F496475

General Info

Members Datasets Scaffolds Average Seq Length
2153 654 2153 89

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10399621|Ga0157372_103996212
Length 100
Sequence MAHKKAGGSSRNGRDSEAKRLGVKVYGGEAIRAGGIIVRQRGTRIHAGRNVGLGKDHTLFALVDGTVSFGIKGAQQHKYANVEPQGDLVAAASSSVQPAA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
31 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
34 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
35 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
36 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
37 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
43 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
82 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
83 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
132 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
133 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
134 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
135 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
136 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
139 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
140 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
141 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
142 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
143 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
144 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
145 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
150 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
151 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
152 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
153 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
154 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
155 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
157 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
158 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
160 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
161 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
162 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
163 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
164 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
165 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
166 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
167 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
168 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
169 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
170 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
171 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
172 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
173 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
174 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
175 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
176 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
177 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
178 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
179 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
180 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
181 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
182 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
183 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
184 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
185 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
186 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
187 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
188 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
189 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
190 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
191 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
192 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
193 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
194 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
195 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
196 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
197 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
198 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
199 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
200 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
201 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
202 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
203 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
207 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
209 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
210 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
211 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
212 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
215 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
218 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
306 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
308 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
312 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
313 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
314 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
315 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
317 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
318 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
319 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
320 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
321 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
322 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
323 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
324 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
325 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
326 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
327 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
328 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
329 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
330 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
331 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
332 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
333 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
334 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
335 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
336 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
337 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
338 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
339 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
340 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
341 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
342 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
343 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
344 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
351 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
352 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
353 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
354 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
355 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
356 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
357 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
358 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
359 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
360 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
361 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
362 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
363 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
364 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
365 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
366 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
367 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
368 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
369 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
370 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
371 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
372 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
373 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
374 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
375 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
376 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
377 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
378 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
379 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
380 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
381 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
382 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
383 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
384 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
385 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
386 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
387 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
388 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
389 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
390 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
391 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
394 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
395 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
396 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
397 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
398 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
399 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
400 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
401 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
402 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
403 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
404 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
405 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
406 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
407 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
408 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
409 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
410 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
411 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
412 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
413 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
414 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
415 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
416 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
417 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
418 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
419 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
420 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
421 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
422 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
423 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
424 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
425 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
426 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
427 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
428 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
429 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
430 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
431 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
432 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
433 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
434 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
435 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
436 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
437 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
438 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
439 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
440 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
441 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
442 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
443 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
444 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
445 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
448 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
449 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
450 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
451 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
452 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
453 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
454 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
455 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
456 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
457 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
458 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
459 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
460 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
461 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
462 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
