072936_1041_1733 229
1431 3300060353 Ga0501082_0058739 Ga0501082_0058739_1501_2193 229
1432 3300003322 rootL2_10004195 rootL2_100041952 230
1433 3300003775 Ga0055524_1005244 Ga0055524_10052446 230
1434 3300003791 Ga0055530_10008665 Ga0055530_100086654 230
1435 3300003792 Ga0055540_1004941 Ga0055540_10049415 230
1436 3300003794 Ga0055531_10011515 Ga0055531_100115152 230
1437 3300005295 Ga0065707_10084317 Ga0065707_100843174 230
1438 3300005330 Ga0070690_100324328 Ga0070690_1003243282 230
1439 3300005330 Ga0070690_100334634 Ga0070690_1003346342 230
1440 3300005331 Ga0070670_100318007 Ga0070670_1003180071 230
1441 3300005333 Ga0070677_10016786 Ga0070677_100167862 230
1442 3300005333 Ga0070677_10022484 Ga0070677_100224842 230
1443 3300005334 Ga0068869_100322259 Ga0068869_1003222592 230
1444 3300005337 Ga0070682_100113107 Ga0070682_1001131073 230
1445 3300005337 Ga0070682_100210161 Ga0070682_1002101612 230
1446 3300005341 Ga0070691_10029274 Ga0070691_100292743 230
1447 3300005353 Ga0070669_100015248 Ga0070669_1000152482 230
1448 3300005354 Ga0070675_100162855 Ga0070675_1001628552 230
1449 3300005354 Ga0070675_100359043 Ga0070675_1003590432 230
1450 3300005355 Ga0070671_100275046 Ga0070671_1002750461 230
1451 3300005364 Ga0070673_100270418 Ga0070673_1002704182 230
1452 3300005364 Ga0070673_100642635 Ga0070673_1006426351 230
1453 3300005366 Ga0070659_100061501 Ga0070659_1000615011 230
1454 3300005367 Ga0070667_100007562 Ga0070667_1000075626 230
1455 3300005367 Ga0070667_100484284 Ga0070667_1004842841 230
1456 3300005445 Ga0070708_100709372 Ga0070708_1007093721 230
1457 3300005457 Ga0070662_100045531 Ga0070662_1000455314 230
1458 3300005457 Ga0070662_100278752 Ga0070662_1002787522 230
1459 3300005457 Ga0070662_100366824 Ga0070662_1003668242 230
1460 3300005459 Ga0068867_100191191 Ga0068867_1001911912 230
1461 3300005459 Ga0068867_100523793 Ga0068867_1005237932 230
1462 3300005459 Ga0068867_100558279 Ga0068867_1005582791 230
1463 3300005466 Ga0070685_10066875 Ga0070685_100668753 230
1464 3300005543 Ga0070672_100083454 Ga0070672_1000834545 230
1465 3300005543 Ga0070672_100323773 Ga0070672_1003237731 230
1466 3300005544 Ga0070686_100618358 Ga0070686_1006183581 230
1467 3300005548 Ga0070665_100019353 Ga0070665_1000193536 230
1468 3300005548 Ga0070665_100022199 Ga0070665_1000221996 230
1469 3300005548 Ga0070665_100399193 Ga0070665_1003991932 230
1470 3300005548 Ga0070665_100548241 Ga0070665_1005482412 230
1471 3300005548 Ga0070665_100934252 Ga0070665_1009342522 230
1472 3300005564 Ga0070664_100158321 Ga0070664_1001583213 230
1473 3300005618 Ga0068864_100408442 Ga0068864_1004084422 230
1474 3300005618 Ga0068864_100629958 Ga0068864_1006299581 230
1475 3300005719 Ga0068861_100110945 Ga0068861_1001109453 230
1476 3300005719 Ga0068861_100354319 Ga0068861_1003543192 230
1477 3300005840 Ga0068870_10034752 Ga0068870_100347524 230
1478 3300005840 Ga0068870_10216235 Ga0068870_102162351 230
1479 3300005841 Ga0068863_100357873 Ga0068863_1003578732 230
1480 3300005842 Ga0068858_100399254 Ga0068858_1003992542 230
1481 3300005844 Ga0068862_100100822 Ga0068862_1001008222 230
1482 3300005844 Ga0068862_100105038 Ga0068862_1001050383 230
1483 3300005844 Ga0068862_100118255 Ga0068862_1001182552 230
1484 3300006177 Ga0075362_10138046 Ga0075362_101380462 230
1485 3300006195 Ga0075366_10252643 Ga0075366_102526431 230
1486 3300006237 Ga0097621_100275244 Ga0097621_1002752442 230
1487 3300006237 Ga0097621_100326365 Ga0097621_1003263652 230
1488 3300006358 Ga0068871_100135864 Ga0068871_1001358643 230
1489 3300006358 Ga0068871_100286442 Ga0068871_1002864422 230
1490 3300006358 Ga0068871_100829289 Ga0068871_1008292891 230
1491 3300006881 Ga0068865_100132161 Ga0068865_1001321612 230
1492 3300006946 Ga0079104_1001225 Ga0079104_10012256 230
1493 3300009092 Ga0105250_10086987 Ga0105250_100869872 230
1494 3300009093 Ga0105240_10389827 Ga0105240_103898273 230
1495 3300009093 Ga0105240_10872058 Ga0105240_108720581 230
1496 3300009147 Ga0114129_10090756 Ga0114129_100907564 230
1497 3300009174 Ga0105241_10933744 Ga0105241_109337441 230
1498 3300009177 Ga0105248_10398756 Ga0105248_103987563 230
1499 3300009177 Ga0105248_10647977 Ga0105248_106479772 230
1500 3300009545 Ga0105237_10164814 Ga0105237_101648142 230
1501 3300009553 Ga0105249_10104233 Ga0105249_101042334 230
1502 3300010375 Ga0105239_10270198 Ga0105239_102701981 230
1503 3300011119 Ga0105246_10483584 Ga0105246_104835841 230
1504 3300013296 Ga0157374_10240866 Ga0157374_102408662 230
1505 3300013297 Ga0157378_10537660 Ga0157378_105376601 230
1506 3300013306 Ga0163162_10483704 Ga0163162_104837042 230
1507 3300014325 Ga0163163_10138883 Ga0163163_101388836 230
1508 3300014325 Ga0163163_10794273 Ga0163163_107942732 230
1509 3300014326 Ga0157380_10094996 Ga0157380_100949963 230
1510 3300014968 Ga0157379_10050437 Ga0157379_100504372 230
1511 3300014969 Ga0157376_10532517 Ga0157376_105325172 230
1512 3300025291 Ga0209675_1007235 Ga0209675_10072354 230
1513 3300025298 Ga0209050_1001097 Ga0209050_10010976 230
1514 3300025299 Ga0209256_1000045 Ga0209256_1000045259 230
1515 3300025303 Ga0209051_1000004 Ga0209051_1000004944 230
1516 3300025304 Ga0209257_1002681 Ga0209257_10026816 230
1517 3300025893 Ga0207682_10022616 Ga0207682_100226163 230
1518 3300025901 Ga0207688_10060092 Ga0207688_100600923 230
1519 3300025908 Ga0207643_10059061 Ga0207643_100590613 230
1520 3300025908 Ga0207643_10162080 Ga0207643_101620802 230
1521 3300025908 Ga0207643_10338280 Ga0207643_103382802 230
1522 3300025910 Ga0207684_10178046 Ga0207684_101780462 230
1523 3300025913 Ga0207695_10159878 Ga0207695_101598783 230
1524 3300025913 Ga0207695_10574072 Ga0207695_105740721 230
1525 3300025914 Ga0207671_10136439 Ga0207671_101364392 230
1526 3300025918 Ga0207662_10057775 Ga0207662_100577752 230
1527 3300025919 Ga0207657_10232603 Ga0207657_102326031 230
1528 3300025923 Ga0207681_10079282 Ga0207681_100792824 230
1529 3300025923 Ga0207681_10155028 Ga0207681_101550282 230
1530 3300025926 Ga0207659_10019205 Ga0207659_100192054 230
1531 3300025926 Ga0207659_10271207 Ga0207659_102712072 230
1532 3300025931 Ga0207644_10106420 Ga0207644_101064203 230
1533 3300025933 Ga0207706_10034769 Ga0207706_100347696 230
1534 3300025933 Ga0207706_10454239 Ga0207706_104542391 230
1535 3300025934 Ga0207686_10027328 Ga0207686_100273282 230
1536 3300025936 Ga0207670_10144337 Ga0207670_101443373 230
1537 3300025937 Ga0207669_10031107 Ga0207669_100311073 230
1538 3300025938 Ga0207704_10461118 Ga0207704_104611181 230
1539 3300025944 Ga0207661_10127555 Ga0207661_101275553 230
1540 3300025945 Ga0207679_10299150 Ga0207679_102991502 230
1541 3300025961 Ga0207712_10164226 Ga0207712_101642262 230
1542 3300025972 Ga0207668_10405545 Ga0207668_104055451 230
1543 3300025986 Ga0207658_10005412 Ga0207658_100054126 230
1544 3300026035 Ga0207703_10317908 Ga0207703_103179082 230
1545 3300026041 Ga0207639_10641885 Ga0207639_106418852 230
1546 3300026075 Ga0207708_10053315 Ga0207708_100533152 230
1547 3300026088 Ga0207641_10098303 Ga0207641_100983034 230
1548 3300026089 Ga0207648_10228806 Ga0207648_102288062 230
1549 3300026089 Ga0207648_10259003 Ga0207648_102590032 230
1550 3300026089 Ga0207648_10267236 Ga0207648_102672362 230
1551 3300026095 Ga0207676_10488851 Ga0207676_104888511 230
1552 3300026116 Ga0207674_10102998 Ga0207674_101029984 230
1553 3300026118 Ga0207675_100155177 Ga0207675_1001551772 230
1554 3300026118 Ga0207675_100178318 Ga0207675_1001783183 230
1555 3300027111 Ga0209281_1001178 Ga0209281_100117810 230
1556 3300027907 Ga0207428_10253123 Ga0207428_102531232 230
1557 3300028379 Ga0268266_10001238 Ga0268266_1000123823 230
1558 3300028379 Ga0268266_10109533 Ga0268266_101095333 230
1559 3300028379 Ga0268266_10338225 Ga0268266_103382252 230
1560 3300028381 Ga0268264_10760999 Ga0268264_107609991 230
1561 3300028794 Ga0307515_10221730 Ga0307515_102217303 230
1562 3300028794 Ga0307515_10552049 Ga0307515_105520491 230
1563 3300031239 Ga0265328_10043978 Ga0265328_100439782 230
1564 3300031247 Ga0265340_10021359 Ga0265340_100213594 230
1565 3300031247 Ga0265340_10108860 Ga0265340_101088601 230
1566 3300031250 Ga0265331_10009629 Ga0265331_100096294 230
1567 3300031251 Ga0265327_10000161 Ga0265327_1000016175 230
1568 3300031251 Ga0265327_10001331 Ga0265327_1000133137 230
1569 3300031251 Ga0265327_10008647 Ga0265327_100086474 230
1570 3300031251 Ga0265327_10020861 Ga0265327_100208617 230
1571 3300031456 Ga0307513_10054041 Ga0307513_100540412 230
1572 3300031456 Ga0307513_10193284 Ga0307513_101932842 230
1573 3300031456 Ga0307513_10206251 Ga0307513_102062512 230
1574 3300031456 Ga0307513_10256504 Ga0307513_102565041 230
1575 3300031507 Ga0307509_10006255 Ga0307509_100062556 230
1576 3300031507 Ga0307509_10356357 Ga0307509_103563571 230
1577 3300031548 Ga0307408_100240460 Ga0307408_1002404602 230
1578 3300031548 Ga0307408_100720427 Ga0307408_1007204271 230
1579 3300031852 Ga0307410_10036837 Ga0307410_100368376 230
1580 3300031901 Ga0307406_10036154 Ga0307406_100361544 230
1581 3300031903 Ga0307407_10489990 Ga0307407_104899901 230
1582 3300031995 Ga0307409_100023232 Ga0307409_1000232324 230
1583 3300031995 Ga0307409_100078354 Ga0307409_1000783542 230
1584 3300032002 Ga0307416_100134976 Ga0307416_1001349763 230
1585 3300032002 Ga0307416_100185596 Ga0307416_1001855962 230
1586 3300032002 Ga0307416_100332252 Ga0307416_1003322522 230
1587 3300032005 Ga0307411_10104384 Ga0307411_101043842 230
1588 3300032005 Ga0307411_10336029 Ga0307411_103360292 230
1589 3300032126 Ga0307415_100109499 Ga0307415_1001094992 230
1590 3300032126 Ga0307415_100376168 Ga0307415_1003761681 230
1591 3300032168 Ga0316593_10001054 Ga0316593_100010541 230
1592 3300032168 Ga0316593_10001330 Ga0316593_100013304 230
1593 3300033541 Ga0316596_1000180 Ga0316596_10001806 230
1594 3300033541 Ga0316596_1075650 Ga0316596_10756502 230
1595 3300035085 Ga0373929_0084202 Ga0373929_0084202_25_717 230
1596 3300035119 Ga0373956_0049608 Ga0373956_0049608_46_756 230
1597 3300035241 Ga0373961_0124661 Ga0373961_0124661_147_839 230
1598 3300035242 Ga0373962_0061277 Ga0373962_0061277_401_1093 230
1599 3300035691 Ga0373931_0335996 Ga0373931_0335996_194_886 230
1600 3300036401 Ga0373937_0677315 Ga0373937_0677315_254_946 230
1601 3300037418 Ga0395900_0000542 Ga0395900_0000542_1867_2574 230
1602 3300037466 Ga0395898_0004844 Ga0395898_0004844_2949_3656 230
1603 3300041441 Ga0451787_527582 Ga0451787_527582_146_838 230
1604 3300041459 Ga0451800_1565474 Ga0451800_1565474_146_838 230
1605 3300042005 Ga0439448_0117717 Ga0439448_0117717_66_773 230
1606 3300042121 Ga0450919_000204 Ga0450919_000204_2498_3205 230
1607 3300042122 Ga0450920_000570 Ga0450920_000570_3569_4264 230
1608 3300042125 Ga0450923_004529 Ga0450923_004529_1428_2123 230
1609 3300042132 Ga0450895_005337 Ga0450895_005337_138_833 230
1610 3300042133 Ga0450896_005860 Ga0450896_005860_886_1581 230
1611 3300042184 Ga0450908_006323 Ga0450908_006323_822_1517 230
1612 3300042531 Ga0450918_000638 Ga0450918_000638_4843_5550 230
1613 3300042531 Ga0450918_013913 Ga0450918_013913_417_1112 230
1614 3300044656 Ga0466969_0010294 Ga0466969_0010294_2337_3044 230
1615 3300044658 Ga0466972_0042445 Ga0466972_0042445_1127_1834 230
1616 3300044683 Ga0466965_0111530 Ga0466965_0111530_345_1052 230
1617 3300044712 Ga0453684_0404442 Ga0453684_0404442_105_806 230
1618 3300046452 Ga0495617_075029 Ga0495617_075029_212_904 230
1619 3300046455 Ga0495603_0042696 Ga0495603_0042696_1216_1908 230
1620 3300046499 Ga0495594_0141860 Ga0495594_0141860_33_725 230
1621 3300046506 Ga0495583_0040027 Ga0495583_0040027_927_1619 230
1622 3300046512 Ga0495610_0167808 Ga0495610_0167808_212_904 230
1623 3300046513 Ga0495616_0001374 Ga0495616_0001374_14858_15556 230
1624 3300046520 Ga0495637_0125980 Ga0495637_0125980_106_798 230
1625 3300046523 Ga0495644_0009868 Ga0495644_0009868_304_996 230
1626 3300046528 Ga0495642_0143355 Ga0495642_0143355_212_910 230
1627 3300046535 Ga0495586_0035595 Ga0495586_0035595_1452_2147 230
1628 3300046535 Ga0495586_0084971 Ga0495586_0084971_626_1318 230
1629 3300046537 Ga0495598_0004279 Ga0495598_0004279_505_1197 230
1630 3300046539 Ga0495621_0001211 Ga0495621_0001211_1622_2314 230
1631 3300046558 Ga0495633_0077264 Ga0495633_0077264_626_1318 230
1632 3300046615 Ga0495656_0032400 Ga0495656_0032400_1038_1730 230
1633 3300046615 Ga0495656_0084401 Ga0495656_0084401_663_1355 230
1634 3300046642 Ga0495634_0065165 Ga0495634_0065165_1558_2250 230
1635 3300046648 Ga0495611_0103893 Ga0495611_0103893_113_829 230
1636 3300046660 Ga0495625_0044283 Ga0495625_0044283_43_741 230
1637 3300046660 Ga0495625_0323500 Ga0495625_0323500_23_715 230
1638 3300046674 Ga0495588_0356894 Ga0495588_0356894_65_757 230
1639 3300046692 Ga0495671_0111330 Ga0495671_0111330_551_1243 230
1640 3300046694 Ga0495649_0020320 Ga0495649_0020320_1705_2397 230
1641 3300047470 Ga0495681_0042189 Ga0495681_0042189_640_1338 230
1642 3300047471 Ga0495684_0286106 Ga0495684_0286106_119_811 230
1643 3300047673 Ga0495593_0012462 Ga0495593_0012462_2222_2923 230
1644 3300048918 Ga0496115_0415541 Ga0496115_0415541_163_855 230
1645 3300048927 Ga0496124_0000604 Ga0496124_0000604_55457_56164 230
1646 3300048928 Ga0496125_0032447 Ga0496125_0032447_2848_3555 230
1647 3300048929 Ga0496126_0011436 Ga0496126_0011436_6640_7332 230
1648 3300049536 Ga0501320_000653 Ga0501320_000653_1183_1890 230
1649 3300049539 Ga0501323_001711 Ga0501323_001711_920_1627 230
1650 3300049568 Ga0501031_0001681 Ga0501031_0001681_10337_11029 230
1651 3300049568 Ga0501031_0003823 Ga0501031_0003823_7191_7883 230
1652 3300049569 Ga0501032_0000036 Ga0501032_0000036_81389_82081 230
1653 3300049569 Ga0501032_0001142 Ga0501032_0001142_13085_13789 230
1654 3300049569 Ga0501032_0012075 Ga0501032_0012075_3678_4370 230
1655 3300049569 Ga0501032_0073945 Ga0501032_0073945_297_989 230
1656 3300049570 Ga0501033_0001755 Ga0501033_0001755_16577_17269 230
1657 3300049570 Ga0501033_0001957 Ga0501033_0001957_15399_16091 230
1658 3300049570 Ga0501033_0001959 Ga0501033_0001959_15426_16118 230
1659 3300049571 Ga0501034_0060042 Ga0501034_0060042_1805_2497 230
1660 3300049571 Ga0501034_0174721 Ga0501034_0174721_829_1533 230
1661 3300049572 Ga0501036_0000512 Ga0501036_0000512_3199_3891 230
1662 3300049572 Ga0501036_0077910 Ga0501036_0077910_255_947 230
1663 3300049572 Ga0501036_0149559 Ga0501036_0149559_263_955 230
1664 3300049572 Ga0501036_0285854 Ga0501036_0285854_359_1051 230
1665 3300049572 Ga0501036_0430796 Ga0501036_0430796_149_853 230
1666 3300049573 Ga0501037_0001523 Ga0501037_0001523_830_1522 230
1667 3300049573 Ga0501037_0032830 Ga0501037_0032830_843_1547 230
1668 3300049573 Ga0501037_0316367 Ga0501037_0316367_339_1031 230
1669 3300049574 Ga0501038_0001466 Ga0501038_0001466_11859_12551 230
1670 3300049574 Ga0501038_0073369 Ga0501038_0073369_633_1325 230
1671 3300049574 Ga0501038_0127040 Ga0501038_0127040_1015_1707 230
1672 3300049575 Ga0501039_0002729 Ga0501039_0002729_10665_11357 230
1673 3300049576 Ga0501040_0000218 Ga0501040_0000218_1795_2487 230
1674 3300049577 Ga0501041_0265846 Ga0501041_0265846_136_828 230
1675 3300049578 Ga0501042_0000726 Ga0501042_0000726_1758_2450 230
1676 3300049579 Ga0501043_0000157 Ga0501043_0000157_26535_27227 230
1677 3300049579 Ga0501043_0015137 Ga0501043_0015137_5006_5698 230
1678 3300049579 Ga0501043_0054355 Ga0501043_0054355_1155_1847 230
1679 3300049579 Ga0501043_0077210 Ga0501043_0077210_293_997 230
1680 3300049580 Ga0501046_0002470 Ga0501046_0002470_10683_11375 230
1681 3300049580 Ga0501046_0006637 Ga0501046_0006637_7781_8473 230
1682 3300049581 Ga0501047_0008217 Ga0501047_0008217_8886_9578 230
1683 3300049582 Ga0501048_0038565 Ga0501048_0038565_931_1623 230
1684 3300049582 Ga0501048_0097071 Ga0501048_0097071_912_1604 230
1685 3300049583 Ga0501067_0000278 Ga0501067_0000278_19872_20576 230
1686 3300049583 Ga0501067_0047129 Ga0501067_0047129_206_898 230
1687 3300049584 Ga0501068_0008291 Ga0501068_0008291_2263_2955 230
1688 3300049584 Ga0501068_0032722 Ga0501068_0032722_1804_2496 230
1689 3300049584 Ga0501068_0065039 Ga0501068_0065039_101_805 230
1690 3300049585 Ga0501069_0043763 Ga0501069_0043763_250_942 230
1691 3300049586 Ga0501070_0375209 Ga0501070_0375209_365_1057 230
1692 3300049587 Ga0501071_0025062 Ga0501071_0025062_1781_2473 230
1693 3300049588 Ga0501072_0494935 Ga0501072_0494935_58_750 230
1694 3300049589 Ga0501073_0000031 Ga0501073_0000031_107752_108456 230
1695 3300049589 Ga0501073_0020942 Ga0501073_0020942_1761_2453 230
1696 3300049593 Ga0501077_0019433 Ga0501077_0019433_1761_2453 230
1697 3300049741 Ga0501079_0001448 Ga0501079_0001448_11974_12666 230
1698 3300049742 Ga0501080_0004044 Ga0501080_0004044_1844_2536 230
1699 3300049742 Ga0501080_0014943 Ga0501080_0014943_838_1542 230
1700 3300049744 Ga0501083_0036098 Ga0501083_0036098_163_855 230
1701 3300049744 Ga0501083_0228381 Ga0501083_0228381_447_1151 230
1702 3300049744 Ga0501083_0297516 Ga0501083_0297516_131_823 230
1703 3300049822 Ga0501035_0000671 Ga0501035_0000671_35073_35765 230
1704 3300049822 Ga0501035_0004008 Ga0501035_0004008_1199_1891 230
1705 3300049822 Ga0501035_0076652 Ga0501035_0076652_1908_2600 230
1706 3300049822 Ga0501035_0260617 Ga0501035_0260617_24_722 230
1707 3300049823 Ga0501044_0000747 Ga0501044_0000747_5167_5859 230
1708 3300049823 Ga0501044_0007466 Ga0501044_0007466_9471_10163 230
1709 3300049823 Ga0501044_0015445 Ga0501044_0015445_1504_2196 230
1710 3300049823 Ga0501044_0049018 Ga0501044_0049018_14_706 230
1711 3300049823 Ga0501044_0066905 Ga0501044_0066905_1082_1786 230
1712 3300049823 Ga0501044_0312522 Ga0501044_0312522_391_1083 230
1713 3300049824 Ga0501045_0002614 Ga0501045_0002614_9763_10455 230
1714 3300049824 Ga0501045_0423376 Ga0501045_0423376_52_744 230
1715 3300050507 nmdc:mga05p37_47362_c1 nmdc:mga05p37_47362_c1_2797_3504 230
1716 3300050511 nmdc:mga08y16_749650_c1 nmdc:mga08y16_749650_c1_91_783 230
1717 3300053078 Ga0495612_0046715 Ga0495612_0046715_781_1473 230
1718 3300053083 Ga0495655_0003437 Ga0495655_0003437_1813_2511 230
1719 3300053088 Ga0500644_0052758 Ga0500644_0052758_616_1308 230
1720 3300053104 Ga0500556_0001832 Ga0500556_0001832_5458_6150 230
1721 3300053122 Ga0500608_120592 Ga0500608_120592_340_1032 230
1722 3300053158 Ga0500627_0183937 Ga0500627_0183937_62_760 230
1723 3300054114 Ga0501084_0011095 Ga0501084_0011095_112_804 230
1724 3300060353 Ga0501082_0049449 Ga0501082_0049449_1204_1896 230
1725 3300061734 Ga0530510_0171641 Ga0530510_0171641_27_719 230
1726 2124908027 MRS2a_Contig_97 MRS2a_00806250 231
1727 2162886007 SwRhRL2b_contig_480260 SwRhRL2b_0165.00004310 231
1728 2162886007 SwRhRL2b_contig_530085 SwRhRL2b_0999.00001170 231
1729 2162886007 SwRhRL2b_contig_93034 SwRhRL2b_0779.00003100 231
1730 3300001979 JGI24740J21852_10002263 JGI24740J21852_100022635 231
1731 3300001979 JGI24740J21852_10008888 JGI24740J21852_100088886 231
1732 3300001979 JGI24740J21852_10009980 JGI24740J21852_100099803 231
1733 3300001979 JGI24740J21852_10044406 JGI24740J21852_100444062 231
1734 3300001989 JGI24739J22299_10006788 JGI24739J22299_100067882 231
1735 3300001989 JGI24739J22299_10012692 JGI24739J22299_100126923 231
1736 3300001990 JGI24737J22298_10019023 JGI24737J22298_100190232 231
1737 3300001990 JGI24737J22298_10080892 JGI24737J22298_100808922 231
1738 3300002067 JGI24735J21928_10004283 JGI24735J21928_100042836 231
1739 3300002067 JGI24735J21928_10004376 JGI24735J21928_100043766 231
1740 3300002067 JGI24735J21928_10015628 JGI24735J21928_100156283 231
1741 3300002067 JGI24735J21928_10016824 JGI24735J21928_100168242 231
1742 3300002075 JGI24738J21930_10000269 JGI24738J21930_100002696 231
1743 3300002704 JGI25155J39150_1001463 JGI25155J39150_10014633 231
1744 3300002705 JGI25156J39149_1019169 JGI25156J39149_10191692 231
1745 3300002705 JGI25156J39149_1019178 JGI25156J39149_10191782 231
1746 3300002705 JGI25156J39149_1022116 JGI25156J39149_10221162 231
1747 3300002705 JGI25156J39149_1022234 JGI25156J39149_10222341 231
1748 3300002737 JGI25162J39368_1003029 JGI25162J39368_10030295 231
1749 3300002737 JGI25162J39368_1013686 JGI25162J39368_10136861 231
1750 3300002737 JGI25162J39368_1013692 JGI25162J39368_10136921 231
1751 3300002738 JGI25154J39366_1001113 JGI25154J39366_10011136 231
1752 3300002738 JGI25154J39366_1003448 JGI25154J39366_10034485 231
1753 3300002738 JGI25154J39366_1009085 JGI25154J39366_10090852 231
1754 3300002738 JGI25154J39366_1009100 JGI25154J39366_10091002 231
1755 3300002739 JGI25158J39367_1002309 JGI25158J39367_10023095 231
1756 3300002739 JGI25158J39367_1004871 JGI25158J39367_10048712 231
1757 3300002739 JGI25158J39367_1005117 JGI25158J39367_10051172 231
1758 3300002741 JGI25157J39369_1000533 JGI25157J39369_100053315 231
1759 3300002741 JGI25157J39369_1002793 JGI25157J39369_10027934 231
1760 3300002771 JGI25163J39215_1002498 JGI25163J39215_10024982 231
1761 3300002772 JGI25164J39214_1010646 JGI25164J39214_10106461 231
1762 3300002772 JGI25164J39214_1010659 JGI25164J39214_10106591 231
1763 3300002773 JGI25152J39213_1003388 JGI25152J39213_10033885 231
1764 3300002773 JGI25152J39213_1008855 JGI25152J39213_10088555 231
1765 3300002774 JGI25150J39212_1001674 JGI25150J39212_100167411 231
1766 3300002774 JGI25150J39212_1005950 JGI25150J39212_10059503 231
1767 3300002774 JGI25150J39212_1013679 JGI25150J39212_10136791 231
1768 3300002870 Ga0006763J43179_104870 Ga0006763J43179_1048702 231
1769 3300002987 JGI25159J45721_1003731 JGI25159J45721_10037314 231
1770 3300002987 JGI25159J45721_1022089 JGI25159J45721_10220891 231
1771 3300002987 JGI25159J45721_1031512 JGI25159J45721_10315121 231
1772 3300003161 Ga0006765J45826_105488 Ga0006765J45826_1054885 231
1773 3300003162 Ga0006778J45830_1013353 Ga0006778J45830_10133535 231
1774 3300003163 Ga0006759J45824_1008312 Ga0006759J45824_10083126 231
1775 3300003163 Ga0006759J45824_1008313 Ga0006759J45824_10083134 231
1776 3300003163 Ga0006759J45824_1012908 Ga0006759J45824_10129083 231
1777 3300003163 Ga0006759J45824_1013393 Ga0006759J45824_10133935 231
1778 3300003163 Ga0006759J45824_1037313 Ga0006759J45824_10373135 231
1779 3300003163 Ga0006759J45824_1054940 Ga0006759J45824_10549403 231
1780 3300003163 Ga0006759J45824_1056950 Ga0006759J45824_10569504 231
1781 3300003163 Ga0006759J45824_1060960 Ga0006759J45824_10609602 231
1782 3300003187 JGI25151J46595_10019549 JGI25151J46595_100195493 231
1783 3300003187 JGI25151J46595_10026408 JGI25151J46595_100264083 231
1784 3300003187 JGI25151J46595_10064117 JGI25151J46595_100641172 231
1785 3300003214 JGI25165J46597_1000973 JGI25165J46597_10009737 231
1786 3300003214 JGI25165J46597_1019692 JGI25165J46597_10196921 231
1787 3300003214 JGI25165J46597_1019703 JGI25165J46597_10197031 231
1788 3300003215 JGI25153J46596_10007546 JGI25153J46596_100075464 231
1789 3300003215 JGI25153J46596_10010831 JGI25153J46596_100108315 231
1790 3300003215 JGI25153J46596_10051198 JGI25153J46596_100511981 231
1791 3300003288 Ga0007428J48920_101815 Ga0007428J48920_1018152 231
1792 3300003300 Ga0006758J48902_1003362 Ga0006758J48902_10033629 231
1793 3300003300 Ga0006758J48902_1013144 Ga0006758J48902_10131443 231
1794 3300003300 Ga0006758J48902_1013439 Ga0006758J48902_10134393 231
1795 3300003300 Ga0006758J48902_1021026 Ga0006758J48902_10210262 231
1796 3300003305 Ga0006770J48903_1008186 Ga0006770J48903_10081869 231
1797 3300003305 Ga0006770J48903_1028423 Ga0006770J48903_10284234 231
1798 3300003308 Ga0006777J48905_1018169 Ga0006777J48905_10181693 231
1799 3300003308 Ga0006777J48905_1021980 Ga0006777J48905_102198010 231
1800 3300003308 Ga0006777J48905_1035131 Ga0006777J48905_10351316 231
1801 3300003322 rootL2_10046672 rootL2_100466726 231
1802 3300003322 rootL2_10062408 rootL2_100624082 231
1803 3300003323 rootH1_10294861 rootH1_102948612 231
1804 3300003354 JGI25160J50197_1002205 JGI25160J50197_10022055 231
1805 3300003354 JGI25160J50197_1036689 JGI25160J50197_10366891 231
1806 3300003374 JGI25161J50226_1007205 JGI25161J50226_10072052 231
1807 3300003374 JGI25161J50226_1010855 JGI25161J50226_10108551 231