463 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
464 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
465 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
466 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
467 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
468 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
469 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
470 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
471 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
472 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
473 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
474 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
475 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
476 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
477 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
478 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
479 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
480 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
481 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
482 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
483 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
484 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
485 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
486 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
487 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
488 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
489 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
490 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
491 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
492 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
493 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
494 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
495 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
496 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
497 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
498 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
499 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
500 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
501 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
502 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
503 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
504 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
505 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
506 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
507 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
508 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
509 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
510 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
511 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
512 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
513 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
514 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
515 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
516 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
517 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
518 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
519 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
520 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
521 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
522 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
523 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
524 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
525 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
526 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
527 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
528 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
529 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
530 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
531 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
532 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
533 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
534 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
535 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
536 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
537 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
538 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
539 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
540 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
541 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
542 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
543 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
544 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
545 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
546 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
547 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
548 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
549 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
550 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
551 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
552 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
553 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
554 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
555 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
556 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
557 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
558 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
559 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
560 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
561 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
564 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
565 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
566 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
567 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
568 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
571 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
576 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
577 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
582 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
583 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
584 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
585 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
586 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
587 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
588 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
589 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
590 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
591 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
592 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
594 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
595 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
596 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
597 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
598 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
599 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
600 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
601 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
602 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
603 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
604 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
605 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
606 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
607 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
608 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
609 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
610 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
611 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
612 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
613 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
614 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
615 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
616 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
617 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
618 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
619 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
620 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
621 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
622 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
623 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
624 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
625 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
626 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
627 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
628 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
629 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
630 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
631 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
643 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
653 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
654 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 4.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 5.02
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_176 2124908027 Bacteria 17736
2 SwRhRL2b_contig_3591334 2162886007 Bacteria 1346
3 2214828539 2209111006 Bacteria 9335
4 2214860512 2209111006 Bacteria 603
5 ARSoilYngRDRAFT_c00047 3300000042 Bacteria 19344
6 ARcpr5yngRDRAFT_c000047 3300000043 Bacteria 19138
7 ARSoilOldRDRAFT_c000056 3300000044 Bacteria 23604
8 ARCol0oldRDRAFT_c00903 3300000045 Bacteria 2336
9 ARCol0yngRDRAFT_1000188 3300000652 Bacteria 10468
10 JGI24741J21665_1013392 3300001915 Bacteria 1392
11 JGI24752J21851_1005681 3300001976 Bacteria 1628
12 JGI24746J21847_1001650 3300001977 Bacteria 3577
13 JGI24747J21853_1003522 3300001978 Bacteria 1358
14 JGI24739J22299_10002198 3300001989 Bacteria 7496
15 JGI24739J22299_10076955 3300001989 Bacteria 1029
16 JGI24739J22299_10159588 3300001989 Unclassified 666
17 JGI24739J22299_10243682 3300001989 Bacteria 526
18 JGI24737J22298_10020399 3300001990 Bacteria 2116
19 JGI24750J21931_1000565 3300002070 Bacteria 5662
20 JGI24750J21931_1058269 3300002070 Bacteria 614
21 JGI24745J21846_1002000 3300002073 Bacteria 2037
22 JGI24748J21848_1000820 3300002074 Bacteria 3367
23 JGI24748J21848_1024778 3300002074 Bacteria 731
24 JGI24738J21930_10000068 3300002075 Bacteria 21789
25 JGI24738J21930_10042619 3300002075 Bacteria 922
26 JGI24738J21930_10051603 3300002075 Bacteria 839
27 JGI24749J21850_1002631 3300002076 Bacteria 2517
28 JGI24749J21850_1003369 3300002076 Bacteria 2235
29 JGI24744J21845_10002561 3300002077 Bacteria 3711
30 JGI24035J26624_1000806 3300002126 Bacteria 2947
31 JGI24035J26624_1001611 3300002126 Bacteria 2131
32 JGI24033J26618_1009627 3300002155 Bacteria 1127
33 JGI24034J26672_10003051 3300002239 Bacteria 2322
34 JGI24034J26672_10016234 3300002239 Bacteria 1146
35 JGI24034J26672_10017419 3300002239 Bacteria 1112
36 JGI24742J22300_10000478 3300002244 Bacteria 5961
37 JGI24742J22300_10005731 3300002244 Bacteria 2044
38 JGI24742J22300_10050496 3300002244 Bacteria 752
39 JGI24751J29686_10015828 3300002459 Bacteria 1555
40 JGI25165J46597_1000047 3300003214 Bacteria 254601
41 JGI25165J46597_1000066 3300003214 Bacteria 199459
42 Ga0006758J48902_1019684 3300003300 Bacteria 746
43 rootL2_10033783 3300003322 Bacteria 3058
44 rootH1_10017260 3300003323 Bacteria 5342
45 JGI26128J50194_1008847 3300003347 Unclassified 641
46 JGI26128J50194_1011354 3300003347 Unclassified 560
47 JGI26129J50193_1013618 3300003349 Bacteria 597
48 JGI25160J50197_1000155 3300003354 Bacteria 60424
49 JGI26139J50223_101259 3300003382 Bacteria 767
50 JGI26140J50224_102677 3300003383 Bacteria 648
51 JGI26140J50224_103316 3300003383 Unclassified 596
52 JGI26143J51219_1007187 3300003502 Bacteria 579
53 JGI26141J51220_1001596 3300003503 Bacteria 1371
54 JGI26141J51220_1011422 3300003503 Bacteria 587
55 Ga0007410J51695_1024736 3300003574 Bacteria 757
56 Ga0007409J51694_1020325 3300003575 Bacteria 754
57 Ga0007409J51694_1055017 3300003575 Bacteria 618
58 Ga0058859_10015097 3300004798 Bacteria 954
59 Ga0058859_10072815 3300004798 Bacteria 582
60 Ga0058860_11986261 3300004801 Bacteria 773
61 Ga0058860_12217485 3300004801 Bacteria 1180
62 Ga0065165_1000502 3300005262 Bacteria 60462
63 Ga0065717_1002291 3300005276 Bacteria 2214
64 Ga0065716_1000773 3300005277 Bacteria 750
65 Ga0065714_10003265 3300005288 Bacteria 9100
66 Ga0065714_10494008 3300005288 Bacteria 527
67 Ga0065704_10003559 3300005289 Bacteria 6979
68 Ga0065704_10005640 3300005289 Bacteria 2987
69 Ga0065704_10096858 3300005289 Bacteria 2421
70 Ga0065704_10563289 3300005289 Bacteria 628
71 Ga0065712_10088144 3300005290 Bacteria 2536
72 Ga0065712_10114297 3300005290 Bacteria 1769
73 Ga0065712_10774846 3300005290 Bacteria 516
74 Ga0065715_10007102 3300005293 Bacteria 3167
75 Ga0065715_10226322 3300005293 Bacteria 1251
76 Ga0065715_10286218 3300005293 Bacteria 1074
77 Ga0065707_10353394 3300005295 Bacteria 915
78 Ga0070658_10246966 3300005327 Bacteria 1514
79 Ga0070658_10375888 3300005327 Bacteria 1218
80 Ga0070658_10496049 3300005327 Bacteria 1054
81 Ga0070658_10548482 3300005327 Bacteria 1000
82 Ga0070658_11053169 3300005327 Bacteria 707
83 Ga0070676_10004633 3300005328 Bacteria 7260
84 Ga0070676_10022670 3300005328 Bacteria 3523
85 Ga0070676_10080971 3300005328 Bacteria 1970
86 Ga0070676_10271039 3300005328 Bacteria 1140
87 Ga0070683_100000546 3300005329 Bacteria 26626
88 Ga0070683_100006589 3300005329 Bacteria 9753
89 Ga0070683_100023875 3300005329 Bacteria 5473
90 Ga0070683_100096823 3300005329 Bacteria 2776
91 Ga0070683_100212345 3300005329 Bacteria 1838
92 Ga0070683_100227123 3300005329 Bacteria 1774
93 Ga0070683_101685802 3300005329 Bacteria 609
94 Ga0070690_100147828 3300005330 Bacteria 1600
95 Ga0070690_100152161 3300005330 Bacteria 1579
96 Ga0070690_100547596 3300005330 Bacteria 872
97 Ga0070690_101223728 3300005330 Bacteria 599
98 Ga0070670_100001363 3300005331 Bacteria 19576
99 Ga0070670_100028047 3300005331 Bacteria 4844
100 Ga0070670_100039253 3300005331 Bacteria 4071
101 Ga0070670_100047430 3300005331 Bacteria 3697
102 Ga0070670_100061724 3300005331 Bacteria 3217
103 Ga0070670_100111026 3300005331 Bacteria 2362
104 Ga0070670_100207384 3300005331 Bacteria 1703
105 Ga0070670_100303710 3300005331 Bacteria 1396
106 Ga0070670_100622504 3300005331 Bacteria 967
107 Ga0070670_102139665 3300005331 Bacteria 516
108 Ga0070677_10001970 3300005333 Bacteria 6512
109 Ga0070677_10004240 3300005333 Bacteria 4669
110 Ga0070677_10027068 3300005333 Bacteria 2156
111 Ga0070677_10205605 3300005333 Bacteria 953
112 Ga0070677_10943637 3300005333 Bacteria 501
113 Ga0068869_100002241 3300005334 Bacteria 11635
114 Ga0068869_100072509 3300005334 Bacteria 2551
115 Ga0068869_100206090 3300005334 Bacteria 1553
116 Ga0068869_100508278 3300005334 Bacteria 1007
117 Ga0068869_100828206 3300005334 Bacteria 797
118 Ga0070666_10026328 3300005335 Bacteria 3798
119 Ga0070666_10075172 3300005335 Bacteria 2304
120 Ga0070666_10117381 3300005335 Bacteria 1843
121 Ga0070666_10130096 3300005335 Bacteria 1749
122 Ga0070666_10394255 3300005335 Bacteria 995
123 Ga0070666_10602096 3300005335 Bacteria 802
124 Ga0070680_100008073 3300005336 Bacteria 8040
125 Ga0070680_100011943 3300005336 Bacteria 6738
126 Ga0070680_100244828 3300005336 Bacteria 1516
127 Ga0070680_100822154 3300005336 Bacteria 801
128 Ga0070680_101004365 3300005336 Bacteria 720
129 Ga0070680_101059583 3300005336 Bacteria 701
130 Ga0070682_100048795 3300005337 Bacteria 2637
131 Ga0070682_100248989 3300005337 Bacteria 1280
132 Ga0070682_100539640 3300005337 Bacteria 911
133 Ga0068868_100001840 3300005338 Bacteria 14593
134 Ga0068868_100004204 3300005338 Bacteria 10069
135 Ga0068868_100019657 3300005338 Bacteria 5064
136 Ga0068868_100074651 3300005338 Bacteria 2708
137 Ga0068868_100078617 3300005338 Bacteria 2641
138 Ga0068868_100197230 3300005338 Bacteria 1676
139 Ga0068868_100536020 3300005338 Bacteria 1030
140 Ga0068868_100578477 3300005338 Bacteria 993
141 Ga0068868_100666662 3300005338 Bacteria 928
142 Ga0070660_100018589 3300005339 Bacteria 5081
143 Ga0070660_100087626 3300005339 Bacteria 2450
144 Ga0070660_100157902 3300005339 Bacteria 1826
145 Ga0070660_100164825 3300005339 Bacteria 1787
146 Ga0070660_100172308 3300005339 Bacteria 1748
147 Ga0070660_100744626 3300005339 Bacteria 823
148 Ga0070660_100824681 3300005339 Bacteria 781
149 Ga0070660_100845360 3300005339 Bacteria 771
150 Ga0070689_100025793 3300005340 Bacteria 4418
151 Ga0070689_100064791 3300005340 Bacteria 2845
152 Ga0070691_10202860 3300005341 Bacteria 1042
153 Ga0070691_11093019 3300005341 Bacteria 502
154 Ga0070687_100036398 3300005343 Bacteria 2452
155 Ga0070687_100245934 3300005343 Bacteria 1109
156 Ga0070687_100296192 3300005343 Bacteria 1024
157 Ga0070687_100455451 3300005343 Bacteria 852
158 Ga0070687_101248954 3300005343 Bacteria 550
159 Ga0070661_100003030 3300005344 Bacteria 11559
160 Ga0070661_100005403 3300005344 Bacteria 8809
161 Ga0070661_100032576 3300005344 Bacteria 3772
162 Ga0070661_100104257 3300005344 Bacteria 2112
163 Ga0070661_100115127 3300005344 Bacteria 2010
164 Ga0070661_100337719 3300005344 Bacteria 1179
165 Ga0070661_101926868 3300005344 Bacteria 503
166 Ga0070692_10118639 3300005345 Bacteria 1472
167 Ga0070692_10219291 3300005345 Bacteria 1123
168 Ga0070692_10587146 3300005345 Bacteria 735
169 Ga0070668_100004577 3300005347 Bacteria 10253
170 Ga0070668_100352812 3300005347 Bacteria 1245
171 Ga0070668_100584199 3300005347 Bacteria 975
172 Ga0070668_101375312 3300005347 Bacteria 643
173 Ga0070668_101513650 3300005347 Bacteria 613
174 Ga0070668_101598553 3300005347 Bacteria 597
175 Ga0070669_100024258 3300005353 Bacteria 4348
176 Ga0070669_100154213 3300005353 Bacteria 1780
177 Ga0070669_100430871 3300005353 Bacteria 1084
178 Ga0070669_101135943 3300005353 Bacteria 673
179 Ga0070675_100000177 3300005354 Bacteria 39588
180 Ga0070675_100000441 3300005354 Bacteria 28206
181 Ga0070675_100016364 3300005354 Bacteria 5885
182 Ga0070675_100036674 3300005354 Bacteria 3991
183 Ga0070675_100172552 3300005354 Bacteria 1865
184 Ga0070675_100184402 3300005354 Bacteria 1805
185 Ga0070675_100217408 3300005354 Bacteria 1663
186 Ga0070675_100581128 3300005354 Bacteria 1015
187 Ga0070671_100000840 3300005355 Bacteria 22321
188 Ga0070671_100001551 3300005355 Bacteria 17301
189 Ga0070671_100001556 3300005355 Bacteria 17271
190 Ga0070671_100012431 3300005355 Bacteria 6855
191 Ga0070671_100035953 3300005355 Bacteria 4105
192 Ga0070671_100076018 3300005355 Bacteria 2805
193 Ga0070671_100175400 3300005355 Bacteria 1814
194 Ga0070671_100196358 3300005355 Bacteria 1711
195 Ga0070671_100477239 3300005355 Bacteria 1071
196 Ga0070671_100740267 3300005355 Bacteria 854
197 Ga0070671_102013377 3300005355 Bacteria 514
198 Ga0070674_100002395 3300005356 Bacteria 10360
199 Ga0070674_100009399 3300005356 Bacteria 5853
200 Ga0070674_100012746 3300005356 Bacteria 5172
201 Ga0070674_100064581 3300005356 Bacteria 2566
202 Ga0070674_100297066 3300005356 Bacteria 1286
203 Ga0070673_100002294 3300005364 Bacteria 11614
204 Ga0070673_100003991 3300005364 Bacteria 9285
205 Ga0070673_100006931 3300005364 Bacteria 7413
206 Ga0070673_100079208 3300005364 Bacteria 2659
207 Ga0070673_100081985 3300005364 Bacteria 2617
208 Ga0070673_100235763 3300005364 Bacteria 1589
209 Ga0070673_100931497 3300005364 Bacteria 807
210 Ga0070673_101402383 3300005364 Bacteria 657
211 Ga0070688_100006808 3300005365 Bacteria 6133
212 Ga0070688_100025708 3300005365 Bacteria 3489
213 Ga0070688_100092698 3300005365 Bacteria 1976
214 Ga0070659_100002868 3300005366 Bacteria 12275
215 Ga0070659_100017560 3300005366 Bacteria 5389
216 Ga0070659_100021230 3300005366 Bacteria 4940
217 Ga0070659_100100191 3300005366 Bacteria 2331
218 Ga0070659_100142223 3300005366 Bacteria 1953
219 Ga0070659_100344785 3300005366 Bacteria 1249
220 Ga0070659_100582651 3300005366 Bacteria 960
221 Ga0070667_100028530 3300005367 Bacteria 4647
222 Ga0070667_100037514 3300005367 Bacteria 4063
223 Ga0070667_100072231 3300005367 Bacteria 2940
224 Ga0070667_100161685 3300005367 Bacteria 1973
225 Ga0070667_100464192 3300005367 Bacteria 1158
226 Ga0070667_100685256 3300005367 Bacteria 948
227 Ga0070667_100879519 3300005367 Bacteria 833
228 Ga0070667_101430350 3300005367 Bacteria 649
229 Ga0070667_101867082 3300005367 Bacteria 566
230 Ga0070709_10012396 3300005434 Bacteria 4771
231 Ga0070709_11078116 3300005434 Bacteria 642
232 Ga0070709_11644514 3300005434 Bacteria 523
233 Ga0070709_11745307 3300005434 Bacteria 509
234 Ga0070714_100003798 3300005435 Bacteria 11340
235 Ga0070714_100029453 3300005435 Bacteria 4564
236 Ga0070714_100379171 3300005435 Bacteria 1333
237 Ga0070714_100597416 3300005435 Bacteria 1060
238 Ga0070713_100017742 3300005436 Bacteria 5395
239 Ga0070713_100025030 3300005436 Bacteria 4660
240 Ga0070713_100218537 3300005436 Bacteria 1728
241 Ga0070713_100317342 3300005436 Bacteria 1438
242 Ga0070710_10004585 3300005437 Bacteria 6528
243 Ga0070710_10014117 3300005437 Bacteria 4013
244 Ga0070710_10184838 3300005437 Bacteria 1307
245 Ga0070710_10205217 3300005437 Bacteria 1246
246 Ga0070710_10454254 3300005437 Bacteria 869
247 Ga0070701_10009010 3300005438 Bacteria 4352
248 Ga0070711_100013093 3300005439 Bacteria 5202
249 Ga0070711_100024568 3300005439 Bacteria 3932
250 Ga0070711_100035659 3300005439 Bacteria 3328
251 Ga0070711_100612453 3300005439 Bacteria 909
252 Ga0070711_100709485 3300005439 Bacteria 847
253 Ga0070711_101211873 3300005439 Bacteria 653
254 Ga0070711_102073370 3300005439 Bacteria 501
255 Ga0070705_100052378 3300005440 Bacteria 2384
256 Ga0070705_100145755 3300005440 Bacteria 1564
257 Ga0070705_100194504 3300005440 Bacteria 1385
258 Ga0070705_100349431 3300005440 Bacteria 1078
259 Ga0070705_100505133 3300005440 Bacteria 918
260 Ga0070700_100042710 3300005441 Bacteria 2786
261 Ga0070700_100214809 3300005441 Bacteria 1359
262 Ga0070700_100425305 3300005441 Bacteria 1005
263 Ga0070700_101370247 3300005441 Bacteria 597
264 Ga0070694_100296399 3300005444 Bacteria 1238
265 Ga0070694_100324635 3300005444 Bacteria 1185
266 Ga0070694_101850916 3300005444 Bacteria 515
267 Ga0070708_100322007 3300005445 Bacteria 1456
268 Ga0070708_101705258 3300005445 Bacteria 586
269 Ga0070663_100017102 3300005455 Bacteria 4725
270 Ga0070663_100055519 3300005455 Bacteria 2835
271 Ga0070663_100105068 3300005455 Bacteria 2113
272 Ga0070663_100132302 3300005455 Bacteria 1895
273 Ga0070663_100245419 3300005455 Bacteria 1415
274 Ga0070663_100422486 3300005455 Bacteria 1094
275 Ga0070663_100484607 3300005455 Bacteria 1024
276 Ga0070663_101649007 3300005455 Bacteria 572
277 Ga0070663_101665971 3300005455 Bacteria 570
278 Ga0070678_100000199 3300005456 Bacteria 26434
279 Ga0070678_100000295 3300005456 Bacteria 23095
280 Ga0070678_100001549 3300005456 Bacteria 12287
281 Ga0070678_100032267 3300005456 Bacteria 3623
282 Ga0070678_100282376 3300005456 Bacteria 1404
283 Ga0070678_100801024 3300005456 Bacteria 855
284 Ga0070678_102058050 3300005456 Bacteria 540
285 Ga0070678_102058052 3300005456 Bacteria 540
286 Ga0070662_100004198 3300005457 Bacteria 9077
287 Ga0070662_100040552 3300005457 Bacteria 3316
288 Ga0070662_100053740 3300005457 Bacteria 2917
289 Ga0070662_100086491 3300005457 Bacteria 2345
290 Ga0070662_100129688 3300005457 Bacteria 1942
291 Ga0070662_100277443 3300005457 Bacteria 1355
292 Ga0070662_100293484 3300005457 Bacteria 1319
293 Ga0070662_100295457 3300005457 Bacteria 1314
294 Ga0070662_100476694 3300005457 Bacteria 1038
295 Ga0070662_100518040 3300005457 Bacteria 996
296 Ga0070681_10017107 3300005458 Bacteria 7248
297 Ga0070681_10022099 3300005458 Bacteria 6385
298 Ga0070681_10316431 3300005458 Bacteria 1470
299 Ga0070681_10426324 3300005458 Bacteria 1238
300 Ga0070681_10447038 3300005458 Bacteria 1204
301 Ga0070681_11006947 3300005458 Bacteria 753
302 Ga0068867_100006141 3300005459 Bacteria 8504
303 Ga0068867_100010133 3300005459 Bacteria 6645
304 Ga0068867_100010552 3300005459 Bacteria 6517
305 Ga0068867_100017656 3300005459 Bacteria 5066
306 Ga0068867_100037370 3300005459 Bacteria 3529
307 Ga0068867_101193267 3300005459 Bacteria 699
308 Ga0070685_10001508 3300005466 Bacteria 12273
309 Ga0070685_10012971 3300005466 Bacteria 4388
310 Ga0070685_10070280 3300005466 Bacteria 2072
311 Ga0070685_10080740 3300005466 Bacteria 1949
312 Ga0070706_100229554 3300005467 Bacteria 1733
313 Ga0070706_100239108 3300005467 Bacteria 1695
314 Ga0070707_100114201 3300005468 Bacteria 2620
315 Ga0070707_100429992 3300005468 Bacteria 1281
316 Ga0070698_101756437 3300005471 Bacteria 573
317 Ga0074259_11716343 3300005507 Bacteria 641
318 Ga0070699_100041359 3300005518 Bacteria 3990
319 Ga0070699_100659131 3300005518 Bacteria 956
320 Ga0070699_102002956 3300005518 Bacteria 529
321 Ga0070679_100034451 3300005530 Bacteria 5018
322 Ga0070679_100054841 3300005530 Bacteria 3969
323 Ga0070679_100103467 3300005530 Bacteria 2834
324 Ga0070679_100113996 3300005530 Bacteria 2688
325 Ga0070679_100694621 3300005530 Bacteria 960
326 Ga0070679_101053685 3300005530 Bacteria 758
327 Ga0070679_101075051 3300005530 Bacteria 749
328 Ga0070684_100008219 3300005535 Bacteria 8153
329 Ga0070684_100078073 3300005535 Bacteria 2925
330 Ga0070684_100114904 3300005535 Bacteria 2416
331 Ga0070697_100156186 3300005536 Bacteria 1926
332 Ga0070697_100669475 3300005536 Bacteria 915
333 Ga0068853_100033279 3300005539 Bacteria 4372
334 Ga0068853_100050812 3300005539 Bacteria 3566
335 Ga0068853_100084432 3300005539 Bacteria 2782
336 Ga0068853_100254632 3300005539 Bacteria 1612
337 Ga0068853_100418324 3300005539 Bacteria 1256
338 Ga0068853_100972970 3300005539 Bacteria 816
339 Ga0068853_101440580 3300005539 Bacteria 666
340 Ga0068853_101483536 3300005539 Unclassified 656
341 Ga0070672_100000029 3300005543 Bacteria 63114
342 Ga0070672_100002678 3300005543 Bacteria 11386
343 Ga0070672_100045354 3300005543 Bacteria 3399
344 Ga0070672_100084736 3300005543 Bacteria 2546
345 Ga0070672_100197901 3300005543 Bacteria 1680
346 Ga0070672_100270843 3300005543 Bacteria 1434
347 Ga0070672_100512608 3300005543 Bacteria 1038
348 Ga0070672_100706616 3300005543 Bacteria 883