1808 3300003374 JGI25161J50226_1015114 JGI25161J50226_10151141 231
1809 3300003479 Ga0006556J51387_1013499 Ga0006556J51387_10134999 231
1810 3300003544 Ga0007417J51691_1002081 Ga0007417J51691_10020816 231
1811 3300003544 Ga0007417J51691_1012480 Ga0007417J51691_10124805 231
1812 3300003544 Ga0007417J51691_1025655 Ga0007417J51691_10256556 231
1813 3300003544 Ga0007417J51691_1027677 Ga0007417J51691_10276775 231
1814 3300003544 Ga0007417J51691_1047720 Ga0007417J51691_10477202 231
1815 3300003559 Ga0007427J51700_104977 Ga0007427J51700_1049775 231
1816 3300003559 Ga0007427J51700_106759 Ga0007427J51700_1067592 231
1817 3300003565 Ga0006560J51390_1019398 Ga0006560J51390_10193986 231
1818 3300003567 Ga0006554J51385_1014759 Ga0006554J51385_10147599 231
1819 3300003568 Ga0006781J51513_1018262 Ga0006781J51513_10182623 231
1820 3300003574 Ga0007410J51695_1002863 Ga0007410J51695_10028634 231
1821 3300003574 Ga0007410J51695_1004626 Ga0007410J51695_10046266 231
1822 3300003574 Ga0007410J51695_1006059 Ga0007410J51695_10060596 231
1823 3300003574 Ga0007410J51695_1045991 Ga0007410J51695_10459914 231
1824 3300003575 Ga0007409J51694_1015401 Ga0007409J51694_10154019 231
1825 3300003575 Ga0007409J51694_1020508 Ga0007409J51694_10205083 231
1826 3300003575 Ga0007409J51694_1024015 Ga0007409J51694_10240157 231
1827 3300003575 Ga0007409J51694_1041469 Ga0007409J51694_10414692 231
1828 3300003575 Ga0007409J51694_1053185 Ga0007409J51694_10531853 231
1829 3300003577 Ga0007416J51690_1008957 Ga0007416J51690_10089572 231
1830 3300003577 Ga0007416J51690_1008958 Ga0007416J51690_10089581 231
1831 3300003577 Ga0007416J51690_1013143 Ga0007416J51690_10131435 231
1832 3300003577 Ga0007416J51690_1022609 Ga0007416J51690_10226092 231
1833 3300003577 Ga0007416J51690_1031581 Ga0007416J51690_10315817 231
1834 3300003577 Ga0007416J51690_1034163 Ga0007416J51690_10341635 231
1835 3300003578 Ga0006562J51391_1010419 Ga0006562J51391_10104196 231
1836 3300003578 Ga0006562J51391_1020436 Ga0006562J51391_10204366 231
1837 3300003579 Ga0007429J51699_1009554 Ga0007429J51699_10095549 231
1838 3300003579 Ga0007429J51699_1013684 Ga0007429J51699_10136841 231
1839 3300003579 Ga0007429J51699_1075831 Ga0007429J51699_10758312 231
1840 3300003611 Ga0007411J51799_102169 Ga0007411J51799_1021696 231
1841 3300003611 Ga0007411J51799_105007 Ga0007411J51799_1050072 231
1842 3300003611 Ga0007411J51799_110017 Ga0007411J51799_1100172 231
1843 3300003613 Ga0007415J51800_108879 Ga0007415J51800_1088795 231
1844 3300003613 Ga0007415J51800_109874 Ga0007415J51800_1098742 231
1845 3300003693 Ga0032354_1003506 Ga0032354_10035063 231
1846 3300003693 Ga0032354_1013988 Ga0032354_10139883 231
1847 3300003693 Ga0032354_1021066 Ga0032354_10210661 231
1848 3300003693 Ga0032354_1024828 Ga0032354_10248286 231
1849 3300003693 Ga0032354_1033601 Ga0032354_10336013 231
1850 3300003693 Ga0032354_1035910 Ga0032354_10359106 231
1851 3300003735 Ga0006780_1004575 Ga0006780_10045759 231
1852 3300003751 Ga0055538_1000042 Ga0055538_1000042165 231
1853 3300003752 Ga0055539_1000055 Ga0055539_1000055165 231
1854 3300003756 Ga0055533_1000067 Ga0055533_1000067165 231
1855 3300003756 Ga0055533_1000312 Ga0055533_10003126 231
1856 3300003756 Ga0055533_1000367 Ga0055533_100036711 231
1857 3300003756 Ga0055533_1006736 Ga0055533_10067362 231
1858 3300003756 Ga0055533_1010239 Ga0055533_10102391 231
1859 3300003758 Ga0055532_1000053 Ga0055532_1000053165 231
1860 3300003758 Ga0055532_1000420 Ga0055532_100042013 231
1861 3300003758 Ga0055532_1000904 Ga0055532_10009045 231
1862 3300003758 Ga0055532_1012692 Ga0055532_10126921 231
1863 3300003759 Ga0055525_1000147 Ga0055525_100014769 231
1864 3300003759 Ga0055525_1000697 Ga0055525_100069712 231
1865 3300003759 Ga0055525_1001619 Ga0055525_10016196 231
1866 3300003760 Ga0055527_1000706 Ga0055527_10007065 231
1867 3300003760 Ga0055527_1002227 Ga0055527_10022274 231
1868 3300003761 Ga0055535_1001280 Ga0055535_10012807 231
1869 3300003761 Ga0055535_1001743 Ga0055535_10017435 231
1870 3300003761 Ga0055535_1005243 Ga0055535_10052435 231
1871 3300003761 Ga0055535_1011680 Ga0055535_10116802 231
1872 3300003762 Ga0055542_1000965 Ga0055542_10009655 231
1873 3300003762 Ga0055542_1000994 Ga0055542_10009945 231
1874 3300003763 Ga0055529_1000375 Ga0055529_100037531 231
1875 3300003763 Ga0055529_1000766 Ga0055529_100076611 231
1876 3300003763 Ga0055529_1001229 Ga0055529_10012295 231
1877 3300003763 Ga0055529_1004017 Ga0055529_10040172 231
1878 3300003771 Ga0055526_1001586 Ga0055526_10015866 231
1879 3300003771 Ga0055526_1001760 Ga0055526_10017605 231
1880 3300003771 Ga0055526_1016495 Ga0055526_10164951 231
1881 3300003771 Ga0055526_1040102 Ga0055526_10401021 231
1882 3300003771 Ga0055526_1040108 Ga0055526_10401082 231
1883 3300003771 Ga0055526_1060711 Ga0055526_10607111 231
1884 3300003773 Ga0055537_1004461 Ga0055537_10044616 231
1885 3300003773 Ga0055537_1004555 Ga0055537_10045556 231
1886 3300003773 Ga0055537_1007348 Ga0055537_10073482 231
1887 3300003773 Ga0055537_1007354 Ga0055537_10073545 231
1888 3300003773 Ga0055537_1017394 Ga0055537_10173941 231
1889 3300003775 Ga0055524_1014273 Ga0055524_10142735 231
1890 3300003775 Ga0055524_1016630 Ga0055524_10166305 231
1891 3300003775 Ga0055524_1032332 Ga0055524_10323321 231
1892 3300003775 Ga0055524_1040578 Ga0055524_10405781 231
1893 3300003775 Ga0055524_1040607 Ga0055524_10406071 231
1894 3300003781 Ga0055536_1015419 Ga0055536_10154195 231
1895 3300003781 Ga0055536_1046536 Ga0055536_10465361 231
1896 3300003784 Ga0055534_1004800 Ga0055534_10048006 231
1897 3300003784 Ga0055534_1006810 Ga0055534_10068106 231
1898 3300003784 Ga0055534_1010540 Ga0055534_10105402 231
1899 3300003784 Ga0055534_1019064 Ga0055534_10190641 231
1900 3300003790 Ga0055528_1003884 Ga0055528_10038844 231
1901 3300003790 Ga0055528_1007975 Ga0055528_10079755 231
1902 3300003790 Ga0055528_1012187 Ga0055528_10121872 231
1903 3300003790 Ga0055528_1032883 Ga0055528_10328832 231
1904 3300003790 Ga0055528_1036161 Ga0055528_10361611 231
1905 3300003791 Ga0055530_10018909 Ga0055530_100189091 231
1906 3300003792 Ga0055540_1015112 Ga0055540_10151123 231
1907 3300003792 Ga0055540_1019361 Ga0055540_10193612 231
1908 3300003792 Ga0055540_1020762 Ga0055540_10207621 231
1909 3300003792 Ga0055540_1026260 Ga0055540_10262602 231
1910 3300003792 Ga0055540_1045173 Ga0055540_10451732 231
1911 3300003794 Ga0055531_10008751 Ga0055531_100087514 231
1912 3300003794 Ga0055531_10014923 Ga0055531_100149236 231
1913 3300003794 Ga0055531_10018127 Ga0055531_100181275 231
1914 3300003794 Ga0055531_10024841 Ga0055531_100248412 231
1915 3300003794 Ga0055531_10046801 Ga0055531_100468011 231
1916 3300003794 Ga0055531_10065047 Ga0055531_100650472 231
1917 3300003841 Ga0055541_1000042 Ga0055541_100004212 231
1918 3300003841 Ga0055541_1016198 Ga0055541_10161981 231
1919 3300003856 Ga0058692_1008521 Ga0058692_10085211 231
1920 3300003856 Ga0058692_1021124 Ga0058692_10211242 231
1921 3300004625 Ga0055543_1001868 Ga0055543_10018686 231
1922 3300004625 Ga0055543_1006838 Ga0055543_10068381 231
1923 3300004625 Ga0055543_1019404 Ga0055543_10194042 231
1924 3300004625 Ga0055543_1020426 Ga0055543_10204261 231
1925 3300004785 Ga0058858_1423729 Ga0058858_14237293 231
1926 3300004801 Ga0058860_10182235 Ga0058860_101822351 231
1927 3300004801 Ga0058860_10196087 Ga0058860_101960871 231
1928 3300005262 Ga0065165_1002163 Ga0065165_10021636 231
1929 3300005262 Ga0065165_1003318 Ga0065165_10033185 231
1930 3300005262 Ga0065165_1005491 Ga0065165_10054912 231
1931 3300005262 Ga0065165_1007574 Ga0065165_10075742 231
1932 3300005262 Ga0065165_1012211 Ga0065165_10122116 231
1933 3300005262 Ga0065165_1017368 Ga0065165_10173681 231
1934 3300005262 Ga0065165_1084770 Ga0065165_10847701 231
1935 3300005272 Ga0065703_1000567 Ga0065703_10005676 231
1936 3300005288 Ga0065714_10000728 Ga0065714_100007282 231
1937 3300005288 Ga0065714_10013518 Ga0065714_100135184 231
1938 3300005288 Ga0065714_10093619 Ga0065714_100936191 231
1939 3300005288 Ga0065714_10141567 Ga0065714_101415672 231
1940 3300005288 Ga0065714_10156470 Ga0065714_101564702 231
1941 3300005288 Ga0065714_10204262 Ga0065714_102042621 231
1942 3300005289 Ga0065704_10004101 Ga0065704_100041015 231
1943 3300005289 Ga0065704_10012044 Ga0065704_100120442 231
1944 3300005289 Ga0065704_10033296 Ga0065704_100332961 231
1945 3300005289 Ga0065704_10048089 Ga0065704_100480893 231
1946 3300005289 Ga0065704_10071580 Ga0065704_100715805 231
1947 3300005289 Ga0065704_10109360 Ga0065704_101093601 231
1948 3300005289 Ga0065704_10174585 Ga0065704_101745852 231
1949 3300005289 Ga0065704_10326866 Ga0065704_103268661 231
1950 3300005290 Ga0065712_10013211 Ga0065712_100132112 231
1951 3300005290 Ga0065712_10068086 Ga0065712_100680865 231
1952 3300005293 Ga0065715_10009586 Ga0065715_100095864 231
1953 3300005293 Ga0065715_10100546 Ga0065715_101005463 231
1954 3300005293 Ga0065715_10275534 Ga0065715_102755342 231
1955 3300005293 Ga0065715_10414577 Ga0065715_104145771 231
1956 3300005295 Ga0065707_10145446 Ga0065707_101454462 231
1957 3300005327 Ga0070658_10034935 Ga0070658_100349354 231
1958 3300005327 Ga0070658_10325437 Ga0070658_103254372 231
1959 3300005328 Ga0070676_10012937 Ga0070676_100129374 231
1960 3300005328 Ga0070676_10575125 Ga0070676_105751251 231
1961 3300005329 Ga0070683_100062099 Ga0070683_1000620994 231
1962 3300005329 Ga0070683_100108640 Ga0070683_1001086401 231
1963 3300005329 Ga0070683_100367281 Ga0070683_1003672812 231
1964 3300005330 Ga0070690_100024862 Ga0070690_1000248624 231
1965 3300005330 Ga0070690_100079606 Ga0070690_1000796063 231
1966 3300005331 Ga0070670_100172285 Ga0070670_1001722852 231
1967 3300005331 Ga0070670_100174975 Ga0070670_1001749752 231
1968 3300005331 Ga0070670_100411167 Ga0070670_1004111673 231
1969 3300005331 Ga0070670_100721135 Ga0070670_1007211351 231
1970 3300005333 Ga0070677_10017819 Ga0070677_100178193 231
1971 3300005333 Ga0070677_10153971 Ga0070677_101539711 231
1972 3300005334 Ga0068869_100012392 Ga0068869_1000123924 231
1973 3300005334 Ga0068869_100134056 Ga0068869_1001340561 231
1974 3300005334 Ga0068869_100203574 Ga0068869_1002035741 231
1975 3300005334 Ga0068869_100243813 Ga0068869_1002438132 231
1976 3300005334 Ga0068869_100409706 Ga0068869_1004097061 231
1977 3300005335 Ga0070666_10044235 Ga0070666_100442353 231
1978 3300005335 Ga0070666_10081242 Ga0070666_100812422 231
1979 3300005335 Ga0070666_10149611 Ga0070666_101496112 231
1980 3300005335 Ga0070666_10320407 Ga0070666_103204071 231
1981 3300005336 Ga0070680_100134450 Ga0070680_1001344502 231
1982 3300005337 Ga0070682_100043929 Ga0070682_1000439292 231
1983 3300005337 Ga0070682_100274736 Ga0070682_1002747362 231
1984 3300005338 Ga0068868_100035172 Ga0068868_1000351726 231
1985 3300005338 Ga0068868_100054643 Ga0068868_1000546432 231
1986 3300005338 Ga0068868_100090067 Ga0068868_1000900672 231
1987 3300005339 Ga0070660_100004872 Ga0070660_1000048726 231
1988 3300005339 Ga0070660_100033761 Ga0070660_1000337615 231
1989 3300005339 Ga0070660_100054384 Ga0070660_1000543846 231
1990 3300005339 Ga0070660_100163159 Ga0070660_1001631592 231
1991 3300005339 Ga0070660_100170370 Ga0070660_1001703702 231
1992 3300005339 Ga0070660_100180761 Ga0070660_1001807612 231
1993 3300005340 Ga0070689_100456633 Ga0070689_1004566331 231
1994 3300005340 Ga0070689_100504853 Ga0070689_1005048531 231
1995 3300005341 Ga0070691_10171364 Ga0070691_101713642 231
1996 3300005344 Ga0070661_100011000 Ga0070661_10001100012 231
1997 3300005344 Ga0070661_100022248 Ga0070661_1000222484 231
1998 3300005344 Ga0070661_100041940 Ga0070661_1000419403 231
1999 3300005344 Ga0070661_100045102 Ga0070661_1000451022 231
2000 3300005344 Ga0070661_100132569 Ga0070661_1001325693 231
2001 3300005344 Ga0070661_100157554 Ga0070661_1001575543 231
2002 3300005347 Ga0070668_100039490 Ga0070668_1000394902 231
2003 3300005347 Ga0070668_100082658 Ga0070668_1000826583 231
2004 3300005347 Ga0070668_100518289 Ga0070668_1005182891 231
2005 3300005353 Ga0070669_100001492 Ga0070669_10000149211 231
2006 3300005353 Ga0070669_100036662 Ga0070669_1000366622 231
2007 3300005353 Ga0070669_100053724 Ga0070669_1000537245 231
2008 3300005353 Ga0070669_100079880 Ga0070669_1000798802 231
2009 3300005353 Ga0070669_100144424 Ga0070669_1001444242 231
2010 3300005353 Ga0070669_100251075 Ga0070669_1002510752 231
2011 3300005353 Ga0070669_100674029 Ga0070669_1006740291 231
2012 3300005354 Ga0070675_100036618 Ga0070675_1000366186 231
2013 3300005354 Ga0070675_100053700 Ga0070675_1000537002 231
2014 3300005354 Ga0070675_100075970 Ga0070675_1000759702 231
2015 3300005354 Ga0070675_100253368 Ga0070675_1002533682 231
2016 3300005354 Ga0070675_100658881 Ga0070675_1006588811 231
2017 3300005355 Ga0070671_100071083 Ga0070671_1000710833 231
2018 3300005355 Ga0070671_100082359 Ga0070671_1000823593 231
2019 3300005355 Ga0070671_100174467 Ga0070671_1001744672 231
2020 3300005355 Ga0070671_100399634 Ga0070671_1003996341 231
2021 3300005355 Ga0070671_100543545 Ga0070671_1005435451 231
2022 3300005356 Ga0070674_100052645 Ga0070674_1000526452 231
2023 3300005356 Ga0070674_100267987 Ga0070674_1002679872 231
2024 3300005364 Ga0070673_100269916 Ga0070673_1002699162 231
2025 3300005364 Ga0070673_100301582 Ga0070673_1003015821 231
2026 3300005364 Ga0070673_100345478 Ga0070673_1003454782 231
2027 3300005366 Ga0070659_100004507 Ga0070659_1000045075 231
2028 3300005366 Ga0070659_100022490 Ga0070659_1000224906 231
2029 3300005366 Ga0070659_100023988 Ga0070659_1000239884 231
2030 3300005366 Ga0070659_100047642 Ga0070659_1000476425 231
2031 3300005366 Ga0070659_100174424 Ga0070659_1001744242 231
2032 3300005366 Ga0070659_100618863 Ga0070659_1006188631 231
2033 3300005367 Ga0070667_100129740 Ga0070667_1001297403 231
2034 3300005367 Ga0070667_100142463 Ga0070667_1001424632 231
2035 3300005367 Ga0070667_100170432 Ga0070667_1001704322 231
2036 3300005367 Ga0070667_100226428 Ga0070667_1002264282 231
2037 3300005367 Ga0070667_100271951 Ga0070667_1002719511 231
2038 3300005435 Ga0070714_100142641 Ga0070714_1001426413 231
2039 3300005435 Ga0070714_100890750 Ga0070714_1008907501 231
2040 3300005455 Ga0070663_100001491 Ga0070663_1000014917 231
2041 3300005455 Ga0070663_100044432 Ga0070663_1000444323 231
2042 3300005455 Ga0070663_100220534 Ga0070663_1002205342 231
2043 3300005455 Ga0070663_100472609 Ga0070663_1004726092 231
2044 3300005457 Ga0070662_100018993 Ga0070662_1000189933 231
2045 3300005457 Ga0070662_100023222 Ga0070662_1000232227 231
2046 3300005457 Ga0070662_100142409 Ga0070662_1001424091 231
2047 3300005457 Ga0070662_100252324 Ga0070662_1002523242 231
2048 3300005457 Ga0070662_100317088 Ga0070662_1003170882 231
2049 3300005458 Ga0070681_10042650 Ga0070681_100426504 231
2050 3300005459 Ga0068867_100020316 Ga0068867_1000203166 231
2051 3300005459 Ga0068867_100036683 Ga0068867_1000366834 231
2052 3300005459 Ga0068867_100072766 Ga0068867_1000727664 231
2053 3300005459 Ga0068867_100085089 Ga0068867_1000850891 231
2054 3300005459 Ga0068867_100233655 Ga0068867_1002336551 231
2055 3300005459 Ga0068867_100241435 Ga0068867_1002414351 231
2056 3300005530 Ga0070679_100015259 Ga0070679_1000152596 231
2057 3300005530 Ga0070679_100100542 Ga0070679_1001005423 231
2058 3300005530 Ga0070679_100506104 Ga0070679_1005061042 231
2059 3300005530 Ga0070679_100736605 Ga0070679_1007366052 231
2060 3300005535 Ga0070684_100053645 Ga0070684_1000536454 231
2061 3300005539 Ga0068853_100008367 Ga0068853_10000836712 231
2062 3300005539 Ga0068853_100129859 Ga0068853_1001298592 231
2063 3300005539 Ga0068853_100146388 Ga0068853_1001463881 231
2064 3300005539 Ga0068853_100536368 Ga0068853_1005363682 231
2065 3300005539 Ga0068853_100711380 Ga0068853_1007113801 231
2066 3300005543 Ga0070672_100014710 Ga0070672_1000147102 231
2067 3300005543 Ga0070672_100112906 Ga0070672_1001129062 231
2068 3300005543 Ga0070672_100251260 Ga0070672_1002512602 231
2069 3300005543 Ga0070672_100295397 Ga0070672_1002953972 231
2070 3300005543 Ga0070672_100348310 Ga0070672_1003483102 231
2071 3300005543 Ga0070672_100384124 Ga0070672_1003841242 231
2072 3300005544 Ga0070686_100097020 Ga0070686_1000970202 231
2073 3300005547 Ga0070693_100126049 Ga0070693_1001260491 231
2074 3300005548 Ga0070665_100026283 Ga0070665_1000262836 231
2075 3300005548 Ga0070665_100158839 Ga0070665_1001588392 231
2076 3300005548 Ga0070665_100168679 Ga0070665_1001686792 231
2077 3300005548 Ga0070665_100173818 Ga0070665_1001738183 231
2078 3300005548 Ga0070665_100384776 Ga0070665_1003847762 231
2079 3300005548 Ga0070665_100548171 Ga0070665_1005481711 231
2080 3300005548 Ga0070665_100792787 Ga0070665_1007927871 231
2081 3300005548 Ga0070665_101017901 Ga0070665_1010179011 231
2082 3300005563 Ga0068855_100004511 Ga0068855_1000045116 231
2083 3300005563 Ga0068855_100053580 Ga0068855_1000535804 231
2084 3300005563 Ga0068855_100097026 Ga0068855_1000970262 231
2085 3300005563 Ga0068855_100123020 Ga0068855_1001230204 231
2086 3300005563 Ga0068855_100317666 Ga0068855_1003176663 231
2087 3300005563 Ga0068855_100356361 Ga0068855_1003563612 231
2088 3300005563 Ga0068855_100930881 Ga0068855_1009308811 231
2089 3300005564 Ga0070664_100001142 Ga0070664_10000114214 231
2090 3300005564 Ga0070664_100031876 Ga0070664_1000318766 231
2091 3300005564 Ga0070664_100048424 Ga0070664_1000484243 231
2092 3300005564 Ga0070664_100196662 Ga0070664_1001966622 231
2093 3300005564 Ga0070664_100413474 Ga0070664_1004134742 231
2094 3300005564 Ga0070664_100534215 Ga0070664_1005342152 231
2095 3300005564 Ga0070664_100563869 Ga0070664_1005638691 231
2096 3300005577 Ga0068857_100025716 Ga0068857_1000257164 231
2097 3300005577 Ga0068857_100032464 Ga0068857_1000324644 231
2098 3300005577 Ga0068857_100046047 Ga0068857_1000460474 231
2099 3300005577 Ga0068857_100233551 Ga0068857_1002335512 231
2100 3300005577 Ga0068857_100445116 Ga0068857_1004451162 231
2101 3300005578 Ga0068854_100086090 Ga0068854_1000860903 231
2102 3300005578 Ga0068854_100156655 Ga0068854_1001566552 231
2103 3300005578 Ga0068854_100167081 Ga0068854_1001670812 231
2104 3300005578 Ga0068854_100202094 Ga0068854_1002020943 231
2105 3300005614 Ga0068856_100085286 Ga0068856_1000852866 231
2106 3300005614 Ga0068856_100087143 Ga0068856_1000871431 231
2107 3300005614 Ga0068856_100091085 Ga0068856_1000910853 231
2108 3300005614 Ga0068856_100333528 Ga0068856_1003335282 231
2109 3300005614 Ga0068856_100340212 Ga0068856_1003402122 231
2110 3300005616 Ga0068852_100062072 Ga0068852_1000620726 231
2111 3300005616 Ga0068852_100136545 Ga0068852_1001365452 231
2112 3300005616 Ga0068852_100138200 Ga0068852_1001382003 231
2113 3300005616 Ga0068852_100267268 Ga0068852_1002672683 231
2114 3300005616 Ga0068852_100368009 Ga0068852_1003680092 231
2115 3300005616 Ga0068852_100670704 Ga0068852_1006707042 231
2116 3300005617 Ga0068859_100406391 Ga0068859_1004063911 231
2117 3300005617 Ga0068859_100640986 Ga0068859_1006409862 231
2118 3300005618 Ga0068864_100042982 Ga0068864_1000429825 231
2119 3300005718 Ga0068866_10038012 Ga0068866_100380121 231
2120 3300005718 Ga0068866_10051681 Ga0068866_100516813 231
2121 3300005719 Ga0068861_100014692 Ga0068861_1000146927 231
2122 3300005719 Ga0068861_100026051 Ga0068861_1000260514 231
2123 3300005719 Ga0068861_100035592 Ga0068861_1000355926 231
2124 3300005719 Ga0068861_100058573 Ga0068861_1000585732 231
2125 3300005719 Ga0068861_100476514 Ga0068861_1004765142 231
2126 3300005834 Ga0068851_10006211 Ga0068851_1000621112 231
2127 3300005834 Ga0068851_10017555 Ga0068851_100175552 231
2128 3300005834 Ga0068851_10084771 Ga0068851_100847712 231
2129 3300005834 Ga0068851_10100433 Ga0068851_101004332 231
2130 3300005834 Ga0068851_10130722 Ga0068851_101307222 231
2131 3300005840 Ga0068870_10176362 Ga0068870_101763622 231
2132 3300005841 Ga0068863_100088523 Ga0068863_1000885233 231
2133 3300005841 Ga0068863_100093146 Ga0068863_1000931462 231
2134 3300005842 Ga0068858_100018393 Ga0068858_1000183936 231
2135 3300005842 Ga0068858_100024611 Ga0068858_1000246116 231
2136 3300005842 Ga0068858_100121304 Ga0068858_1001213043 231
2137 3300005842 Ga0068858_100548838 Ga0068858_1005488381 231
2138 3300005843 Ga0068860_100012597 Ga0068860_1000125976 231
2139 3300005843 Ga0068860_100058871 Ga0068860_1000588713 231
2140 3300005843 Ga0068860_100164365 Ga0068860_1001643652 231
2141 3300005843 Ga0068860_100789241 Ga0068860_1007892411 231
2142 3300005844 Ga0068862_100024248 Ga0068862_1000242481 231
2143 3300005844 Ga0068862_100125193 Ga0068862_1001251933 231
2144 3300005844 Ga0068862_100382834 Ga0068862_1003828342 231
2145 3300005844 Ga0068862_100485940 Ga0068862_1004859401 231
2146 3300005844 Ga0068862_100598014 Ga0068862_1005980141 231
2147 3300005937 Ga0081455_10000719 Ga0081455_100007196 231
2148 3300005985 Ga0081539_10000011 Ga0081539_10000011145 231
2149 3300006028 Ga0070717_10233787 Ga0070717_102337872 231
2150 3300006028 Ga0070717_10270577 Ga0070717_102705772 231
2151 3300006038 Ga0075365_10057081 Ga0075365_100570813 231
2152 3300006038 Ga0075365_10336381 Ga0075365_103363811 231
2153 3300006042 Ga0075368_10009651 Ga0075368_100096512 231
2154 3300006042 Ga0075368_10014215 Ga0075368_100142152 231
2155 3300006042 Ga0075368_10121622 Ga0075368_101216222 231
2156 3300006042 Ga0075368_10178109 Ga0075368_101781091 231
2157 3300006048 Ga0075363_100009222 Ga0075363_1000092225 231
2158 3300006048 Ga0075363_100012214 Ga0075363_1000122144 231
2159 3300006048 Ga0075363_100016273 Ga0075363_1000162733 231
2160 3300006048 Ga0075363_100031525 Ga0075363_1000315256 231
2161 3300006048 Ga0075363_100075525 Ga0075363_1000755252 231
2162 3300006048 Ga0075363_100177638 Ga0075363_1001776382 231
2163 3300006048 Ga0075363_100251625 Ga0075363_1002516252 231
2164 3300006051 Ga0075364_10008143 Ga0075364_100081436 231
2165 3300006051 Ga0075364_10022236 Ga0075364_100222365 231
2166 3300006051 Ga0075364_10031524 Ga0075364_100315244 231
2167 3300006051 Ga0075364_10074969 Ga0075364_100749692 231
2168 3300006058 Ga0075432_10097008 Ga0075432_100970081 231
2169 3300006163 Ga0070715_10047015 Ga0070715_100470151 231
2170 3300006163 Ga0070715_10111245 Ga0070715_101112451 231
2171 3300006173 Ga0070716_100288591 Ga0070716_1002885912 231
2172 3300006177 Ga0075362_10040414 Ga0075362_100404143 231
2173 3300006177 Ga0075362_10061659 Ga0075362_100616593 231
2174 3300006177 Ga0075362_10070332 Ga0075362_100703323 231
2175 3300006177 Ga0075362_10076455 Ga0075362_100764551 231
2176 3300006178 Ga0075367_10148848 Ga0075367_101488481 231
2177 3300006178 Ga0075367_10244469 Ga0075367_102444692 231
2178 3300006186 Ga0075369_10018756 Ga0075369_100187563 231
2179 3300006186 Ga0075369_10019408 Ga0075369_100194086 231
2180 3300006186 Ga0075369_10033207 Ga0075369_100332072 231
2181 3300006186 Ga0075369_10117470 Ga0075369_101174702 231
2182 3300006186 Ga0075369_10166541 Ga0075369_101665411 231
2183 3300006195 Ga0075366_10004740 Ga0075366_100047402 231
2184 3300006195 Ga0075366_10020376 Ga0075366_100203767 231
2185 3300006195 Ga0075366_10039994 Ga0075366_100399946 231
2186 3300006195 Ga0075366_10045922 Ga0075366_100459223 231
2187 3300006195 Ga0075366_10123301 Ga0075366_101233012 231
2188 3300006195 Ga0075366_10129179 Ga0075366_101291792 231
2189 3300006195 Ga0075366_10204762 Ga0075366_102047621 231
2190 3300006195 Ga0075366_10227509 Ga0075366_102275092 231
2191 3300006237 Ga0097621_100036459 Ga0097621_1000364594 231
2192 3300006237 Ga0097621_100045976 Ga0097621_1000459764 231
2193 3300006237 Ga0097621_100046420 Ga0097621_1000464205 231
2194 3300006237 Ga0097621_100425942 Ga0097621_1004259422 231
2195 3300006237 Ga0097621_100521674 Ga0097621_1005216741 231
2196 3300006353 Ga0075370_10010622 Ga0075370_100106225 231
2197 3300006353 Ga0075370_10011570 Ga0075370_100115706 231
2198 3300006353 Ga0075370_10017419 Ga0075370_100174193 231
2199 3300006353 Ga0075370_10018877 Ga0075370_100188773 231
2200 3300006353 Ga0075370_10020081 Ga0075370_100200814 231
2201 3300006353 Ga0075370_10082080 Ga0075370_100820803 231
2202 3300006353 Ga0075370_10331532 Ga0075370_103315321 231