349 Ga0070672_101002931 3300005543 Bacteria 740
350 Ga0070672_101031835 3300005543 Bacteria 729
351 Ga0070686_100003612 3300005544 Bacteria 8488
352 Ga0070686_100005498 3300005544 Bacteria 7014
353 Ga0070686_100773877 3300005544 Bacteria 772
354 Ga0070695_100194138 3300005545 Bacteria 1447
355 Ga0070695_100428755 3300005545 Bacteria 1008
356 Ga0070695_100824996 3300005545 Bacteria 744
357 Ga0070696_100000754 3300005546 Bacteria 20726
358 Ga0070696_100045926 3300005546 Bacteria 3027
359 Ga0070696_100460079 3300005546 Bacteria 1005
360 Ga0070696_100470026 3300005546 Bacteria 995
361 Ga0070696_100734356 3300005546 Bacteria 807
362 Ga0070693_100025946 3300005547 Bacteria 3157
363 Ga0070693_100049790 3300005547 Bacteria 2392
364 Ga0070693_100088336 3300005547 Bacteria 1863
365 Ga0070693_100097889 3300005547 Bacteria 1781
366 Ga0070693_101607833 3300005547 Bacteria 510
367 Ga0070665_100002745 3300005548 Bacteria 19075
368 Ga0070665_100018805 3300005548 Bacteria 6927
369 Ga0070665_100056129 3300005548 Bacteria 3949
370 Ga0070665_100152807 3300005548 Bacteria 2311
371 Ga0070665_100200351 3300005548 Bacteria 1997
372 Ga0070665_100365128 3300005548 Bacteria 1450
373 Ga0070665_100585725 3300005548 Bacteria 1128
374 Ga0068855_100002322 3300005563 Bacteria 23507
375 Ga0068855_100136502 3300005563 Bacteria 2798
376 Ga0068855_100459357 3300005563 Bacteria 1389
377 Ga0068855_100771544 3300005563 Bacteria 1024
378 Ga0068855_101502555 3300005563 Bacteria 692
379 Ga0068855_101613475 3300005563 Bacteria 663
380 Ga0068855_102285631 3300005563 Bacteria 541
381 Ga0070664_100000185 3300005564 Bacteria 44271
382 Ga0070664_100007540 3300005564 Bacteria 8782
383 Ga0070664_100015789 3300005564 Bacteria 6181
384 Ga0070664_100030726 3300005564 Bacteria 4483
385 Ga0070664_100113154 3300005564 Bacteria 2370
386 Ga0070664_100275010 3300005564 Bacteria 1518
387 Ga0070664_100330207 3300005564 Bacteria 1383
388 Ga0070664_100361207 3300005564 Bacteria 1323
389 Ga0068857_100010099 3300005577 Bacteria 8200
390 Ga0068857_100037353 3300005577 Bacteria 4302
391 Ga0068857_100220438 3300005577 Bacteria 1732
392 Ga0068857_100232629 3300005577 Bacteria 1686
393 Ga0068857_101206443 3300005577 Bacteria 733
394 Ga0068857_101374427 3300005577 Bacteria 686
395 Ga0068857_101847406 3300005577 Bacteria 591
396 Ga0068857_102312949 3300005577 Bacteria 528
397 Ga0068854_100004779 3300005578 Bacteria 8539
398 Ga0068854_100005954 3300005578 Bacteria 7724
399 Ga0068854_100006654 3300005578 Bacteria 7364
400 Ga0068854_100010424 3300005578 Bacteria 6027
401 Ga0068854_100135659 3300005578 Bacteria 1884
402 Ga0068854_100180560 3300005578 Bacteria 1648
403 Ga0068854_100620040 3300005578 Bacteria 925
404 Ga0068854_100716922 3300005578 Bacteria 865
405 Ga0068856_100000855 3300005614 Bacteria 32735
406 Ga0068856_100001340 3300005614 Bacteria 25903
407 Ga0068856_100166571 3300005614 Bacteria 2215
408 Ga0068856_100287023 3300005614 Bacteria 1662
409 Ga0068856_100306968 3300005614 Bacteria 1604
410 Ga0068856_100655388 3300005614 Bacteria 1070
411 Ga0068856_100725453 3300005614 Bacteria 1014
412 Ga0068856_100815705 3300005614 Bacteria 952
413 Ga0068856_101189176 3300005614 Bacteria 779
414 Ga0068856_102708950 3300005614 Bacteria 501
415 Ga0070702_100000293 3300005615 Bacteria 17107
416 Ga0070702_100005192 3300005615 Bacteria 6032
417 Ga0070702_100022772 3300005615 Bacteria 3318
418 Ga0070702_100075923 3300005615 Bacteria 1999
419 Ga0070702_100076023 3300005615 Bacteria 1998
420 Ga0070702_100179287 3300005615 Bacteria 1385
421 Ga0070702_100760182 3300005615 Bacteria 745
422 Ga0068852_100000016 3300005616 Bacteria 132773
423 Ga0068852_100001602 3300005616 Bacteria 15397
424 Ga0068852_100004733 3300005616 Bacteria 9657
425 Ga0068852_100005847 3300005616 Bacteria 8834
426 Ga0068852_100011315 3300005616 Bacteria 6713
427 Ga0068852_100019341 3300005616 Bacteria 5387
428 Ga0068852_100025768 3300005616 Bacteria 4769
429 Ga0068852_100081226 3300005616 Bacteria 2877
430 Ga0068852_100114102 3300005616 Bacteria 2461
431 Ga0068852_100191806 3300005616 Bacteria 1928
432 Ga0068852_100835011 3300005616 Bacteria 936
433 Ga0068852_101779462 3300005616 Bacteria 638
434 Ga0068852_102303163 3300005616 Bacteria 560
435 Ga0068859_100001767 3300005617 Bacteria 21986
436 Ga0068859_100013103 3300005617 Bacteria 8331
437 Ga0068859_100348107 3300005617 Bacteria 1576
438 Ga0068859_100538038 3300005617 Bacteria 1263
439 Ga0068864_100011338 3300005618 Bacteria 7365
440 Ga0068864_100021394 3300005618 Bacteria 5420
441 Ga0068864_100024487 3300005618 Bacteria 5079
442 Ga0068864_100028741 3300005618 Bacteria 4704
443 Ga0068864_100088909 3300005618 Bacteria 2721
444 Ga0068864_100389456 3300005618 Bacteria 1323
445 Ga0068864_100815251 3300005618 Bacteria 918
446 Ga0068866_10008945 3300005718 Bacteria 4239
447 Ga0068866_10012085 3300005718 Bacteria 3756
448 Ga0068866_10024670 3300005718 Bacteria 2817
449 Ga0068866_10178043 3300005718 Bacteria 1254
450 Ga0068861_100090261 3300005719 Bacteria 2417
451 Ga0068861_100131918 3300005719 Bacteria 2028
452 Ga0068861_100202694 3300005719 Bacteria 1666
453 Ga0068861_100345443 3300005719 Bacteria 1303
454 Ga0068861_100538805 3300005719 Bacteria 1062
455 Ga0068851_10014095 3300005834 Bacteria 3790
456 Ga0068851_10025793 3300005834 Bacteria 2885
457 Ga0068851_10029539 3300005834 Bacteria 2714
458 Ga0068851_10042021 3300005834 Bacteria 2300
459 Ga0068851_10070254 3300005834 Bacteria 1810
460 Ga0068870_10012155 3300005840 Bacteria 4014
461 Ga0068870_10045705 3300005840 Bacteria 2293
462 Ga0068870_10050340 3300005840 Bacteria 2201
463 Ga0068870_11175018 3300005840 Bacteria 555
464 Ga0068863_100019083 3300005841 Bacteria 6565
465 Ga0068863_100043298 3300005841 Bacteria 4274
466 Ga0068863_100068228 3300005841 Bacteria 3364
467 Ga0068863_100900900 3300005841 Bacteria 885
468 Ga0068858_100004999 3300005842 Bacteria 12990
469 Ga0068858_100009515 3300005842 Bacteria 9271
470 Ga0068858_100108493 3300005842 Bacteria 2591
471 Ga0068858_100183275 3300005842 Bacteria 1977
472 Ga0068858_100231612 3300005842 Bacteria 1751
473 Ga0068858_100386386 3300005842 Bacteria 1343
474 Ga0068858_100547671 3300005842 Bacteria 1120
475 Ga0068860_100010336 3300005843 Bacteria 9229
476 Ga0068860_100019087 3300005843 Bacteria 6656
477 Ga0068860_100025558 3300005843 Bacteria 5696
478 Ga0068860_100037681 3300005843 Bacteria 4628
479 Ga0068860_100110596 3300005843 Bacteria 2626
480 Ga0068860_100570744 3300005843 Bacteria 1135
481 Ga0068860_100934673 3300005843 Bacteria 884
482 Ga0068862_100094829 3300005844 Bacteria 2603
483 Ga0068862_100277998 3300005844 Bacteria 1533
484 Ga0068862_100489577 3300005844 Bacteria 1165
485 Ga0068862_102305306 3300005844 Bacteria 550
486 Ga0081455_10000002 3300005937 Bacteria 460472
487 Ga0081455_10018858 3300005937 Bacteria 6546
488 Ga0081455_10155142 3300005937 Bacteria 1761
489 Ga0081455_10218124 3300005937 Bacteria 1416
490 Ga0081455_10326135 3300005937 Bacteria 1092
491 Ga0081540_1013929 3300005983 Bacteria 5191
492 Ga0070717_10023506 3300006028 Bacteria 4885
493 Ga0075365_10647113 3300006038 Bacteria 747
494 Ga0075365_11321993 3300006038 Bacteria 506
495 Ga0075368_10177725 3300006042 Bacteria 896
496 Ga0075368_10211460 3300006042 Bacteria 822
497 Ga0075368_10431808 3300006042 Bacteria 581
498 Ga0075363_100224005 3300006048 Bacteria 1078
499 Ga0075363_100531447 3300006048 Bacteria 700
500 Ga0075364_10011774 3300006051 Bacteria 5325
501 Ga0075364_10499658 3300006051 Bacteria 831
502 Ga0075432_10010313 3300006058 Bacteria 3169
503 Ga0075432_10456828 3300006058 Bacteria 561
504 Ga0070715_10032343 3300006163 Bacteria 2130
505 Ga0070715_10506401 3300006163 Bacteria 692
506 Ga0070716_100002237 3300006173 Bacteria 8916
507 Ga0070716_101771048 3300006173 Bacteria 511
508 Ga0070712_100048653 3300006175 Bacteria 2940
509 Ga0070712_100220045 3300006175 Bacteria 1503
510 Ga0070712_100507689 3300006175 Bacteria 1011
511 Ga0070712_101197713 3300006175 Bacteria 661
512 Ga0070712_101279546 3300006175 Bacteria 639
513 Ga0070712_101340397 3300006175 Bacteria 624
514 Ga0075362_10111986 3300006177 Bacteria 1285
515 Ga0075362_10333219 3300006177 Bacteria 757
516 Ga0075369_10020166 3300006186 Bacteria 2729
517 Ga0075369_10358718 3300006186 Bacteria 684
518 Ga0075369_10502268 3300006186 Bacteria 576
519 Ga0075366_10437501 3300006195 Bacteria 806
520 Ga0075366_10496452 3300006195 Bacteria 754
521 Ga0097621_100000378 3300006237 Bacteria 31017
522 Ga0097621_100011969 3300006237 Bacteria 6419
523 Ga0097621_100020007 3300006237 Bacteria 5152
524 Ga0097621_100074431 3300006237 Bacteria 2813
525 Ga0097621_100182157 3300006237 Bacteria 1815
526 Ga0097621_100864083 3300006237 Bacteria 841
527 Ga0097621_101122517 3300006237 Bacteria 739
528 Ga0097621_102165030 3300006237 Bacteria 532
529 Ga0075370_10247891 3300006353 Bacteria 1055
530 Ga0068871_100001533 3300006358 Bacteria 15496
531 Ga0068871_100007149 3300006358 Bacteria 7963
532 Ga0068871_100007371 3300006358 Bacteria 7851
533 Ga0068871_100035236 3300006358 Bacteria 3975
534 Ga0068871_100091275 3300006358 Bacteria 2538
535 Ga0068871_100185778 3300006358 Bacteria 1788
536 Ga0068871_100807571 3300006358 Bacteria 865
537 Ga0075428_100010200 3300006844 Bacteria 10427
538 Ga0075428_100024997 3300006844 Bacteria 6608
539 Ga0075428_100070421 3300006844 Bacteria 3823
540 Ga0075428_100256932 3300006844 Bacteria 1882
541 Ga0075428_101459018 3300006844 Bacteria 717
542 Ga0075430_100001483 3300006846 Bacteria 19129
543 Ga0075430_100078624 3300006846 Bacteria 2765
544 Ga0075430_100296990 3300006846 Bacteria 1336
545 Ga0075431_100017410 3300006847 Bacteria 7302
546 Ga0075433_10002052 3300006852 Bacteria 15222
547 Ga0075433_10019693 3300006852 Bacteria 5628
548 Ga0075433_10113614 3300006852 Bacteria 2402
549 Ga0075433_10387708 3300006852 Bacteria 1233
550 Ga0075433_10697133 3300006852 Bacteria 889
551 Ga0075433_11023804 3300006852 Bacteria 719
552 Ga0075434_100001473 3300006871 Bacteria 19815
553 Ga0075434_100238856 3300006871 Bacteria 1837
554 Ga0075434_100910128 3300006871 Bacteria 894
555 Ga0075434_101039773 3300006871 Bacteria 833
556 Ga0075429_100005294 3300006880 Bacteria 11102
557 Ga0075429_100050698 3300006880 Bacteria 3611
558 Ga0075429_101444655 3300006880 Unclassified 599
559 Ga0068865_100012439 3300006881 Bacteria 5356
560 Ga0068865_100056737 3300006881 Bacteria 2730
561 Ga0068865_100142173 3300006881 Bacteria 1810
562 Ga0068865_100365118 3300006881 Bacteria 1173
563 Ga0068865_100463108 3300006881 Bacteria 1050
564 Ga0068865_100667405 3300006881 Bacteria 885
565 Ga0068865_102007719 3300006881 Bacteria 525
566 Ga0075436_100089911 3300006914 Bacteria 2134
567 Ga0075436_100149631 3300006914 Bacteria 1642
568 Ga0075436_100198680 3300006914 Bacteria 1420
569 Ga0075436_100796905 3300006914 Bacteria 703
570 Ga0075436_101312623 3300006914 Bacteria 547
571 Ga0097620_100001767 3300006931 Bacteria 21986
572 Ga0097620_100013103 3300006931 Bacteria 8331
573 Ga0097620_100348120 3300006931 Bacteria 1576
574 Ga0097620_100538048 3300006931 Bacteria 1263
575 Ga0075435_100024384 3300007076 Bacteria 4694
576 Ga0075435_100362455 3300007076 Bacteria 1243
577 Ga0075435_100536393 3300007076 Bacteria 1013
578 Ga0075435_100600199 3300007076 Bacteria 955
579 Ga0075435_100666276 3300007076 Bacteria 903
580 Ga0075435_101344590 3300007076 Bacteria 626
581 Ga0099794_10143464 3300007265 Bacteria 1210
582 Ga0105251_10070903 3300009011 Bacteria 1622
583 Ga0105251_10144257 3300009011 Bacteria 1077
584 Ga0105251_10587310 3300009011 Bacteria 528
585 Ga0105244_10042238 3300009036 Bacteria 2358
586 Ga0105250_10089444 3300009092 Bacteria 1251
587 Ga0105240_10034871 3300009093 Bacteria 6488
588 Ga0105240_10209167 3300009093 Bacteria 2281
589 Ga0105240_10232895 3300009093 Bacteria 2139
590 Ga0105240_10305213 3300009093 Bacteria 1819
591 Ga0105240_11090266 3300009093 Bacteria 850
592 Ga0105240_11996874 3300009093 Bacteria 603
593 Ga0105240_12392972 3300009093 Bacteria 547
594 Ga0111539_10008538 3300009094 Bacteria 13014
595 Ga0111539_10069152 3300009094 Bacteria 4169
596 Ga0111539_10118660 3300009094 Bacteria 3101
597 Ga0111539_10268805 3300009094 Bacteria 1985
598 Ga0111539_10455428 3300009094 Bacteria 1490
599 Ga0111539_13217547 3300009094 Bacteria 526
600 Ga0105245_10000888 3300009098 Bacteria 27206
601 Ga0105245_10130933 3300009098 Bacteria 2353
602 Ga0105245_10296132 3300009098 Bacteria 1586
603 Ga0105245_10875349 3300009098 Bacteria 939
604 Ga0105245_12845782 3300009098 Bacteria 536
605 Ga0105247_10053051 3300009101 Bacteria 2500
606 Ga0105247_10136072 3300009101 Bacteria 1605
607 Ga0105247_10154172 3300009101 Bacteria 1516
608 Ga0105247_10468344 3300009101 Bacteria 912
609 Ga0105247_11133877 3300009101 Bacteria 619
610 Ga0105247_11289841 3300009101 Bacteria 586
611 Ga0114129_10046549 3300009147 Bacteria 6095
612 Ga0114129_10061852 3300009147 Bacteria 5232
613 Ga0114129_10129586 3300009147 Bacteria 3466
614 Ga0114129_10628835 3300009147 Bacteria 1388
615 Ga0105243_10009700 3300009148 Bacteria 7333
616 Ga0105243_10019984 3300009148 Bacteria 5078
617 Ga0105243_10033559 3300009148 Bacteria 3969
618 Ga0105243_10293542 3300009148 Bacteria 1470
619 Ga0105243_10445895 3300009148 Bacteria 1213
620 Ga0105243_10624830 3300009148 Bacteria 1040
621 Ga0105243_10832933 3300009148 Bacteria 912
622 Ga0105241_10000662 3300009174 Bacteria 25854
623 Ga0105241_10223435 3300009174 Bacteria 1584
624 Ga0105241_10658778 3300009174 Bacteria 952
625 Ga0105241_10753354 3300009174 Bacteria 893
626 Ga0105242_10003386 3300009176 Bacteria 12416
627 Ga0105242_10014624 3300009176 Bacteria 6076
628 Ga0105242_10116331 3300009176 Bacteria 2287
629 Ga0105242_10156694 3300009176 Bacteria 1990
630 Ga0105242_10187238 3300009176 Bacteria 1830
631 Ga0105242_10507433 3300009176 Bacteria 1148
632 Ga0105242_11228772 3300009176 Bacteria 770
633 Ga0105242_11448057 3300009176 Bacteria 716
634 Ga0105248_10006662 3300009177 Bacteria 12673
635 Ga0105248_10028745 3300009177 Bacteria 6196
636 Ga0105248_10239921 3300009177 Bacteria 2040
637 Ga0105248_10488622 3300009177 Bacteria 1388
638 Ga0105248_10564611 3300009177 Bacteria 1284
639 Ga0105248_11622780 3300009177 Bacteria 733
640 Ga0105248_11827197 3300009177 Bacteria 689
641 Ga0105248_11983222 3300009177 Bacteria 661
642 Ga0105248_12203723 3300009177 Bacteria 627
643 Ga0105248_12312838 3300009177 Bacteria 612
644 Ga0105237_10067784 3300009545 Bacteria 3562
645 Ga0105237_10135919 3300009545 Bacteria 2453
646 Ga0105237_10242146 3300009545 Bacteria 1805
647 Ga0105237_11046530 3300009545 Bacteria 823
648 Ga0105237_11327976 3300009545 Bacteria 725
649 Ga0105238_10056035 3300009551 Bacteria 3955
650 Ga0105238_10399317 3300009551 Bacteria 1368
651 Ga0105238_10470315 3300009551 Bacteria 1255
652 Ga0105238_10508731 3300009551 Bacteria 1206
653 Ga0105238_10721315 3300009551 Bacteria 1009
654 Ga0105238_11443176 3300009551 Bacteria 716
655 Ga0105238_11778975 3300009551 Bacteria 648
656 Ga0105238_11868394 3300009551 Bacteria 633
657 Ga0105249_10000643 3300009553 Bacteria 31810
658 Ga0105249_10026179 3300009553 Bacteria 5253
659 Ga0105249_10292150 3300009553 Bacteria 1632
660 Ga0105249_10561594 3300009553 Bacteria 1193
661 Ga0105249_10585417 3300009553 Bacteria 1169
662 Ga0105249_12692896 3300009553 Bacteria 569
663 Ga0105239_10083669 3300010375 Bacteria 3514
664 Ga0105239_10661150 3300010375 Bacteria 1194
665 Ga0105239_10840656 3300010375 Bacteria 1052
666 Ga0105239_12040652 3300010375 Bacteria 666
667 Ga0105239_12741927 3300010375 Bacteria 575
668 Ga0105246_10007028 3300011119 Bacteria 6890
669 Ga0105246_10084317 3300011119 Bacteria 2273
670 Ga0105246_10595737 3300011119 Bacteria 954
671 Ga0105246_11341865 3300011119 Bacteria 665
672 Ga0105246_11527198 3300011119 Unclassified 628
673 Ga0105246_11892129 3300011119 Bacteria 573
674 Ga0157340_1003731 3300012473 Bacteria 850
675 Ga0157317_1035201 3300012475 Bacteria 503
676 Ga0157336_1035594 3300012477 Bacteria 517
677 Ga0157337_1004632 3300012483 Bacteria 886
678 Ga0157337_1041167 3300012483 Unclassified 510
679 Ga0157321_1011031 3300012487 Unclassified 699
680 Ga0157329_1017635 3300012491 Bacteria 639
681 Ga0157335_1001442 3300012492 Bacteria 1307
682 Ga0157335_1001701 3300012492 Bacteria 1242
683 Ga0157341_1001441 3300012494 Bacteria 1442
684 Ga0157323_1000760 3300012495 Bacteria 1463
685 Ga0157319_1001829 3300012497 Bacteria 1150
686 Ga0157345_1020153 3300012498 Unclassified 672
687 Ga0157314_1003958 3300012500 Unclassified 1072
688 Ga0157314_1014636 3300012500 Bacteria 732
689 Ga0157347_1017328 3300012502 Bacteria 818
690 Ga0157339_1001931 3300012505 Bacteria 1343
691 Ga0157324_1018218 3300012506 Unclassified 687
692 Ga0157342_1001855 3300012507 Bacteria 1637
693 Ga0157316_1001319 3300012510 Bacteria 1513
694 Ga0157326_1036482 3300012513 Unclassified 673
695 Ga0157338_1008116 3300012515 Bacteria 1011
696 Ga0157373_10001165 3300013100 Bacteria 20128
697 Ga0157373_10021687 3300013100 Bacteria 4662
698 Ga0157373_10352621 3300013100 Bacteria 1050
699 Ga0157373_10528260 3300013100 Bacteria 854
700 Ga0157373_10810746 3300013100 Bacteria 691
701 Ga0157373_11182253 3300013100 Bacteria 576
702 Ga0157371_10000371 3300013102 Bacteria 56697
703 Ga0157371_10065058 3300013102 Bacteria 2582
704 Ga0157371_10226966 3300013102 Bacteria 1342
705 Ga0157371_10263846 3300013102 Bacteria 1242
706 Ga0157371_10580790 3300013102 Bacteria 832
707 Ga0157371_10731026 3300013102 Bacteria 742
708 Ga0157371_11386880 3300013102 Bacteria 546
709 Ga0157370_10004045 3300013104 Bacteria 17021
710 Ga0157370_10005866 3300013104 Bacteria 13710
711 Ga0157370_10035333 3300013104 Bacteria 4859
712 Ga0157370_10173814 3300013104 Bacteria 2002
713 Ga0157370_10359280 3300013104 Bacteria 1342
714 Ga0157370_10433103 3300013104 Bacteria 1209
715 Ga0157370_10621428 3300013104 Bacteria 988
716 Ga0157370_10977870 3300013104 Bacteria 767
717 Ga0157369_10011164 3300013105 Bacteria 10213
718 Ga0157369_10064607 3300013105 Bacteria 3941
719 Ga0157369_10279794 3300013105 Bacteria 1738
720 Ga0157369_10364302 3300013105 Bacteria 1500
721 Ga0157369_10530976 3300013105 Bacteria 1217
722 Ga0157369_10758647 3300013105 Bacteria 998
723 Ga0157369_10904189 3300013105 Bacteria 905
724 Ga0157369_11065173 3300013105 Bacteria 827
725 Ga0157369_11150938 3300013105 Bacteria 792
726 Ga0157374_10003722 3300013296 Bacteria 12819
727 Ga0157374_10035202 3300013296 Bacteria 4579
728 Ga0157374_10052738 3300013296 Bacteria 3789
729 Ga0157374_10071691 3300013296 Bacteria 3267
730 Ga0157374_10101628 3300013296 Bacteria 2756
731 Ga0157374_10247425 3300013296 Bacteria 1754
732 Ga0157374_10441201 3300013296 Bacteria 1302
733 Ga0157374_10570099 3300013296 Bacteria 1141
734 Ga0157374_11104102 3300013296 Bacteria 814
735 Ga0157374_12871393 3300013296 Bacteria 509
736 Ga0157378_10013808 3300013297 Bacteria 7063
737 Ga0157378_10018715 3300013297 Bacteria 6088
738 Ga0157378_10026894 3300013297 Bacteria 5074
739 Ga0157378_10070094 3300013297 Bacteria 3147
740 Ga0157378_10070991 3300013297 Bacteria 3127
741 Ga0157378_10086735 3300013297 Bacteria 2838
742 Ga0157378_10150556 3300013297 Bacteria 2168
743 Ga0157378_10167047 3300013297 Bacteria 2062
744 Ga0157378_10343624 3300013297 Bacteria 1456
745 Ga0157378_10970315 3300013297 Bacteria 883
746 Ga0163162_10000015 3300013306 Bacteria 261996
747 Ga0163162_10014534 3300013306 Bacteria 7692
748 Ga0163162_10087395 3300013306 Bacteria 3196
749 Ga0163162_10110048 3300013306 Bacteria 2852
750 Ga0163162_10150864 3300013306 Bacteria 2442
751 Ga0163162_10294888 3300013306 Bacteria 1753
752 Ga0163162_11235430 3300013306 Bacteria 848
753 Ga0163162_11538364 3300013306 Bacteria 758
754 Ga0163162_12037480 3300013306 Bacteria 658
755 Ga0163162_12550794 3300013306 Bacteria 588
756 Ga0163162_12563921 3300013306 Bacteria 586
757 Ga0157372_10002819 3300013307 Bacteria 18778
758 Ga0157372_10046062 3300013307 Bacteria 4840
759 Ga0157372_10050524 3300013307 Bacteria 4625
760 Ga0157372_10050777 3300013307 Bacteria 4613
761 Ga0157372_10349163 3300013307 Bacteria 1723
762 Ga0157372_10399621 3300013307 Bacteria 1601
763 Ga0157372_11070640 3300013307 Bacteria 933
764 Ga0157372_11114573 3300013307 Bacteria 913
765 Ga0157372_11232952 3300013307 Bacteria 864
766 Ga0157372_11576804 3300013307 Bacteria 756
767 Ga0157372_12188521 3300013307 Bacteria 635
768 Ga0157372_13188435 3300013307 Bacteria 523
769 Ga0157375_10000426 3300013308 Bacteria 38161
770 Ga0157375_10001031 3300013308 Bacteria 24026
771 Ga0157375_10005891 3300013308 Bacteria 10679
772 Ga0157375_10006612 3300013308 Bacteria 10087
773 Ga0157375_10006675 3300013308 Bacteria 10047
774 Ga0157375_10027552 3300013308 Bacteria 5312
775 Ga0157375_10067001 3300013308 Bacteria 3586
776 Ga0157375_10116734 3300013308 Bacteria 2773
777 Ga0157375_10157051 3300013308 Bacteria 2414
778 Ga0157375_13698520 3300013308 Bacteria 508
779 Ga0163163_10004431 3300014325 Bacteria 11977
780 Ga0163163_10178936 3300014325 Bacteria 2168
781 Ga0163163_11357856 3300014325 Bacteria 772
782 Ga0157380_10005584 3300014326 Bacteria 8785
783 Ga0157380_10047739 3300014326 Bacteria 3369
784 Ga0157380_12394832 3300014326 Bacteria 593
785 Ga0157380_12930518 3300014326 Bacteria 543
786 Ga0182008_10278669 3300014497 Bacteria 869
787 Ga0182008_10372705 3300014497 Bacteria 761
788 Ga0157377_10004255 3300014745 Bacteria 6557
789 Ga0157377_10038573 3300014745 Bacteria 2639
790 Ga0157377_10105786 3300014745 Bacteria 1684
791 Ga0157377_10238340 3300014745 Bacteria 1173
792 Ga0157377_11159979 3300014745 Unclassified 596
793 Ga0157379_10004682 3300014968 Bacteria 11742
794 Ga0157379_10010116 3300014968 Bacteria 8225
795 Ga0157379_10034362 3300014968 Bacteria 4521
796 Ga0157379_10121834 3300014968 Bacteria 2346
797 Ga0157379_10810996 3300014968 Bacteria 884
798 Ga0157379_10823658 3300014968 Bacteria 877
799 Ga0157379_11286706 3300014968 Bacteria 706
800 Ga0157379_11548263 3300014968 Bacteria 646
801 Ga0157379_12175613 3300014968 Bacteria 551
802 Ga0157376_10002952 3300014969 Bacteria 11665
803 Ga0157376_10012211 3300014969 Bacteria 6366
804 Ga0157376_10035989 3300014969 Bacteria 4008
805 Ga0157376_10036819 3300014969 Bacteria 3966
806 Ga0157376_10044669 3300014969 Bacteria 3643
807 Ga0157376_10072518 3300014969 Bacteria 2929
808 Ga0157376_10101370 3300014969 Bacteria 2516
809 Ga0157376_10616492 3300014969 Bacteria 1082
810 Ga0157376_11212415 3300014969 Bacteria 783
811 Ga0157376_12540643 3300014969 Bacteria 552
812 Ga0163161_10015375 3300017792 Bacteria 5335
813 Ga0163161_10037777 3300017792 Bacteria 3462
814 Ga0163161_10061205 3300017792 Bacteria 2740
815 Ga0163161_10066417 3300017792 Bacteria 2634
816 Ga0163161_10114368 3300017792 Bacteria 2021
817 Ga0163161_10279755 3300017792 Bacteria 1308
818 Ga0163161_10512510 3300017792 Bacteria 978
819 Ga0163161_10680552 3300017792 Bacteria 855
820 Ga0163161_10882382 3300017792 Bacteria 757
821 Ga0163161_11097379 3300017792 Bacteria 684
822 Ga0206356_11040495 3300020070 Bacteria 1319
823 Ga0206356_11148339 3300020070 Bacteria 601
824 Ga0206349_1351612 3300020075 Bacteria 679
825 Ga0206354_11000226 3300020081 Bacteria 655
826 Ga0206354_11125984 3300020081 Bacteria 912
827 Ga0206354_11201073 3300020081 Bacteria 812
828 Ga0206354_11321297 3300020081 Bacteria 721
829 Ga0206353_11112049 3300020082 Bacteria 812
830 Ga0206353_11364463 3300020082 Bacteria 811
831 Ga0154015_1561563 3300020610 Bacteria 745
832 Ga0213876_10491303 3300021384 Bacteria 653
833 Ga0213875_10402609 3300021388 Bacteria 653
834 Ga0213871_10119801 3300021441 Bacteria 784
835 Ga0224712_10578391 3300022467 Bacteria 547
836 Ga0207672_1007501 3300025223 Bacteria 637
837 Ga0209147_100667 3300025229 Bacteria 17779
838 Ga0209233_1000045 3300025261 Bacteria 473379
839 Ga0207666_1000034 3300025271 Bacteria 28645
840 Ga0207666_1003896 3300025271 Bacteria 1851
841 Ga0209130_1009775 3300025284 Bacteria 2700
842 Ga0207673_1000061 3300025290 Bacteria 9198
843 Ga0207673_1000425 3300025290 Bacteria 4347
844 Ga0209564_1002084 3300025295 Bacteria 17145
845 Ga0207426_1000037 3300025302 Bacteria 442735
846 Ga0207697_10000280 3300025315 Bacteria 28276
847 Ga0207697_10003843 3300025315 Bacteria 7327
848 Ga0207697_10054568 3300025315 Bacteria 1656
849 Ga0207697_10195600 3300025315 Bacteria 888
850 Ga0207656_10002822 3300025321 Bacteria 5914
851 Ga0207656_10003030 3300025321 Bacteria 5747
852 Ga0207656_10006343 3300025321 Bacteria 4242
853 Ga0207656_10033434 3300025321 Bacteria 2142
854 Ga0207696_1132341 3300025711 Bacteria 670
855 Ga0207655_1079570 3300025728 Bacteria 1187
856 Ga0207713_1212633 3300025735 Bacteria 587
857 Ga0207713_1234019 3300025735 Bacteria 548
858 Ga0207653_10060296 3300025885 Bacteria 1278
859 Ga0207682_10000134 3300025893 Bacteria 33520
860 Ga0207682_10000807 3300025893 Bacteria 14499
861 Ga0207682_10003234 3300025893 Bacteria 7126
862 Ga0207682_10079376 3300025893 Bacteria 1403
863 Ga0207692_10006215 3300025898 Bacteria 4836
864 Ga0207692_10102115 3300025898 Bacteria 1576
865 Ga0207692_10456061 3300025898 Bacteria 805
866 Ga0207642_10010308 3300025899 Bacteria 3289
867 Ga0207642_10012830 3300025899 Bacteria 3038
868 Ga0207642_10016500 3300025899 Bacteria 2783
869 Ga0207710_10003581 3300025900 Bacteria 6895
870 Ga0207710_10131861 3300025900 Bacteria 1201
871 Ga0207688_10003819 3300025901 Bacteria 8218
872 Ga0207688_10012429 3300025901 Bacteria 4631
873 Ga0207688_11067684 3300025901 Bacteria 510
874 Ga0207680_10014420 3300025903 Bacteria 4090
875 Ga0207680_10027255 3300025903 Bacteria 3179
876 Ga0207680_10189805 3300025903 Bacteria 1394
877 Ga0207680_10321768 3300025903 Bacteria 1081
878 Ga0207680_10497229 3300025903 Bacteria 868
879 Ga0207680_10657471 3300025903 Bacteria 750
880 Ga0207680_11110636 3300025903 Bacteria 565
881 Ga0207647_10027189 3300025904 Bacteria 3732
882 Ga0207647_10084374 3300025904 Bacteria 1901
883 Ga0207647_10273465 3300025904 Bacteria 965
884 Ga0207647_10339846 3300025904 Bacteria 851
885 Ga0207699_10001462 3300025906 Bacteria 11208
886 Ga0207699_10085525 3300025906 Bacteria 1967
887 Ga0207699_10087035 3300025906 Bacteria 1952
888 Ga0207699_10279965 3300025906 Bacteria 1159
889 Ga0207699_10554598 3300025906 Bacteria 834
890 Ga0207645_10000888 3300025907 Bacteria 24819
891 Ga0207645_10000982 3300025907 Bacteria 23565
892 Ga0207645_10037279 3300025907 Bacteria 3119
893 Ga0207645_10127096 3300025907 Bacteria 1657
894 Ga0207645_10314895 3300025907 Bacteria 1043