2203 3300006358 Ga0068871_100570321 Ga0068871_1005703211 231
2204 3300006844 Ga0075428_100114355 Ga0075428_1001143554 231
2205 3300006846 Ga0075430_100258158 Ga0075430_1002581581 231
2206 3300006846 Ga0075430_100552563 Ga0075430_1005525631 231
2207 3300006847 Ga0075431_100082693 Ga0075431_1000826933 231
2208 3300006847 Ga0075431_100461728 Ga0075431_1004617282 231
2209 3300006847 Ga0075431_100655978 Ga0075431_1006559782 231
2210 3300006931 Ga0097620_100406394 Ga0097620_1004063942 231
2211 3300006931 Ga0097620_100640938 Ga0097620_1006409381 231
2212 3300006944 Ga0099823_1002332 Ga0099823_10023326 231
2213 3300006944 Ga0099823_1049317 Ga0099823_10493175 231
2214 3300006946 Ga0079104_1029861 Ga0079104_10298612 231
2215 3300006946 Ga0079104_1030543 Ga0079104_10305432 231
2216 3300006948 Ga0099826_10000051 Ga0099826_1000005150 231
2217 3300006948 Ga0099826_10000093 Ga0099826_100000936 231
2218 3300006948 Ga0099826_10014646 Ga0099826_100146464 231
2219 3300006948 Ga0099826_10029122 Ga0099826_100291224 231
2220 3300009011 Ga0105251_10007598 Ga0105251_1000759812 231
2221 3300009011 Ga0105251_10008134 Ga0105251_100081345 231
2222 3300009011 Ga0105251_10010748 Ga0105251_100107484 231
2223 3300009011 Ga0105251_10021253 Ga0105251_100212531 231
2224 3300009011 Ga0105251_10026606 Ga0105251_100266063 231
2225 3300009011 Ga0105251_10041620 Ga0105251_100416202 231
2226 3300009011 Ga0105251_10102054 Ga0105251_101020541 231
2227 3300009011 Ga0105251_10110775 Ga0105251_101107752 231
2228 3300009011 Ga0105251_10117327 Ga0105251_101173272 231
2229 3300009011 Ga0105251_10163685 Ga0105251_101636852 231
2230 3300009011 Ga0105251_10172621 Ga0105251_101726211 231
2231 3300009011 Ga0105251_10197120 Ga0105251_101971201 231
2232 3300009036 Ga0105244_10015476 Ga0105244_100154764 231
2233 3300009036 Ga0105244_10018351 Ga0105244_100183512 231
2234 3300009036 Ga0105244_10028299 Ga0105244_100282996 231
2235 3300009036 Ga0105244_10117479 Ga0105244_101174792 231
2236 3300009036 Ga0105244_10147254 Ga0105244_101472542 231
2237 3300009036 Ga0105244_10147256 Ga0105244_101472562 231
2238 3300009092 Ga0105250_10006995 Ga0105250_100069954 231
2239 3300009092 Ga0105250_10021127 Ga0105250_100211273 231
2240 3300009092 Ga0105250_10079017 Ga0105250_100790172 231
2241 3300009092 Ga0105250_10089428 Ga0105250_100894282 231
2242 3300009092 Ga0105250_10104016 Ga0105250_101040162 231
2243 3300009092 Ga0105250_10176664 Ga0105250_101766641 231
2244 3300009092 Ga0105250_10234897 Ga0105250_102348971 231
2245 3300009093 Ga0105240_10003945 Ga0105240_1000394516 231
2246 3300009093 Ga0105240_10028244 Ga0105240_100282446 231
2247 3300009093 Ga0105240_10061281 Ga0105240_100612815 231
2248 3300009093 Ga0105240_10084275 Ga0105240_100842756 231
2249 3300009093 Ga0105240_10118621 Ga0105240_101186213 231
2250 3300009093 Ga0105240_10127654 Ga0105240_101276545 231
2251 3300009093 Ga0105240_10321604 Ga0105240_103216043 231
2252 3300009093 Ga0105240_10430869 Ga0105240_104308691 231
2253 3300009093 Ga0105240_10558908 Ga0105240_105589082 231
2254 3300009093 Ga0105240_10930410 Ga0105240_109304101 231
2255 3300009094 Ga0111539_10261586 Ga0111539_102615862 231
2256 3300009094 Ga0111539_10616300 Ga0111539_106163001 231
2257 3300009094 Ga0111539_10687435 Ga0111539_106874352 231
2258 3300009098 Ga0105245_10043502 Ga0105245_100435023 231
2259 3300009098 Ga0105245_10097601 Ga0105245_100976014 231
2260 3300009101 Ga0105247_10014245 Ga0105247_100142454 231
2261 3300009101 Ga0105247_10173586 Ga0105247_101735862 231
2262 3300009148 Ga0105243_10000248 Ga0105243_1000024862 231
2263 3300009148 Ga0105243_10016441 Ga0105243_100164414 231
2264 3300009148 Ga0105243_10056174 Ga0105243_100561744 231
2265 3300009148 Ga0105243_10058416 Ga0105243_100584162 231
2266 3300009148 Ga0105243_10078444 Ga0105243_100784443 231
2267 3300009148 Ga0105243_10082803 Ga0105243_100828035 231
2268 3300009148 Ga0105243_10339164 Ga0105243_103391642 231
2269 3300009148 Ga0105243_10408690 Ga0105243_104086901 231
2270 3300009148 Ga0105243_10566174 Ga0105243_105661741 231
2271 3300009174 Ga0105241_10062554 Ga0105241_100625544 231
2272 3300009174 Ga0105241_10323527 Ga0105241_103235271 231
2273 3300009174 Ga0105241_10539600 Ga0105241_105396002 231
2274 3300009176 Ga0105242_10011101 Ga0105242_100111016 231
2275 3300009176 Ga0105242_10219074 Ga0105242_102190742 231
2276 3300009176 Ga0105242_10296680 Ga0105242_102966801 231
2277 3300009176 Ga0105242_10302885 Ga0105242_103028852 231
2278 3300009176 Ga0105242_10363527 Ga0105242_103635272 231
2279 3300009177 Ga0105248_10174730 Ga0105248_101747302 231
2280 3300009177 Ga0105248_10330094 Ga0105248_103300943 231
2281 3300009545 Ga0105237_10004215 Ga0105237_1000421510 231
2282 3300009545 Ga0105237_10019864 Ga0105237_100198643 231
2283 3300009545 Ga0105237_10023654 Ga0105237_100236546 231
2284 3300009545 Ga0105237_10029982 Ga0105237_100299823 231
2285 3300009545 Ga0105237_10039485 Ga0105237_100394852 231
2286 3300009545 Ga0105237_10230648 Ga0105237_102306482 231
2287 3300009545 Ga0105237_10394553 Ga0105237_103945531 231
2288 3300009545 Ga0105237_10427240 Ga0105237_104272402 231
2289 3300009551 Ga0105238_10001522 Ga0105238_1000152215 231
2290 3300009551 Ga0105238_10055311 Ga0105238_100553114 231
2291 3300009551 Ga0105238_10070225 Ga0105238_100702254 231
2292 3300009551 Ga0105238_10074461 Ga0105238_100744614 231
2293 3300009551 Ga0105238_10088308 Ga0105238_100883082 231
2294 3300009551 Ga0105238_10092066 Ga0105238_100920662 231
2295 3300009551 Ga0105238_10135101 Ga0105238_101351016 231
2296 3300009551 Ga0105238_10235630 Ga0105238_102356302 231
2297 3300009551 Ga0105238_10481239 Ga0105238_104812392 231
2298 3300009551 Ga0105238_10510569 Ga0105238_105105692 231
2299 3300009551 Ga0105238_10555026 Ga0105238_105550262 231
2300 3300009553 Ga0105249_10039669 Ga0105249_100396694 231
2301 3300009553 Ga0105249_10103094 Ga0105249_101030946 231
2302 3300010159 Ga0099796_10096586 Ga0099796_100965861 231
2303 3300010375 Ga0105239_10014369 Ga0105239_100143696 231
2304 3300010375 Ga0105239_10028268 Ga0105239_100282686 231
2305 3300010375 Ga0105239_10138610 Ga0105239_101386101 231
2306 3300010375 Ga0105239_10143278 Ga0105239_101432786 231
2307 3300010375 Ga0105239_11282310 Ga0105239_112823101 231
2308 3300011119 Ga0105246_10056409 Ga0105246_100564094 231
2309 3300011119 Ga0105246_10143839 Ga0105246_101438391 231
2310 3300011119 Ga0105246_10297059 Ga0105246_102970592 231
2311 3300011119 Ga0105246_10468730 Ga0105246_104687302 231
2312 3300011119 Ga0105246_10471011 Ga0105246_104710112 231
2313 3300011119 Ga0105246_10471991 Ga0105246_104719912 231
2314 3300012497 Ga0157319_1000047 Ga0157319_10000476 231
2315 3300013100 Ga0157373_10025258 Ga0157373_100252584 231
2316 3300013100 Ga0157373_10026424 Ga0157373_100264243 231
2317 3300013100 Ga0157373_10087303 Ga0157373_100873032 231
2318 3300013100 Ga0157373_10188334 Ga0157373_101883343 231
2319 3300013102 Ga0157371_10000710 Ga0157371_100007106 231
2320 3300013102 Ga0157371_10021095 Ga0157371_1002109512 231
2321 3300013102 Ga0157371_10072372 Ga0157371_100723722 231
2322 3300013102 Ga0157371_10532517 Ga0157371_105325171 231
2323 3300013104 Ga0157370_10018567 Ga0157370_100185672 231
2324 3300013104 Ga0157370_10020339 Ga0157370_100203394 231
2325 3300013104 Ga0157370_10074593 Ga0157370_100745932 231
2326 3300013104 Ga0157370_10077397 Ga0157370_100773972 231
2327 3300013104 Ga0157370_10095138 Ga0157370_100951386 231
2328 3300013104 Ga0157370_10257516 Ga0157370_102575163 231
2329 3300013104 Ga0157370_10291884 Ga0157370_102918842 231
2330 3300013105 Ga0157369_10012054 Ga0157369_100120545 231
2331 3300013105 Ga0157369_10041518 Ga0157369_100415185 231
2332 3300013105 Ga0157369_10052190 Ga0157369_100521906 231
2333 3300013105 Ga0157369_10056080 Ga0157369_100560804 231
2334 3300013105 Ga0157369_10063626 Ga0157369_100636264 231
2335 3300013105 Ga0157369_10079398 Ga0157369_100793982 231
2336 3300013105 Ga0157369_10167362 Ga0157369_101673622 231
2337 3300013105 Ga0157369_10541084 Ga0157369_105410842 231
2338 3300013105 Ga0157369_10557050 Ga0157369_105570502 231
2339 3300013296 Ga0157374_10001397 Ga0157374_1000139713 231
2340 3300013296 Ga0157374_10027429 Ga0157374_100274295 231
2341 3300013296 Ga0157374_10046997 Ga0157374_100469976 231
2342 3300013296 Ga0157374_10149620 Ga0157374_101496203 231
2343 3300013296 Ga0157374_10277777 Ga0157374_102777771 231
2344 3300013297 Ga0157378_10004819 Ga0157378_1000481911 231
2345 3300013297 Ga0157378_10059853 Ga0157378_100598533 231
2346 3300013307 Ga0157372_10010403 Ga0157372_100104034 231
2347 3300013307 Ga0157372_10010548 Ga0157372_100105484 231
2348 3300013307 Ga0157372_10017321 Ga0157372_100173216 231
2349 3300013307 Ga0157372_10036644 Ga0157372_100366446 231
2350 3300013307 Ga0157372_10152350 Ga0157372_101523502 231
2351 3300013307 Ga0157372_10246432 Ga0157372_102464323 231
2352 3300013307 Ga0157372_10290065 Ga0157372_102900651 231
2353 3300013308 Ga0157375_10066773 Ga0157375_100667733 231
2354 3300013308 Ga0157375_10323515 Ga0157375_103235152 231
2355 3300013308 Ga0157375_11023227 Ga0157375_110232271 231
2356 3300014325 Ga0163163_10053479 Ga0163163_100534796 231
2357 3300014325 Ga0163163_10096865 Ga0163163_100968655 231
2358 3300014325 Ga0163163_10756905 Ga0163163_107569051 231
2359 3300014326 Ga0157380_10027107 Ga0157380_100271079 231
2360 3300014326 Ga0157380_10045061 Ga0157380_100450612 231
2361 3300014497 Ga0182008_10005790 Ga0182008_100057906 231
2362 3300014497 Ga0182008_10056782 Ga0182008_100567823 231
2363 3300014497 Ga0182008_10267650 Ga0182008_102676501 231
2364 3300014745 Ga0157377_10000420 Ga0157377_1000042011 231
2365 3300014745 Ga0157377_10083741 Ga0157377_100837413 231
2366 3300014745 Ga0157377_10403478 Ga0157377_104034782 231
2367 3300014968 Ga0157379_10081922 Ga0157379_100819226 231
2368 3300014968 Ga0157379_10267211 Ga0157379_102672112 231
2369 3300014968 Ga0157379_10380594 Ga0157379_103805942 231
2370 3300014969 Ga0157376_10107378 Ga0157376_101073781 231
2371 3300015261 Ga0182006_1003658 Ga0182006_10036583 231
2372 3300015261 Ga0182006_1008556 Ga0182006_10085567 231
2373 3300015261 Ga0182006_1010089 Ga0182006_10100894 231
2374 3300015261 Ga0182006_1013810 Ga0182006_10138102 231
2375 3300015261 Ga0182006_1026098 Ga0182006_10260981 231
2376 3300015261 Ga0182006_1036842 Ga0182006_10368422 231
2377 3300015261 Ga0182006_1140711 Ga0182006_11407111 231
2378 3300015262 Ga0182007_10018209 Ga0182007_100182091 231
2379 3300015262 Ga0182007_10035953 Ga0182007_100359532 231
2380 3300015262 Ga0182007_10154696 Ga0182007_101546961 231
2381 3300015265 Ga0182005_1001566 Ga0182005_10015666 231
2382 3300015265 Ga0182005_1039083 Ga0182005_10390831 231
2383 3300015265 Ga0182005_1043182 Ga0182005_10431822 231
2384 3300015265 Ga0182005_1058249 Ga0182005_10582491 231
2385 3300015683 Ga0183362_10014 Ga0183362_1001432 231
2386 3300016635 Ga0183361_10015 Ga0183361_1001510 231
2387 3300017792 Ga0163161_10057093 Ga0163161_100570932 231
2388 3300017792 Ga0163161_10068372 Ga0163161_100683722 231
2389 3300017792 Ga0163161_10089105 Ga0163161_100891051 231
2390 3300017792 Ga0163161_10150572 Ga0163161_101505722 231
2391 3300017792 Ga0163161_10333708 Ga0163161_103337081 231
2392 3300017792 Ga0163161_10601609 Ga0163161_106016091 231
2393 3300019179 Ga0184593_100839 Ga0184593_1008392 231
2394 3300020069 Ga0197907_10126445 Ga0197907_101264455 231
2395 3300020069 Ga0197907_10464023 Ga0197907_104640232 231
2396 3300020070 Ga0206356_10084425 Ga0206356_100844253 231
2397 3300020070 Ga0206356_11000981 Ga0206356_110009815 231
2398 3300020076 Ga0206355_1487813 Ga0206355_14878136 231
2399 3300020076 Ga0206355_1531200 Ga0206355_15312004 231
2400 3300020077 Ga0206351_10620683 Ga0206351_106206832 231
2401 3300020077 Ga0206351_10629243 Ga0206351_106292432 231
2402 3300020078 Ga0206352_10541187 Ga0206352_105411871 231
2403 3300020080 Ga0206350_10154136 Ga0206350_101541364 231
2404 3300020080 Ga0206350_10703408 Ga0206350_107034082 231
2405 3300020081 Ga0206354_10999262 Ga0206354_109992624 231
2406 3300020081 Ga0206354_11062004 Ga0206354_110620046 231
2407 3300020082 Ga0206353_10101101 Ga0206353_101011013 231
2408 3300020082 Ga0206353_11264784 Ga0206353_112647841 231
2409 3300020610 Ga0154015_1005695 Ga0154015_10056953 231
2410 3300020610 Ga0154015_1082036 Ga0154015_10820362 231
2411 3300021361 Ga0213872_10001174 Ga0213872_100011746 231
2412 3300021361 Ga0213872_10002302 Ga0213872_100023025 231
2413 3300021361 Ga0213872_10002796 Ga0213872_100027966 231
2414 3300021361 Ga0213872_10003575 Ga0213872_100035755 231
2415 3300021361 Ga0213872_10013483 Ga0213872_100134836 231
2416 3300021361 Ga0213872_10013711 Ga0213872_100137112 231
2417 3300021361 Ga0213872_10038758 Ga0213872_100387582 231
2418 3300021361 Ga0213872_10093952 Ga0213872_100939521 231
2419 3300021361 Ga0213872_10128669 Ga0213872_101286692 231
2420 3300022467 Ga0224712_10000449 Ga0224712_100004494 231
2421 3300022467 Ga0224712_10020815 Ga0224712_100208152 231
2422 3300025206 Ga0209435_100186 Ga0209435_10018612 231
2423 3300025206 Ga0209435_100191 Ga0209435_1001915 231
2424 3300025206 Ga0209435_100715 Ga0209435_1007152 231
2425 3300025207 Ga0209760_100117 Ga0209760_10011757 231
2426 3300025207 Ga0209760_101366 Ga0209760_1013666 231
2427 3300025208 Ga0209436_101414 Ga0209436_1014145 231
2428 3300025208 Ga0209436_101521 Ga0209436_1015215 231
2429 3300025208 Ga0209436_110490 Ga0209436_1104902 231
2430 3300025224 Ga0209784_100060 Ga0209784_10006012 231
2431 3300025225 Ga0209566_100075 Ga0209566_10007512 231
2432 3300025225 Ga0209566_100606 Ga0209566_10060610 231
2433 3300025226 Ga0209674_100067 Ga0209674_100067165 231
2434 3300025226 Ga0209674_100100 Ga0209674_10010012 231
2435 3300025226 Ga0209674_102782 Ga0209674_1027826 231
2436 3300025226 Ga0209674_104429 Ga0209674_1044292 231
2437 3300025228 Ga0209672_100073 Ga0209672_100073171 231
2438 3300025228 Ga0209672_100717 Ga0209672_1007173 231
2439 3300025228 Ga0209672_100718 Ga0209672_1007183 231
2440 3300025228 Ga0209672_102940 Ga0209672_1029404 231
2441 3300025229 Ga0209147_100060 Ga0209147_100060169 231
2442 3300025229 Ga0209147_100093 Ga0209147_100093171 231
2443 3300025229 Ga0209147_100096 Ga0209147_10009612 231
2444 3300025229 Ga0209147_100853 Ga0209147_1008537 231
2445 3300025229 Ga0209147_102542 Ga0209147_1025424 231
2446 3300025229 Ga0209147_103483 Ga0209147_1034836 231
2447 3300025230 Ga0209563_100011 Ga0209563_100011651 231
2448 3300025230 Ga0209563_100068 Ga0209563_100068165 231
2449 3300025230 Ga0209563_100088 Ga0209563_100088105 231
2450 3300025230 Ga0209563_100195 Ga0209563_10019537 231
2451 3300025230 Ga0209563_100889 Ga0209563_1008895 231
2452 3300025230 Ga0209563_103486 Ga0209563_1034864 231
2453 3300025231 Ga0207427_101665 Ga0207427_1016653 231
2454 3300025231 Ga0207427_103268 Ga0207427_1032686 231
2455 3300025233 Ga0209437_100639 Ga0209437_1006396 231
2456 3300025233 Ga0209437_100749 Ga0209437_1007496 231
2457 3300025233 Ga0209437_101208 Ga0209437_1012083 231
2458 3300025242 Ga0209258_100140 Ga0209258_100140171 231
2459 3300025242 Ga0209258_100141 Ga0209258_10014167 231
2460 3300025242 Ga0209258_100387 Ga0209258_10038712 231
2461 3300025242 Ga0209258_100793 Ga0209258_10079311 231
2462 3300025242 Ga0209258_102011 Ga0209258_1020113 231
2463 3300025242 Ga0209258_102012 Ga0209258_1020124 231
2464 3300025242 Ga0209258_103442 Ga0209258_1034422 231
2465 3300025242 Ga0209258_104059 Ga0209258_1040591 231
2466 3300025245 Ga0207425_1000767 Ga0207425_10007676 231
2467 3300025245 Ga0207425_1001042 Ga0207425_10010429 231
2468 3300025245 Ga0207425_1001095 Ga0207425_10010955 231
2469 3300025245 Ga0207425_1007941 Ga0207425_10079416 231
2470 3300025245 Ga0207425_1027415 Ga0207425_10274151 231
2471 3300025246 Ga0209646_1000246 Ga0209646_100024635 231
2472 3300025246 Ga0209646_1000434 Ga0209646_10004346 231
2473 3300025246 Ga0209646_1000740 Ga0209646_10007405 231
2474 3300025246 Ga0209646_1001041 Ga0209646_10010415 231
2475 3300025250 Ga0209026_1000004 Ga0209026_1000004729 231
2476 3300025250 Ga0209026_1004204 Ga0209026_10042046 231
2477 3300025250 Ga0209026_1008075 Ga0209026_10080752 231
2478 3300025253 Ga0209677_100057 Ga0209677_10005712 231
2479 3300025253 Ga0209677_101729 Ga0209677_1017296 231
2480 3300025253 Ga0209677_104488 Ga0209677_1044886 231
2481 3300025253 Ga0209677_106079 Ga0209677_1060792 231
2482 3300025254 Ga0209148_1000140 Ga0209148_1000140172 231
2483 3300025254 Ga0209148_1000323 Ga0209148_100032347 231
2484 3300025254 Ga0209148_1000666 Ga0209148_100066623 231
2485 3300025254 Ga0209148_1000990 Ga0209148_100099010 231
2486 3300025254 Ga0209148_1025879 Ga0209148_10258791 231
2487 3300025256 Ga0209759_1000979 Ga0209759_10009796 231
2488 3300025256 Ga0209759_1002023 Ga0209759_10020237 231
2489 3300025256 Ga0209759_1004194 Ga0209759_10041944 231
2490 3300025256 Ga0209759_1004226 Ga0209759_10042264 231
2491 3300025256 Ga0209759_1005734 Ga0209759_10057343 231
2492 3300025256 Ga0209759_1005917 Ga0209759_10059173 231
2493 3300025256 Ga0209759_1006000 Ga0209759_10060006 231
2494 3300025256 Ga0209759_1011404 Ga0209759_10114042 231
2495 3300025256 Ga0209759_1019813 Ga0209759_10198132 231
2496 3300025258 Ga0209129_1000204 Ga0209129_100020447 231
2497 3300025258 Ga0209129_1009319 Ga0209129_10093195 231
2498 3300025261 Ga0209233_1000133 Ga0209233_100013313 231
2499 3300025261 Ga0209233_1000612 Ga0209233_100061210 231
2500 3300025261 Ga0209233_1007243 Ga0209233_10072436 231
2501 3300025261 Ga0209233_1023462 Ga0209233_10234621 231
2502 3300025263 Ga0209565_1002110 Ga0209565_10021106 231
2503 3300025263 Ga0209565_1002835 Ga0209565_10028354 231
2504 3300025263 Ga0209565_1003275 Ga0209565_10032754 231
2505 3300025263 Ga0209565_1006443 Ga0209565_10064436 231
2506 3300025263 Ga0209565_1006554 Ga0209565_10065542 231
2507 3300025263 Ga0209565_1008373 Ga0209565_10083734 231
2508 3300025263 Ga0209565_1032081 Ga0209565_10320812 231
2509 3300025271 Ga0207666_1005435 Ga0207666_10054352 231
2510 3300025272 Ga0209455_1000125 Ga0209455_1000125172 231
2511 3300025272 Ga0209455_1000303 Ga0209455_100030332 231
2512 3300025272 Ga0209455_1000915 Ga0209455_10009157 231
2513 3300025272 Ga0209455_1001203 Ga0209455_10012035 231
2514 3300025272 Ga0209455_1005403 Ga0209455_10054031 231
2515 3300025273 Ga0209673_1000463 Ga0209673_10004636 231
2516 3300025273 Ga0209673_1001644 Ga0209673_10016445 231
2517 3300025273 Ga0209673_1003465 Ga0209673_10034655 231
2518 3300025273 Ga0209673_1004929 Ga0209673_10049296 231
2519 3300025273 Ga0209673_1005984 Ga0209673_10059844 231
2520 3300025273 Ga0209673_1008361 Ga0209673_10083615 231
2521 3300025273 Ga0209673_1013310 Ga0209673_10133102 231
2522 3300025273 Ga0209673_1013335 Ga0209673_10133353 231
2523 3300025273 Ga0209673_1018215 Ga0209673_10182152 231
2524 3300025284 Ga0209130_1002153 Ga0209130_10021535 231
2525 3300025284 Ga0209130_1002838 Ga0209130_10028385 231
2526 3300025284 Ga0209130_1003943 Ga0209130_10039436 231
2527 3300025284 Ga0209130_1003951 Ga0209130_10039516 231
2528 3300025284 Ga0209130_1012392 Ga0209130_10123924 231
2529 3300025291 Ga0209675_1000186 Ga0209675_10001866 231
2530 3300025291 Ga0209675_1002952 Ga0209675_10029526 231
2531 3300025291 Ga0209675_1004701 Ga0209675_10047016 231
2532 3300025291 Ga0209675_1009571 Ga0209675_10095716 231
2533 3300025291 Ga0209675_1009879 Ga0209675_10098796 231
2534 3300025291 Ga0209675_1022604 Ga0209675_10226042 231
2535 3300025292 Ga0209676_1001219 Ga0209676_100121920 231
2536 3300025292 Ga0209676_1007526 Ga0209676_10075266 231
2537 3300025292 Ga0209676_1011169 Ga0209676_10111696 231
2538 3300025292 Ga0209676_1014157 Ga0209676_10141574 231
2539 3300025294 Ga0209025_1000198 Ga0209025_100019814 231
2540 3300025294 Ga0209025_1001281 Ga0209025_100128119 231
2541 3300025294 Ga0209025_1014425 Ga0209025_10144254 231
2542 3300025294 Ga0209025_1015058 Ga0209025_10150586 231
2543 3300025294 Ga0209025_1017025 Ga0209025_10170256 231
2544 3300025294 Ga0209025_1021549 Ga0209025_10215492 231
2545 3300025294 Ga0209025_1025048 Ga0209025_10250486 231
2546 3300025294 Ga0209025_1027656 Ga0209025_10276564 231
2547 3300025294 Ga0209025_1051209 Ga0209025_10512092 231
2548 3300025294 Ga0209025_1059482 Ga0209025_10594822 231
2549 3300025295 Ga0209564_1000008 Ga0209564_10000087 231
2550 3300025295 Ga0209564_1000027 Ga0209564_1000027437 231
2551 3300025295 Ga0209564_1000230 Ga0209564_100023096 231
2552 3300025295 Ga0209564_1002159 Ga0209564_10021596 231
2553 3300025295 Ga0209564_1006016 Ga0209564_10060164 231
2554 3300025295 Ga0209564_1006926 Ga0209564_10069264 231
2555 3300025295 Ga0209564_1007105 Ga0209564_10071054 231
2556 3300025295 Ga0209564_1013777 Ga0209564_10137776 231
2557 3300025297 Ga0209758_1000442 Ga0209758_100044247 231
2558 3300025297 Ga0209758_1006572 Ga0209758_10065724 231
2559 3300025297 Ga0209758_1006647 Ga0209758_10066474 231
2560 3300025297 Ga0209758_1006747 Ga0209758_10067475 231
2561 3300025297 Ga0209758_1011259 Ga0209758_10112594 231
2562 3300025297 Ga0209758_1017275 Ga0209758_10172753 231
2563 3300025298 Ga0209050_1000052 Ga0209050_1000052298 231
2564 3300025298 Ga0209050_1000292 Ga0209050_100029277 231
2565 3300025298 Ga0209050_1002030 Ga0209050_10020307 231
2566 3300025298 Ga0209050_1002318 Ga0209050_10023186 231
2567 3300025298 Ga0209050_1002464 Ga0209050_10024649 231
2568 3300025298 Ga0209050_1008688 Ga0209050_10086884 231
2569 3300025298 Ga0209050_1017496 Ga0209050_10174961 231
2570 3300025298 Ga0209050_1017757 Ga0209050_10177574 231
2571 3300025298 Ga0209050_1024305 Ga0209050_10243053 231
2572 3300025298 Ga0209050_1024472 Ga0209050_10244722 231
2573 3300025298 Ga0209050_1046662 Ga0209050_10466622 231
2574 3300025299 Ga0209256_1000347 Ga0209256_100034749 231
2575 3300025299 Ga0209256_1002133 Ga0209256_100213310 231
2576 3300025299 Ga0209256_1004685 Ga0209256_10046855 231
2577 3300025299 Ga0209256_1005253 Ga0209256_10052536 231
2578 3300025299 Ga0209256_1006716 Ga0209256_10067166 231
2579 3300025299 Ga0209256_1006866 Ga0209256_10068664 231
2580 3300025299 Ga0209256_1012344 Ga0209256_10123446 231
2581 3300025302 Ga0207426_1001110 Ga0207426_100111018 231
2582 3300025302 Ga0207426_1002480 Ga0207426_10024806 231
2583 3300025302 Ga0207426_1005297 Ga0207426_10052974 231
2584 3300025302 Ga0207426_1005398 Ga0207426_10053986 231
2585 3300025302 Ga0207426_1005868 Ga0207426_10058684 231
2586 3300025303 Ga0209051_1003269 Ga0209051_10032694 231
2587 3300025303 Ga0209051_1003409 Ga0209051_10034095 231
2588 3300025303 Ga0209051_1003886 Ga0209051_10038866 231
2589 3300025303 Ga0209051_1005726 Ga0209051_10057266 231
2590 3300025303 Ga0209051_1009985 Ga0209051_10099854 231
2591 3300025303 Ga0209051_1010189 Ga0209051_10101896 231
2592 3300025303 Ga0209051_1013191 Ga0209051_10131913 231
2593 3300025303 Ga0209051_1015302 Ga0209051_10153022 231
2594 3300025303 Ga0209051_1019200 Ga0209051_10192003 231
2595 3300025303 Ga0209051_1021880 Ga0209051_10218801 231
2596 3300025303 Ga0209051_1022225 Ga0209051_10222252 231
2597 3300025303 Ga0209051_1060489 Ga0209051_10604892 231
2598 3300025303 Ga0209051_1076672 Ga0209051_10766722 231
2599 3300025304 Ga0209257_1000015 Ga0209257_1000015591 231
2600 3300025304 Ga0209257_1000047 Ga0209257_1000047425 231
2601 3300025304 Ga0209257_1000295 Ga0209257_100029580 231
2602 3300025304 Ga0209257_1004915 Ga0209257_10049156 231
2603 3300025304 Ga0209257_1005866 Ga0209257_10058665 231
2604 3300025304 Ga0209257_1013612 Ga0209257_10136123 231
2605 3300025304 Ga0209257_1018291 Ga0209257_10182916 231
2606 3300025304 Ga0209257_1073957 Ga0209257_10739571 231
2607 3300025315 Ga0207697_10029768 Ga0207697_100297683 231
2608 3300025321 Ga0207656_10000010 Ga0207656_1000001011 231
2609 3300025321 Ga0207656_10006797 Ga0207656_100067974 231
2610 3300025321 Ga0207656_10013288 Ga0207656_100132883 231
2611 3300025321 Ga0207656_10062293 Ga0207656_100622931 231
2612 3300025321 Ga0207656_10071946 Ga0207656_100719462 231
2613 3300025711 Ga0207696_1001151 Ga0207696_10011516 231
2614 3300025711 Ga0207696_1001495 Ga0207696_10014956 231
2615 3300025711 Ga0207696_1002359 Ga0207696_10023595 231
2616 3300025711 Ga0207696_1003354 Ga0207696_10033544 231
2617 3300025711 Ga0207696_1003709 Ga0207696_100370911 231
2618 3300025711 Ga0207696_1016351 Ga0207696_10163513 231
2619 3300025711 Ga0207696_1019611 Ga0207696_10196112 231
2620 3300025728 Ga0207655_1001460 Ga0207655_100146014 231
2621 3300025728 Ga0207655_1003094 Ga0207655_100309413 231
2622 3300025728 Ga0207655_1003120 Ga0207655_10031206 231
2623 3300025728 Ga0207655_1003763 Ga0207655_10037636 231
2624 3300025728 Ga0207655_1006903 Ga0207655_10069034 231
2625 3300025728 Ga0207655_1008829 Ga0207655_100882912 231
2626 3300025728 Ga0207655_1010082 Ga0207655_10100826 231
2627 3300025728 Ga0207655_1012838 Ga0207655_10128383 231
2628 3300025728 Ga0207655_1017941 Ga0207655_101794110 231
2629 3300025728 Ga0207655_1018405 Ga0207655_10184053 231
2630 3300025728 Ga0207655_1030773 Ga0207655_10307733 231
2631 3300025728 Ga0207655_1041197 Ga0207655_10411971 231
2632 3300025728 Ga0207655_1076800 Ga0207655_10768002 231
2633 3300025728 Ga0207655_1084316 Ga0207655_10843161 231
2634 3300025728 Ga0207655_1090869 Ga0207655_10908692 231
2635 3300025728 Ga0207655_1093717 Ga0207655_10937171 231
2636 3300025728 Ga0207655_1113502 Ga0207655_11135021 231
2637 3300025735 Ga0207713_1001159 Ga0207713_10011596 231
2638 3300025735 Ga0207713_1001989 Ga0207713_10019892 231
2639 3300025735 Ga0207713_1006017 Ga0207713_10060175 231
2640 3300025735 Ga0207713_1007150 Ga0207713_100715012 231
2641 3300025735 Ga0207713_1016558 Ga0207713_10165584 231
2642 3300025735 Ga0207713_1018455 Ga0207713_10184555 231
2643 3300025735 Ga0207713_1023621 Ga0207713_10236212 231
2644 3300025735 Ga0207713_1026133 Ga0207713_10261331 231
2645 3300025735 Ga0207713_1033501 Ga0207713_10335014 231
2646 3300025735 Ga0207713_1035877 Ga0207713_10358773 231
2647 3300025735 Ga0207713_1037508 Ga0207713_10375081 231
2648 3300025735 Ga0207713_1120368 Ga0207713_11203681 231
2649 3300025899 Ga0207642_10019626 Ga0207642_100196263 231
2650 3300025899 Ga0207642_10055370 Ga0207642_100553702 231
2651 3300025899 Ga0207642_10154028 Ga0207642_101540282 231
2652 3300025900 Ga0207710_10000021 Ga0207710_10000021312 231
2653 3300025900 Ga0207710_10158885 Ga0207710_101588852 231
2654 3300025901 Ga0207688_10041707 Ga0207688_100417072 231
2655 3300025901 Ga0207688_10042705 Ga0207688_100427053 231
2656 3300025901 Ga0207688_10071820 Ga0207688_100718203 231
2657 3300025903 Ga0207680_10015569 Ga0207680_100155693 231
2658 3300025903 Ga0207680_10016617 Ga0207680_100166176 231
2659 3300025903 Ga0207680_10567673 Ga0207680_105676731 231
2660 3300025904 Ga0207647_10005195 Ga0207647_100051956 231
2661 3300025904 Ga0207647_10022181 Ga0207647_100221812 231
2662 3300025904 Ga0207647_10065166 Ga0207647_100651662 231
2663 3300025904 Ga0207647_10071478 Ga0207647_100714782 231
2664 3300025904 Ga0207647_10124988 Ga0207647_101249882 231
2665 3300025907 Ga0207645_10019136 Ga0207645_100191366 231
2666 3300025907 Ga0207645_10065340 Ga0207645_100653402 231
2667 3300025909 Ga0207705_10021241 Ga0207705_100212414 231
2668 3300025909 Ga0207705_10052423 Ga0207705_100524232 231
2669 3300025909 Ga0207705_10095672 Ga0207705_100956723 231
2670 3300025909 Ga0207705_10178469 Ga0207705_101784691 231
2671 3300025911 Ga0207654_10003945 Ga0207654_100039455 231
2672 3300025911 Ga0207654_10041412 Ga0207654_100414123 231
2673 3300025911 Ga0207654_10126982 Ga0207654_101269821 231
2674 3300025912 Ga0207707_10036275 Ga0207707_100362753 231
2675 3300025912 Ga0207707_10157658 Ga0207707_101576582 231
2676 3300025913 Ga0207695_10000929 Ga0207695_1000092942 231
2677 3300025913 Ga0207695_10004556 Ga0207695_100045566 231
2678 3300025913 Ga0207695_10006996 Ga0207695_100069965 231
2679 3300025913 Ga0207695_10014990 Ga0207695_100149906 231
2680 3300025913 Ga0207695_10042668 Ga0207695_100426682 231
2681 3300025913 Ga0207695_10055074 Ga0207695_100550744 231
2682 3300025913 Ga0207695_10059323 Ga0207695_100593232 231
2683 3300025913 Ga0207695_10072393 Ga0207695_100723936 231
2684 3300025913 Ga0207695_10142963 Ga0207695_101429632 231
2685 3300025913 Ga0207695_10149283 Ga0207695_101492834 231
2686 3300025913 Ga0207695_10309846 Ga0207695_103098462 231
2687 3300025913 Ga0207695_10322704 Ga0207695_103227042 231
2688 3300025913 Ga0207695_10336245 Ga0207695_103362452 231
2689 3300025913 Ga0207695_10341593 Ga0207695_103415933 231
2690 3300025913 Ga0207695_10569167 Ga0207695_105691671 231
2691 3300025914 Ga0207671_10002745 Ga0207671_1000274512 231
2692 3300025914 Ga0207671_10011222 Ga0207671_100112226 231
2693 3300025914 Ga0207671_10014095 Ga0207671_100140954 231
2694 3300025914 Ga0207671_10020608 Ga0207671_100206084 231
2695 3300025914 Ga0207671_10048974 Ga0207671_100489746 231
2696 3300025914 Ga0207671_10074837 Ga0207671_100748373 231
2697 3300025914 Ga0207671_10075831 Ga0207671_100758316 231
2698 3300025914 Ga0207671_10086216 Ga0207671_100862162 231
2699 3300025914 Ga0207671_10097900 Ga0207671_100979004 231
2700 3300025917 Ga0207660_10018127 Ga0207660_100181274 231
2701 3300025917 Ga0207660_10067750 Ga0207660_100677502 231
2702 3300025918 Ga0207662_10408244 Ga0207662_104082442 231
2703 3300025919 Ga0207657_10006550 Ga0207657_100065505 231
2704 3300025919 Ga0207657_10015852 Ga0207657_100158522 231
2705 3300025919 Ga0207657_10042849 Ga0207657_100428495 231
2706 3300025919 Ga0207657_10065832 Ga0207657_100658324 231
2707 3300025919 Ga0207657_10083898 Ga0207657_100838983 231
2708 3300025919 Ga0207657_10158281 Ga0207657_101582812 231
2709 3300025919 Ga0207657_10458564 Ga0207657_104585642 231
2710 3300025920 Ga0207649_10000041 Ga0207649_10000041120 231
2711 3300025920 Ga0207649_10015303 Ga0207649_100153034 231
2712 3300025920 Ga0207649_10082979 Ga0207649_100829792 231
2713 3300025920 Ga0207649_10640878 Ga0207649_106408782 231
2714 3300025921 Ga0207652_10037372 Ga0207652_100373723 231
2715 3300025921 Ga0207652_10083698 Ga0207652_100836982 231
2716 3300025923 Ga0207681_10001418 Ga0207681_100014188 231
2717 3300025923 Ga0207681_10027574 Ga0207681_100275744 231
2718 3300025923 Ga0207681_10043264 Ga0207681_100432642 231
2719 3300025923 Ga0207681_10150913 Ga0207681_101509132 231
2720 3300025924 Ga0207694_10001706 Ga0207694_100017066 231
2721 3300025924 Ga0207694_10013926 Ga0207694_100139266 231
2722 3300025924 Ga0207694_10022624 Ga0207694_100226246 231
2723 3300025924 Ga0207694_10031994 Ga0207694_100319943 231
2724 3300025924 Ga0207694_10035665 Ga0207694_100356656 231
2725 3300025924 Ga0207694_10065792 Ga0207694_100657926 231
2726 3300025924 Ga0207694_10269413 Ga0207694_102694131 231
2727 3300025924 Ga0207694_10269629 Ga0207694_102696291 231
2728 3300025924 Ga0207694_10339905 Ga0207694_103399052 231
2729 3300025925 Ga0207650_10043288 Ga0207650_100432884 231
2730 3300025925 Ga0207650_10108986 Ga0207650_101089863 231
2731 3300025925 Ga0207650_10112964 Ga0207650_101129643 231
2732 3300025925 Ga0207650_10245312 Ga0207650_102453122 231
2733 3300025926 Ga0207659_10080834 Ga0207659_100808343 231
2734 3300025926 Ga0207659_10226348 Ga0207659_102263482 231
2735 3300025926 Ga0207659_10345350 Ga0207659_103453502 231
2736 3300025926 Ga0207659_10412056 Ga0207659_104120562 231
2737 3300025926 Ga0207659_10792164 Ga0207659_107921641 231
2738 3300025927 Ga0207687_10025583 Ga0207687_100255834 231
2739 3300025927 Ga0207687_10195312 Ga0207687_101953122 231
2740 3300025927 Ga0207687_10462377 Ga0207687_104623771 231
2741 3300025929 Ga0207664_10028011 Ga0207664_100280114 231
2742 3300025929 Ga0207664_10373784 Ga0207664_103737841 231
2743 3300025931 Ga0207644_10055596 Ga0207644_100555966 231
2744 3300025931 Ga0207644_10055718 Ga0207644_100557183 231
2745 3300025931 Ga0207644_10283200 Ga0207644_102832002 231
2746 3300025931 Ga0207644_10310403 Ga0207644_103104032 231
2747 3300025932 Ga0207690_10000040 Ga0207690_10000040122 231
2748 3300025932 Ga0207690_10041702 Ga0207690_100417022 231
2749 3300025932 Ga0207690_10048838 Ga0207690_100488384 231
2750 3300025932 Ga0207690_10119859 Ga0207690_101198593 231
2751 3300025932 Ga0207690_10172704 Ga0207690_101727042 231
2752 3300025932 Ga0207690_10241797 Ga0207690_102417972 231
2753 3300025933 Ga0207706_10049444 Ga0207706_100494445 231
2754 3300025933 Ga0207706_10050422 Ga0207706_100504223 231
2755 3300025933 Ga0207706_10081816 Ga0207706_100818164 231
2756 3300025933 Ga0207706_10093523 Ga0207706_100935233 231
2757 3300025933 Ga0207706_10096000 Ga0207706_100960002 231
2758 3300025934 Ga0207686_10002281 Ga0207686_100022815 231
2759 3300025934 Ga0207686_10004082 Ga0207686_100040825 231
2760 3300025934 Ga0207686_10006427 Ga0207686_100064274 231
2761 3300025934 Ga0207686_10150003 Ga0207686_101500032 231
2762 3300025935 Ga0207709_10000023 Ga0207709_100000236 231
2763 3300025935 Ga0207709_10000880 Ga0207709_1000088014 231
2764 3300025935 Ga0207709_10007814 Ga0207709_100078144 231
2765 3300025935 Ga0207709_10008524 Ga0207709_100085245 231
2766 3300025935 Ga0207709_10010798 Ga0207709_100107985 231
2767 3300025935 Ga0207709_10206622 Ga0207709_102066222 231
2768 3300025935 Ga0207709_10243058 Ga0207709_102430582 231
2769 3300025935 Ga0207709_10284672 Ga0207709_102846722 231
2770 3300025935 Ga0207709_10360007 Ga0207709_103600071 231
2771 3300025935 Ga0207709_10535833 Ga0207709_105358331 231
2772 3300025937 Ga0207669_10011311 Ga0207669_100113117 231
2773 3300025937 Ga0207669_10098372 Ga0207669_100983723 231
2774 3300025940 Ga0207691_10076816 Ga0207691_100768164 231
2775 3300025940 Ga0207691_10078790 Ga0207691_100787904 231
2776 3300025940 Ga0207691_10165374 Ga0207691_101653743 231
2777 3300025940 Ga0207691_10610141 Ga0207691_106101412 231
2778 3300025941 Ga0207711_10024697 Ga0207711_100246977 231
2779 3300025941 Ga0207711_10028988 Ga0207711_100289882 231
2780 3300025941 Ga0207711_10283501 Ga0207711_102835012 231
2781 3300025941 Ga0207711_10363858 Ga0207711_103638582 231
2782 3300025941 Ga0207711_10370579 Ga0207711_103705791 231
2783 3300025941 Ga0207711_10376310 Ga0207711_103763102 231
2784 3300025942 Ga0207689_10012387 Ga0207689_100123874 231
2785 3300025942 Ga0207689_10026708 Ga0207689_100267084 231
2786 3300025942 Ga0207689_10034462 Ga0207689_100344623 231
2787 3300025942 Ga0207689_10095725 Ga0207689_100957252 231
2788 3300025944 Ga0207661_10154507 Ga0207661_101545071 231
2789 3300025945 Ga0207679_10000081 Ga0207679_1000008183 231
2790 3300025945 Ga0207679_10001142 Ga0207679_1000114210 231
2791 3300025945 Ga0207679_10005047 Ga0207679_100050473 231
2792 3300025945 Ga0207679_10018738 Ga0207679_100187386 231
2793 3300025945 Ga0207679_10078880 Ga0207679_100788804 231
2794 3300025949 Ga0207667_10004875 Ga0207667_100048756 231
2795 3300025949 Ga0207667_10005112 Ga0207667_100051125 231
2796 3300025949 Ga0207667_10023256 Ga0207667_100232565 231
2797 3300025949 Ga0207667_10024497 Ga0207667_100244975 231
2798 3300025949 Ga0207667_10123035 Ga0207667_101230352 231
2799 3300025949 Ga0207667_10339047 Ga0207667_103390473 231
2800 3300025949 Ga0207667_10471226 Ga0207667_104712261 231
2801 3300025960 Ga0207651_10071942 Ga0207651_100719422 231
2802 3300025960 Ga0207651_10093868 Ga0207651_100938683 231
2803 3300025960 Ga0207651_10205702 Ga0207651_102057022 231
2804 3300025960 Ga0207651_10295197 Ga0207651_102951972 231
2805 3300025960 Ga0207651_10530231 Ga0207651_105302312 231
2806 3300025961 Ga0207712_10008980 Ga0207712_100089804 231
2807 3300025961 Ga0207712_10017230 Ga0207712_100172309 231
2808 3300025961 Ga0207712_10051790 Ga0207712_100517902 231
2809 3300025961 Ga0207712_10094578 Ga0207712_100945782 231
2810 3300025961 Ga0207712_10806836 Ga0207712_108068361 231
2811 3300025972 Ga0207668_10023613 Ga0207668_100236133 231
2812 3300025972 Ga0207668_10048418 Ga0207668_100484186 231
2813 3300025972 Ga0207668_10757820 Ga0207668_107578201 231
2814 3300025981 Ga0207640_10024619 Ga0207640_100246193 231
2815 3300025981 Ga0207640_10027602 Ga0207640_100276026 231
2816 3300025981 Ga0207640_10060779 Ga0207640_100607791 231
2817 3300025981 Ga0207640_10104424 Ga0207640_101044242 231
2818 3300025986 Ga0207658_10002284 Ga0207658_1000228413 231
2819 3300025986 Ga0207658_10021398 Ga0207658_100213984 231
2820 3300025986 Ga0207658_10080258 Ga0207658_100802584 231
2821 3300025986 Ga0207658_10201434 Ga0207658_102014342 231
2822 3300025986 Ga0207658_10438354 Ga0207658_104383541 231
2823 3300025986 Ga0207658_10688208 Ga0207658_106882082 231
2824 3300026023 Ga0207677_10017168 Ga0207677_100171686 231
2825 3300026023 Ga0207677_10046409 Ga0207677_100464092 231
2826 3300026023 Ga0207677_10059025 Ga0207677_100590255 231
2827 3300026035 Ga0207703_10002762 Ga0207703_1000276216 231
2828 3300026035 Ga0207703_10007128 Ga0207703_100071283 231
2829 3300026035 Ga0207703_10017084 Ga0207703_100170844 231
2830 3300026035 Ga0207703_10148635 Ga0207703_101486353 231
2831 3300026035 Ga0207703_10334158 Ga0207703_103341582 231
2832 3300026035 Ga0207703_10650561 Ga0207703_106505611 231
2833 3300026041 Ga0207639_10000396 Ga0207639_1000039631 231
2834 3300026041 Ga0207639_10060207 Ga0207639_100602072 231
2835 3300026067 Ga0207678_10004336 Ga0207678_100043365 231
2836 3300026067 Ga0207678_10021697 Ga0207678_100216974 231
2837 3300026067 Ga0207678_10040548 Ga0207678_100405486 231
2838 3300026067 Ga0207678_10045124 Ga0207678_100451244 231
2839 3300026067 Ga0207678_10080010 Ga0207678_100800102 231
2840 3300026067 Ga0207678_10092895 Ga0207678_100928952 231
2841 3300026067 Ga0207678_10096602 Ga0207678_100966022 231
2842 3300026067 Ga0207678_10115983 Ga0207678_101159833 231
2843 3300026067 Ga0207678_10127772 Ga0207678_101277721 231
2844 3300026067 Ga0207678_10356376 Ga0207678_103563761 231
2845 3300026078 Ga0207702_10002227 Ga0207702_100022276 231
2846 3300026078 Ga0207702_10117812 Ga0207702_101178121 231
2847 3300026078 Ga0207702_10143005 Ga0207702_101430052 231
2848 3300026078 Ga0207702_10207911 Ga0207702_102079111 231
2849 3300026078 Ga0207702_10329227 Ga0207702_103292272 231
2850 3300026078 Ga0207702_10606184 Ga0207702_106061841 231
2851 3300026088 Ga0207641_10006999 Ga0207641_100069994 231
2852 3300026088 Ga0207641_10055272 Ga0207641_100552725 231
2853 3300026088 Ga0207641_10307790 Ga0207641_103077901 231
2854 3300026089 Ga0207648_10020968 Ga0207648_100209686 231
2855 3300026089 Ga0207648_10028030 Ga0207648_100280306 231
2856 3300026089 Ga0207648_10051162 Ga0207648_100511624 231
2857 3300026089 Ga0207648_10055639 Ga0207648_100556394 231
2858 3300026089 Ga0207648_10082707 Ga0207648_100827073 231
2859 3300026089 Ga0207648_10130852 Ga0207648_101308523 231
2860 3300026089 Ga0207648_10206558 Ga0207648_102065581 231
2861 3300026089 Ga0207648_10290167 Ga0207648_102901672 231
2862 3300026095 Ga0207676_10020130 Ga0207676_100201304 231
2863 3300026116 Ga0207674_10021420 Ga0207674_100214204 231
2864 3300026116 Ga0207674_10044100 Ga0207674_100441006 231
2865 3300026116 Ga0207674_10047838 Ga0207674_100478384 231
2866 3300026116 Ga0207674_10066091 Ga0207674_100660912 231
2867 3300026116 Ga0207674_10079818 Ga0207674_100798182 231
2868 3300026116 Ga0207674_10113859 Ga0207674_101138592 231
2869 3300026116 Ga0207674_10777643 Ga0207674_107776431 231
2870 3300026118 Ga0207675_100032434 Ga0207675_1000324346 231
2871 3300026118 Ga0207675_100055603 Ga0207675_1000556034 231
2872 3300026118 Ga0207675_100060097 Ga0207675_1000600973 231
2873 3300026118 Ga0207675_100077105 Ga0207675_1000771052 231
2874 3300026118 Ga0207675_100218674 Ga0207675_1002186742 231
2875 3300026121 Ga0207683_10090688 Ga0207683_100906881 231
2876 3300026142 Ga0207698_10012103 Ga0207698_100121036 231
2877 3300026142 Ga0207698_10020183 Ga0207698_100201834 231
2878 3300026142 Ga0207698_10100002 Ga0207698_101000022 231
2879 3300026142 Ga0207698_10125231 Ga0207698_101252314 231
2880 3300026142 Ga0207698_10227871 Ga0207698_102278713 231
2881 3300027111 Ga0209281_1002730 Ga0209281_10027303 231
2882 3300027111 Ga0209281_1009907 Ga0209281_10099074 231
2883 3300027111 Ga0209281_1010375 Ga0209281_10103753 231
2884 3300027252 Ga0209973_1000237 Ga0209973_10002374 231
2885 3300027296 Ga0209389_1000020 Ga0209389_100002013 231
2886 3300027296 Ga0209389_1028914 Ga0209389_10289146 231
2887 3300027312 Ga0209371_1000038 Ga0209371_1000038337 231
2888 3300027312 Ga0209371_1000983 Ga0209371_100098310 231
2889 3300027312 Ga0209371_1003035 Ga0209371_10030356 231
2890 3300027312 Ga0209371_1005236 Ga0209371_10052364 231
2891 3300027312 Ga0209371_1005302 Ga0209371_10053025 231
2892 3300027312 Ga0209371_1010553 Ga0209371_10105536 231
2893 3300027312 Ga0209371_1011462 Ga0209371_10114623 231
2894 3300027378 Ga0209981_1002814 Ga0209981_10028142 231
2895 3300027395 Ga0209996_1004645 Ga0209996_10046453 231
2896 3300027424 Ga0209984_1000331 Ga0209984_10003313 231
2897 3300027462 Ga0210000_1020083 Ga0210000_10200831 231
2898 3300027471 Ga0209995_1002467 Ga0209995_10024672 231
2899 3300027471 Ga0209995_1006510 Ga0209995_10065103 231
2900 3300027543 Ga0209999_1001100 Ga0209999_10011004 231
2901 3300027552 Ga0209982_1000593 Ga0209982_10005934 231
2902 3300027552 Ga0209982_1000883 Ga0209982_10008836 231
2903 3300027614 Ga0209970_1005372 Ga0209970_10053723 231
2904 3300027665 Ga0209983_1002694 Ga0209983_10026942 231
2905 3300027665 Ga0209983_1006330 Ga0209983_10063305 231
2906 3300027665 Ga0209983_1009605 Ga0209983_10096053 231
2907 3300027666 Ga0209282_1000014 Ga0209282_1000014123 231
2908 3300027666 Ga0209282_1000137 Ga0209282_100013713 231
2909 3300027666 Ga0209282_1017523 Ga0209282_10175234 231
2910 3300027666 Ga0209282_1046786 Ga0209282_10467861 231
2911 3300027682 Ga0209971_1000964 Ga0209971_10009644 231
2912 3300027682 Ga0209971_1005245 Ga0209971_10052456 231
2913 3300027866 Ga0209813_10146388 Ga0209813_101463882 231
2914 3300027876 Ga0209974_10000928 Ga0209974_100009285 231
2915 3300027876 Ga0209974_10003613 Ga0209974_100036136 231
2916 3300027876 Ga0209974_10005081 Ga0209974_100050814 231
2917 3300027876 Ga0209974_10006186 Ga0209974_100061868 231
2918 3300027907 Ga0207428_10008621 Ga0207428_100086216 231
2919 3300027907 Ga0207428_10052786 Ga0207428_100527864 231
2920 3300028379 Ga0268266_10010675 Ga0268266_100106754 231
2921 3300028379 Ga0268266_10022996 Ga0268266_100229964 231
2922 3300028379 Ga0268266_10026919 Ga0268266_100269194 231
2923 3300028379 Ga0268266_10045726 Ga0268266_100457264 231
2924 3300028379 Ga0268266_10103994 Ga0268266_101039943 231
2925 3300028379 Ga0268266_10224445 Ga0268266_102244451 231
2926 3300028379 Ga0268266_10329596 Ga0268266_103295962 231
2927 3300028379 Ga0268266_10348076 Ga0268266_103480762 231
2928 3300028379 Ga0268266_10460263 Ga0268266_104602632 231
2929 3300028380 Ga0268265_10026744 Ga0268265_100267446 231
2930 3300028380 Ga0268265_10195224 Ga0268265_101952242 231
2931 3300028380 Ga0268265_10201756 Ga0268265_102017563 231
2932 3300028381 Ga0268264_10002141 Ga0268264_100021416 231
2933 3300028381 Ga0268264_10038596 Ga0268264_100385963 231
2934 3300028381 Ga0268264_10045122 Ga0268264_100451226 231
2935 3300028381 Ga0268264_10150689 Ga0268264_101506891 231
2936 3300028381 Ga0268264_10408088 Ga0268264_104080881 231
2937 3300028573 Ga0265334_10135597 Ga0265334_101355971 231
2938 3300028577 Ga0265318_10000228 Ga0265318_1000022852 231
2939 3300028786 Ga0307517_10012098 Ga0307517_100120986 231
2940 3300028786 Ga0307517_10176061 Ga0307517_101760612 231
2941 3300028786 Ga0307517_10269518 Ga0307517_102695181 231
2942 3300028794 Ga0307515_10000672 Ga0307515_1000067269 231
2943 3300028794 Ga0307515_10011782 Ga0307515_100117829 231
2944 3300028794 Ga0307515_10038449 Ga0307515_100384496 231
2945 3300028794 Ga0307515_10043121 Ga0307515_100431214 231
2946 3300028794 Ga0307515_10050896 Ga0307515_100508965 231
2947 3300028794 Ga0307515_10081289 Ga0307515_100812896 231
2948 3300028794 Ga0307515_10284135 Ga0307515_102841351 231
2949 3300028794 Ga0307515_10333589 Ga0307515_103335891 231
2950 3300028800 Ga0265338_10004458 Ga0265338_100044586 231
2951 3300028800 Ga0265338_10011072 Ga0265338_100110722 231
2952 3300028800 Ga0265338_10076408 Ga0265338_100764082 231
2953 3300028800 Ga0265338_10443456 Ga0265338_104434561 231
2954 3300029957 Ga0265324_10009870 Ga0265324_100098704 231
2955 3300029957 Ga0265324_10032918 Ga0265324_100329182 231
2956 3300030500 Ga0268256_1000038 Ga0268256_1000038337 231
2957 3300030500 Ga0268256_1000914 Ga0268256_100091411 231
2958 3300030500 Ga0268256_1002721 Ga0268256_10027216 231
2959 3300030500 Ga0268256_1004068 Ga0268256_10040685 231
2960 3300030500 Ga0268256_1005099 Ga0268256_10050996 231
2961 3300030500 Ga0268256_1019867 Ga0268256_10198673 231
2962 3300030500 Ga0268256_1030003 Ga0268256_10300032 231
2963 3300030500 Ga0268256_1042817 Ga0268256_10428172 231
2964 3300030522 Ga0307512_10052499 Ga0307512_100524993 231
2965 3300030522 Ga0307512_10121491 Ga0307512_101214912 231
2966 3300030731 Ga0316177_1013731 Ga0316177_10137313 231
2967 3300030731 Ga0316177_1035072 Ga0316177_10350721 231
2968 3300030731 Ga0316177_1045360 Ga0316177_10453602 231
2969 3300030732 Ga0316176_1055008 Ga0316176_10550086 231
2970 3300030733 Ga0314311_1059830 Ga0314311_10598304 231
2971 3300030735 Ga0316178_1082999 Ga0316178_10829992 231
2972 3300030736 Ga0316180_1046416 Ga0316180_10464163 231
2973 3300030742 Ga0316183_1084751 Ga0316183_10847512 231
2974 3300030742 Ga0316183_1180741 Ga0316183_11807411 231
2975 3300030744 Ga0316181_1106969 Ga0316181_11069693 231
2976 3300030745 Ga0316182_1170981 Ga0316182_11709813 231
2977 3300030863 Ga0265766_1000692 Ga0265766_10006921 231
2978 3300030878 Ga0265770_1019770 Ga0265770_10197701 231
2979 3300031235 Ga0265330_10000043 Ga0265330_100000436 231
2980 3300031235 Ga0265330_10001236 Ga0265330_100012366 231
2981 3300031238 Ga0265332_10000018 Ga0265332_10000018117 231
2982 3300031238 Ga0265332_10002063 Ga0265332_100020635 231
2983 3300031238 Ga0265332_10002429 Ga0265332_100024295 231
2984 3300031238 Ga0265332_10031107 Ga0265332_100311072 231
2985 3300031239 Ga0265328_10001204 Ga0265328_100012048 231
2986 3300031239 Ga0265328_10014120 Ga0265328_100141204 231
2987 3300031239 Ga0265328_10014916 Ga0265328_100149162 231
2988 3300031241 Ga0265325_10037968 Ga0265325_100379683 231
2989 3300031241 Ga0265325_10090055 Ga0265325_100900552 231
2990 3300031247 Ga0265340_10062128 Ga0265340_100621283 231
2991 3300031249 Ga0265339_10014268 Ga0265339_100142682 231
2992 3300031250 Ga0265331_10000050 Ga0265331_10000050150 231
2993 3300031250 Ga0265331_10005250 Ga0265331_100052506 231
2994 3300031250 Ga0265331_10015964 Ga0265331_100159646 231
2995 3300031250 Ga0265331_10028103 Ga0265331_100281031 231
2996 3300031251 Ga0265327_10000020 Ga0265327_10000020353 231
2997 3300031251 Ga0265327_10000109 Ga0265327_1000010975 231
2998 3300031251 Ga0265327_10028174 Ga0265327_100281741 231
2999 3300031251 Ga0265327_10156596 Ga0265327_101565961 231
3000 3300031344 Ga0265316_10024063 Ga0265316_100240634 231
3001 3300031456 Ga0307513_10045162 Ga0307513_100451624 231
3002 3300031456 Ga0307513_10060560 Ga0307513_100605604 231
3003 3300031456 Ga0307513_10061523 Ga0307513_100615236 231
3004 3300031456 Ga0307513_10135732 Ga0307513_101357323 231
3005 3300031456 Ga0307513_10180220 Ga0307513_101802203 231
3006 3300031456 Ga0307513_10190405 Ga0307513_101904053 231
3007 3300031456 Ga0307513_10482734 Ga0307513_104827341 231
3008 3300031507 Ga0307509_10067896 Ga0307509_100678963 231
3009 3300031507 Ga0307509_10071053 Ga0307509_100710533 231
3010 3300031507 Ga0307509_10141996 Ga0307509_101419962 231
3011 3300031548 Ga0307408_100000089 Ga0307408_1000000896 231
3012 3300031548 Ga0307408_100000911 Ga0307408_10000091113 231
3013 3300031548 Ga0307408_100040708 Ga0307408_1000407084 231
3014 3300031548 Ga0307408_100092388 Ga0307408_1000923882 231
3015 3300031548 Ga0307408_100160835 Ga0307408_1001608352 231
3016 3300031548 Ga0307408_100427280 Ga0307408_1004272802 231
3017 3300031548 Ga0307408_100515184 Ga0307408_1005151841 231
3018 3300031548 Ga0307408_100684186 Ga0307408_1006841861 231
3019 3300031595 Ga0265313_10025575 Ga0265313_100255756 231
3020 3300031616 Ga0307508_10003204 Ga0307508_100032044 231