895 Ga0207645_10548843 3300025907 Bacteria 784
896 Ga0207645_10786131 3300025907 Bacteria 647
897 Ga0207643_10000322 3300025908 Bacteria 32870
898 Ga0207643_10000475 3300025908 Bacteria 25958
899 Ga0207643_10185746 3300025908 Bacteria 1260
900 Ga0207705_10050336 3300025909 Bacteria 2999
901 Ga0207705_10075154 3300025909 Bacteria 2453
902 Ga0207705_10111895 3300025909 Bacteria 2018
903 Ga0207705_10699015 3300025909 Bacteria 788
904 Ga0207705_10712429 3300025909 Bacteria 780
905 Ga0207705_10722240 3300025909 Bacteria 774
906 Ga0207705_10851975 3300025909 Bacteria 707
907 Ga0207705_11522419 3300025909 Bacteria 506
908 Ga0207684_10588808 3300025910 Bacteria 950
909 Ga0207654_10006328 3300025911 Bacteria 5951
910 Ga0207654_10237782 3300025911 Bacteria 1216
911 Ga0207654_10249488 3300025911 Bacteria 1189
912 Ga0207654_10417862 3300025911 Bacteria 935
913 Ga0207654_10640543 3300025911 Bacteria 761
914 Ga0207707_10015137 3300025912 Bacteria 6715
915 Ga0207707_10026952 3300025912 Bacteria 5023
916 Ga0207707_10085111 3300025912 Bacteria 2762
917 Ga0207707_10089927 3300025912 Bacteria 2683
918 Ga0207707_10377450 3300025912 Bacteria 1219
919 Ga0207707_10913485 3300025912 Bacteria 725
920 Ga0207695_10067327 3300025913 Bacteria 3674
921 Ga0207695_10118940 3300025913 Bacteria 2613
922 Ga0207695_10154207 3300025913 Bacteria 2233
923 Ga0207671_10203233 3300025914 Bacteria 1548
924 Ga0207671_10903796 3300025914 Bacteria 698
925 Ga0207693_10005568 3300025915 Bacteria 10480
926 Ga0207693_10022202 3300025915 Bacteria 5044
927 Ga0207693_10107745 3300025915 Bacteria 2186
928 Ga0207693_10321183 3300025915 Bacteria 1212
929 Ga0207663_10077423 3300025916 Bacteria 2165
930 Ga0207663_10079870 3300025916 Bacteria 2137
931 Ga0207663_10148346 3300025916 Bacteria 1642
932 Ga0207663_10506524 3300025916 Bacteria 938
933 Ga0207663_11605451 3300025916 Bacteria 523
934 Ga0207660_10005579 3300025917 Bacteria 8170
935 Ga0207660_10026462 3300025917 Bacteria 3951
936 Ga0207660_10459972 3300025917 Bacteria 1030
937 Ga0207660_10641068 3300025917 Bacteria 866
938 Ga0207660_10707106 3300025917 Bacteria 822
939 Ga0207660_10889638 3300025917 Bacteria 727
940 Ga0207660_11065188 3300025917 Bacteria 659
941 Ga0207660_11341311 3300025917 Bacteria 580
942 Ga0207662_10133633 3300025918 Bacteria 1566
943 Ga0207662_10145421 3300025918 Bacteria 1504
944 Ga0207662_10305668 3300025918 Bacteria 1058
945 Ga0207657_10001665 3300025919 Bacteria 23972
946 Ga0207657_10036372 3300025919 Bacteria 4406
947 Ga0207657_10047632 3300025919 Bacteria 3746
948 Ga0207657_10198306 3300025919 Bacteria 1616
949 Ga0207657_10414921 3300025919 Bacteria 1058
950 Ga0207657_10470352 3300025919 Bacteria 986
951 Ga0207657_10753659 3300025919 Bacteria 754
952 Ga0207657_10840002 3300025919 Bacteria 709
953 Ga0207657_11334260 3300025919 Bacteria 541
954 Ga0207649_10000271 3300025920 Bacteria 40924
955 Ga0207649_10003027 3300025920 Bacteria 9259
956 Ga0207649_10018411 3300025920 Bacteria 3972
957 Ga0207649_10070577 3300025920 Bacteria 2228
958 Ga0207649_10155037 3300025920 Bacteria 1581
959 Ga0207649_10219937 3300025920 Bacteria 1352
960 Ga0207649_10338544 3300025920 Bacteria 1110
961 Ga0207649_10652213 3300025920 Bacteria 813
962 Ga0207649_11068357 3300025920 Bacteria 636
963 Ga0207649_11197839 3300025920 Bacteria 600
964 Ga0207649_11271525 3300025920 Bacteria 582
965 Ga0207652_10021096 3300025921 Bacteria 5373
966 Ga0207652_10047524 3300025921 Bacteria 3666
967 Ga0207652_10081716 3300025921 Bacteria 2827
968 Ga0207652_10095312 3300025921 Bacteria 2621
969 Ga0207652_10187554 3300025921 Bacteria 1859
970 Ga0207652_10466197 3300025921 Bacteria 1138
971 Ga0207652_10560927 3300025921 Bacteria 1026
972 Ga0207652_10577155 3300025921 Bacteria 1009
973 Ga0207652_11545837 3300025921 Bacteria 568
974 Ga0207646_10095685 3300025922 Bacteria 2661
975 Ga0207646_10477264 3300025922 Bacteria 1124
976 Ga0207646_11685356 3300025922 Bacteria 545
977 Ga0207681_10000658 3300025923 Bacteria 22886
978 Ga0207681_10022861 3300025923 Bacteria 3992
979 Ga0207681_10023100 3300025923 Bacteria 3972
980 Ga0207681_10506244 3300025923 Bacteria 989
981 Ga0207681_11326297 3300025923 Bacteria 604
982 Ga0207694_10091237 3300025924 Bacteria 2404
983 Ga0207694_10292043 3300025924 Bacteria 1341
984 Ga0207694_10642090 3300025924 Bacteria 894
985 Ga0207694_10658891 3300025924 Bacteria 882
986 Ga0207650_10000507 3300025925 Bacteria 32529
987 Ga0207650_10001677 3300025925 Bacteria 15731
988 Ga0207650_10018412 3300025925 Bacteria 4902
989 Ga0207650_10034215 3300025925 Bacteria 3684
990 Ga0207650_10186302 3300025925 Bacteria 1656
991 Ga0207650_10282604 3300025925 Bacteria 1352
992 Ga0207650_10290250 3300025925 Bacteria 1334
993 Ga0207650_10691617 3300025925 Bacteria 861
994 Ga0207650_11320783 3300025925 Bacteria 614
995 Ga0207650_11548794 3300025925 Bacteria 563
996 Ga0207659_10000177 3300025926 Bacteria 38217
997 Ga0207659_10028374 3300025926 Bacteria 3803
998 Ga0207659_10032751 3300025926 Bacteria 3571
999 Ga0207659_10073672 3300025926 Bacteria 2501
1000 Ga0207659_10317447 3300025926 Bacteria 1284
1001 Ga0207659_10329218 3300025926 Bacteria 1262
1002 Ga0207659_10377861 3300025926 Bacteria 1181
1003 Ga0207659_10706798 3300025926 Bacteria 863
1004 Ga0207687_10000495 3300025927 Bacteria 26551
1005 Ga0207687_10011220 3300025927 Bacteria 5851
1006 Ga0207687_10302359 3300025927 Bacteria 1289
1007 Ga0207700_10000624 3300025928 Bacteria 20699
1008 Ga0207664_10003549 3300025929 Bacteria 10412
1009 Ga0207664_10005612 3300025929 Bacteria 8586
1010 Ga0207664_10026183 3300025929 Bacteria 4405
1011 Ga0207664_10355167 3300025929 Bacteria 1298
1012 Ga0207644_10000157 3300025931 Bacteria 49224
1013 Ga0207644_10000279 3300025931 Bacteria 33969
1014 Ga0207644_10001258 3300025931 Bacteria 16301
1015 Ga0207644_10003027 3300025931 Bacteria 10817
1016 Ga0207644_10006733 3300025931 Bacteria 7486
1017 Ga0207644_10007021 3300025931 Bacteria 7333
1018 Ga0207644_10022080 3300025931 Bacteria 4344
1019 Ga0207644_10024638 3300025931 Bacteria 4132
1020 Ga0207644_10162709 3300025931 Bacteria 1736
1021 Ga0207644_10700703 3300025931 Bacteria 844
1022 Ga0207690_10002339 3300025932 Bacteria 11519
1023 Ga0207690_10008301 3300025932 Bacteria 6160
1024 Ga0207690_10035634 3300025932 Bacteria 3216
1025 Ga0207690_10049383 3300025932 Bacteria 2804
1026 Ga0207690_10180975 3300025932 Bacteria 1587
1027 Ga0207690_10488581 3300025932 Bacteria 994
1028 Ga0207690_11225515 3300025932 Bacteria 627
1029 Ga0207690_11371159 3300025932 Bacteria 591
1030 Ga0207706_10000002 3300025933 Bacteria 360309
1031 Ga0207706_10000542 3300025933 Bacteria 40183
1032 Ga0207706_10043058 3300025933 Bacteria 4001
1033 Ga0207706_10043246 3300025933 Bacteria 3993
1034 Ga0207706_10087052 3300025933 Bacteria 2746
1035 Ga0207706_10330295 3300025933 Bacteria 1327
1036 Ga0207706_10395876 3300025933 Bacteria 1198
1037 Ga0207706_10416015 3300025933 Bacteria 1165
1038 Ga0207706_10492595 3300025933 Bacteria 1058
1039 Ga0207706_10964075 3300025933 Bacteria 718
1040 Ga0207686_10002682 3300025934 Bacteria 9665
1041 Ga0207686_10005492 3300025934 Bacteria 6803
1042 Ga0207686_10006144 3300025934 Bacteria 6453
1043 Ga0207686_10028899 3300025934 Bacteria 3264
1044 Ga0207686_10329046 3300025934 Bacteria 1144
1045 Ga0207709_10002372 3300025935 Bacteria 11884
1046 Ga0207709_10072573 3300025935 Bacteria 2190
1047 Ga0207709_10415027 3300025935 Bacteria 1033
1048 Ga0207709_10648295 3300025935 Bacteria 840
1049 Ga0207670_10021268 3300025936 Bacteria 4000
1050 Ga0207670_10030427 3300025936 Bacteria 3449
1051 Ga0207670_10263810 3300025936 Bacteria 1336
1052 Ga0207670_11255076 3300025936 Bacteria 628
1053 Ga0207669_10000808 3300025937 Bacteria 13424
1054 Ga0207669_10023174 3300025937 Bacteria 3311
1055 Ga0207669_10064692 3300025937 Bacteria 2264
1056 Ga0207669_10120938 3300025937 Bacteria 1777
1057 Ga0207669_11378430 3300025937 Bacteria 600
1058 Ga0207704_10016281 3300025938 Bacteria 3818
1059 Ga0207704_10037899 3300025938 Bacteria 2789
1060 Ga0207704_10044678 3300025938 Bacteria 2626
1061 Ga0207704_10073258 3300025938 Bacteria 2180
1062 Ga0207704_10130157 3300025938 Bacteria 1741
1063 Ga0207704_10155154 3300025938 Bacteria 1622
1064 Ga0207704_10633032 3300025938 Bacteria 879
1065 Ga0207704_11053833 3300025938 Bacteria 690
1066 Ga0207665_10001758 3300025939 Bacteria 14547
1067 Ga0207665_10247395 3300025939 Bacteria 1316
1068 Ga0207665_10795262 3300025939 Bacteria 747
1069 Ga0207665_11522545 3300025939 Bacteria 531
1070 Ga0207691_10000040 3300025940 Bacteria 106561
1071 Ga0207691_10000937 3300025940 Bacteria 28981
1072 Ga0207691_10002815 3300025940 Bacteria 16961
1073 Ga0207691_10017121 3300025940 Bacteria 6876
1074 Ga0207691_10104593 3300025940 Bacteria 2523
1075 Ga0207691_10110030 3300025940 Bacteria 2451
1076 Ga0207691_10120560 3300025940 Bacteria 2325
1077 Ga0207691_10391596 3300025940 Bacteria 1185
1078 Ga0207691_10794167 3300025940 Bacteria 796
1079 Ga0207711_10008985 3300025941 Bacteria 8353
1080 Ga0207711_10176370 3300025941 Bacteria 1942
1081 Ga0207711_10244981 3300025941 Bacteria 1644
1082 Ga0207711_10255878 3300025941 Bacteria 1609
1083 Ga0207711_10287043 3300025941 Bacteria 1516
1084 Ga0207711_10607427 3300025941 Bacteria 1020
1085 Ga0207711_10797604 3300025941 Bacteria 880
1086 Ga0207711_11206206 3300025941 Bacteria 698
1087 Ga0207711_11373769 3300025941 Bacteria 649
1088 Ga0207711_11636323 3300025941 Bacteria 587
1089 Ga0207689_10003227 3300025942 Bacteria 14940
1090 Ga0207689_10004890 3300025942 Bacteria 12082
1091 Ga0207689_10011199 3300025942 Bacteria 7695
1092 Ga0207689_10050098 3300025942 Bacteria 3444
1093 Ga0207689_10739299 3300025942 Bacteria 830
1094 Ga0207661_10018577 3300025944 Bacteria 5167
1095 Ga0207661_10023815 3300025944 Bacteria 4631
1096 Ga0207661_10155987 3300025944 Bacteria 1977
1097 Ga0207661_10210058 3300025944 Bacteria 1715
1098 Ga0207661_10272210 3300025944 Bacteria 1511
1099 Ga0207661_10325061 3300025944 Bacteria 1383
1100 Ga0207661_11856490 3300025944 Bacteria 548
1101 Ga0207679_10000046 3300025945 Bacteria 119975
1102 Ga0207679_10003550 3300025945 Bacteria 9658
1103 Ga0207679_10004596 3300025945 Bacteria 8589
1104 Ga0207679_10006358 3300025945 Bacteria 7466
1105 Ga0207679_10032735 3300025945 Bacteria 3653
1106 Ga0207679_10384382 3300025945 Bacteria 1231
1107 Ga0207679_10915645 3300025945 Bacteria 802
1108 Ga0207679_11007552 3300025945 Bacteria 763
1109 Ga0207679_11128903 3300025945 Bacteria 719
1110 Ga0207667_10001575 3300025949 Bacteria 28681
1111 Ga0207667_10007962 3300025949 Bacteria 12641
1112 Ga0207667_10119555 3300025949 Bacteria 2715
1113 Ga0207667_10149382 3300025949 Bacteria 2405
1114 Ga0207667_10157361 3300025949 Bacteria 2338
1115 Ga0207667_10338873 3300025949 Bacteria 1535
1116 Ga0207667_10515707 3300025949 Bacteria 1211
1117 Ga0207667_10718035 3300025949 Bacteria 1001
1118 Ga0207667_11304817 3300025949 Bacteria 702
1119 Ga0207667_12177179 3300025949 Bacteria 512
1120 Ga0207651_10000214 3300025960 Bacteria 24891
1121 Ga0207651_10001380 3300025960 Bacteria 11003
1122 Ga0207651_10019572 3300025960 Bacteria 4060
1123 Ga0207651_10037055 3300025960 Bacteria 3191
1124 Ga0207651_10044521 3300025960 Bacteria 2971
1125 Ga0207651_10056540 3300025960 Bacteria 2701
1126 Ga0207651_10175668 3300025960 Bacteria 1694
1127 Ga0207651_10653343 3300025960 Bacteria 923
1128 Ga0207712_10000512 3300025961 Bacteria 32105
1129 Ga0207712_10035776 3300025961 Bacteria 3377
1130 Ga0207712_10109076 3300025961 Bacteria 2073
1131 Ga0207712_10501542 3300025961 Bacteria 1038
1132 Ga0207712_11005794 3300025961 Bacteria 740
1133 Ga0207668_10000537 3300025972 Bacteria 23803
1134 Ga0207668_10088546 3300025972 Bacteria 2267
1135 Ga0207668_10089016 3300025972 Bacteria 2262
1136 Ga0207668_10114557 3300025972 Bacteria 2029
1137 Ga0207668_10278308 3300025972 Bacteria 1371
1138 Ga0207640_10002737 3300025981 Bacteria 9439
1139 Ga0207640_10004765 3300025981 Bacteria 7364
1140 Ga0207640_10244052 3300025981 Bacteria 1390
1141 Ga0207640_10332954 3300025981 Bacteria 1213
1142 Ga0207640_10733543 3300025981 Bacteria 850
1143 Ga0207640_11380651 3300025981 Bacteria 631
1144 Ga0207640_11501123 3300025981 Bacteria 605
1145 Ga0207658_10011593 3300025986 Bacteria 6000
1146 Ga0207658_10027595 3300025986 Bacteria 3990
1147 Ga0207658_10055880 3300025986 Bacteria 2927
1148 Ga0207658_10094771 3300025986 Bacteria 2324
1149 Ga0207658_10179602 3300025986 Bacteria 1750
1150 Ga0207658_10377691 3300025986 Bacteria 1240
1151 Ga0207658_10506001 3300025986 Bacteria 1076
1152 Ga0207658_11163101 3300025986 Bacteria 705
1153 Ga0207677_10000212 3300026023 Bacteria 46475
1154 Ga0207677_10006404 3300026023 Bacteria 6456
1155 Ga0207677_10037467 3300026023 Bacteria 3170
1156 Ga0207677_10047121 3300026023 Bacteria 2892
1157 Ga0207677_10146436 3300026023 Bacteria 1816
1158 Ga0207677_10502649 3300026023 Bacteria 1048
1159 Ga0207677_10817633 3300026023 Bacteria 835
1160 Ga0207703_10000940 3300026035 Bacteria 28248
1161 Ga0207703_10012140 3300026035 Bacteria 6713
1162 Ga0207703_10023508 3300026035 Bacteria 4842
1163 Ga0207703_10025491 3300026035 Bacteria 4651
1164 Ga0207703_10729671 3300026035 Bacteria 943
1165 Ga0207703_11555631 3300026035 Bacteria 636