3021 3300031616 Ga0307508_10014730 Ga0307508_100147307 231
3022 3300031616 Ga0307508_10157260 Ga0307508_101572602 231
3023 3300031649 Ga0307514_10002098 Ga0307514_1000209814 231
3024 3300031649 Ga0307514_10306502 Ga0307514_103065021 231
3025 3300031665 Ga0316575_10028016 Ga0316575_100280162 231
3026 3300031665 Ga0316575_10065509 Ga0316575_100655092 231
3027 3300031665 Ga0316575_10077266 Ga0316575_100772661 231
3028 3300031665 Ga0316575_10125991 Ga0316575_101259911 231
3029 3300031691 Ga0316579_10001300 Ga0316579_100013005 231
3030 3300031691 Ga0316579_10002293 Ga0316579_100022936 231
3031 3300031691 Ga0316579_10019256 Ga0316579_100192564 231
3032 3300031691 Ga0316579_10025223 Ga0316579_100252233 231
3033 3300031691 Ga0316579_10102455 Ga0316579_101024552 231
3034 3300031691 Ga0316579_10109645 Ga0316579_101096451 231
3035 3300031711 Ga0265314_10000126 Ga0265314_1000012698 231
3036 3300031711 Ga0265314_10010858 Ga0265314_100108582 231
3037 3300031727 Ga0316576_10017216 Ga0316576_100172164 231
3038 3300031727 Ga0316576_10022230 Ga0316576_100222304 231
3039 3300031727 Ga0316576_10073113 Ga0316576_100731136 231
3040 3300031728 Ga0316578_10000241 Ga0316578_100002416 231
3041 3300031728 Ga0316578_10005618 Ga0316578_100056184 231
3042 3300031728 Ga0316578_10026809 Ga0316578_100268094 231
3043 3300031728 Ga0316578_10033290 Ga0316578_100332904 231
3044 3300031728 Ga0316578_10041170 Ga0316578_100411702 231
3045 3300031730 Ga0307516_10000048 Ga0307516_1000004845 231
3046 3300031730 Ga0307516_10000439 Ga0307516_1000043935 231
3047 3300031730 Ga0307516_10022658 Ga0307516_100226582 231
3048 3300031730 Ga0307516_10026131 Ga0307516_100261316 231
3049 3300031730 Ga0307516_10029631 Ga0307516_100296316 231
3050 3300031730 Ga0307516_10060839 Ga0307516_100608396 231
3051 3300031730 Ga0307516_10368208 Ga0307516_103682081 231
3052 3300031730 Ga0307516_10393276 Ga0307516_103932762 231
3053 3300031731 Ga0307405_10006387 Ga0307405_100063876 231
3054 3300031731 Ga0307405_10013658 Ga0307405_100136585 231
3055 3300031731 Ga0307405_10229491 Ga0307405_102294911 231
3056 3300031731 Ga0307405_10254854 Ga0307405_102548542 231
3057 3300031733 Ga0316577_10027484 Ga0316577_100274842 231
3058 3300031733 Ga0316577_10028434 Ga0316577_100284344 231
3059 3300031733 Ga0316577_10034258 Ga0316577_100342584 231
3060 3300031733 Ga0316577_10075924 Ga0316577_100759242 231
3061 3300031733 Ga0316577_10190436 Ga0316577_101904362 231
3062 3300031824 Ga0307413_10206278 Ga0307413_102062782 231
3063 3300031901 Ga0307406_10475879 Ga0307406_104758791 231
3064 3300031911 Ga0307412_10000505 Ga0307412_1000050515 231
3065 3300031911 Ga0307412_10017396 Ga0307412_100173964 231
3066 3300031911 Ga0307412_10041167 Ga0307412_100411676 231
3067 3300031911 Ga0307412_10057603 Ga0307412_100576036 231
3068 3300031911 Ga0307412_10137101 Ga0307412_101371013 231
3069 3300031911 Ga0307412_10163924 Ga0307412_101639241 231
3070 3300031995 Ga0307409_100002394 Ga0307409_1000023941 231
3071 3300031995 Ga0307409_100081436 Ga0307409_1000814364 231
3072 3300032002 Ga0307416_100004760 Ga0307416_1000047606 231
3073 3300032002 Ga0307416_100032384 Ga0307416_1000323843 231
3074 3300032002 Ga0307416_100185645 Ga0307416_1001856453 231
3075 3300032002 Ga0307416_100276036 Ga0307416_1002760361 231
3076 3300032002 Ga0307416_100691172 Ga0307416_1006911721 231
3077 3300032002 Ga0307416_100709687 Ga0307416_1007096872 231
3078 3300032002 Ga0307416_100776847 Ga0307416_1007768471 231
3079 3300032004 Ga0307414_10006142 Ga0307414_100061424 231
3080 3300032004 Ga0307414_10306429 Ga0307414_103064292 231
3081 3300032005 Ga0307411_10005049 Ga0307411_100050496 231
3082 3300032005 Ga0307411_10216553 Ga0307411_102165532 231
3083 3300032005 Ga0307411_10222747 Ga0307411_102227471 231
3084 3300032126 Ga0307415_100030680 Ga0307415_1000306803 231
3085 3300032133 Ga0316583_10008755 Ga0316583_100087552 231
3086 3300032133 Ga0316583_10010383 Ga0316583_100103833 231
3087 3300032133 Ga0316583_10012061 Ga0316583_100120616 231
3088 3300032133 Ga0316583_10055951 Ga0316583_100559511 231
3089 3300032137 Ga0316585_10008481 Ga0316585_100084816 231
3090 3300032137 Ga0316585_10036291 Ga0316585_100362911 231
3091 3300032137 Ga0316585_10091138 Ga0316585_100911382 231
3092 3300032139 Ga0316580_10002424 Ga0316580_100024246 231
3093 3300032139 Ga0316580_10012872 Ga0316580_100128722 231
3094 3300032168 Ga0316593_10001008 Ga0316593_100010084 231
3095 3300032168 Ga0316593_10001157 Ga0316593_100011577 231
3096 3300032168 Ga0316593_10001533 Ga0316593_100015335 231
3097 3300032168 Ga0316593_10001680 Ga0316593_100016804 231
3098 3300032168 Ga0316593_10001686 Ga0316593_100016864 231
3099 3300032168 Ga0316593_10001713 Ga0316593_100017132 231
3100 3300032168 Ga0316593_10002297 Ga0316593_100022976 231
3101 3300032168 Ga0316593_10004121 Ga0316593_100041213 231
3102 3300032168 Ga0316593_10004761 Ga0316593_100047615 231
3103 3300032168 Ga0316593_10005618 Ga0316593_100056184 231
3104 3300032168 Ga0316593_10011003 Ga0316593_100110031 231
3105 3300032168 Ga0316593_10012084 Ga0316593_100120846 231
3106 3300032168 Ga0316593_10012613 Ga0316593_100126133 231
3107 3300032168 Ga0316593_10032779 Ga0316593_100327792 231
3108 3300032168 Ga0316593_10047330 Ga0316593_100473302 231
3109 3300032168 Ga0316593_10086092 Ga0316593_100860921 231
3110 3300032168 Ga0316593_10116300 Ga0316593_101163001 231
3111 3300033179 Ga0307507_10016833 Ga0307507_100168335 231
3112 3300033179 Ga0307507_10197177 Ga0307507_101971772 231
3113 3300033180 Ga0307510_10085086 Ga0307510_100850862 231
3114 3300033180 Ga0307510_10170717 Ga0307510_101707172 231
3115 3300033524 Ga0316592_1000037 Ga0316592_10000375 231
3116 3300033524 Ga0316592_1000343 Ga0316592_10003433 231
3117 3300033524 Ga0316592_1000481 Ga0316592_10004819 231
3118 3300033524 Ga0316592_1000905 Ga0316592_10009054 231
3119 3300033524 Ga0316592_1005192 Ga0316592_10051921 231
3120 3300033524 Ga0316592_1005922 Ga0316592_10059222 231
3121 3300033524 Ga0316592_1017145 Ga0316592_10171452 231
3122 3300033524 Ga0316592_1043275 Ga0316592_10432752 231
3123 3300033527 Ga0316586_1000205 Ga0316586_10002054 231
3124 3300033527 Ga0316586_1000331 Ga0316586_10003315 231
3125 3300033527 Ga0316586_1000524 Ga0316586_10005244 231
3126 3300033527 Ga0316586_1000950 Ga0316586_10009504 231
3127 3300033527 Ga0316586_1001851 Ga0316586_10018513 231
3128 3300033527 Ga0316586_1003535 Ga0316586_10035353 231
3129 3300033528 Ga0316588_1000465 Ga0316588_10004652 231
3130 3300033528 Ga0316588_1000602 Ga0316588_10006024 231
3131 3300033528 Ga0316588_1001285 Ga0316588_10012854 231
3132 3300033528 Ga0316588_1001673 Ga0316588_10016736 231
3133 3300033528 Ga0316588_1002197 Ga0316588_10021974 231
3134 3300033528 Ga0316588_1005712 Ga0316588_10057125 231
3135 3300033528 Ga0316588_1048918 Ga0316588_10489181 231
3136 3300033529 Ga0316587_1000088 Ga0316587_10000886 231
3137 3300033529 Ga0316587_1000712 Ga0316587_10007122 231
3138 3300033529 Ga0316587_1000826 Ga0316587_10008261 231
3139 3300033529 Ga0316587_1001179 Ga0316587_10011796 231
3140 3300033529 Ga0316587_1001187 Ga0316587_10011874 231
3141 3300033529 Ga0316587_1001236 Ga0316587_10012363 231
3142 3300033529 Ga0316587_1007363 Ga0316587_10073631 231
3143 3300033541 Ga0316596_1000019 Ga0316596_10000199 231
3144 3300033541 Ga0316596_1000020 Ga0316596_10000206 231
3145 3300033541 Ga0316596_1000175 Ga0316596_10001755 231
3146 3300033541 Ga0316596_1001469 Ga0316596_10014696 231
3147 3300033541 Ga0316596_1003395 Ga0316596_10033955 231
3148 3300033541 Ga0316596_1003606 Ga0316596_10036063 231
3149 3300033541 Ga0316596_1003794 Ga0316596_10037942 231
3150 3300033541 Ga0316596_1007006 Ga0316596_10070062 231
3151 3300033541 Ga0316596_1007093 Ga0316596_10070931 231
3152 3300033541 Ga0316596_1010500 Ga0316596_10105004 231
3153 3300033541 Ga0316596_1025728 Ga0316596_10257281 231
3154 3300033541 Ga0316596_1076546 Ga0316596_10765462 231
3155 3300033547 Ga0316212_1006842 Ga0316212_10068421 231
3156 3300035086 Ga0373934_0001702 Ga0373934_0001702_1598_2311 231
3157 3300035088 Ga0373940_0083738 Ga0373940_0083738_27_725 231
3158 3300035113 Ga0373936_0002759 Ga0373936_0002759_161_874 231
3159 3300035114 Ga0373939_0000177 Ga0373939_0000177_5518_6228 231
3160 3300035114 Ga0373939_0019559 Ga0373939_0019559_33_743 231
3161 3300035116 Ga0373945_0073808 Ga0373945_0073808_125_856 231
3162 3300035117 Ga0373953_0005967 Ga0373953_0005967_1666_2379 231
3163 3300035118 Ga0373954_0001595 Ga0373954_0001595_861_1574 231
3164 3300035118 Ga0373954_0148407 Ga0373954_0148407_369_1097 231
3165 3300035119 Ga0373956_0001547 Ga0373956_0001547_7292_8005 231
3166 3300035119 Ga0373956_0004706 Ga0373956_0004706_3075_3788 231
3167 3300035119 Ga0373956_0077024 Ga0373956_0077024_679_1416 231
3168 3300035120 Ga0373957_0020027 Ga0373957_0020027_559_1272 231
3169 3300035172 Ga0373955_0033277 Ga0373955_0033277_1338_2051 231
3170 3300035172 Ga0373955_0147670 Ga0373955_0147670_406_1119 231
3171 3300035172 Ga0373955_0206378 Ga0373955_0206378_229_939 231
3172 3300035398 Ga0316574_0001814 Ga0316574_0001814_8005_8700 231
3173 3300035398 Ga0316574_0030135 Ga0316574_0030135_1755_2450 231
3174 3300035398 Ga0316574_0031371 Ga0316574_0031371_1259_1954 231
3175 3300035398 Ga0316574_0064814 Ga0316574_0064814_863_1558 231
3176 3300035410 Ga0373924_0001903 Ga0373924_0001903_2165_2878 231
3177 3300035691 Ga0373931_0012290 Ga0373931_0012290_1706_2437 231
3178 3300035692 Ga0373935_0050564 Ga0373935_0050564_977_1705 231
3179 3300035695 Ga0373927_0037294 Ga0373927_0037294_2117_2812 231
3180 3300035695 Ga0373927_0181210 Ga0373927_0181210_524_1255 231
3181 3300035724 Ga0373933_0158832 Ga0373933_0158832_336_1064 231
3182 3300035725 Ga0373947_0257184 Ga0373947_0257184_71_784 231
3183 3300035725 Ga0373947_0374663 Ga0373947_0374663_143_880 231
3184 3300035725 Ga0373947_0509151 Ga0373947_0509151_76_771 231
3185 3300036401 Ga0373937_0001885 Ga0373937_0001885_1629_2342 231
3186 3300036401 Ga0373937_0024571 Ga0373937_0024571_1755_2483 231
3187 3300036401 Ga0373937_0115724 Ga0373937_0115724_211_918 231
3188 3300036647 Ga0316582_0009358 Ga0316582_0009358_2756_3451 231
3189 3300036647 Ga0316582_0012499 Ga0316582_0012499_3911_4606 231
3190 3300036647 Ga0316582_0034937 Ga0316582_0034937_959_1654 231
3191 3300036647 Ga0316582_0037931 Ga0316582_0037931_1865_2560 231
3192 3300036647 Ga0316582_0038029 Ga0316582_0038029_364_1059 231
3193 3300036647 Ga0316582_0046396 Ga0316582_0046396_281_976 231
3194 3300036647 Ga0316582_0053126 Ga0316582_0053126_640_1335 231
3195 3300036647 Ga0316582_0128222 Ga0316582_0128222_987_1682 231
3196 3300036712 Ga0316584_0003506 Ga0316584_0003506_360_1055 231
3197 3300036712 Ga0316584_0035668 Ga0316584_0035668_2433_3128 231
3198 3300036712 Ga0316584_0046567 Ga0316584_0046567_1739_2434 231
3199 3300036712 Ga0316584_0068626 Ga0316584_0068626_140_835 231
3200 3300036712 Ga0316584_0076455 Ga0316584_0076455_1576_2271 231
3201 3300036712 Ga0316584_0189113 Ga0316584_0189113_640_1335 231
3202 3300036712 Ga0316584_0338310 Ga0316584_0338310_96_791 231
3203 3300036712 Ga0316584_0415751 Ga0316584_0415751_55_762 231
3204 3300037068 Ga0373925_0013245 Ga0373925_0013245_2593_3303 231
3205 3300037068 Ga0373925_0029884 Ga0373925_0029884_1046_1759 231
3206 3300037068 Ga0373925_0106448 Ga0373925_0106448_1331_2068 231
3207 3300037068 Ga0373925_0132144 Ga0373925_0132144_118_846 231
3208 3300037312 Ga0395899_0000078 Ga0395899_0000078_141745_142446 231
3209 3300037312 Ga0395899_0002866 Ga0395899_0002866_12828_13526 231
3210 3300037312 Ga0395899_0005833 Ga0395899_0005833_7040_7735 231
3211 3300037312 Ga0395899_0028671 Ga0395899_0028671_1827_2528 231
3212 3300037312 Ga0395899_0079269 Ga0395899_0079269_295_990 231
3213 3300037312 Ga0395899_0268389 Ga0395899_0268389_253_948 231
3214 3300037312 Ga0395899_0341135 Ga0395899_0341135_253_948 231
3215 3300037418 Ga0395900_0004137 Ga0395900_0004137_9421_10116 231
3216 3300037418 Ga0395900_0108339 Ga0395900_0108339_1613_2311 231
3217 3300037418 Ga0395900_0114062 Ga0395900_0114062_565_1272 231
3218 3300037418 Ga0395900_0118612 Ga0395900_0118612_1934_2635 231
3219 3300037418 Ga0395900_0194391 Ga0395900_0194391_369_1064 231
3220 3300037418 Ga0395900_0340419 Ga0395900_0340419_337_1032 231
3221 3300037418 Ga0395900_0343460 Ga0395900_0343460_669_1367 231
3222 3300037418 Ga0395900_0352768 Ga0395900_0352768_657_1352 231
3223 3300037418 Ga0395900_0535820 Ga0395900_0535820_382_1077 231
3224 3300037418 Ga0395900_0583781 Ga0395900_0583781_81_782 231
3225 3300037418 Ga0395900_0668078 Ga0395900_0668078_253_948 231
3226 3300037466 Ga0395898_0005792 Ga0395898_0005792_10759_11460 231
3227 3300037466 Ga0395898_0016725 Ga0395898_0016725_5787_6485 231
3228 3300037466 Ga0395898_0045954 Ga0395898_0045954_2539_3237 231
3229 3300037466 Ga0395898_0067954 Ga0395898_0067954_2320_3021 231
3230 3300037466 Ga0395898_0188549 Ga0395898_0188549_135_833 231
3231 3300037466 Ga0395898_0215439 Ga0395898_0215439_1102_1797 231
3232 3300037466 Ga0395898_0262474 Ga0395898_0262474_113_808 231
3233 3300037466 Ga0395898_0284147 Ga0395898_0284147_827_1522 231
3234 3300037471 Ga0395905_0003008 Ga0395905_0003008_15742_16440 231
3235 3300037471 Ga0395905_0007900 Ga0395905_0007900_2823_3521 231
3236 3300037471 Ga0395905_0015366 Ga0395905_0015366_5986_6696 231
3237 3300037471 Ga0395905_0025382 Ga0395905_0025382_1794_2498 231
3238 3300037471 Ga0395905_0032091 Ga0395905_0032091_3884_4579 231
3239 3300037471 Ga0395905_0038750 Ga0395905_0038750_1939_2643 231
3240 3300037471 Ga0395905_0049982 Ga0395905_0049982_2477_3187 231
3241 3300037471 Ga0395905_0061348 Ga0395905_0061348_1102_1806 231
3242 3300037471 Ga0395905_0070304 Ga0395905_0070304_1943_2656 231
3243 3300037471 Ga0395905_0172135 Ga0395905_0172135_1258_1953 231
3244 3300037471 Ga0395905_0197631 Ga0395905_0197631_343_1038 231
3245 3300037471 Ga0395905_0210641 Ga0395905_0210641_340_1035 231
3246 3300037471 Ga0395905_0211120 Ga0395905_0211120_294_992 231
3247 3300037471 Ga0395905_0214547 Ga0395905_0214547_462_1157 231
3248 3300037471 Ga0395905_0365664 Ga0395905_0365664_221_916 231
3249 3300037471 Ga0395905_0645296 Ga0395905_0645296_189_887 231
3250 3300037471 Ga0395905_0676195 Ga0395905_0676195_216_911 231
3251 3300037471 Ga0395905_0682232 Ga0395905_0682232_208_906 231
3252 3300037588 Ga0316581_0000596 Ga0316581_0000596_2682_3377 231
3253 3300037588 Ga0316581_0088740 Ga0316581_0088740_209_916 231
3254 3300037853 Ga0436364_1476474 Ga0436364_1476474_2067_2765 231
3255 3300038443 Ga0395901_0001551 Ga0395901_0001551_21280_21981 231
3256 3300038443 Ga0395901_0005665 Ga0395901_0005665_1832_2533 231
3257 3300038443 Ga0395901_0052878 Ga0395901_0052878_1828_2529 231
3258 3300038443 Ga0395901_0094399 Ga0395901_0094399_383_1078 231
3259 3300038443 Ga0395901_0118869 Ga0395901_0118869_962_1657 231
3260 3300038443 Ga0395901_0263988 Ga0395901_0263988_331_1029 231
3261 3300038443 Ga0395901_0542737 Ga0395901_0542737_441_1136 231
3262 3300038705 Ga0237819_00741 Ga0237819_00741_5299_5994 231
3263 3300038725 Ga0400484_42754 Ga0400484_42754_3004_3699 231
3264 3300038725 Ga0400484_44930 Ga0400484_44930_5538_6233 231
3265 3300038726 Ga0400490_06365 Ga0400490_06365_259_954 231
3266 3300038726 Ga0400490_14561 Ga0400490_14561_3809_4504 231
3267 3300038726 Ga0400490_23159 Ga0400490_23159_4966_5661 231
3268 3300038726 Ga0400490_23793 Ga0400490_23793_5969_6664 231
3269 3300038726 Ga0400490_34376 Ga0400490_34376_144_839 231
3270 3300038727 Ga0400491_01726 Ga0400491_01726_1764_2459 231
3271 3300038727 Ga0400491_05075 Ga0400491_05075_67_762 231
3272 3300038735 Ga0400485_05553 Ga0400485_05553_1555_2250 231
3273 3300038735 Ga0400485_10260 Ga0400485_10260_40_735 231
3274 3300038735 Ga0400485_22368 Ga0400485_22368_433_1128 231
3275 3300038741 Ga0400488_03593 Ga0400488_03593_600_1295 231
3276 3300038741 Ga0400488_39782 Ga0400488_39782_87_782 231
3277 3300038741 Ga0400488_44048 Ga0400488_44048_253_948 231
3278 3300038741 Ga0400488_59732 Ga0400488_59732_153_848 231
3279 3300038742 Ga0400486_00562 Ga0400486_00562_1710_2405 231
3280 3300038742 Ga0400486_06077 Ga0400486_06077_17964_18659 231
3281 3300038742 Ga0400486_08483 Ga0400486_08483_2483_3178 231
3282 3300038742 Ga0400486_20964 Ga0400486_20964_1557_2252 231
3283 3300039062 Ga0400483_036904 Ga0400483_036904_367_1062 231
3284 3300039062 Ga0400483_044792 Ga0400483_044792_1710_2405 231
3285 3300039062 Ga0400483_072918 Ga0400483_072918_212_907 231
3286 3300039062 Ga0400483_077033 Ga0400483_077033_1834_2529 231
3287 3300039062 Ga0400483_093445 Ga0400483_093445_1701_2396 231
3288 3300039062 Ga0400483_097852 Ga0400483_097852_377_1072 231
3289 3300039062 Ga0400483_112750 Ga0400483_112750_8525_9220 231
3290 3300039062 Ga0400483_177360 Ga0400483_177360_1086_1781 231
3291 3300039062 Ga0400483_184072 Ga0400483_184072_597_1292 231
3292 3300039062 Ga0400483_196379 Ga0400483_196379_13170_13865 231
3293 3300039062 Ga0400483_242812 Ga0400483_242812_307_1002 231
3294 3300039062 Ga0400483_284829 Ga0400483_284829_5509_6204 231
3295 3300039062 Ga0400483_287945 Ga0400483_287945_70_765 231
3296 3300039093 Ga0400489_04938 Ga0400489_04938_384_1079 231
3297 3300039093 Ga0400489_13021 Ga0400489_13021_1485_2180 231
3298 3300039110 Ga0400487_11086 Ga0400487_11086_2827_3522 231
3299 3300039110 Ga0400487_19871 Ga0400487_19871_1213_1908 231
3300 3300039110 Ga0400487_24868 Ga0400487_24868_1526_2221 231
3301 3300039110 Ga0400487_42317 Ga0400487_42317_1801_2496 231
3302 3300039110 Ga0400487_48323 Ga0400487_48323_1139_1834 231
3303 3300039110 Ga0400487_61079 Ga0400487_61079_87_782 231
3304 3300039437 Ga0436365_1808852 Ga0436365_1808852_115_813 231
3305 3300039437 Ga0436365_1933986 Ga0436365_1933986_1402_2133 231
3306 3300039438 Ga0436360_0532400 Ga0436360_0532400_596_1291 231
3307 3300039447 Ga0436361_0167298 Ga0436361_0167298_994_1701 231
3308 3300039447 Ga0436361_0169447 Ga0436361_0169447_425_1120 231
3309 3300039447 Ga0436361_0312153 Ga0436361_0312153_1177_1875 231
3310 3300039447 Ga0436361_0336197 Ga0436361_0336197_13275_13970 231
3311 3300039447 Ga0436361_0426137 Ga0436361_0426137_384_1079 231
3312 3300039447 Ga0436361_0590883 Ga0436361_0590883_17194_17901 231
3313 3300039447 Ga0436361_0693112 Ga0436361_0693112_1883_2578 231
3314 3300039447 Ga0436361_0706474 Ga0436361_0706474_282_977 231
3315 3300039447 Ga0436361_0712914 Ga0436361_0712914_316_1011 231
3316 3300039447 Ga0436361_0823903 Ga0436361_0823903_1211_1906 231
3317 3300039447 Ga0436361_0946169 Ga0436361_0946169_258_965 231
3318 3300039447 Ga0436361_1024452 Ga0436361_1024452_368_1075 231
3319 3300039447 Ga0436361_1038070 Ga0436361_1038070_1886_2581 231
3320 3300039447 Ga0436361_1173153 Ga0436361_1173153_687_1394 231
3321 3300039453 Ga0436362_0671535 Ga0436362_0671535_52_762 231
3322 3300041404 Ga0439436_0002495 Ga0439436_0002495_1774_2469 231
3323 3300041404 Ga0439436_0009101 Ga0439436_0009101_371_1072 231
3324 3300041405 Ga0439438_005852 Ga0439438_005852_1348_2043 231
3325 3300041406 Ga0439439_0012844 Ga0439439_0012844_434_1135 231
3326 3300041406 Ga0439439_0058191 Ga0439439_0058191_95_790 231
3327 3300041407 Ga0439447_011662 Ga0439447_011662_379_1074 231
3328 3300041407 Ga0439447_035275 Ga0439447_035275_282_977 231
3329 3300041408 Ga0439453_0011980 Ga0439453_0011980_687_1388 231
3330 3300041410 Ga0439461_0002207 Ga0439461_0002207_1181_1882 231
3331 3300041411 Ga0439466_0011018 Ga0439466_0011018_995_1690 231
3332 3300041411 Ga0439466_0024415 Ga0439466_0024415_375_1070 231
3333 3300041411 Ga0439466_0107948 Ga0439466_0107948_113_808 231
3334 3300041413 Ga0439465_0008385 Ga0439465_0008385_643_1344 231
3335 3300041453 Ga0451797_0277581 Ga0451797_0277581_13_708 231
3336 3300041456 Ga0451795_0048191 Ga0451795_0048191_153_887 231
3337 3300041456 Ga0451795_0204267 Ga0451795_0204267_541_1251 231
3338 3300041460 Ga0451802_0167517 Ga0451802_0167517_301_1011 231
3339 3300041460 Ga0451802_1482025 Ga0451802_1482025_335_1054 231
3340 3300041486 Ga0451807_0262198 Ga0451807_0262198_2004_2714 231
3341 3300041498 Ga0451841_0887743 Ga0451841_0887743_162_857 231
3342 3300041498 Ga0451841_1119244 Ga0451841_1119244_322_1029 231
3343 3300041505 Ga0451849_0140794 Ga0451849_0140794_131_868 231
3344 3300041509 Ga0451843_0484181 Ga0451843_0484181_154_864 231
3345 3300041509 Ga0451843_1524044 Ga0451843_1524044_190_900 231
3346 3300041512 Ga0451853_3241757 Ga0451853_3241757_93_788 231
3347 3300041997 Ga0439431_0008398 Ga0439431_0008398_1315_2010 231
3348 3300041997 Ga0439431_0051945 Ga0439431_0051945_109_810 231
3349 3300041997 Ga0439431_0066549 Ga0439431_0066549_101_796 231
3350 3300041999 Ga0439433_0003667 Ga0439433_0003667_1811_2512 231
3351 3300042002 Ga0439442_031902 Ga0439442_031902_74_775 231
3352 3300042004 Ga0439445_0003170 Ga0439445_0003170_431_1132 231
3353 3300042005 Ga0439448_0001040 Ga0439448_0001040_4408_5106 231
3354 3300042005 Ga0439448_0063792 Ga0439448_0063792_91_786 231
3355 3300042006 Ga0439432_005986 Ga0439432_005986_1712_2413 231
3356 3300042006 Ga0439432_010297 Ga0439432_010297_1986_2681 231
3357 3300042007 Ga0439449_0006857 Ga0439449_0006857_1606_2310 231
3358 3300042007 Ga0439449_0012119 Ga0439449_0012119_1805_2506 231
3359 3300042007 Ga0439449_0144178 Ga0439449_0144178_170_868 231
3360 3300042010 Ga0439452_010388 Ga0439452_010388_363_1058 231
3361 3300042010 Ga0439452_020072 Ga0439452_020072_182_883 231
3362 3300042010 Ga0439452_028931 Ga0439452_028931_655_1356 231
3363 3300042011 Ga0439454_031026 Ga0439454_031026_21_722 231
3364 3300042012 Ga0439455_0024449 Ga0439455_0024449_692_1387 231
3365 3300042115 Ga0450911_001203 Ga0450911_001203_3655_4350 231
3366 3300042122 Ga0450920_008268 Ga0450920_008268_987_1685 231
3367 3300042123 Ga0450921_001349 Ga0450921_001349_360_1058 231
3368 3300042123 Ga0450921_002858 Ga0450921_002858_135_830 231
3369 3300042125 Ga0450923_041005 Ga0450923_041005_226_936 231
3370 3300042127 Ga0450890_000883 Ga0450890_000883_2241_2948 231
3371 3300042129 Ga0450891_000057 Ga0450891_000057_5382_6092 231
3372 3300042130 Ga0450892_000259 Ga0450892_000259_4629_5339 231
3373 3300042133 Ga0450896_019530 Ga0450896_019530_62_757 231
3374 3300042139 Ga0450904_001503 Ga0450904_001503_1867_2562 231
3375 3300042139 Ga0450904_002138 Ga0450904_002138_143_841 231
3376 3300042145 Ga0450906_003636 Ga0450906_003636_502_1200 231
3377 3300042156 Ga0439446_0032801 Ga0439446_0032801_528_1223 231
3378 3300042156 Ga0439446_0083216 Ga0439446_0083216_26_736 231
3379 3300042157 Ga0439458_0024362 Ga0439458_0024362_705_1400 231
3380 3300042157 Ga0439458_0027720 Ga0439458_0027720_412_1107 231
3381 3300042157 Ga0439458_0096294 Ga0439458_0096294_40_735 231
3382 3300042185 Ga0450909_005867 Ga0450909_005867_485_1180 231
3383 3300042435 Ga0439434_0011201 Ga0439434_0011201_1858_2553 231
3384 3300042437 Ga0439444_0010546 Ga0439444_0010546_147_842 231
3385 3300042438 Ga0439459_0005142 Ga0439459_0005142_85_780 231
3386 3300042461 Ga0439460_0006240 Ga0439460_0006240_1332_2069 231
3387 3300042531 Ga0450918_001428 Ga0450918_001428_1912_2610 231
3388 3300042532 Ga0450893_0002829 Ga0450893_0002829_1094_1789 231
3389 3300042532 Ga0450893_0020269 Ga0450893_0020269_409_1119 231
3390 3300042876 Ga0451577_0018616 Ga0451577_0018616_1414_2109 231
3391 3300042876 Ga0451577_0022858 Ga0451577_0022858_486_1193 231
3392 3300042876 Ga0451577_0095880 Ga0451577_0095880_1944_2639 231
3393 3300042876 Ga0451577_0108531 Ga0451577_0108531_138_842 231
3394 3300042876 Ga0451577_0143622 Ga0451577_0143622_183_881 231
3395 3300042876 Ga0451577_0165901 Ga0451577_0165901_918_1625 231
3396 3300042876 Ga0451577_0171958 Ga0451577_0171958_358_1053 231
3397 3300044656 Ga0466969_0005824 Ga0466969_0005824_3926_4624 231
3398 3300044656 Ga0466969_0007725 Ga0466969_0007725_1829_2527 231
3399 3300044656 Ga0466969_0013172 Ga0466969_0013172_2089_2784 231
3400 3300044656 Ga0466969_0019552 Ga0466969_0019552_1898_2599 231
3401 3300044656 Ga0466969_0131324 Ga0466969_0131324_74_778 231
3402 3300044658 Ga0466972_0005095 Ga0466972_0005095_1983_2678 231
3403 3300044659 Ga0466973_0018308 Ga0466973_0018308_3337_4035 231
3404 3300044666 Ga0466977_0012392 Ga0466977_0012392_2359_3054 231
3405 3300044673 Ga0453683_0196790 Ga0453683_0196790_169_864 231
3406 3300044683 Ga0466965_0002098 Ga0466965_0002098_5843_6541 231
3407 3300044683 Ga0466965_0003067 Ga0466965_0003067_4519_5226 231
3408 3300044683 Ga0466965_0003272 Ga0466965_0003272_2847_3548 231
3409 3300044683 Ga0466965_0024466 Ga0466965_0024466_524_1222 231
3410 3300044683 Ga0466965_0111141 Ga0466965_0111141_22_723 231
3411 3300044684 Ga0466966_0007868 Ga0466966_0007868_3263_3970 231
3412 3300044684 Ga0466966_0028392 Ga0466966_0028392_1812_2510 231
3413 3300044684 Ga0466966_0039346 Ga0466966_0039346_516_1217 231
3414 3300044684 Ga0466966_0046057 Ga0466966_0046057_1703_2404 231
3415 3300044684 Ga0466966_0108486 Ga0466966_0108486_13_711 231
3416 3300044684 Ga0466966_0175797 Ga0466966_0175797_558_1256 231
3417 3300044684 Ga0466966_0250641 Ga0466966_0250641_119_814 231
3418 3300044684 Ga0466966_0266667 Ga0466966_0266667_300_1004 231
3419 3300044684 Ga0466966_0353777 Ga0466966_0353777_12_707 231
3420 3300044693 Ga0466961_0027751 Ga0466961_0027751_891_1598 231
3421 3300044693 Ga0466961_0037792 Ga0466961_0037792_1816_2514 231
3422 3300044693 Ga0466961_0039006 Ga0466961_0039006_516_1217 231
3423 3300044693 Ga0466961_0057220 Ga0466961_0057220_133_828 231
3424 3300044693 Ga0466961_0104296 Ga0466961_0104296_569_1270 231
3425 3300044694 Ga0466963_0009556 Ga0466963_0009556_3353_4051 231
3426 3300044694 Ga0466963_0039053 Ga0466963_0039053_1498_2199 231
3427 3300044694 Ga0466963_0122706 Ga0466963_0122706_32_739 231
3428 3300044706 Ga0466964_0003612 Ga0466964_0003612_2944_3651 231
3429 3300044706 Ga0466964_0003855 Ga0466964_0003855_2976_3677 231
3430 3300044706 Ga0466964_0048520 Ga0466964_0048520_376_1071 231
3431 3300044712 Ga0453684_0010662 Ga0453684_0010662_514_1209 231
3432 3300044712 Ga0453684_0067677 Ga0453684_0067677_1720_2424 231
3433 3300044712 Ga0453684_0135701 Ga0453684_0135701_430_1143 231
3434 3300044712 Ga0453684_0153086 Ga0453684_0153086_484_1179 231
3435 3300044712 Ga0453684_0175065 Ga0453684_0175065_155_862 231
3436 3300044712 Ga0453684_0211925 Ga0453684_0211925_1051_1746 231
3437 3300044712 Ga0453684_0771485 Ga0453684_0771485_46_741 231
3438 3300044719 Ga0466971_0003236 Ga0466971_0003236_1827_2528 231
3439 3300044719 Ga0466971_0011241 Ga0466971_0011241_1401_2099 231
3440 3300044719 Ga0466971_0176954 Ga0466971_0176954_126_827 231
3441 3300044735 Ga0466968_0004267 Ga0466968_0004267_2144_2851 231
3442 3300044735 Ga0466968_0079539 Ga0466968_0079539_733_1428 231
3443 3300044735 Ga0466968_0140572 Ga0466968_0140572_358_1059 231
3444 3300044765 Ga0466970_0010068 Ga0466970_0010068_2264_2965 231
3445 3300044765 Ga0466970_0107948 Ga0466970_0107948_608_1303 231
3446 3300044765 Ga0466970_0121056 Ga0466970_0121056_423_1121 231
3447 3300044765 Ga0466970_0163880 Ga0466970_0163880_388_1086 231
3448 3300044842 Ga0466957_0014157 Ga0466957_0014157_3514_4215 231
3449 3300044842 Ga0466957_0021202 Ga0466957_0021202_733_1440 231
3450 3300044842 Ga0466957_0125045 Ga0466957_0125045_713_1408 231
3451 3300044842 Ga0466957_0157332 Ga0466957_0157332_381_1082 231
3452 3300044842 Ga0466957_0262336 Ga0466957_0262336_310_1014 231
3453 3300044842 Ga0466957_0361593 Ga0466957_0361593_250_951 231
3454 3300044842 Ga0466957_0378773 Ga0466957_0378773_60_755 231
3455 3300044901 Ga0466960_0022858 Ga0466960_0022858_462_1157 231
3456 3300044901 Ga0466960_0048640 Ga0466960_0048640_1250_1960 231
3457 3300044901 Ga0466960_0113226 Ga0466960_0113226_295_996 231
3458 3300044901 Ga0466960_0277730 Ga0466960_0277730_198_896 231
3459 3300044901 Ga0466960_0427517 Ga0466960_0427517_56_751 231
3460 3300045049 Ga0466959_0009161 Ga0466959_0009161_3229_3936 231
3461 3300045049 Ga0466959_0024121 Ga0466959_0024121_1975_2673 231
3462 3300045049 Ga0466959_0074239 Ga0466959_0074239_506_1207 231
3463 3300045049 Ga0466959_0219086 Ga0466959_0219086_176_871 231
3464 3300045049 Ga0466959_0370416 Ga0466959_0370416_72_776 231
3465 3300045051 Ga0451576_0000741 Ga0451576_0000741_58388_59083 231
3466 3300045051 Ga0451576_0003062 Ga0451576_0003062_4358_5056 231
3467 3300045051 Ga0451576_0020903 Ga0451576_0020903_4814_5509 231
3468 3300045051 Ga0451576_0025541 Ga0451576_0025541_1809_2504 231
3469 3300045051 Ga0451576_0031250 Ga0451576_0031250_4285_4989 231
3470 3300045051 Ga0451576_0031555 Ga0451576_0031555_3189_3893 231
3471 3300045051 Ga0451576_0076746 Ga0451576_0076746_615_1325 231
3472 3300045836 Ga0466958_0002024 Ga0466958_0002024_8648_9346 231
3473 3300045836 Ga0466958_0009193 Ga0466958_0009193_3974_4681 231
3474 3300045836 Ga0466958_0021653 Ga0466958_0021653_1321_2022 231
3475 3300045836 Ga0466958_0034070 Ga0466958_0034070_1546_2247 231
3476 3300045976 Ga0466967_0549631 Ga0466967_0549631_229_924 231
3477 3300046452 Ga0495617_001026 Ga0495617_001026_6257_6952 231
3478 3300046452 Ga0495617_001948 Ga0495617_001948_1902_2597 231
3479 3300046452 Ga0495617_004204 Ga0495617_004204_2662_3360 231
3480 3300046453 Ga0495627_000182 Ga0495627_000182_2182_2877 231
3481 3300046453 Ga0495627_005010 Ga0495627_005010_4556_5251 231
3482 3300046453 Ga0495627_050205 Ga0495627_050205_99_797 231
3483 3300046454 Ga0495592_0017503 Ga0495592_0017503_4336_5046 231
3484 3300046454 Ga0495592_0017992 Ga0495592_0017992_488_1204 231
3485 3300046454 Ga0495592_0036070 Ga0495592_0036070_1055_1753 231
3486 3300046454 Ga0495592_0056442 Ga0495592_0056442_495_1193 231
3487 3300046454 Ga0495592_0081418 Ga0495592_0081418_493_1206 231
3488 3300046455 Ga0495603_0002356 Ga0495603_0002356_1841_2539 231
3489 3300046455 Ga0495603_0007446 Ga0495603_0007446_4119_4814 231
3490 3300046455 Ga0495603_0025195 Ga0495603_0025195_1990_2688 231
3491 3300046455 Ga0495603_0046431 Ga0495603_0046431_1569_2264 231
3492 3300046455 Ga0495603_0136477 Ga0495603_0136477_534_1244 231
3493 3300046457 Ga0495590_0000020 Ga0495590_0000020_2584_3279 231
3494 3300046457 Ga0495590_0005309 Ga0495590_0005309_2068_2763 231
3495 3300046458 Ga0495591_004568 Ga0495591_004568_4611_5306 231
3496 3300046458 Ga0495591_007415 Ga0495591_007415_3879_4574 231
3497 3300046458 Ga0495591_007919 Ga0495591_007919_476_1174 231
3498 3300046458 Ga0495591_008200 Ga0495591_008200_2032_2727 231
3499 3300046458 Ga0495591_056370 Ga0495591_056370_164_859 231
3500 3300046459 Ga0495629_0006590 Ga0495629_0006590_6032_6727 231
3501 3300046459 Ga0495629_0025297 Ga0495629_0025297_1901_2599 231
3502 3300046459 Ga0495629_0026766 Ga0495629_0026766_1964_2662 231
3503 3300046459 Ga0495629_0028245 Ga0495629_0028245_1016_1714 231
3504 3300046459 Ga0495629_0047753 Ga0495629_0047753_2069_2770 231
3505 3300046459 Ga0495629_0123766 Ga0495629_0123766_39_737 231
3506 3300046459 Ga0495629_0124917 Ga0495629_0124917_599_1309 231
3507 3300046459 Ga0495629_0179547 Ga0495629_0179547_551_1279 231
3508 3300046460 Ga0495638_0010010 Ga0495638_0010010_2034_2729 231
3509 3300046460 Ga0495638_0010721 Ga0495638_0010721_3676_4371 231
3510 3300046460 Ga0495638_0029373 Ga0495638_0029373_733_1431 231
3511 3300046460 Ga0495638_0042928 Ga0495638_0042928_283_993 231
3512 3300046460 Ga0495638_0112063 Ga0495638_0112063_74_769 231
3513 3300046460 Ga0495638_0233293 Ga0495638_0233293_128_823 231
3514 3300046461 Ga0495641_0034399 Ga0495641_0034399_1666_2379 231
3515 3300046462 Ga0495651_0000262 Ga0495651_0000262_38691_39404 231
3516 3300046462 Ga0495651_0012535 Ga0495651_0012535_2877_3590 231
3517 3300046462 Ga0495651_0405697 Ga0495651_0405697_132_863 231
3518 3300046463 Ga0495653_0003544 Ga0495653_0003544_1894_2589 231
3519 3300046463 Ga0495653_0006482 Ga0495653_0006482_7242_7955 231
3520 3300046463 Ga0495653_0025764 Ga0495653_0025764_1926_2633 231
3521 3300046463 Ga0495653_0042103 Ga0495653_0042103_1002_1697 231
3522 3300046463 Ga0495653_0060701 Ga0495653_0060701_1837_2535 231
3523 3300046463 Ga0495653_0067768 Ga0495653_0067768_375_1073 231
3524 3300046463 Ga0495653_0155740 Ga0495653_0155740_113_811 231
3525 3300046463 Ga0495653_0401414 Ga0495653_0401414_85_783 231
3526 3300046471 Ga0495650_0004288 Ga0495650_0004288_5616_6311 231
3527 3300046471 Ga0495650_0004799 Ga0495650_0004799_6138_6833 231
3528 3300046471 Ga0495650_0008022 Ga0495650_0008022_1976_2671 231
3529 3300046471 Ga0495650_0009500 Ga0495650_0009500_2920_3618 231
3530 3300046471 Ga0495650_0010515 Ga0495650_0010515_2816_3511 231
3531 3300046471 Ga0495650_0017326 Ga0495650_0017326_1920_2615 231
3532 3300046471 Ga0495650_0017995 Ga0495650_0017995_936_1631 231
3533 3300046471 Ga0495650_0039990 Ga0495650_0039990_432_1127 231
3534 3300046471 Ga0495650_0071140 Ga0495650_0071140_199_894 231
3535 3300046471 Ga0495650_0082680 Ga0495650_0082680_213_908 231
3536 3300046472 Ga0495580_0002666 Ga0495580_0002666_13183_13881 231
3537 3300046472 Ga0495580_0008648 Ga0495580_0008648_4401_5096 231
3538 3300046472 Ga0495580_0009966 Ga0495580_0009966_1642_2355 231
3539 3300046472 Ga0495580_0024354 Ga0495580_0024354_1824_2522 231
3540 3300046472 Ga0495580_0047362 Ga0495580_0047362_1604_2302 231
3541 3300046472 Ga0495580_0051891 Ga0495580_0051891_2184_2879 231
3542 3300046472 Ga0495580_0267421 Ga0495580_0267421_309_1007 231
3543 3300046473 Ga0495582_0013331 Ga0495582_0013331_1904_2599 231
3544 3300046473 Ga0495582_0018313 Ga0495582_0018313_1524_2222 231
3545 3300046473 Ga0495582_0021204 Ga0495582_0021204_890_1588 231
3546 3300046473 Ga0495582_0057328 Ga0495582_0057328_374_1072 231
3547 3300046473 Ga0495582_0152636 Ga0495582_0152636_70_807 231
3548 3300046474 Ga0495605_0002653 Ga0495605_0002653_5608_6303 231
3549 3300046474 Ga0495605_0003232 Ga0495605_0003232_3120_3815 231
3550 3300046474 Ga0495605_0003346 Ga0495605_0003346_6372_7067 231
3551 3300046474 Ga0495605_0008384 Ga0495605_0008384_1389_2084 231
3552 3300046474 Ga0495605_0013410 Ga0495605_0013410_1935_2630 231
3553 3300046474 Ga0495605_0013696 Ga0495605_0013696_1732_2427 231
3554 3300046474 Ga0495605_0017644 Ga0495605_0017644_1888_2583 231
3555 3300046474 Ga0495605_0021467 Ga0495605_0021467_1810_2508 231
3556 3300046474 Ga0495605_0127367 Ga0495605_0127367_380_1075 231
3557 3300046475 Ga0495639_0024830 Ga0495639_0024830_526_1239 231
3558 3300046475 Ga0495639_0124777 Ga0495639_0124777_214_945 231
3559 3300046476 Ga0495662_0108904 Ga0495662_0108904_294_992 231
3560 3300046476 Ga0495662_0244700 Ga0495662_0244700_123_821 231
3561 3300046477 Ga0495664_0017670 Ga0495664_0017670_1556_2254 231
3562 3300046477 Ga0495664_0079473 Ga0495664_0079473_191_889 231
3563 3300046491 Ga0495584_0002812 Ga0495584_0002812_2921_3616 231
3564 3300046491 Ga0495584_0007925 Ga0495584_0007925_4274_4969 231
3565 3300046491 Ga0495584_0011818 Ga0495584_0011818_3059_3754 231
3566 3300046491 Ga0495584_0018163 Ga0495584_0018163_98_793 231
3567 3300046491 Ga0495584_0020283 Ga0495584_0020283_1717_2412 231
3568 3300046491 Ga0495584_0028642 Ga0495584_0028642_1945_2655 231
3569 3300046491 Ga0495584_0031277 Ga0495584_0031277_1130_1825 231
3570 3300046491 Ga0495584_0172216 Ga0495584_0172216_87_785 231
3571 3300046492 Ga0495585_0012012 Ga0495585_0012012_2487_3182 231
3572 3300046492 Ga0495585_0015837 Ga0495585_0015837_1168_1863 231
3573 3300046492 Ga0495585_0020976 Ga0495585_0020976_853_1548 231
3574 3300046492 Ga0495585_0035023 Ga0495585_0035023_1797_2495 231
3575 3300046492 Ga0495585_0060098 Ga0495585_0060098_110_805 231
3576 3300046492 Ga0495585_0086385 Ga0495585_0086385_718_1413 231
3577 3300046499 Ga0495594_0031927 Ga0495594_0031927_418_1131 231
3578 3300046499 Ga0495594_0180907 Ga0495594_0180907_422_1120 231
3579 3300046500 Ga0495596_0005141 Ga0495596_0005141_1829_2524 231
3580 3300046500 Ga0495596_0005175 Ga0495596_0005175_3609_4304 231
3581 3300046500 Ga0495596_0011320 Ga0495596_0011320_668_1363 231
3582 3300046500 Ga0495596_0016679 Ga0495596_0016679_2302_3000 231
3583 3300046500 Ga0495596_0021654 Ga0495596_0021654_101_796 231
3584 3300046500 Ga0495596_0024896 Ga0495596_0024896_993_1691 231
3585 3300046500 Ga0495596_0079213 Ga0495596_0079213_224_919 231
3586 3300046500 Ga0495596_0196920 Ga0495596_0196920_34_729 231
3587 3300046501 Ga0495607_0004301 Ga0495607_0004301_2713_3411 231
3588 3300046501 Ga0495607_0006925 Ga0495607_0006925_5416_6111 231
3589 3300046501 Ga0495607_0013138 Ga0495607_0013138_177_872 231
3590 3300046501 Ga0495607_0015517 Ga0495607_0015517_153_848 231
3591 3300046501 Ga0495607_0020526 Ga0495607_0020526_2585_3280 231
3592 3300046501 Ga0495607_0038288 Ga0495607_0038288_2058_2753 231
3593 3300046501 Ga0495607_0045652 Ga0495607_0045652_974_1669 231
3594 3300046501 Ga0495607_0071401 Ga0495607_0071401_991_1686 231
3595 3300046501 Ga0495607_0077195 Ga0495607_0077195_447_1142 231
3596 3300046501 Ga0495607_0255605 Ga0495607_0255605_31_726 231
3597 3300046506 Ga0495583_0000310 Ga0495583_0000310_74621_75316 231
3598 3300046506 Ga0495583_0000517 Ga0495583_0000517_33946_34641 231
3599 3300046506 Ga0495583_0006309 Ga0495583_0006309_4937_5632 231
3600 3300046506 Ga0495583_0008161 Ga0495583_0008161_2493_3191 231
3601 3300046506 Ga0495583_0008580 Ga0495583_0008580_4526_5221 231
3602 3300046506 Ga0495583_0008959 Ga0495583_0008959_3353_4048 231
3603 3300046506 Ga0495583_0013755 Ga0495583_0013755_1902_2597 231
3604 3300046506 Ga0495583_0014761 Ga0495583_0014761_744_1439 231
3605 3300046506 Ga0495583_0028893 Ga0495583_0028893_428_1123 231
3606 3300046506 Ga0495583_0115709 Ga0495583_0115709_393_1088 231
3607 3300046507 Ga0495606_0000600 Ga0495606_0000600_4702_5397 231
3608 3300046507 Ga0495606_0007181 Ga0495606_0007181_9238_9933 231
3609 3300046507 Ga0495606_0013036 Ga0495606_0013036_4020_4715 231
3610 3300046507 Ga0495606_0018493 Ga0495606_0018493_2158_2856 231
3611 3300046507 Ga0495606_0019502 Ga0495606_0019502_2130_2825 231
3612 3300046507 Ga0495606_0020178 Ga0495606_0020178_1112_1816 231
3613 3300046507 Ga0495606_0023944 Ga0495606_0023944_1162_1857 231
3614 3300046507 Ga0495606_0039988 Ga0495606_0039988_2048_2743 231
3615 3300046507 Ga0495606_0065259 Ga0495606_0065259_1439_2134 231
3616 3300046507 Ga0495606_0075642 Ga0495606_0075642_962_1657 231
3617 3300046507 Ga0495606_0111727 Ga0495606_0111727_601_1296 231
3618 3300046507 Ga0495606_0121584 Ga0495606_0121584_310_1005 231
3619 3300046507 Ga0495606_0134123 Ga0495606_0134123_97_795 231
3620 3300046511 Ga0495608_0007277 Ga0495608_0007277_5297_6010 231
3621 3300046511 Ga0495608_0018080 Ga0495608_0018080_2549_3247 231
3622 3300046511 Ga0495608_0064168 Ga0495608_0064168_957_1652 231
3623 3300046512 Ga0495610_0003877 Ga0495610_0003877_4821_5516 231
3624 3300046512 Ga0495610_0009271 Ga0495610_0009271_2294_2989 231
3625 3300046512 Ga0495610_0010097 Ga0495610_0010097_774_1469 231
3626 3300046512 Ga0495610_0020302 Ga0495610_0020302_1328_2026 231
3627 3300046512 Ga0495610_0023962 Ga0495610_0023962_1708_2403 231
3628 3300046512 Ga0495610_0027750 Ga0495610_0027750_413_1111 231
3629 3300046512 Ga0495610_0029280 Ga0495610_0029280_367_1077 231
3630 3300046512 Ga0495610_0049149 Ga0495610_0049149_659_1354 231
3631 3300046512 Ga0495610_0062659 Ga0495610_0062659_633_1340 231
3632 3300046512 Ga0495610_0149401 Ga0495610_0149401_206_901 231
3633 3300046513 Ga0495616_0002539 Ga0495616_0002539_2724_3419 231
3634 3300046513 Ga0495616_0020539 Ga0495616_0020539_2034_2729 231
3635 3300046513 Ga0495616_0022828 Ga0495616_0022828_442_1137 231
3636 3300046513 Ga0495616_0033072 Ga0495616_0033072_715_1410 231
3637 3300046513 Ga0495616_0040238 Ga0495616_0040238_761_1456 231
3638 3300046513 Ga0495616_0047106 Ga0495616_0047106_1304_1999 231
3639 3300046513 Ga0495616_0053842 Ga0495616_0053842_1145_1843 231
3640 3300046514 Ga0495618_0009815 Ga0495618_0009815_1902_2600 231
3641 3300046514 Ga0495618_0015048 Ga0495618_0015048_1666_2379 231
3642 3300046514 Ga0495618_0210642 Ga0495618_0210642_138_836 231
3643 3300046515 Ga0495620_0011229 Ga0495620_0011229_1917_2615 231
3644 3300046515 Ga0495620_0012783 Ga0495620_0012783_3513_4208 231
3645 3300046515 Ga0495620_0012958 Ga0495620_0012958_1780_2475 231
3646 3300046515 Ga0495620_0136758 Ga0495620_0136758_105_800 231
3647 3300046516 Ga0495628_0009854 Ga0495628_0009854_5812_6528 231
3648 3300046516 Ga0495628_0015894 Ga0495628_0015894_2700_3398 231
3649 3300046516 Ga0495628_0030115 Ga0495628_0030115_1864_2562 231
3650 3300046516 Ga0495628_0059703 Ga0495628_0059703_1833_2531 231
3651 3300046516 Ga0495628_0117062 Ga0495628_0117062_1107_1820 231
3652 3300046516 Ga0495628_0173274 Ga0495628_0173274_28_726 231
3653 3300046516 Ga0495628_0296058 Ga0495628_0296058_86_796 231
3654 3300046516 Ga0495628_0364392 Ga0495628_0364392_41_739 231
3655 3300046517 Ga0495630_0001591 Ga0495630_0001591_1666_2379 231
3656 3300046517 Ga0495630_0020703 Ga0495630_0020703_2567_3265 231
3657 3300046517 Ga0495630_0021769 Ga0495630_0021769_2997_3704 231
3658 3300046517 Ga0495630_0069269 Ga0495630_0069269_378_1076 231
3659 3300046517 Ga0495630_0375755 Ga0495630_0375755_195_893 231
3660 3300046518 Ga0495631_0000496 Ga0495631_0000496_3831_4529 231
3661 3300046519 Ga0495632_0024421 Ga0495632_0024421_382_1089 231
3662 3300046519 Ga0495632_0033158 Ga0495632_0033158_1881_2576 231
3663 3300046519 Ga0495632_0045773 Ga0495632_0045773_350_1045 231
3664 3300046520 Ga0495637_0001714 Ga0495637_0001714_2060_2755 231
3665 3300046520 Ga0495637_0013614 Ga0495637_0013614_1190_1885 231
3666 3300046520 Ga0495637_0032333 Ga0495637_0032333_1448_2143 231
3667 3300046522 Ga0495643_0010644 Ga0495643_0010644_4657_5352 231
3668 3300046522 Ga0495643_0013033 Ga0495643_0013033_1840_2535 231
3669 3300046522 Ga0495643_0023583 Ga0495643_0023583_2010_2711 231
3670 3300046522 Ga0495643_0031793 Ga0495643_0031793_2088_2783 231
3671 3300046522 Ga0495643_0032093 Ga0495643_0032093_1910_2605 231
3672 3300046522 Ga0495643_0036366 Ga0495643_0036366_364_1059 231
3673 3300046522 Ga0495643_0037230 Ga0495643_0037230_825_1520 231
3674 3300046522 Ga0495643_0039034 Ga0495643_0039034_799_1497 231
3675 3300046522 Ga0495643_0042163 Ga0495643_0042163_1383_2078 231
3676 3300046523 Ga0495644_0057810 Ga0495644_0057810_129_824 231
3677 3300046523 Ga0495644_0104124 Ga0495644_0104124_51_746 231
3678 3300046523 Ga0495644_0111588 Ga0495644_0111588_292_987 231
3679 3300046524 Ga0495648_0013276 Ga0495648_0013276_3349_4044 231
3680 3300046524 Ga0495648_0014819 Ga0495648_0014819_3159_3857 231
3681 3300046524 Ga0495648_0034037 Ga0495648_0034037_725_1420 231
3682 3300046524 Ga0495648_0042742 Ga0495648_0042742_1902_2597 231
3683 3300046524 Ga0495648_0049584 Ga0495648_0049584_38_736 231
3684 3300046524 Ga0495648_0053446 Ga0495648_0053446_141_839 231
3685 3300046524 Ga0495648_0108321 Ga0495648_0108321_391_1086 231
3686 3300046524 Ga0495648_0202150 Ga0495648_0202150_248_943 231
3687 3300046525 Ga0495663_0026187 Ga0495663_0026187_102_797 231
3688 3300046525 Ga0495663_0033047 Ga0495663_0033047_535_1239 231
3689 3300046526 Ga0495666_0003087 Ga0495666_0003087_6020_6733 231
3690 3300046526 Ga0495666_0012848 Ga0495666_0012848_1575_2273 231
3691 3300046526 Ga0495666_0014922 Ga0495666_0014922_1903_2601 231
3692 3300046526 Ga0495666_0030164 Ga0495666_0030164_1566_2264 231
3693 3300046528 Ga0495642_0004349 Ga0495642_0004349_1951_2646 231
3694 3300046528 Ga0495642_0015953 Ga0495642_0015953_2166_2864 231
3695 3300046528 Ga0495642_0021122 Ga0495642_0021122_157_858 231
3696 3300046528 Ga0495642_0045877 Ga0495642_0045877_419_1114 231
3697 3300046528 Ga0495642_0127470 Ga0495642_0127470_51_746 231
3698 3300046529 Ga0495652_0019580 Ga0495652_0019580_1623_2339 231
3699 3300046529 Ga0495652_0022553 Ga0495652_0022553_3047_3745 231
3700 3300046529 Ga0495652_0073582 Ga0495652_0073582_1817_2530 231
3701 3300046529 Ga0495652_0075882 Ga0495652_0075882_1829_2542 231
3702 3300046529 Ga0495652_0122940 Ga0495652_0122940_944_1642 231
3703 3300046530 Ga0495654_0000115 Ga0495654_0000115_88773_89468 231
3704 3300046530 Ga0495654_0039369 Ga0495654_0039369_1588_2283 231
3705 3300046530 Ga0495654_0044431 Ga0495654_0044431_1392_2087 231
3706 3300046530 Ga0495654_0058914 Ga0495654_0058914_597_1292 231
3707 3300046531 Ga0495665_0005644 Ga0495665_0005644_1841_2539 231
3708 3300046531 Ga0495665_0031552 Ga0495665_0031552_1837_2535 231
3709 3300046531 Ga0495665_0058850 Ga0495665_0058850_536_1234 231
3710 3300046531 Ga0495665_0085709 Ga0495665_0085709_174_881 231
3711 3300046533 Ga0495640_0007216 Ga0495640_0007216_663_1376 231
3712 3300046533 Ga0495640_0035349 Ga0495640_0035349_1903_2601 231
3713 3300046533 Ga0495640_0038635 Ga0495640_0038635_1091_1789 231
3714 3300046533 Ga0495640_0049724 Ga0495640_0049724_383_1081 231
3715 3300046533 Ga0495640_0172376 Ga0495640_0172376_381_1076 231
3716 3300046535 Ga0495586_0017712 Ga0495586_0017712_1251_1949 231
3717 3300046535 Ga0495586_0027002 Ga0495586_0027002_2014_2709 231
3718 3300046535 Ga0495586_0027185 Ga0495586_0027185_262_969 231
3719 3300046535 Ga0495586_0079643 Ga0495586_0079643_328_1047 231
3720 3300046535 Ga0495586_0213591 Ga0495586_0213591_197_892 231
3721 3300046536 Ga0495587_0012352 Ga0495587_0012352_1913_2611 231
3722 3300046536 Ga0495587_0015602 Ga0495587_0015602_2009_2716 231
3723 3300046536 Ga0495587_0052325 Ga0495587_0052325_31_744 231
3724 3300046536 Ga0495587_0096951 Ga0495587_0096951_562_1257 231
3725 3300046536 Ga0495587_0124547 Ga0495587_0124547_458_1174 231
3726 3300046538 Ga0495609_0002112 Ga0495609_0002112_9451_10146 231
3727 3300046538 Ga0495609_0003741 Ga0495609_0003741_5919_6614 231
3728 3300046538 Ga0495609_0005231 Ga0495609_0005231_1962_2657 231
3729 3300046538 Ga0495609_0006941 Ga0495609_0006941_4807_5502 231
3730 3300046538 Ga0495609_0007322 Ga0495609_0007322_3447_4142 231
3731 3300046538 Ga0495609_0009863 Ga0495609_0009863_12_707 231
3732 3300046538 Ga0495609_0010454 Ga0495609_0010454_1779_2474 231
3733 3300046538 Ga0495609_0010718 Ga0495609_0010718_3141_3836 231
3734 3300046538 Ga0495609_0023809 Ga0495609_0023809_1980_2675 231
3735 3300046538 Ga0495609_0024419 Ga0495609_0024419_829_1524 231
3736 3300046538 Ga0495609_0040698 Ga0495609_0040698_867_1562 231
3737 3300046539 Ga0495621_0023035 Ga0495621_0023035_146_853 231
3738 3300046542 Ga0495597_0000060 Ga0495597_0000060_91124_91819 231
3739 3300046542 Ga0495597_0007608 Ga0495597_0007608_4625_5320 231
3740 3300046542 Ga0495597_0008648 Ga0495597_0008648_2437_3147 231
3741 3300046542 Ga0495597_0009678 Ga0495597_0009678_1260_1958 231
3742 3300046542 Ga0495597_0012910 Ga0495597_0012910_1862_2557 231
3743 3300046542 Ga0495597_0014560 Ga0495597_0014560_1204_1899 231
3744 3300046542 Ga0495597_0016240 Ga0495597_0016240_2126_2827 231
3745 3300046542 Ga0495597_0017705 Ga0495597_0017705_2220_2915 231
3746 3300046542 Ga0495597_0097177 Ga0495597_0097177_225_920 231
3747 3300046542 Ga0495597_0168106 Ga0495597_0168106_156_851 231
3748 3300046543 Ga0495645_0000876 Ga0495645_0000876_18175_18891 231
3749 3300046543 Ga0495645_0006837 Ga0495645_0006837_5199_5897 231
3750 3300046543 Ga0495645_0054356 Ga0495645_0054356_1810_2505 231
3751 3300046543 Ga0495645_0297605 Ga0495645_0297605_315_1043 231
3752 3300046543 Ga0495645_0380367 Ga0495645_0380367_82_780 231
3753 3300046557 Ga0495622_0010681 Ga0495622_0010681_1935_2630 231
3754 3300046557 Ga0495622_0011082 Ga0495622_0011082_191_889 231
3755 3300046557 Ga0495622_0046758 Ga0495622_0046758_150_860 231
3756 3300046557 Ga0495622_0092997 Ga0495622_0092997_340_1035 231
3757 3300046558 Ga0495633_0007144 Ga0495633_0007144_2030_2725 231
3758 3300046558 Ga0495633_0016754 Ga0495633_0016754_1979_2674 231
3759 3300046558 Ga0495633_0035933 Ga0495633_0035933_1454_2149 231
3760 3300046558 Ga0495633_0150457 Ga0495633_0150457_49_744 231
3761 3300046558 Ga0495633_0152692 Ga0495633_0152692_324_1019 231
3762 3300046559 Ga0495667_0024516 Ga0495667_0024516_1894_2607 231
3763 3300046559 Ga0495667_0036408 Ga0495667_0036408_1611_2324 231
3764 3300046559 Ga0495667_0324928 Ga0495667_0324928_89_787 231
3765 3300046615 Ga0495656_0006272 Ga0495656_0006272_2398_3093 231
3766 3300046615 Ga0495656_0006613 Ga0495656_0006613_1851_2552 231
3767 3300046615 Ga0495656_0086999 Ga0495656_0086999_285_980 231
3768 3300046615 Ga0495656_0308816 Ga0495656_0308816_20_757 231