1166 Ga0207639_10002004 3300026041 Bacteria 13735
1167 Ga0207639_10003900 3300026041 Bacteria 10058
1168 Ga0207639_10008828 3300026041 Bacteria 6928
1169 Ga0207639_10078544 3300026041 Bacteria 2605
1170 Ga0207639_10166064 3300026041 Bacteria 1865
1171 Ga0207639_10284988 3300026041 Bacteria 1454
1172 Ga0207639_10313275 3300026041 Bacteria 1391
1173 Ga0207639_10779085 3300026041 Bacteria 890
1174 Ga0207639_10836512 3300026041 Bacteria 859
1175 Ga0207639_11668184 3300026041 Bacteria 597
1176 Ga0207678_10004864 3300026067 Bacteria 12062
1177 Ga0207678_10007136 3300026067 Bacteria 9914
1178 Ga0207678_10015442 3300026067 Bacteria 6713
1179 Ga0207678_10018849 3300026067 Bacteria 6061
1180 Ga0207678_10132741 3300026067 Bacteria 2125
1181 Ga0207678_10428106 3300026067 Bacteria 1148
1182 Ga0207678_10569758 3300026067 Bacteria 991
1183 Ga0207678_10842087 3300026067 Bacteria 810
1184 Ga0207708_10058304 3300026075 Bacteria 2946
1185 Ga0207708_10102657 3300026075 Bacteria 2214
1186 Ga0207708_10368662 3300026075 Bacteria 1182
1187 Ga0207708_11514822 3300026075 Bacteria 589
1188 Ga0207702_10002642 3300026078 Bacteria 16821
1189 Ga0207702_10003362 3300026078 Bacteria 14663
1190 Ga0207702_10278000 3300026078 Bacteria 1582
1191 Ga0207702_10288004 3300026078 Bacteria 1555
1192 Ga0207702_10313681 3300026078 Bacteria 1492
1193 Ga0207702_11060320 3300026078 Bacteria 804
1194 Ga0207702_11182518 3300026078 Bacteria 759
1195 Ga0207702_11188339 3300026078 Bacteria 757
1196 Ga0207702_11493070 3300026078 Bacteria 669
1197 Ga0207702_11706858 3300026078 Bacteria 622
1198 Ga0207702_11958096 3300026078 Bacteria 577
1199 Ga0207702_12526250 3300026078 Bacteria 500
1200 Ga0207641_10001370 3300026088 Bacteria 24094
1201 Ga0207641_10026578 3300026088 Bacteria 4778
1202 Ga0207641_10031392 3300026088 Bacteria 4407
1203 Ga0207641_10037513 3300026088 Bacteria 4048
1204 Ga0207641_10238727 3300026088 Bacteria 1692
1205 Ga0207648_10001508 3300026089 Bacteria 25663
1206 Ga0207648_10002036 3300026089 Bacteria 22064
1207 Ga0207648_10003734 3300026089 Bacteria 15928
1208 Ga0207648_10012603 3300026089 Bacteria 7910
1209 Ga0207648_10104232 3300026089 Bacteria 2487
1210 Ga0207648_10463942 3300026089 Bacteria 1155
1211 Ga0207648_10703749 3300026089 Bacteria 936
1212 Ga0207648_11048167 3300026089 Bacteria 764
1213 Ga0207676_10005710 3300026095 Bacteria 8806
1214 Ga0207676_10009322 3300026095 Bacteria 6984
1215 Ga0207676_10010200 3300026095 Bacteria 6683
1216 Ga0207676_10026092 3300026095 Bacteria 4342
1217 Ga0207676_10047503 3300026095 Bacteria 3327
1218 Ga0207676_11139697 3300026095 Bacteria 772
1219 Ga0207676_11293707 3300026095 Bacteria 724
1220 Ga0207674_10049405 3300026116 Bacteria 4302
1221 Ga0207674_10101631 3300026116 Bacteria 2855
1222 Ga0207674_10152530 3300026116 Bacteria 2267
1223 Ga0207674_10420880 3300026116 Bacteria 1291
1224 Ga0207674_11089683 3300026116 Bacteria 768
1225 Ga0207675_100000552 3300026118 Bacteria 36552
1226 Ga0207675_100041297 3300026118 Bacteria 4308
1227 Ga0207675_100310205 3300026118 Bacteria 1538
1228 Ga0207675_100759538 3300026118 Bacteria 981
1229 Ga0207683_10000010 3300026121 Bacteria 150106
1230 Ga0207683_10003043 3300026121 Bacteria 14660
1231 Ga0207683_10004012 3300026121 Bacteria 12736
1232 Ga0207683_10004449 3300026121 Bacteria 12105
1233 Ga0207683_10007349 3300026121 Bacteria 9441
1234 Ga0207683_10032902 3300026121 Bacteria 4505
1235 Ga0207683_12114743 3300026121 Bacteria 511
1236 Ga0207698_10000086 3300026142 Bacteria 61523
1237 Ga0207698_10007930 3300026142 Bacteria 6690
1238 Ga0207698_10015085 3300026142 Bacteria 5163
1239 Ga0207698_10017117 3300026142 Bacteria 4909
1240 Ga0207698_10029650 3300026142 Bacteria 3922
1241 Ga0207698_10047047 3300026142 Bacteria 3264
1242 Ga0207698_10236695 3300026142 Bacteria 1661
1243 Ga0207698_10449346 3300026142 Bacteria 1244
1244 Ga0207698_10499383 3300026142 Bacteria 1184
1245 Ga0207698_10819944 3300026142 Bacteria 934
1246 Ga0207698_11093502 3300026142 Bacteria 810
1247 Ga0207698_11335979 3300026142 Bacteria 732
1248 Ga0207698_11467696 3300026142 Bacteria 697
1249 Ga0207698_11809248 3300026142 Bacteria 626
1250 Ga0207698_11973766 3300026142 Bacteria 598
1251 Ga0207698_12095736 3300026142 Bacteria 579
1252 Ga0207698_12392163 3300026142 Bacteria 539
1253 Ga0209969_1001288 3300027360 Bacteria 3451
1254 Ga0209967_1011091 3300027364 Bacteria 1261
1255 Ga0209967_1024941 3300027364 Bacteria 883
1256 Ga0209981_1008718 3300027378 Bacteria 1377
1257 Ga0209981_1012434 3300027378 Bacteria 1179
1258 Ga0209996_1026772 3300027395 Bacteria 828
1259 Ga0209984_1002948 3300027424 Bacteria 1925
1260 Ga0210000_1006874 3300027462 Bacteria 1660
1261 Ga0210000_1032288 3300027462 Bacteria 821
1262 Ga0209968_1082878 3300027526 Bacteria 578
1263 Ga0209999_1001111 3300027543 Bacteria 4596
1264 Ga0209999_1004725 3300027543 Bacteria 2447
1265 Ga0209999_1114876 3300027543 Bacteria 527
1266 Ga0209982_1002455 3300027552 Bacteria 2604
1267 Ga0209970_1003037 3300027614 Bacteria 2830
1268 Ga0209970_1006403 3300027614 Bacteria 1930
1269 Ga0210002_1001809 3300027617 Bacteria 3045
1270 Ga0209983_1003000 3300027665 Bacteria 3639
1271 Ga0209983_1003857 3300027665 Bacteria 3176
1272 Ga0209971_1002883 3300027682 Bacteria 4110
1273 Ga0209971_1050177 3300027682 Bacteria 1008
1274 Ga0209966_1001182 3300027695 Bacteria 4666
1275 Ga0209998_10088350 3300027717 Bacteria 757
1276 Ga0209813_10031067 3300027866 Bacteria 1574
1277 Ga0209974_10025130 3300027876 Bacteria 1972
1278 Ga0209974_10046397 3300027876 Bacteria 1453
1279 Ga0207428_10000082 3300027907 Bacteria 133684
1280 Ga0207428_10087415 3300027907 Bacteria 2425
1281 Ga0207428_10206692 3300027907 Bacteria 1476
1282 Ga0268266_10006793 3300028379 Bacteria 10427
1283 Ga0268266_10016359 3300028379 Bacteria 6341
1284 Ga0268266_10031400 3300028379 Bacteria 4510
1285 Ga0268266_10117705 3300028379 Bacteria 2361
1286 Ga0268266_10147525 3300028379 Bacteria 2117
1287 Ga0268266_10457351 3300028379 Bacteria 1214
1288 Ga0268266_10715821 3300028379 Bacteria 965
1289 Ga0268266_11160095 3300028379 Bacteria 747
1290 Ga0268265_10000817 3300028380 Bacteria 29538
1291 Ga0268265_10039327 3300028380 Bacteria 3486
1292 Ga0268265_10084203 3300028380 Bacteria 2520
1293 Ga0268265_10904141 3300028380 Bacteria 867
1294 Ga0268265_11222801 3300028380 Bacteria 749
1295 Ga0268264_10001227 3300028381 Bacteria 24655
1296 Ga0268264_10016466 3300028381 Bacteria 6053
1297 Ga0268264_10213102 3300028381 Bacteria 1774
1298 Ga0268264_10301638 3300028381 Bacteria 1508
1299 Ga0268264_10764745 3300028381 Bacteria 963
1300 Ga0268264_11006952 3300028381 Bacteria 840
1301 Ga0268264_11575188 3300028381 Bacteria 668
1302 Ga0265319_1242520 3300028563 Bacteria 550
1303 Ga0265334_10000295 3300028573 Bacteria 27889
1304 Ga0265334_10052011 3300028573 Bacteria 1569
1305 Ga0265318_10278608 3300028577 Bacteria 610
1306 Ga0265338_10000409 3300028800 Bacteria 76989
1307 Ga0265338_10681684 3300028800 Bacteria 710
1308 Ga0265775_107380 3300030762 Bacteria 659
1309 Ga0265330_10193759 3300031235 Bacteria 860
1310 Ga0265325_10000043 3300031241 Bacteria 89158
1311 Ga0265325_10070091 3300031241 Bacteria 1762
1312 Ga0265340_10399095 3300031247 Bacteria 607
1313 Ga0265340_10442845 3300031247 Bacteria 572
1314 Ga0265339_10118890 3300031249 Bacteria 1360
1315 Ga0265339_10445323 3300031249 Bacteria 602
1316 Ga0265316_10197680 3300031344 Bacteria 1492
1317 Ga0265316_10253914 3300031344 Bacteria 1290
1318 Ga0265316_10268766 3300031344 Bacteria 1248
1319 Ga0265316_10859958 3300031344 Bacteria 634
1320 Ga0307513_10020341 3300031456 Bacteria 7876
1321 Ga0265313_10011598 3300031595 Bacteria 5467
1322 Ga0265313_10070035 3300031595 Bacteria 1617
1323 Ga0307508_10326921 3300031616 Bacteria 1125
1324 Ga0316575_10009680 3300031665 Bacteria 3531
1325 Ga0316575_10019501 3300031665 Bacteria 2594
1326 Ga0316575_10150158 3300031665 Bacteria 961
1327 Ga0316579_10006229 3300031691 Bacteria 4858
1328 Ga0316579_10051146 3300031691 Bacteria 1933
1329 Ga0316579_10057999 3300031691 Bacteria 1819
1330 Ga0265314_10017254 3300031711 Bacteria 5672
1331 Ga0265342_10000417 3300031712 Bacteria 46743
1332 Ga0265342_10309079 3300031712 Bacteria 831
1333 Ga0316576_10116527 3300031727 Bacteria 2005
1334 Ga0316576_10121021 3300031727 Bacteria 1965
1335 Ga0316576_10216041 3300031727 Bacteria 1443
1336 Ga0316576_10314598 3300031727 Bacteria 1169
1337 Ga0316576_10386003 3300031727 Bacteria 1039
1338 Ga0316576_10819654 3300031727 Bacteria 669
1339 Ga0316578_10001340 3300031728 Bacteria 9899
1340 Ga0316578_10018543 3300031728 Bacteria 3817
1341 Ga0316578_10127409 3300031728 Bacteria 1531
1342 Ga0316578_10326112 3300031728 Bacteria 916
1343 Ga0307405_10356009 3300031731 Bacteria 1131
1344 Ga0307405_10688390 3300031731 Bacteria 845
1345 Ga0307405_11031693 3300031731 Bacteria 703
1346 Ga0316577_10002986 3300031733 Bacteria 8465
1347 Ga0316577_10019529 3300031733 Bacteria 3751
1348 Ga0316577_10039954 3300031733 Bacteria 2624
1349 Ga0316577_10379747 3300031733 Bacteria 803
1350 Ga0316577_10903851 3300031733 Bacteria 500
1351 Ga0307413_10102597 3300031824 Bacteria 1894
1352 Ga0307413_10306424 3300031824 Bacteria 1207
1353 Ga0307413_11205537 3300031824 Bacteria 658
1354 Ga0307406_10265111 3300031901 Bacteria 1302
1355 Ga0307406_10299972 3300031901 Bacteria 1234
1356 Ga0307406_10749990 3300031901 Bacteria 819
1357 Ga0307406_11076450 3300031901 Bacteria 693
1358 Ga0307407_10577904 3300031903 Bacteria 834
1359 Ga0307407_10777738 3300031903 Bacteria 727
1360 Ga0307412_10063803 3300031911 Bacteria 2487
1361 Ga0307412_11089558 3300031911 Bacteria 710
1362 Ga0307412_12087721 3300031911 Bacteria 526
1363 Ga0307409_100018222 3300031995 Bacteria 4711
1364 Ga0307409_101341792 3300031995 Bacteria 741
1365 Ga0307409_101855116 3300031995 Bacteria 632
1366 Ga0307409_102855072 3300031995 Bacteria 510
1367 Ga0307416_100490663 3300032002 Bacteria 1290
1368 Ga0307416_100685740 3300032002 Bacteria 1112
1369 Ga0307416_100699197 3300032002 Bacteria 1103
1370 Ga0307414_10357215 3300032004 Bacteria 1256
1371 Ga0307414_10622995 3300032004 Bacteria 970
1372 Ga0307414_10876922 3300032004 Bacteria 822
1373 Ga0307411_10172328 3300032005 Bacteria 1633
1374 Ga0307411_10293135 3300032005 Bacteria 1301
1375 Ga0307411_10307152 3300032005 Bacteria 1275
1376 Ga0307411_10501367 3300032005 Bacteria 1026
1377 Ga0307411_11983072 3300032005 Bacteria 543
1378 Ga0307415_100384934 3300032126 Bacteria 1192
1379 Ga0316583_10034064 3300032133 Bacteria 1807
1380 Ga0316583_10035108 3300032133 Bacteria 1779
1381 Ga0316583_10036633 3300032133 Bacteria 1740
1382 Ga0316585_10001610 3300032137 Bacteria 5982
1383 Ga0316585_10035680 3300032137 Bacteria 1575
1384 Ga0316580_10015835 3300032139 Bacteria 2309
1385 Ga0316580_10204428 3300032139 Bacteria 609
1386 Ga0316593_10003203 3300032168 Bacteria 4023
1387 Ga0316593_10016699 3300032168 Bacteria 2229
1388 Ga0316593_10019580 3300032168 Bacteria 2092
1389 Ga0316593_10032057 3300032168 Bacteria 1715
1390 Ga0316593_10037266 3300032168 Bacteria 1606
1391 Ga0316593_10063144 3300032168 Bacteria 1269
1392 Ga0316593_10181101 3300032168 Bacteria 775
1393 Ga0316593_10195267 3300032168 Bacteria 747
1394 Ga0316593_10236833 3300032168 Bacteria 680
1395 Ga0316593_10324047 3300032168 Bacteria 586
1396 Ga0316592_1050128 3300033524 Bacteria 932
1397 Ga0316592_1096363 3300033524 Bacteria 679
1398 Ga0316592_1102111 3300033524 Bacteria 660
1399 Ga0316586_1072608 3300033527 Bacteria 635
1400 Ga0316586_1077255 3300033527 Bacteria 619
1401 Ga0316586_1098468 3300033527 Bacteria 557
1402 Ga0316588_1003589 3300033528 Bacteria 2851
1403 Ga0316588_1063921 3300033528 Bacteria 900
1404 Ga0316588_1130965 3300033528 Bacteria 638
1405 Ga0316587_1011564 3300033529 Bacteria 1426
1406 Ga0316587_1042868 3300033529 Bacteria 820
1407 Ga0316587_1052693 3300033529 Bacteria 747
1408 Ga0316587_1053284 3300033529 Bacteria 743
1409 Ga0316587_1060900 3300033529 Bacteria 699
1410 Ga0316587_1066617 3300033529 Bacteria 671
1411 Ga0316587_1068580 3300033529 Bacteria 663
1412 Ga0316587_1070462 3300033529 Bacteria 654
1413 Ga0316587_1074048 3300033529 Bacteria 639
1414 Ga0316587_1082102 3300033529 Bacteria 610
1415 Ga0316596_1002275 3300033541 Bacteria 4075
1416 Ga0316596_1022875 3300033541 Bacteria 1598
1417 Ga0316596_1033532 3300033541 Bacteria 1338
1418 Ga0316596_1070754 3300033541 Bacteria 934
1419 Ga0316596_1127341 3300033541 Bacteria 694
1420 Ga0316596_1141781 3300033541 Bacteria 658
1421 Ga0316596_1157461 3300033541 Bacteria 625
1422 Ga0316596_1170954 3300033541 Bacteria 600
1423 Ga0316596_1180345 3300033541 Bacteria 584
1424 Ga0373930_0002970 3300034816 Bacteria 2668
1425 Ga0373948_0000117 3300034817 Bacteria 8265
1426 Ga0373948_0060778 3300034817 Bacteria 829
1427 Ga0373948_0083666 3300034817 Bacteria 731
1428 Ga0373950_0000224 3300034818 Bacteria 7546
1429 Ga0373950_0024172 3300034818 Bacteria 1090
1430 Ga0373958_0000053 3300034819 Bacteria 11207
1431 Ga0373958_0011792 3300034819 Bacteria 1484
1432 Ga0373959_0000295 3300034820 Bacteria 10603
1433 Ga0373938_0002791 3300034957 Bacteria 2816
1434 Ga0373938_0045951 3300034957 Bacteria 984
1435 Ga0373938_0060371 3300034957 Bacteria 885
1436 Ga0373926_0006274 3300035083 Bacteria 3946