3769 3300046616 Ga0495668_0007707 Ga0495668_0007707_2114_2809 231
3770 3300046616 Ga0495668_0012732 Ga0495668_0012732_3716_4411 231
3771 3300046616 Ga0495668_0020876 Ga0495668_0020876_708_1403 231
3772 3300046616 Ga0495668_0025580 Ga0495668_0025580_1912_2607 231
3773 3300046616 Ga0495668_0028258 Ga0495668_0028258_915_1613 231
3774 3300046616 Ga0495668_0035408 Ga0495668_0035408_516_1211 231
3775 3300046616 Ga0495668_0094506 Ga0495668_0094506_196_891 231
3776 3300046642 Ga0495634_0018015 Ga0495634_0018015_2569_3267 231
3777 3300046642 Ga0495634_0019079 Ga0495634_0019079_2113_2808 231
3778 3300046642 Ga0495634_0162625 Ga0495634_0162625_663_1376 231
3779 3300046642 Ga0495634_0203111 Ga0495634_0203111_371_1066 231
3780 3300046648 Ga0495611_0013452 Ga0495611_0013452_858_1568 231
3781 3300046648 Ga0495611_0023806 Ga0495611_0023806_373_1068 231
3782 3300046648 Ga0495611_0026624 Ga0495611_0026624_1083_1778 231
3783 3300046648 Ga0495611_0035256 Ga0495611_0035256_518_1213 231
3784 3300046648 Ga0495611_0103487 Ga0495611_0103487_237_932 231
3785 3300046648 Ga0495611_0129066 Ga0495611_0129066_163_858 231
3786 3300046648 Ga0495611_0269165 Ga0495611_0269165_57_755 231
3787 3300046660 Ga0495625_0020104 Ga0495625_0020104_2581_3276 231
3788 3300046660 Ga0495625_0022675 Ga0495625_0022675_1926_2633 231
3789 3300046660 Ga0495625_0022811 Ga0495625_0022811_3881_4576 231
3790 3300046660 Ga0495625_0026926 Ga0495625_0026926_2033_2731 231
3791 3300046660 Ga0495625_0038358 Ga0495625_0038358_1909_2607 231
3792 3300046660 Ga0495625_0093155 Ga0495625_0093155_107_802 231
3793 3300046660 Ga0495625_0228704 Ga0495625_0228704_214_909 231
3794 3300046663 Ga0495635_0014432 Ga0495635_0014432_2777_3472 231
3795 3300046663 Ga0495635_0016191 Ga0495635_0016191_2105_2818 231
3796 3300046663 Ga0495635_0049363 Ga0495635_0049363_380_1078 231
3797 3300046664 Ga0495659_0012574 Ga0495659_0012574_1126_1821 231
3798 3300046665 Ga0495661_0010615 Ga0495661_0010615_2633_3331 231
3799 3300046665 Ga0495661_0010669 Ga0495661_0010669_3469_4170 231
3800 3300046665 Ga0495661_0011570 Ga0495661_0011570_1415_2110 231
3801 3300046665 Ga0495661_0013210 Ga0495661_0013210_419_1114 231
3802 3300046665 Ga0495661_0013697 Ga0495661_0013697_4566_5261 231
3803 3300046665 Ga0495661_0018478 Ga0495661_0018478_1650_2345 231
3804 3300046665 Ga0495661_0019336 Ga0495661_0019336_786_1481 231
3805 3300046665 Ga0495661_0022427 Ga0495661_0022427_299_994 231
3806 3300046665 Ga0495661_0024058 Ga0495661_0024058_1656_2354 231
3807 3300046665 Ga0495661_0037189 Ga0495661_0037189_1108_1803 231
3808 3300046665 Ga0495661_0049136 Ga0495661_0049136_1476_2180 231
3809 3300046665 Ga0495661_0311011 Ga0495661_0311011_34_729 231
3810 3300046674 Ga0495588_0010876 Ga0495588_0010876_1998_2693 231
3811 3300046674 Ga0495588_0039051 Ga0495588_0039051_1015_1710 231
3812 3300046674 Ga0495588_0108226 Ga0495588_0108226_314_1021 231
3813 3300046674 Ga0495588_0144360 Ga0495588_0144360_361_1056 231
3814 3300046675 Ga0495657_0024064 Ga0495657_0024064_2967_3680 231
3815 3300046675 Ga0495657_0038350 Ga0495657_0038350_1466_2164 231
3816 3300046675 Ga0495657_0082039 Ga0495657_0082039_698_1411 231
3817 3300046678 Ga0495599_0018423 Ga0495599_0018423_3146_3862 231
3818 3300046678 Ga0495599_0039843 Ga0495599_0039843_1849_2547 231
3819 3300046678 Ga0495599_0080121 Ga0495599_0080121_1203_1919 231
3820 3300046678 Ga0495599_0103472 Ga0495599_0103472_131_829 231
3821 3300046678 Ga0495599_0335749 Ga0495599_0335749_199_894 231
3822 3300046679 Ga0495623_0023807 Ga0495623_0023807_2801_3499 231
3823 3300046679 Ga0495623_0149049 Ga0495623_0149049_387_1085 231
3824 3300046679 Ga0495623_0211305 Ga0495623_0211305_174_881 231
3825 3300046680 Ga0495646_0016730 Ga0495646_0016730_2911_3609 231
3826 3300046680 Ga0495646_0052255 Ga0495646_0052255_1479_2177 231
3827 3300046680 Ga0495646_0061659 Ga0495646_0061659_505_1203 231
3828 3300046680 Ga0495646_0251087 Ga0495646_0251087_230_925 231
3829 3300046681 Ga0495647_0008534 Ga0495647_0008534_1046_1759 231
3830 3300046683 Ga0495658_0062255 Ga0495658_0062255_1401_2114 231
3831 3300046683 Ga0495658_0101065 Ga0495658_0101065_263_1000 231
3832 3300046683 Ga0495658_0282610 Ga0495658_0282610_34_762 231
3833 3300046684 Ga0495669_0021103 Ga0495669_0021103_2016_2711 231
3834 3300046684 Ga0495669_0021848 Ga0495669_0021848_2025_2720 231
3835 3300046684 Ga0495669_0026297 Ga0495669_0026297_1216_1917 231
3836 3300046684 Ga0495669_0042853 Ga0495669_0042853_1291_1986 231
3837 3300046684 Ga0495669_0050421 Ga0495669_0050421_952_1650 231
3838 3300046684 Ga0495669_0126004 Ga0495669_0126004_324_1019 231
3839 3300046689 Ga0495613_0024317 Ga0495613_0024317_2226_2924 231
3840 3300046689 Ga0495613_0041905 Ga0495613_0041905_1020_1718 231
3841 3300046689 Ga0495613_0487358 Ga0495613_0487358_14_742 231
3842 3300046690 Ga0495624_0011204 Ga0495624_0011204_1841_2539 231
3843 3300046690 Ga0495624_0163200 Ga0495624_0163200_374_1072 231
3844 3300046690 Ga0495624_0177515 Ga0495624_0177515_463_1161 231
3845 3300046690 Ga0495624_0219798 Ga0495624_0219798_170_883 231
3846 3300046690 Ga0495624_0283511 Ga0495624_0283511_229_936 231
3847 3300046690 Ga0495624_0318387 Ga0495624_0318387_150_860 231
3848 3300046691 Ga0495670_0015440 Ga0495670_0015440_2900_3595 231
3849 3300046691 Ga0495670_0040136 Ga0495670_0040136_24_719 231
3850 3300046691 Ga0495670_0170528 Ga0495670_0170528_223_927 231
3851 3300046692 Ga0495671_0008146 Ga0495671_0008146_3542_4237 231
3852 3300046692 Ga0495671_0029072 Ga0495671_0029072_1917_2615 231
3853 3300046692 Ga0495671_0042709 Ga0495671_0042709_865_1560 231
3854 3300046692 Ga0495671_0082798 Ga0495671_0082798_849_1544 231
3855 3300046692 Ga0495671_0090741 Ga0495671_0090741_45_749 231
3856 3300046694 Ga0495649_0014801 Ga0495649_0014801_1912_2607 231
3857 3300046694 Ga0495649_0024341 Ga0495649_0024341_2351_3046 231
3858 3300046694 Ga0495649_0026348 Ga0495649_0026348_168_863 231
3859 3300046694 Ga0495649_0026842 Ga0495649_0026842_534_1229 231
3860 3300046694 Ga0495649_0040459 Ga0495649_0040459_200_898 231
3861 3300046694 Ga0495649_0083596 Ga0495649_0083596_220_918 231
3862 3300046694 Ga0495649_0128855 Ga0495649_0128855_603_1298 231
3863 3300046794 Ga0495589_0005345 Ga0495589_0005345_2897_3595 231
3864 3300046794 Ga0495589_0014565 Ga0495589_0014565_1171_1866 231
3865 3300046794 Ga0495589_0022141 Ga0495589_0022141_500_1195 231
3866 3300046794 Ga0495589_0023941 Ga0495589_0023941_1229_1924 231
3867 3300046794 Ga0495589_0059302 Ga0495589_0059302_255_950 231
3868 3300046809 Ga0495600_0020912 Ga0495600_0020912_3454_4167 231
3869 3300046809 Ga0495600_0026041 Ga0495600_0026041_1817_2515 231
3870 3300046809 Ga0495600_0064540 Ga0495600_0064540_84_782 231
3871 3300046809 Ga0495600_0165931 Ga0495600_0165931_362_1069 231
3872 3300046810 Ga0495660_0003674 Ga0495660_0003674_1963_2658 231
3873 3300046810 Ga0495660_0016570 Ga0495660_0016570_1415_2110 231
3874 3300046810 Ga0495660_0023488 Ga0495660_0023488_2171_2878 231
3875 3300046810 Ga0495660_0030863 Ga0495660_0030863_383_1078 231
3876 3300046810 Ga0495660_0100634 Ga0495660_0100634_237_932 231
3877 3300046810 Ga0495660_0217380 Ga0495660_0217380_170_865 231
3878 3300046810 Ga0495660_0238660 Ga0495660_0238660_41_736 231
3879 3300047315 Ga0495581_0011795 Ga0495581_0011795_2257_2964 231
3880 3300047315 Ga0495581_0012682 Ga0495581_0012682_2934_3632 231
3881 3300047315 Ga0495581_0029554 Ga0495581_0029554_936_1634 231
3882 3300047315 Ga0495581_0032726 Ga0495581_0032726_1911_2609 231
3883 3300047315 Ga0495581_0032971 Ga0495581_0032971_317_1012 231
3884 3300047315 Ga0495581_0084242 Ga0495581_0084242_230_925 231
3885 3300047317 Ga0495604_0060131 Ga0495604_0060131_1529_2242 231
3886 3300047317 Ga0495604_0060212 Ga0495604_0060212_1530_2228 231
3887 3300047317 Ga0495604_0100103 Ga0495604_0100103_965_1663 231
3888 3300047317 Ga0495604_0320725 Ga0495604_0320725_187_885 231
3889 3300047317 Ga0495604_0321765 Ga0495604_0321765_153_860 231
3890 3300047318 Ga0495636_0006088 Ga0495636_0006088_2023_2718 231
3891 3300047318 Ga0495636_0006698 Ga0495636_0006698_1889_2596 231
3892 3300047318 Ga0495636_0007040 Ga0495636_0007040_1885_2580 231
3893 3300047318 Ga0495636_0010674 Ga0495636_0010674_1399_2094 231
3894 3300047319 Ga0495674_0030234 Ga0495674_0030234_1345_2043 231
3895 3300047319 Ga0495674_0035014 Ga0495674_0035014_1881_2582 231
3896 3300047319 Ga0495674_0035609 Ga0495674_0035609_2591_3325 231
3897 3300047319 Ga0495674_0073837 Ga0495674_0073837_1837_2535 231
3898 3300047319 Ga0495674_0106813 Ga0495674_0106813_1567_2265 231
3899 3300047319 Ga0495674_0321555 Ga0495674_0321555_172_870 231
3900 3300047320 Ga0495672_0000201 Ga0495672_0000201_82696_83391 231
3901 3300047320 Ga0495672_0017725 Ga0495672_0017725_1799_2497 231
3902 3300047320 Ga0495672_0019097 Ga0495672_0019097_1918_2613 231
3903 3300047320 Ga0495672_0020418 Ga0495672_0020418_1960_2655 231
3904 3300047320 Ga0495672_0026706 Ga0495672_0026706_1931_2626 231
3905 3300047320 Ga0495672_0035703 Ga0495672_0035703_1434_2129 231
3906 3300047320 Ga0495672_0077299 Ga0495672_0077299_937_1635 231
3907 3300047320 Ga0495672_0204111 Ga0495672_0204111_265_960 231
3908 3300047321 Ga0495676_0028869 Ga0495676_0028869_3870_4565 231
3909 3300047321 Ga0495676_0040228 Ga0495676_0040228_1326_2024 231
3910 3300047321 Ga0495676_0046788 Ga0495676_0046788_1203_1901 231
3911 3300047321 Ga0495676_0063290 Ga0495676_0063290_1000_1710 231
3912 3300047321 Ga0495676_0130647 Ga0495676_0130647_1034_1732 231
3913 3300047322 Ga0495680_0039804 Ga0495680_0039804_2995_3690 231
3914 3300047322 Ga0495680_0052699 Ga0495680_0052699_2023_2721 231
3915 3300047322 Ga0495680_0057028 Ga0495680_0057028_1901_2599 231
3916 3300047322 Ga0495680_0058733 Ga0495680_0058733_435_1133 231
3917 3300047322 Ga0495680_0082750 Ga0495680_0082750_1174_1887 231
3918 3300047323 Ga0495683_0007469 Ga0495683_0007469_4582_5277 231
3919 3300047323 Ga0495683_0010512 Ga0495683_0010512_1459_2154 231
3920 3300047323 Ga0495683_0025191 Ga0495683_0025191_2060_2755 231
3921 3300047323 Ga0495683_0026862 Ga0495683_0026862_1811_2509 231
3922 3300047323 Ga0495683_0027703 Ga0495683_0027703_405_1103 231
3923 3300047323 Ga0495683_0032458 Ga0495683_0032458_428_1123 231
3924 3300047323 Ga0495683_0041185 Ga0495683_0041185_327_1022 231
3925 3300047323 Ga0495683_0095300 Ga0495683_0095300_182_880 231
3926 3300047323 Ga0495683_0137259 Ga0495683_0137259_402_1100 231
3927 3300047443 Ga0495687_000370 Ga0495687_000370_1885_2580 231
3928 3300047443 Ga0495687_004642 Ga0495687_004642_1823_2518 231
3929 3300047443 Ga0495687_007822 Ga0495687_007822_3621_4316 231
3930 3300047443 Ga0495687_014326 Ga0495687_014326_2051_2746 231
3931 3300047443 Ga0495687_014570 Ga0495687_014570_1615_2325 231
3932 3300047443 Ga0495687_018540 Ga0495687_018540_2189_2884 231
3933 3300047443 Ga0495687_023948 Ga0495687_023948_389_1087 231
3934 3300047443 Ga0495687_024856 Ga0495687_024856_142_837 231
3935 3300047443 Ga0495687_027249 Ga0495687_027249_1026_1721 231
3936 3300047443 Ga0495687_033356 Ga0495687_033356_1439_2134 231
3937 3300047443 Ga0495687_060018 Ga0495687_060018_584_1282 231
3938 3300047443 Ga0495687_076261 Ga0495687_076261_288_983 231
3939 3300047444 Ga0495675_0000381 Ga0495675_0000381_492_1205 231
3940 3300047444 Ga0495675_0016828 Ga0495675_0016828_2666_3364 231
3941 3300047444 Ga0495675_0027749 Ga0495675_0027749_1093_1791 231
3942 3300047444 Ga0495675_0040028 Ga0495675_0040028_1857_2570 231
3943 3300047445 Ga0495677_0006314 Ga0495677_0006314_1773_2468 231
3944 3300047445 Ga0495677_0006510 Ga0495677_0006510_1812_2507 231
3945 3300047445 Ga0495677_0010503 Ga0495677_0010503_2606_3301 231
3946 3300047445 Ga0495677_0016825 Ga0495677_0016825_943_1638 231
3947 3300047445 Ga0495677_0031277 Ga0495677_0031277_428_1123 231
3948 3300047445 Ga0495677_0105601 Ga0495677_0105601_83_778 231
3949 3300047446 Ga0495679_002067 Ga0495679_002067_6031_6726 231
3950 3300047446 Ga0495679_005329 Ga0495679_005329_1896_2594 231
3951 3300047446 Ga0495679_005684 Ga0495679_005684_73_771 231
3952 3300047446 Ga0495679_006772 Ga0495679_006772_2338_3036 231
3953 3300047446 Ga0495679_008823 Ga0495679_008823_402_1097 231
3954 3300047447 Ga0495685_001143 Ga0495685_001143_1312_2007 231
3955 3300047447 Ga0495685_008666 Ga0495685_008666_2189_2884 231
3956 3300047447 Ga0495685_011186 Ga0495685_011186_588_1283 231
3957 3300047447 Ga0495685_079285 Ga0495685_079285_351_1055 231
3958 3300047469 Ga0495673_0000185 Ga0495673_0000185_6249_6944 231
3959 3300047469 Ga0495673_0000338 Ga0495673_0000338_56508_57206 231
3960 3300047469 Ga0495673_0002607 Ga0495673_0002607_2408_3103 231
3961 3300047469 Ga0495673_0019890 Ga0495673_0019890_1369_2067 231
3962 3300047469 Ga0495673_0027453 Ga0495673_0027453_1839_2534 231
3963 3300047469 Ga0495673_0040685 Ga0495673_0040685_1095_1790 231
3964 3300047470 Ga0495681_0027050 Ga0495681_0027050_975_1670 231
3965 3300047470 Ga0495681_0030651 Ga0495681_0030651_409_1104 231
3966 3300047470 Ga0495681_0031178 Ga0495681_0031178_1506_2204 231
3967 3300047470 Ga0495681_0089324 Ga0495681_0089324_51_752 231
3968 3300047470 Ga0495681_0152050 Ga0495681_0152050_89_799 231
3969 3300047470 Ga0495681_0165249 Ga0495681_0165249_25_720 231
3970 3300047471 Ga0495684_0095557 Ga0495684_0095557_329_1027 231
3971 3300047471 Ga0495684_0176834 Ga0495684_0176834_532_1269 231
3972 3300047472 Ga0495686_0005000 Ga0495686_0005000_8009_8704 231
3973 3300047472 Ga0495686_0013056 Ga0495686_0013056_1926_2636 231
3974 3300047472 Ga0495686_0035426 Ga0495686_0035426_1538_2233 231
3975 3300047472 Ga0495686_0041880 Ga0495686_0041880_1986_2681 231
3976 3300047472 Ga0495686_0041982 Ga0495686_0041982_302_997 231
3977 3300047673 Ga0495593_0015440 Ga0495593_0015440_462_1160 231
3978 3300047673 Ga0495593_0016602 Ga0495593_0016602_1624_2322 231
3979 3300047673 Ga0495593_0027458 Ga0495593_0027458_858_1556 231
3980 3300047673 Ga0495593_0032681 Ga0495593_0032681_1440_2150 231
3981 3300047673 Ga0495593_0043547 Ga0495593_0043547_1250_1963 231
3982 3300047673 Ga0495593_0061774 Ga0495593_0061774_564_1262 231
3983 3300047673 Ga0495593_0099747 Ga0495593_0099747_494_1189 231
3984 3300048088 Ga0495602_0045589 Ga0495602_0045589_2895_3593 231
3985 3300048088 Ga0495602_0053905 Ga0495602_0053905_964_1662 231
3986 3300048088 Ga0495602_0058801 Ga0495602_0058801_2297_3004 231
3987 3300048088 Ga0495602_0072298 Ga0495602_0072298_405_1103 231
3988 3300048088 Ga0495602_0121132 Ga0495602_0121132_944_1642 231
3989 3300048089 Ga0495614_0022910 Ga0495614_0022910_1593_2291 231
3990 3300048089 Ga0495614_0097232 Ga0495614_0097232_501_1199 231
3991 3300048089 Ga0495614_0140874 Ga0495614_0140874_203_901 231
3992 3300048090 Ga0495615_0009603 Ga0495615_0009603_254_949 231
3993 3300048091 Ga0495626_0003909 Ga0495626_0003909_1924_2619 231
3994 3300048091 Ga0495626_0010744 Ga0495626_0010744_3224_3919 231
3995 3300048091 Ga0495626_0011243 Ga0495626_0011243_171_866 231
3996 3300048091 Ga0495626_0012906 Ga0495626_0012906_1974_2684 231
3997 3300048091 Ga0495626_0016437 Ga0495626_0016437_2077_2775 231
3998 3300048091 Ga0495626_0018386 Ga0495626_0018386_1006_1707 231
3999 3300048091 Ga0495626_0025216 Ga0495626_0025216_128_823 231
4000 3300048091 Ga0495626_0136430 Ga0495626_0136430_67_762 231
4001 3300048091 Ga0495626_0147376 Ga0495626_0147376_249_947 231
4002 3300048903 Ga0496100_0036717 Ga0496100_0036717_470_1168 231
4003 3300048903 Ga0496100_0141653 Ga0496100_0141653_702_1433 231
4004 3300048903 Ga0496100_0198603 Ga0496100_0198603_401_1096 231
4005 3300048903 Ga0496100_0271806 Ga0496100_0271806_502_1200 231
4006 3300048904 Ga0496101_0026210 Ga0496101_0026210_1536_2234 231
4007 3300048904 Ga0496101_0098087 Ga0496101_0098087_568_1263 231
4008 3300048905 Ga0496102_0022040 Ga0496102_0022040_3135_3833 231
4009 3300048905 Ga0496102_0022350 Ga0496102_0022350_1816_2514 231
4010 3300048905 Ga0496102_0025358 Ga0496102_0025358_4061_4756 231
4011 3300048905 Ga0496102_0036709 Ga0496102_0036709_2168_2872 231
4012 3300048905 Ga0496102_0068828 Ga0496102_0068828_476_1171 231
4013 3300048905 Ga0496102_0123498 Ga0496102_0123498_513_1211 231
4014 3300048905 Ga0496102_0145376 Ga0496102_0145376_978_1709 231
4015 3300048905 Ga0496102_0604783 Ga0496102_0604783_99_797 231
4016 3300048906 Ga0496103_0020863 Ga0496103_0020863_1423_2121 231
4017 3300048906 Ga0496103_0024738 Ga0496103_0024738_857_1552 231
4018 3300048906 Ga0496103_0038048 Ga0496103_0038048_1550_2248 231
4019 3300048906 Ga0496103_0056865 Ga0496103_0056865_470_1168 231
4020 3300048906 Ga0496103_0231519 Ga0496103_0231519_292_987 231
4021 3300048906 Ga0496103_0257027 Ga0496103_0257027_160_858 231
4022 3300048907 Ga0496104_0049965 Ga0496104_0049965_1522_2253 231
4023 3300048907 Ga0496104_0077952 Ga0496104_0077952_1233_1931 231
4024 3300048907 Ga0496104_0087748 Ga0496104_0087748_1960_2688 231
4025 3300048907 Ga0496104_0392711 Ga0496104_0392711_35_733 231
4026 3300048907 Ga0496104_0527948 Ga0496104_0527948_160_858 231
4027 3300048909 Ga0496106_0003262 Ga0496106_0003262_2868_3569 231
4028 3300048909 Ga0496106_0017852 Ga0496106_0017852_2748_3446 231
4029 3300048909 Ga0496106_0056405 Ga0496106_0056405_1633_2331 231
4030 3300048909 Ga0496106_0141518 Ga0496106_0141518_475_1206 231
4031 3300048909 Ga0496106_0269798 Ga0496106_0269798_576_1271 231
4032 3300048910 Ga0496107_0030232 Ga0496107_0030232_2797_3528 231
4033 3300048910 Ga0496107_0047964 Ga0496107_0047964_1862_2557 231
4034 3300048910 Ga0496107_0222776 Ga0496107_0222776_147_842 231
4035 3300048910 Ga0496107_0487539 Ga0496107_0487539_60_755 231
4036 3300048911 Ga0496108_0052115 Ga0496108_0052115_1794_2525 231
4037 3300048911 Ga0496108_0143804 Ga0496108_0143804_130_861 231
4038 3300048912 Ga0496109_0161087 Ga0496109_0161087_675_1370 231
4039 3300048912 Ga0496109_0541334 Ga0496109_0541334_110_841 231
4040 3300048912 Ga0496109_0642102 Ga0496109_0642102_169_906 231
4041 3300048913 Ga0496110_0316521 Ga0496110_0316521_279_1010 231
4042 3300048913 Ga0496110_0889679 Ga0496110_0889679_89_784 231
4043 3300048914 Ga0496111_0063099 Ga0496111_0063099_590_1321 231
4044 3300048914 Ga0496111_0154032 Ga0496111_0154032_755_1453 231
4045 3300048915 Ga0496112_0059935 Ga0496112_0059935_1596_2294 231
4046 3300048915 Ga0496112_0934315 Ga0496112_0934315_53_751 231
4047 3300048916 Ga0496113_0027320 Ga0496113_0027320_1819_2517 231
4048 3300048916 Ga0496113_0035860 Ga0496113_0035860_1252_1950 231
4049 3300048916 Ga0496113_0066079 Ga0496113_0066079_1700_2431 231
4050 3300048916 Ga0496113_0209784 Ga0496113_0209784_391_1086 231
4051 3300048917 Ga0496114_0172129 Ga0496114_0172129_1080_1775 231
4052 3300048917 Ga0496114_0406489 Ga0496114_0406489_266_1003 231
4053 3300048918 Ga0496115_0085501 Ga0496115_0085501_64_762 231
4054 3300048918 Ga0496115_0314979 Ga0496115_0314979_229_924 231
4055 3300048918 Ga0496115_0315466 Ga0496115_0315466_327_1031 231
4056 3300048919 Ga0496116_0010680 Ga0496116_0010680_3361_4056 231
4057 3300048919 Ga0496116_0017705 Ga0496116_0017705_462_1160 231
4058 3300048919 Ga0496116_0045572 Ga0496116_0045572_1494_2192 231
4059 3300048919 Ga0496116_0074748 Ga0496116_0074748_57_752 231
4060 3300048919 Ga0496116_0159026 Ga0496116_0159026_110_805 231
4061 3300048919 Ga0496116_0196626 Ga0496116_0196626_292_993 231
4062 3300048919 Ga0496116_0236458 Ga0496116_0236458_213_911 231
4063 3300048919 Ga0496116_0253181 Ga0496116_0253181_107_808 231
4064 3300048920 Ga0496117_0041990 Ga0496117_0041990_1632_2327 231
4065 3300048920 Ga0496117_0047215 Ga0496117_0047215_295_993 231
4066 3300048920 Ga0496117_0051351 Ga0496117_0051351_1879_2577 231
4067 3300048920 Ga0496117_0057807 Ga0496117_0057807_829_1527 231
4068 3300048920 Ga0496117_0066174 Ga0496117_0066174_1641_2339 231
4069 3300048920 Ga0496117_0098224 Ga0496117_0098224_732_1433 231
4070 3300048920 Ga0496117_0110429 Ga0496117_0110429_680_1378 231
4071 3300048920 Ga0496117_0126613 Ga0496117_0126613_470_1168 231
4072 3300048920 Ga0496117_0178289 Ga0496117_0178289_70_768 231
4073 3300048920 Ga0496117_0280542 Ga0496117_0280542_40_735 231
4074 3300048921 Ga0496118_0038754 Ga0496118_0038754_1277_1975 231
4075 3300048921 Ga0496118_0045578 Ga0496118_0045578_823_1521 231
4076 3300048921 Ga0496118_0056046 Ga0496118_0056046_794_1492 231
4077 3300048921 Ga0496118_0057908 Ga0496118_0057908_1897_2595 231
4078 3300048921 Ga0496118_0062438 Ga0496118_0062438_375_1073 231
4079 3300048921 Ga0496118_0104986 Ga0496118_0104986_897_1595 231
4080 3300048921 Ga0496118_0167946 Ga0496118_0167946_630_1331 231
4081 3300048921 Ga0496118_0222227 Ga0496118_0222227_245_943 231
4082 3300048922 Ga0496119_0006879 Ga0496119_0006879_1987_2682 231
4083 3300048922 Ga0496119_0016770 Ga0496119_0016770_3019_3720 231
4084 3300048922 Ga0496119_0102285 Ga0496119_0102285_283_981 231
4085 3300048923 Ga0496120_0008280 Ga0496120_0008280_5034_5735 231
4086 3300048923 Ga0496120_0047097 Ga0496120_0047097_19_714 231
4087 3300048923 Ga0496120_0150048 Ga0496120_0150048_337_1032 231
4088 3300048924 Ga0496121_0025394 Ga0496121_0025394_3654_4349 231
4089 3300048924 Ga0496121_0027385 Ga0496121_0027385_4269_4967 231
4090 3300048924 Ga0496121_0036769 Ga0496121_0036769_1823_2521 231
4091 3300048924 Ga0496121_0075787 Ga0496121_0075787_132_833 231
4092 3300048924 Ga0496121_0080977 Ga0496121_0080977_1206_1904 231
4093 3300048924 Ga0496121_0106736 Ga0496121_0106736_1405_2100 231
4094 3300048924 Ga0496121_0107297 Ga0496121_0107297_1151_1855 231
4095 3300048924 Ga0496121_0187641 Ga0496121_0187641_146_844 231
4096 3300048924 Ga0496121_0193136 Ga0496121_0193136_630_1325 231
4097 3300048924 Ga0496121_0454455 Ga0496121_0454455_39_734 231
4098 3300048925 Ga0496122_0002979 Ga0496122_0002979_1503_2204 231
4099 3300048925 Ga0496122_0013788 Ga0496122_0013788_363_1061 231
4100 3300048925 Ga0496122_0018124 Ga0496122_0018124_2053_2748 231
4101 3300048925 Ga0496122_0029575 Ga0496122_0029575_3740_4435 231
4102 3300048925 Ga0496122_0059460 Ga0496122_0059460_301_996 231
4103 3300048925 Ga0496122_0179960 Ga0496122_0179960_199_894 231
4104 3300048925 Ga0496122_0238505 Ga0496122_0238505_238_933 231
4105 3300048925 Ga0496122_0255647 Ga0496122_0255647_224_919 231
4106 3300048926 Ga0496123_0007909 Ga0496123_0007909_1780_2475 231
4107 3300048926 Ga0496123_0013659 Ga0496123_0013659_4073_4768 231
4108 3300048926 Ga0496123_0031651 Ga0496123_0031651_385_1080 231
4109 3300048926 Ga0496123_0048983 Ga0496123_0048983_1917_2615 231
4110 3300048926 Ga0496123_0086762 Ga0496123_0086762_1019_1717 231
4111 3300048926 Ga0496123_0134169 Ga0496123_0134169_323_1024 231
4112 3300048926 Ga0496123_0163309 Ga0496123_0163309_161_856 231
4113 3300048926 Ga0496123_0181132 Ga0496123_0181132_390_1088 231
4114 3300048927 Ga0496124_0000894 Ga0496124_0000894_45630_46325 231
4115 3300048927 Ga0496124_0026194 Ga0496124_0026194_3934_4629 231
4116 3300048927 Ga0496124_0044280 Ga0496124_0044280_1181_1888 231
4117 3300048927 Ga0496124_0047252 Ga0496124_0047252_1692_2390 231
4118 3300048927 Ga0496124_0049152 Ga0496124_0049152_1896_2594 231
4119 3300048927 Ga0496124_0056123 Ga0496124_0056123_377_1072 231
4120 3300048927 Ga0496124_0080717 Ga0496124_0080717_1907_2608 231
4121 3300048927 Ga0496124_0084354 Ga0496124_0084354_1837_2538 231
4122 3300048928 Ga0496125_0003719 Ga0496125_0003719_15649_16350 231
4123 3300048928 Ga0496125_0032226 Ga0496125_0032226_256_951 231
4124 3300048928 Ga0496125_0032425 Ga0496125_0032425_1783_2481 231
4125 3300048928 Ga0496125_0047998 Ga0496125_0047998_1620_2315 231
4126 3300048928 Ga0496125_0057872 Ga0496125_0057872_2108_2803 231
4127 3300048928 Ga0496125_0063503 Ga0496125_0063503_349_1044 231
4128 3300048928 Ga0496125_0064828 Ga0496125_0064828_923_1621 231
4129 3300048928 Ga0496125_0144008 Ga0496125_0144008_879_1577 231
4130 3300048928 Ga0496125_0147835 Ga0496125_0147835_454_1149 231
4131 3300048928 Ga0496125_0392503 Ga0496125_0392503_84_782 231
4132 3300048928 Ga0496125_0430368 Ga0496125_0430368_22_717 231
4133 3300048929 Ga0496126_0016992 Ga0496126_0016992_5160_5858 231
4134 3300048929 Ga0496126_0022180 Ga0496126_0022180_3870_4568 231
4135 3300048929 Ga0496126_0031527 Ga0496126_0031527_2610_3305 231
4136 3300048929 Ga0496126_0062581 Ga0496126_0062581_810_1511 231
4137 3300048929 Ga0496126_0464825 Ga0496126_0464825_174_875 231
4138 3300049127 Ga0501306_000150 Ga0501306_000150_1846_2541 231
4139 3300049127 Ga0501306_000253 Ga0501306_000253_1813_2511 231
4140 3300049127 Ga0501306_000856 Ga0501306_000856_887_1585 231
4141 3300049127 Ga0501306_003789 Ga0501306_003789_316_1011 231
4142 3300049127 Ga0501306_011502 Ga0501306_011502_113_808 231
4143 3300049127 Ga0501306_027135 Ga0501306_027135_106_816 231
4144 3300049128 Ga0501308_000175 Ga0501308_000175_1497_2192 231
4145 3300049128 Ga0501308_000353 Ga0501308_000353_727_1437 231
4146 3300049128 Ga0501308_000398 Ga0501308_000398_304_999 231
4147 3300049128 Ga0501308_000757 Ga0501308_000757_1042_1737 231
4148 3300049128 Ga0501308_002855 Ga0501308_002855_168_878 231
4149 3300049129 Ga0501309_000132 Ga0501309_000132_30_725 231
4150 3300049129 Ga0501309_002460 Ga0501309_002460_1125_1823 231
4151 3300049129 Ga0501309_003159 Ga0501309_003159_535_1230 231
4152 3300049130 Ga0501310_000172 Ga0501310_000172_3607_4317 231
4153 3300049130 Ga0501310_000687 Ga0501310_000687_1721_2419 231
4154 3300049130 Ga0501310_001364 Ga0501310_001364_268_963 231
4155 3300049130 Ga0501310_007107 Ga0501310_007107_388_1083 231
4156 3300049130 Ga0501310_010741 Ga0501310_010741_267_977 231
4157 3300049160 Ga0501304_000078 Ga0501304_000078_1379_2074 231
4158 3300049160 Ga0501304_000372 Ga0501304_000372_90_800 231
4159 3300049161 Ga0501305_000417 Ga0501305_000417_1261_1971 231
4160 3300049161 Ga0501305_002034 Ga0501305_002034_1192_1887 231
4161 3300049161 Ga0501305_002434 Ga0501305_002434_108_803 231
4162 3300049161 Ga0501305_006645 Ga0501305_006645_726_1421 231
4163 3300049161 Ga0501305_019395 Ga0501305_019395_98_808 231
4164 3300049162 Ga0501307_000085 Ga0501307_000085_3327_4037 231
4165 3300049162 Ga0501307_000892 Ga0501307_000892_315_1010 231
4166 3300049162 Ga0501307_000903 Ga0501307_000903_1069_1764 231
4167 3300049162 Ga0501307_001372 Ga0501307_001372_223_921 231
4168 3300049162 Ga0501307_002597 Ga0501307_002597_459_1169 231
4169 3300049162 Ga0501307_023881 Ga0501307_023881_84_779 231
4170 3300049459 Ga0495678_003816 Ga0495678_003816_2098_2793 231
4171 3300049459 Ga0495678_006847 Ga0495678_006847_772_1467 231
4172 3300049459 Ga0495678_006998 Ga0495678_006998_2912_3607 231
4173 3300049459 Ga0495678_019973 Ga0495678_019973_1567_2262 231
4174 3300049459 Ga0495678_020357 Ga0495678_020357_287_982 231
4175 3300049459 Ga0495678_043615 Ga0495678_043615_1007_1702 231
4176 3300049459 Ga0495678_046681 Ga0495678_046681_757_1452 231
4177 3300049459 Ga0495678_088088 Ga0495678_088088_105_800 231
4178 3300049459 Ga0495678_119004 Ga0495678_119004_180_875 231
4179 3300049460 Ga0495682_0009381 Ga0495682_0009381_2342_3037 231
4180 3300049460 Ga0495682_0018830 Ga0495682_0018830_1824_2522 231
4181 3300049460 Ga0495682_0035921 Ga0495682_0035921_176_871 231
4182 3300049520 Ga0501297_008029 Ga0501297_008029_108_818 231
4183 3300049523 Ga0501300_001467 Ga0501300_001467_635_1345 231
4184 3300049527 Ga0501311_000165 Ga0501311_000165_1440_2135 231
4185 3300049527 Ga0501311_000380 Ga0501311_000380_866_1576 231
4186 3300049528 Ga0501312_000192 Ga0501312_000192_1428_2138 231
4187 3300049528 Ga0501312_002197 Ga0501312_002197_1196_1891 231
4188 3300049529 Ga0501313_000484 Ga0501313_000484_679_1389 231
4189 3300049529 Ga0501313_010359 Ga0501313_010359_101_802 231
4190 3300049530 Ga0501314_000031 Ga0501314_000031_1813_2508 231
4191 3300049530 Ga0501314_000322 Ga0501314_000322_1425_2135 231
4192 3300049530 Ga0501314_006096 Ga0501314_006096_47_742 231
4193 3300049530 Ga0501314_006471 Ga0501314_006471_298_993 231
4194 3300049531 Ga0501315_000244 Ga0501315_000244_869_1567 231
4195 3300049531 Ga0501315_000515 Ga0501315_000515_1350_2045 231
4196 3300049531 Ga0501315_000556 Ga0501315_000556_253_948 231
4197 3300049531 Ga0501315_000984 Ga0501315_000984_175_885 231
4198 3300049531 Ga0501315_009750 Ga0501315_009750_327_1022 231
4199 3300049532 Ga0501316_000938 Ga0501316_000938_241_936 231
4200 3300049532 Ga0501316_004242 Ga0501316_004242_449_1144 231
4201 3300049533 Ga0501317_000846 Ga0501317_000846_259_969 231
4202 3300049533 Ga0501317_002378 Ga0501317_002378_823_1518 231
4203 3300049534 Ga0501318_000363 Ga0501318_000363_682_1377 231
4204 3300049534 Ga0501318_001865 Ga0501318_001865_853_1563 231
4205 3300049534 Ga0501318_003900 Ga0501318_003900_598_1308 231
4206 3300049535 Ga0501319_000343 Ga0501319_000343_72_773 231
4207 3300049536 Ga0501320_007529 Ga0501320_007529_17_712 231
4208 3300049536 Ga0501320_020398 Ga0501320_020398_10_708 231
4209 3300049537 Ga0501321_001359 Ga0501321_001359_268_963 231
4210 3300049537 Ga0501321_004187 Ga0501321_004187_605_1300 231
4211 3300049538 Ga0501322_001695 Ga0501322_001695_92_787 231
4212 3300049539 Ga0501323_000940 Ga0501323_000940_434_1132 231
4213 3300049539 Ga0501323_015540 Ga0501323_015540_57_764 231
4214 3300049540 Ga0501324_000146 Ga0501324_000146_1689_2384 231
4215 3300049556 Ga0501340_001965 Ga0501340_001965_402_1100 231
4216 3300049568 Ga0501031_0021734 Ga0501031_0021734_1800_2495 231
4217 3300049568 Ga0501031_0047534 Ga0501031_0047534_283_978 231
4218 3300049568 Ga0501031_0094229 Ga0501031_0094229_369_1064 231
4219 3300049569 Ga0501032_0005990 Ga0501032_0005990_1891_2586 231
4220 3300049569 Ga0501032_0008553 Ga0501032_0008553_5104_5799 231
4221 3300049569 Ga0501032_0135991 Ga0501032_0135991_848_1543 231
4222 3300049570 Ga0501033_0001208 Ga0501033_0001208_22271_22966 231
4223 3300049570 Ga0501033_0049121 Ga0501033_0049121_2055_2759 231
4224 3300049570 Ga0501033_0092691 Ga0501033_0092691_497_1192 231
4225 3300049570 Ga0501033_0102030 Ga0501033_0102030_706_1401 231
4226 3300049570 Ga0501033_0138394 Ga0501033_0138394_458_1153 231
4227 3300049571 Ga0501034_0023139 Ga0501034_0023139_3852_4547 231
4228 3300049571 Ga0501034_0026567 Ga0501034_0026567_1810_2505 231
4229 3300049571 Ga0501034_0034857 Ga0501034_0034857_1911_2606 231
4230 3300049571 Ga0501034_0040683 Ga0501034_0040683_2076_2780 231
4231 3300049571 Ga0501034_0050695 Ga0501034_0050695_3143_3838 231
4232 3300049571 Ga0501034_0187632 Ga0501034_0187632_25_720 231
4233 3300049571 Ga0501034_0312495 Ga0501034_0312495_417_1112 231
4234 3300049571 Ga0501034_0315527 Ga0501034_0315527_148_843 231
4235 3300049571 Ga0501034_0320118 Ga0501034_0320118_232_927 231
4236 3300049571 Ga0501034_0675798 Ga0501034_0675798_42_737 231
4237 3300049572 Ga0501036_0009568 Ga0501036_0009568_3690_4385 231
4238 3300049572 Ga0501036_0271532 Ga0501036_0271532_416_1120 231
4239 3300049573 Ga0501037_0005394 Ga0501037_0005394_1185_1880 231
4240 3300049573 Ga0501037_0029882 Ga0501037_0029882_1935_2630 231
4241 3300049573 Ga0501037_0054640 Ga0501037_0054640_403_1098 231
4242 3300049573 Ga0501037_0339784 Ga0501037_0339784_63_767 231
4243 3300049574 Ga0501038_0010394 Ga0501038_0010394_6722_7417 231
4244 3300049574 Ga0501038_0014781 Ga0501038_0014781_3948_4643 231
4245 3300049574 Ga0501038_0045240 Ga0501038_0045240_1703_2398 231
4246 3300049574 Ga0501038_0372579 Ga0501038_0372579_70_765 231
4247 3300049575 Ga0501039_0002806 Ga0501039_0002806_10422_11117 231
4248 3300049575 Ga0501039_0141088 Ga0501039_0141088_1131_1826 231
4249 3300049575 Ga0501039_0310175 Ga0501039_0310175_484_1179 231
4250 3300049578 Ga0501042_0291432 Ga0501042_0291432_370_1071 231
4251 3300049579 Ga0501043_0000049 Ga0501043_0000049_1982_2692 231
4252 3300049579 Ga0501043_0050918 Ga0501043_0050918_1811_2506 231
4253 3300049579 Ga0501043_0162916 Ga0501043_0162916_818_1522 231
4254 3300049579 Ga0501043_0307099 Ga0501043_0307099_484_1179 231
4255 3300049579 Ga0501043_0308295 Ga0501043_0308295_91_795 231
4256 3300049579 Ga0501043_0398761 Ga0501043_0398761_201_896 231
4257 3300049580 Ga0501046_0000120 Ga0501046_0000120_80412_81122 231
4258 3300049580 Ga0501046_0054211 Ga0501046_0054211_2112_2816 231
4259 3300049580 Ga0501046_0308890 Ga0501046_0308890_152_847 231
4260 3300049581 Ga0501047_0003888 Ga0501047_0003888_11537_12232 231
4261 3300049581 Ga0501047_0022771 Ga0501047_0022771_1982_2692 231
4262 3300049581 Ga0501047_0030277 Ga0501047_0030277_2596_3300 231
4263 3300049582 Ga0501048_0019080 Ga0501048_0019080_1421_2131 231
4264 3300049649 Ga0501198_000098 Ga0501198_000098_1956_2666 231
4265 3300049662 Ga0501222_000123 Ga0501222_000123_14215_14925 231
4266 3300049665 Ga0501227_001669 Ga0501227_001669_3943_4638 231
4267 3300049665 Ga0501227_109528 Ga0501227_109528_18_713 231
4268 3300049669 Ga0501235_032018 Ga0501235_032018_171_881 231
4269 3300049679 Ga0501249_024981 Ga0501249_024981_460_1155 231
4270 3300049704 Ga0501221_001711 Ga0501221_001711_1489_2199 231
4271 3300049742 Ga0501080_0035081 Ga0501080_0035081_1973_2677 231
4272 3300049766 Ga0501269_001393 Ga0501269_001393_1864_2559 231
4273 3300049773 Ga0501276_006502 Ga0501276_006502_107_817 231
4274 3300049775 Ga0501279_001934 Ga0501279_001934_283_978 231
4275 3300049822 Ga0501035_0026283 Ga0501035_0026283_4340_5044 231
4276 3300049822 Ga0501035_0030233 Ga0501035_0030233_3934_4629 231
4277 3300049822 Ga0501035_0032626 Ga0501035_0032626_2080_2784 231
4278 3300049822 Ga0501035_0035964 Ga0501035_0035964_3580_4275 231
4279 3300049822 Ga0501035_0047407 Ga0501035_0047407_1444_2139 231
4280 3300049822 Ga0501035_0053573 Ga0501035_0053573_1127_1822 231
4281 3300049822 Ga0501035_0136817 Ga0501035_0136817_448_1143 231
4282 3300049823 Ga0501044_0003394 Ga0501044_0003394_15392_16087 231
4283 3300049823 Ga0501044_0023361 Ga0501044_0023361_5751_6455 231
4284 3300049823 Ga0501044_0024454 Ga0501044_0024454_1819_2514 231
4285 3300049823 Ga0501044_0036693 Ga0501044_0036693_463_1158 231
4286 3300049823 Ga0501044_0446026 Ga0501044_0446026_200_910 231
4287 3300049824 Ga0501045_0020789 Ga0501045_0020789_2748_3458 231
4288 3300049853 Ga0501226_000391 Ga0501226_000391_1790_2485 231
4289 3300050489 nmdc:mga03683_108417_c1 nmdc:mga03683_108417_c1_406_1116 231
4290 3300050489 nmdc:mga03683_12404_c1 nmdc:mga03683_12404_c1_1839_2549 231
4291 3300050489 nmdc:mga03683_153975_c1 nmdc:mga03683_153975_c1_72_773 231
4292 3300050489 nmdc:mga03683_29512_c1 nmdc:mga03683_29512_c1_915_1613 231
4293 3300050490 nmdc:mga03n38_138718_c1 nmdc:mga03n38_138718_c1_406_1116 231
4294 3300050490 nmdc:mga03n38_39814_c1 nmdc:mga03n38_39814_c1_855_1550 231
4295 3300050490 nmdc:mga03n38_7208_c1 nmdc:mga03n38_7208_c1_837_1535 231
4296 3300050490 nmdc:mga03n38_8620_c1 nmdc:mga03n38_8620_c1_1839_2549 231
4297 3300050491 nmdc:mga00v17_209501_c1 nmdc:mga00v17_209501_c1_212_922 231
4298 3300050491 nmdc:mga00v17_388972_c1 nmdc:mga00v17_388972_c1_178_873 231
4299 3300050491 nmdc:mga00v17_64031_c1 nmdc:mga00v17_64031_c1_586_1281 231
4300 3300050492 nmdc:mga0yw44_149437_c1 nmdc:mga0yw44_149437_c1_662_1357 231
4301 3300050492 nmdc:mga0yw44_473035_c1 nmdc:mga0yw44_473035_c1_21_731 231
4302 3300050492 nmdc:mga0yw44_48117_c1 nmdc:mga0yw44_48117_c1_1585_2295 231
4303 3300050492 nmdc:mga0yw44_8441_c1 nmdc:mga0yw44_8441_c1_4306_5004 231
4304 3300050493 nmdc:mga0k408_164334_c1 nmdc:mga0k408_164334_c1_184_885 231
4305 3300050493 nmdc:mga0k408_17121_c1 nmdc:mga0k408_17121_c1_2402_3109 231
4306 3300050493 nmdc:mga0k408_208321_c1 nmdc:mga0k408_208321_c1_110_820 231
4307 3300050493 nmdc:mga0k408_246629_c1 nmdc:mga0k408_246629_c1_94_801 231
4308 3300050493 nmdc:mga0k408_32661_c1 nmdc:mga0k408_32661_c1_1283_1996 231
4309 3300050493 nmdc:mga0k408_356679_c1 nmdc:mga0k408_356679_c1_130_834 231
4310 3300050493 nmdc:mga0k408_36153_c1 nmdc:mga0k408_36153_c1_498_1208 231
4311 3300050493 nmdc:mga0k408_36436_c1 nmdc:mga0k408_36436_c1_389_1084 231
4312 3300050493 nmdc:mga0k408_39362_c1 nmdc:mga0k408_39362_c1_1928_2638 231
4313 3300050493 nmdc:mga0k408_50095_c1 nmdc:mga0k408_50095_c1_1628_2338 231
4314 3300050493 nmdc:mga0k408_57763_c1 nmdc:mga0k408_57763_c1_1160_1867 231
4315 3300050494 nmdc:mga06z11_123845_c1 nmdc:mga06z11_123845_c1_670_1380 231
4316 3300050494 nmdc:mga06z11_443725_c1 nmdc:mga06z11_443725_c1_18_728 231
4317 3300050495 nmdc:mga04h51_102386_c1 nmdc:mga04h51_102386_c1_272_982 231
4318 3300050495 nmdc:mga04h51_26754_c1 nmdc:mga04h51_26754_c1_248_946 231
4319 3300050496 nmdc:mga07m45_101062_c1 nmdc:mga07m45_101062_c1_668_1366 231
4320 3300050496 nmdc:mga07m45_10461_c1 nmdc:mga07m45_10461_c1_2054_2764 231
4321 3300050496 nmdc:mga07m45_19594_c1 nmdc:mga07m45_19594_c1_461_1162 231
4322 3300050496 nmdc:mga07m45_22363_c1 nmdc:mga07m45_22363_c1_1723_2433 231
4323 3300050496 nmdc:mga07m45_237046_c1 nmdc:mga07m45_237046_c1_258_965 231
4324 3300050496 nmdc:mga07m45_28088_c1 nmdc:mga07m45_28088_c1_1026_1733 231
4325 3300050496 nmdc:mga07m45_3600_c1 nmdc:mga07m45_3600_c1_3247_3957 231
4326 3300050496 nmdc:mga07m45_5926_c1 nmdc:mga07m45_5926_c1_3419_4114 231
4327 3300050496 nmdc:mga07m45_6587_c1 nmdc:mga07m45_6587_c1_1892_2602 231
4328 3300050496 nmdc:mga07m45_7669_c1 nmdc:mga07m45_7669_c1_2736_3434 231
4329 3300050507 nmdc:mga05p37_547061_c1 nmdc:mga05p37_547061_c1_248_943 231
4330 3300050509 nmdc:mga0qj67_163109_c1 nmdc:mga0qj67_163109_c1_13_708 231
4331 3300050509 nmdc:mga0qj67_51910_c1 nmdc:mga0qj67_51910_c1_1745_2440 231
4332 3300050510 nmdc:mga06r32_111253_c1 nmdc:mga06r32_111253_c1_1480_2175 231
4333 3300050510 nmdc:mga06r32_196088_c1 nmdc:mga06r32_196088_c1_695_1390 231
4334 3300050510 nmdc:mga06r32_555607_c1 nmdc:mga06r32_555607_c1_230_925 231
4335 3300050511 nmdc:mga08y16_102572_c1 nmdc:mga08y16_102572_c1_1834_2529 231
4336 3300050511 nmdc:mga08y16_271837_c1 nmdc:mga08y16_271837_c1_184_879 231
4337 3300050511 nmdc:mga08y16_412990_c1 nmdc:mga08y16_412990_c1_524_1261 231
4338 3300050512 nmdc:mga0n895_295721_c1 nmdc:mga0n895_295721_c1_115_828 231
4339 3300050512 nmdc:mga0n895_359498_c1 nmdc:mga0n895_359498_c1_377_1108 231
4340 3300050516 nmdc:mga0sz30_141896_c1 nmdc:mga0sz30_141896_c1_57_767 231
4341 3300050516 nmdc:mga0sz30_163755_c1 nmdc:mga0sz30_163755_c1_256_975 231
4342 3300050516 nmdc:mga0sz30_7083_c1 nmdc:mga0sz30_7083_c1_1444_2154 231
4343 3300053077 Ga0495601_0108510 Ga0495601_0108510_567_1304 231
4344 3300053084 Ga0495595_0008781 Ga0495595_0008781_1803_2516 231
4345 3300053085 Ga0495619_0445007 Ga0495619_0445007_125_835 231
4346 3300053086 Ga0500578_0027920 Ga0500578_0027920_1916_2626 231
4347 3300053092 Ga0500583_0020251 Ga0500583_0020251_1243_1944 231
4348 3300053093 Ga0500651_0005311 Ga0500651_0005311_2065_2775 231
4349 3300053093 Ga0500651_0040140 Ga0500651_0040140_1240_1935 231
4350 3300053116 Ga0500592_004051 Ga0500592_004051_591_1289 231
4351 3300053118 Ga0500594_0002841 Ga0500594_0002841_1634_2329 231
4352 3300053118 Ga0500594_0004592 Ga0500594_0004592_2163_2861 231
4353 3300053124 Ga0500617_016862 Ga0500617_016862_305_1003 231
4354 3300053125 Ga0500618_004294 Ga0500618_004294_2034_2732 231
4355 3300053130 Ga0500642_0107327 Ga0500642_0107327_207_905 231
4356 3300053131 Ga0500652_001479 Ga0500652_001479_1929_2639 231
4357 3300053134 Ga0500658_0020285 Ga0500658_0020285_1531_2229 231
4358 3300053135 Ga0500659_0029531 Ga0500659_0029531_537_1232 231
4359 3300053136 Ga0500559_0001032 Ga0500559_0001032_1936_2646 231
4360 3300053136 Ga0500559_0019299 Ga0500559_0019299_2009_2707 231
4361 3300053145 Ga0500586_009344 Ga0500586_009344_1895_2590 231
4362 3300053146 Ga0500588_0002151 Ga0500588_0002151_2992_3690 231
4363 3300053149 Ga0500600_0037485 Ga0500600_0037485_22_732 231
4364 3300053151 Ga0500604_0061730 Ga0500604_0061730_311_1021 231
4365 3300053153 Ga0500616_0013250 Ga0500616_0013250_2190_2888 231
4366 3300053156 Ga0500622_0003393 Ga0500622_0003393_7988_8695 231
4367 3300053156 Ga0500622_0006410 Ga0500622_0006410_4182_4892 231
4368 3300053156 Ga0500622_0014639 Ga0500622_0014639_876_1586 231
4369 3300053158 Ga0500627_0050446 Ga0500627_0050446_920_1618 231
4370 3300053158 Ga0500627_0122427 Ga0500627_0122427_447_1157 231
4371 3300053160 Ga0500633_0030189 Ga0500633_0030189_999_1709 231
4372 3300053161 Ga0500634_0045572 Ga0500634_0045572_58_756 231
4373 3300053177 Ga0500636_0070815 Ga0500636_0070815_313_1008 231
4374 3300053730 Ga0500645_004722 Ga0500645_004722_1931_2641 231
4375 3300053730 Ga0500645_039202 Ga0500645_039202_389_1099 231
4376 3300059477 Ga0587084_002879 Ga0587084_002879_340_1035 231
4377 3300059478 Ga0587093_007947 Ga0587093_007947_93_788 231
4378 3300059478 Ga0587093_015006 Ga0587093_015006_125_832 231
4379 3300059490 Ga0587066_010093 Ga0587066_010093_187_882 231
4380 3300059491 Ga0587070_001377 Ga0587070_001377_97_792 231
4381 3300059491 Ga0587070_012783 Ga0587070_012783_121_819 231
4382 3300059491 Ga0587070_052789 Ga0587070_052789_97_792 231
4383 3300059492 Ga0587073_0002616 Ga0587073_0002616_151_846 231
4384 3300059493 Ga0587077_000807 Ga0587077_000807_987_1694 231
4385 3300059493 Ga0587077_003827 Ga0587077_003827_1047_1742 231
4386 3300059493 Ga0587077_004297 Ga0587077_004297_710_1441 231
4387 3300059493 Ga0587077_009688 Ga0587077_009688_473_1168 231
4388 3300059493 Ga0587077_013862 Ga0587077_013862_417_1112 231
4389 3300059493 Ga0587077_028871 Ga0587077_028871_199_897 231
4390 3300059493 Ga0587077_046446 Ga0587077_046446_108_803 231
4391 3300059503 Ga0587080_004622 Ga0587080_004622_90_785 231
4392 3300059503 Ga0587080_005825 Ga0587080_005825_922_1623 231
4393 3300059503 Ga0587080_011247 Ga0587080_011247_473_1168 231
4394 3300059504 Ga0587082_000814 Ga0587082_000814_244_939 231
4395 3300059504 Ga0587082_001355 Ga0587082_001355_556_1254 231
4396 3300059504 Ga0587082_002029 Ga0587082_002029_61_756 231
4397 3300059504 Ga0587082_019793 Ga0587082_019793_314_1009 231
4398 3300059505 Ga0587083_0004307 Ga0587083_0004307_1179_1877 231
4399 3300059505 Ga0587083_0004898 Ga0587083_0004898_110_805 231
4400 3300059505 Ga0587083_0024176 Ga0587083_0024176_270_965 231
4401 3300059508 Ga0587088_001211 Ga0587088_001211_408_1103 231
4402 3300059508 Ga0587088_001458 Ga0587088_001458_388_1083 231
4403 3300059509 Ga0587089_011624 Ga0587089_011624_294_989 231
4404 3300059510 Ga0587090_001097 Ga0587090_001097_1459_2157 231
4405 3300059510 Ga0587090_002031 Ga0587090_002031_240_935 231
4406 3300059510 Ga0587090_006081 Ga0587090_006081_498_1196 231
4407 3300059511 Ga0587091_014264 Ga0587091_014264_484_1179 231
4408 3300059511 Ga0587091_040963 Ga0587091_040963_106_801 231
4409 3300059514 Ga0587095_000498 Ga0587095_000498_105_800 231
4410 3300059514 Ga0587095_003751 Ga0587095_003751_126_821 231
4411 3300059605 Ga0587106_004584 Ga0587106_004584_283_981 231
4412 3300059605 Ga0587106_010952 Ga0587106_010952_84_779 231
4413 3300059607 Ga0587125_000703 Ga0587125_000703_246_941 231
4414 3300059607 Ga0587125_005831 Ga0587125_005831_319_1014 231
4415 3300059608 Ga0587129_000218 Ga0587129_000218_1393_2088 231
4416 3300059622 Ga0587099_000546 Ga0587099_000546_1242_1937 231
4417 3300059623 Ga0587101_000225 Ga0587101_000225_1387_2082 231
4418 3300059623 Ga0587101_000524 Ga0587101_000524_203_898 231
4419 3300059624 Ga0587109_002097 Ga0587109_002097_711_1406 231
4420 3300059624 Ga0587109_006463 Ga0587109_006463_205_900 231
4421 3300059626 Ga0587115_001636 Ga0587115_001636_172_867 231
4422 3300059627 Ga0587117_022001 Ga0587117_022001_30_725 231
4423 3300059630 Ga0587128_000783 Ga0587128_000783_1383_2081 231
4424 3300059630 Ga0587128_015607 Ga0587128_015607_264_959 231
4425 3300059639 Ga0587062_000594 Ga0587062_000594_929_1624 231
4426 3300059639 Ga0587062_000622 Ga0587062_000622_801_1496 231
4427 3300059639 Ga0587062_014842 Ga0587062_014842_142_837 231
4428 3300059640 Ga0587067_000326 Ga0587067_000326_2944_3639 231
4429 3300059640 Ga0587067_012491 Ga0587067_012491_341_1045 231
4430 3300059641 Ga0587068_000021 Ga0587068_000021_420_1115 231
4431 3300059641 Ga0587068_001485 Ga0587068_001485_1145_1840 231
4432 3300059641 Ga0587068_005435 Ga0587068_005435_107_805 231
4433 3300059641 Ga0587068_009144 Ga0587068_009144_419_1114 231
4434 3300059641 Ga0587068_010320 Ga0587068_010320_226_924 231
4435 3300059641 Ga0587068_011420 Ga0587068_011420_238_933 231
4436 3300059641 Ga0587068_013653 Ga0587068_013653_480_1175 231
4437 3300059641 Ga0587068_031883 Ga0587068_031883_45_743 231
4438 3300059642 Ga0587069_000438 Ga0587069_000438_929_1624 231
4439 3300059642 Ga0587069_000921 Ga0587069_000921_1392_2087 231
4440 3300059642 Ga0587069_024149 Ga0587069_024149_57_758 231
4441 3300059643 Ga0587072_000838 Ga0587072_000838_1350_2048 231
4442 3300059644 Ga0587075_016214 Ga0587075_016214_120_815 231
4443 3300059644 Ga0587075_017486 Ga0587075_017486_90_785 231
4444 3300059645 Ga0587076_000769 Ga0587076_000769_1788_2483 231
4445 3300059645 Ga0587076_001775 Ga0587076_001775_268_963 231
4446 3300059645 Ga0587076_003423 Ga0587076_003423_1011_1706 231
4447 3300059645 Ga0587076_006767 Ga0587076_006767_92_787 231
4448 3300059645 Ga0587076_021259 Ga0587076_021259_162_860 231
4449 3300059646 Ga0587078_000345 Ga0587078_000345_1170_1865 231
4450 3300059646 Ga0587078_003722 Ga0587078_003722_88_783 231
4451 3300059647 Ga0587079_000007 Ga0587079_000007_801_1496 231
4452 3300059647 Ga0587079_000436 Ga0587079_000436_1761_2456 231
4453 3300059647 Ga0587079_001317 Ga0587079_001317_1599_2294 231
4454 3300059647 Ga0587079_025314 Ga0587079_025314_85_780 231
4455 3300059649 Ga0587102_000233 Ga0587102_000233_611_1306 231
4456 3300059649 Ga0587102_002470 Ga0587102_002470_264_959 231
4457 3300059649 Ga0587102_015863 Ga0587102_015863_94_789 231
4458 3300059650 Ga0587104_000385 Ga0587104_000385_274_969 231
4459 3300059651 Ga0587105_000154 Ga0587105_000154_1470_2165 231
4460 3300059651 Ga0587105_000319 Ga0587105_000319_115_810 231
4461 3300059652 Ga0587107_000129 Ga0587107_000129_1778_2473 231
4462 3300059653 Ga0587108_000129 Ga0587108_000129_1004_1702 231
4463 3300059653 Ga0587108_000215 Ga0587108_000215_1671_2366 231
4464 3300059660 Ga0587124_000554 Ga0587124_000554_912_1673 231
4465 3300060247 Ga0587096_00059 Ga0587096_00059_71_766 231
4466 3300060344 Ga0587071_000779 Ga0587071_000779_1860_2555 231
4467 3300060344 Ga0587071_001459 Ga0587071_001459_1036_1734 231
4468 3300060344 Ga0587071_053619 Ga0587071_053619_41_739 231
4469 3300060346 Ga0587111_0001912 Ga0587111_0001912_816_1511 231
4470 3300060346 Ga0587111_0022929 Ga0587111_0022929_114_809 231
4471 3300060346 Ga0587111_0038873 Ga0587111_0038873_98_802 231
4472 3300060346 Ga0587111_0042323 Ga0587111_0042323_78_776 231
4473 3300061719 Ga0466962_0013638 Ga0466962_0013638_1827_2528 231
4474 3300061719 Ga0466962_0016604 Ga0466962_0016604_1600_2301 231
4475 3300061719 Ga0466962_0177699 Ga0466962_0177699_114_821 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

29

218

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.9599 19 227
4v9h-assembly1.cif.gz_BC crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state 0.9521 5 225
4v8y-assembly1.cif.gz_CL cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex 0.9517 5 225
7p7t-assembly1.cif.gz_F poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.9485 3 227
4v7f-assembly1.cif.gz_A arx1 pre-60s particle. 0.948 35 225
ID Description Score Start End Superfamily
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9755 73 159 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9725 16 225 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9647 73 159 3.40.50.790
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9636 19 229 3.30.190.20
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9503 16 225 3.30.190.20
ID Description Score Start End GO Terms
AF-Q4K523-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.9984 1 231 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-Q4ZMN4-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.9977 1 231 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A0N0LB29-F1-model_v4 Large ribosomal subunit protein uL1 0.9968 1 231 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625
AF-A0A0X8BTE2-F1-model_v4 deleted 0.9968 1 231
AF-Q9HWC6-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.9966 1 231 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
91.23 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map