1437 Ga0373926_0037624 3300035083 Bacteria 1721
1438 Ga0373928_0016467 3300035084 Bacteria 1513
1439 Ga0373929_0000961 3300035085 Bacteria 5594
1440 Ga0373929_0007665 3300035085 Bacteria 1975
1441 Ga0373934_0013852 3300035086 Bacteria 3051
1442 Ga0373934_0292246 3300035086 Bacteria 675
1443 Ga0373940_0025371 3300035088 Bacteria 1543
1444 Ga0373940_0032827 3300035088 Bacteria 1393
1445 Ga0373940_0081877 3300035088 Bacteria 955
1446 Ga0373944_0003334 3300035089 Bacteria 4138
1447 Ga0373944_0007277 3300035089 Bacteria 2961
1448 Ga0373949_0016985 3300035090 Bacteria 1636
1449 Ga0373949_0103708 3300035090 Bacteria 782
1450 Ga0373951_0023631 3300035091 Bacteria 1420
1451 Ga0373951_0038591 3300035091 Bacteria 1145
1452 Ga0373952_0007306 3300035092 Bacteria 2066
1453 Ga0373952_0037647 3300035092 Bacteria 1104
1454 Ga0373923_0007076 3300035111 Bacteria 3924
1455 Ga0373923_0046637 3300035111 Bacteria 1803
1456 Ga0373923_0396465 3300035111 Bacteria 664
1457 Ga0373932_0024159 3300035112 Bacteria 1633
1458 Ga0373932_0110418 3300035112 Bacteria 906
1459 Ga0373936_0005552 3300035113 Bacteria 4761
1460 Ga0373939_0031296 3300035114 Bacteria 1537
1461 Ga0373939_0047406 3300035114 Bacteria 1319
1462 Ga0373939_0048780 3300035114 Bacteria 1306
1463 Ga0373939_0061339 3300035114 Bacteria 1198
1464 Ga0373939_0196840 3300035114 Bacteria 760
1465 Ga0373939_0301945 3300035114 Bacteria 638
1466 Ga0373939_0396955 3300035114 Bacteria 571
1467 Ga0373941_0003204 3300035115 Bacteria 3678
1468 Ga0373941_0004229 3300035115 Bacteria 3300
1469 Ga0373941_0062605 3300035115 Bacteria 1215
1470 Ga0373941_0152644 3300035115 Bacteria 849
1471 Ga0373945_0001310 3300035116 Bacteria 7546
1472 Ga0373945_0043279 3300035116 Bacteria 1633
1473 Ga0373953_0001186 3300035117 Bacteria 7410
1474 Ga0373953_0052698 3300035117 Bacteria 1647
1475 Ga0373953_0126621 3300035117 Bacteria 1087
1476 Ga0373953_0159593 3300035117 Bacteria 969
1477 Ga0373954_0004854 3300035118 Bacteria 5800
1478 Ga0373954_0050560 3300035118 Bacteria 1950
1479 Ga0373954_0340931 3300035118 Bacteria 740
1480 Ga0373956_0021954 3300035119 Bacteria 2726
1481 Ga0373956_0088421 3300035119 Bacteria 1427
1482 Ga0373956_0105376 3300035119 Bacteria 1310
1483 Ga0373956_0123385 3300035119 Bacteria 1210
1484 Ga0373957_0304241 3300035120 Bacteria 676
1485 Ga0373957_0324141 3300035120 Bacteria 655
1486 Ga0373957_0389196 3300035120 Bacteria 599
1487 Ga0373960_0051086 3300035121 Bacteria 1227
1488 Ga0373960_0060028 3300035121 Bacteria 1151
1489 Ga0373943_0008559 3300035170 Bacteria 4586
1490 Ga0373946_0041938 3300035171 Bacteria 1879
1491 Ga0373946_0184145 3300035171 Bacteria 992
1492 Ga0373955_0009863 3300035172 Bacteria 4492
1493 Ga0373955_0377997 3300035172 Bacteria 859
1494 Ga0373955_0452757 3300035172 Bacteria 782
1495 Ga0373942_0016976 3300035207 Bacteria 1790
1496 Ga0373942_0050409 3300035207 Bacteria 1165
1497 Ga0373942_0127742 3300035207 Bacteria 799
1498 Ga0373942_0154622 3300035207 Bacteria 738
1499 Ga0373961_0003260 3300035241 Bacteria 4042
1500 Ga0373961_0006660 3300035241 Bacteria 2777
1501 Ga0373961_0014900 3300035241 Bacteria 1980
1502 Ga0373961_0387327 3300035241 Bacteria 534
1503 Ga0373962_0022813 3300035242 Bacteria 1662
1504 Ga0373962_0025696 3300035242 Bacteria 1582
1505 Ga0373962_0102127 3300035242 Bacteria 895
1506 Ga0316574_0000656 3300035398 Bacteria 14547
1507 Ga0316574_0028331 3300035398 Bacteria 3378
1508 Ga0316574_0091258 3300035398 Bacteria 1942
1509 Ga0316574_0114342 3300035398 Bacteria 1730
1510 Ga0316574_0186637 3300035398 Bacteria 1333
1511 Ga0316574_0222818 3300035398 Bacteria 1208
1512 Ga0316574_0491967 3300035398 Bacteria 765
1513 Ga0373924_0006926 3300035410 Bacteria 4079
1514 Ga0373924_0061878 3300035410 Bacteria 1567
1515 Ga0373924_0130223 3300035410 Bacteria 1094
1516 Ga0373924_0209701 3300035410 Bacteria 860
1517 Ga0373924_0364235 3300035410 Bacteria 645
1518 Ga0373931_0085163 3300035691 Bacteria 1751
1519 Ga0373931_0173763 3300035691 Bacteria 1271
1520 Ga0373931_0343629 3300035691 Bacteria 932
1521 Ga0373931_0395368 3300035691 Bacteria 874
1522 Ga0373935_0116625 3300035692 Bacteria 1779
1523 Ga0373935_0116801 3300035692 Bacteria 1777
1524 Ga0373935_0210671 3300035692 Bacteria 1346
1525 Ga0373935_0442047 3300035692 Bacteria 938
1526 Ga0373935_0538016 3300035692 Bacteria 851
1527 Ga0373927_0035890 3300035695 Bacteria 3225
1528 Ga0373927_0066394 3300035695 Bacteria 2333
1529 Ga0373933_0001224 3300035724 Bacteria 15196
1530 Ga0373933_0013762 3300035724 Bacteria 4488
1531 Ga0373933_0024904 3300035724 Bacteria 3429
1532 Ga0373933_0224576 3300035724 Bacteria 1205
1533 Ga0373933_0969783 3300035724 Bacteria 560
1534 Ga0373933_1001965 3300035724 Bacteria 550
1535 Ga0373947_0062720 3300035725 Bacteria 2263
1536 Ga0373947_0248962 3300035725 Bacteria 1174
1537 Ga0373947_1012894 3300035725 Bacteria 566
1538 Ga0373937_0000849 3300036401 Bacteria 26229
1539 Ga0373937_0034021 3300036401 Bacteria 4633
1540 Ga0373937_0047581 3300036401 Bacteria 3924
1541 Ga0373937_0136986 3300036401 Bacteria 2289
1542 Ga0373937_0436988 3300036401 Bacteria 1242
1543 Ga0373937_0480437 3300036401 Bacteria 1180
1544 Ga0373937_1348213 3300036401 Bacteria 661
1545 Ga0373937_1704295 3300036401 Bacteria 577
1546 Ga0316582_0012819 3300036647 Bacteria 4695
1547 Ga0316582_0021843 3300036647 Bacteria 3789
1548 Ga0316582_0028998 3300036647 Bacteria 3357
1549 Ga0316582_0051646 3300036647 Bacteria 2609
1550 Ga0316582_0059421 3300036647 Bacteria 2448
1551 Ga0316582_0070995 3300036647 Bacteria 2254
1552 Ga0316582_0140660 3300036647 Bacteria 1627
1553 Ga0316582_0506191 3300036647 Bacteria 832
1554 Ga0316584_0029992 3300036712 Bacteria 4017
1555 Ga0316584_0031836 3300036712 Bacteria 3900
1556 Ga0316584_0040828 3300036712 Bacteria 3457
1557 Ga0316584_0054443 3300036712 Bacteria 2994
1558 Ga0316584_0066848 3300036712 Bacteria 2694
1559 Ga0316584_0090735 3300036712 Bacteria 2287
1560 Ga0316584_0183729 3300036712 Bacteria 1547
1561 Ga0316584_1031178 3300036712 Bacteria 548
1562 Ga0373925_0042182 3300037068 Bacteria 3384
1563 Ga0373925_0104468 3300037068 Bacteria 2181
1564 Ga0373925_0138738 3300037068 Bacteria 1902
1565 Ga0395899_0165840 3300037312 Bacteria 1558
1566 Ga0395899_0461093 3300037312 Bacteria 830
1567 Ga0395900_0030469 3300037418 Bacteria 5540
1568 Ga0395900_0723577 3300037418 Bacteria 927
1569 Ga0395898_0054212 3300037466 Bacteria 3913
1570 Ga0395898_0177855 3300037466 Bacteria 2033
1571 Ga0395905_0000002 3300037471 Bacteria 1356358
1572 Ga0316581_0018561 3300037588 Bacteria 2021
1573 Ga0316581_0037013 3300037588 Bacteria 1482
1574 Ga0316581_0040259 3300037588 Bacteria 1423
1575 Ga0316581_0151787 3300037588 Bacteria 714
1576 Ga0436364_0700652 3300037853 Bacteria 792
1577 Ga0395901_0096101 3300038443 Bacteria 3105
1578 Ga0395901_0635615 3300038443 Bacteria 1072
1579 Ga0400484_34694 3300038725 Bacteria 3403
1580 Ga0400490_39445 3300038726 Bacteria 3074
1581 Ga0400490_51845 3300038726 Bacteria 3760
1582 Ga0400490_56549 3300038726 Bacteria 9639
1583 Ga0400491_07068 3300038727 Bacteria 1498
1584 Ga0400491_11788 3300038727 Bacteria 1066
1585 Ga0400485_17515 3300038735 Bacteria 1515
1586 Ga0400488_37652 3300038741 Bacteria 2153
1587 Ga0400488_49707 3300038741 Bacteria 2020
1588 Ga0400488_53412 3300038741 Bacteria 1059
1589 Ga0400488_54334 3300038741 Bacteria 1383
1590 Ga0242420_015008 3300038996 Bacteria 1336
1591 Ga0400483_065089 3300039062 Bacteria 1661
1592 Ga0400483_067781 3300039062 Bacteria 1150
1593 Ga0400483_190225 3300039062 Bacteria 3334
1594 Ga0400483_244454 3300039062 Bacteria 3198
1595 Ga0400489_39930 3300039093 Bacteria 3230
1596 Ga0400487_09678 3300039110 Bacteria 1999
1597 Ga0400487_49956 3300039110 Bacteria 1338
1598 Ga0436365_0227448 3300039437 Bacteria 816
1599 Ga0436365_0227568 3300039437 Bacteria 4425
1600 Ga0436360_1080288 3300039438 Bacteria 1001
1601 Ga0436361_0127677 3300039447 Bacteria 2795
1602 Ga0451791_0660728 3300041451 Bacteria 830
1603 Ga0451793_1808283 3300041452 Bacteria 1468
1604 Ga0451807_0884989 3300041486 Bacteria 779
1605 Ga0451847_0069475 3300041503 Unclassified 535
1606 Ga0451843_0176270 3300041509 Bacteria 982
1607 Ga0439441_113674 3300042001 Bacteria 616
1608 Ga0439441_117533 3300042001 Bacteria 607
1609 Ga0439448_0030987 3300042005 Bacteria 1698
1610 Ga0439455_0016936 3300042012 Bacteria 1691
1611 Ga0439455_0224523 3300042012 Bacteria 547
1612 Ga0439463_081108 3300042016 Bacteria 834
1613 Ga0450898_019218 3300042134 Bacteria 1190
1614 Ga0450902_000129 3300042137 Bacteria 8189
1615 Ga0450905_001225 3300042142 Bacteria 3255
1616 Ga0439458_0028953 3300042157 Bacteria 1313
1617 Ga0450908_070369 3300042184 Bacteria 621
1618 Ga0439435_0033180 3300042436 Bacteria 1412
1619 Ga0439444_0135382 3300042437 Bacteria 586
1620 Ga0439459_0063962 3300042438 Bacteria 837
1621 Ga0439464_0017743 3300042439 Bacteria 1932
1622 Ga0450893_0037904 3300042532 Bacteria 876
1623 Ga0450901_005170 3300042533 Bacteria 1343
1624 Ga0451577_0052576 3300042876 Bacteria 3637
1625 Ga0451577_0165426 3300042876 Bacteria 1992
1626 Ga0451577_0766331 3300042876 Bacteria 872
1627 Ga0451577_1347734 3300042876 Bacteria 634
1628 Ga0453683_0113707 3300044673 Bacteria 1703
1629 Ga0453683_0823317 3300044673 Bacteria 612
1630 Ga0466965_0210906 3300044683 Bacteria 1033
1631 Ga0466966_0091758 3300044684 Bacteria 1885
1632 Ga0466961_0150592 3300044693 Bacteria 1453
1633 Ga0466963_0001905 3300044694 Bacteria 11411
1634 Ga0466963_0447515 3300044694 Bacteria 911
1635 Ga0453684_0271593 3300044712 Bacteria 1937
1636 Ga0453684_0275710 3300044712 Bacteria 1920
1637 Ga0453684_1405627 3300044712 Bacteria 723
1638 Ga0466971_0027572 3300044719 Bacteria 2545
1639 Ga0466971_0297536 3300044719 Bacteria 774
1640 Ga0466971_0401466 3300044719 Bacteria 668
1641 Ga0466970_0382954 3300044765 Bacteria 801
1642 Ga0466957_0095267 3300044842 Bacteria 1869
1643 Ga0466957_0108577 3300044842 Bacteria 1757
1644 Ga0466957_0310599 3300044842 Bacteria 1061
1645 Ga0466960_0064485 3300044901 Bacteria 1807
1646 Ga0466959_0243074 3300045049 Bacteria 1243
1647 Ga0451576_0029113 3300045051 Bacteria 5911
1648 Ga0451576_0125728 3300045051 Bacteria 2672
1649 Ga0451576_1096283 3300045051 Bacteria 833
1650 Ga0451576_1814892 3300045051 Bacteria 630
1651 Ga0451576_2062754 3300045051 Bacteria 587
1652 Ga0466958_0262088 3300045836 Bacteria 1106
1653 Ga0466958_0294067 3300045836 Bacteria 1042
1654 Ga0466958_0878338 3300045836 Bacteria 585
1655 Ga0466967_0001722 3300045976 Bacteria 13037
1656 Ga0466967_0621687 3300045976 Bacteria 1067
1657 Ga0466967_2254810 3300045976 Bacteria 540
1658 Ga0495617_013564 3300046452 Bacteria 2774
1659 Ga0495617_043452 3300046452 Bacteria 1500
1660 Ga0495627_000094 3300046453 Bacteria 108256
1661 Ga0495627_000391 3300046453 Bacteria 39764
1662 Ga0495592_0002856 3300046454 Bacteria 12273
1663 Ga0495592_0031170 3300046454 Bacteria 4030
1664 Ga0495603_0033576 3300046455 Bacteria 3087
1665 Ga0495603_0207612 3300046455 Bacteria 1131
1666 Ga0495591_053196 3300046458 Bacteria 1099
1667 Ga0495629_0000062 3300046459 Bacteria 97169
1668 Ga0495629_0056444 3300046459 Bacteria 2745
1669 Ga0495629_0296766 3300046459 Bacteria 1107
1670 Ga0495629_0969950 3300046459 Bacteria 554
1671 Ga0495641_0053694 3300046461 Bacteria 1832
1672 Ga0495641_0247975 3300046461 Unclassified 800
1673 Ga0495651_0007412 3300046462 Bacteria 8390
1674 Ga0495651_0020865 3300046462 Bacteria 5085
1675 Ga0495651_0267190 3300046462 Bacteria 1161
1676 Ga0495651_0268733 3300046462 Bacteria 1157
1677 Ga0495653_0005558 3300046463 Bacteria 10277
1678 Ga0495653_0048987 3300046463 Bacteria 3258
1679 Ga0495653_0199896 3300046463 Bacteria 1357
1680 Ga0495650_0245057 3300046471 Bacteria 611
1681 Ga0495580_0006383 3300046472 Bacteria 9616
1682 Ga0495580_0077968 3300046472 Bacteria 2311
1683 Ga0495580_0092029 3300046472 Bacteria 2110
1684 Ga0495580_0225975 3300046472 Bacteria 1285
1685 Ga0495582_0019358 3300046473 Bacteria 3721
1686 Ga0495582_0138476 3300046473 Bacteria 1378
1687 Ga0495582_0173026 3300046473 Bacteria 1229
1688 Ga0495605_0007540 3300046474 Bacteria 6168
1689 Ga0495639_0008961 3300046475 Bacteria 4288
1690 Ga0495639_0043988 3300046475 Bacteria 2018
1691 Ga0495662_0006739 3300046476 Bacteria 5719
1692 Ga0495662_0022613 3300046476 Bacteria 3035
1693 Ga0495664_0293185 3300046477 Bacteria 982
1694 Ga0495664_0799181 3300046477 Bacteria 554
1695 Ga0495584_0021105 3300046491 Bacteria 3307
1696 Ga0495584_0118449 3300046491 Bacteria 1341
1697 Ga0495584_0130131 3300046491 Bacteria 1277
1698 Ga0495584_0267792 3300046491 Bacteria 868
1699 Ga0495584_0700538 3300046491 Bacteria 516
1700 Ga0495585_0002429 3300046492 Bacteria 13343
1701 Ga0495594_0142540 3300046499 Bacteria 1359
1702 Ga0495607_0003759 3300046501 Bacteria 11476
1703 Ga0495583_0040733 3300046506 Bacteria 2179
1704 Ga0495608_0001948 3300046511 Bacteria 14809
1705 Ga0495608_0276011 3300046511 Bacteria 1044
1706 Ga0495608_0732563 3300046511 Bacteria 587
1707 Ga0495610_0000886 3300046512 Bacteria 27808
1708 Ga0495616_0056878 3300046513 Bacteria 1930
1709 Ga0495618_0025063 3300046514 Bacteria 3700
1710 Ga0495618_0061003 3300046514 Bacteria 2391
1711 Ga0495620_0189770 3300046515 Bacteria 793
1712 Ga0495628_0009783 3300046516 Bacteria 8169
1713 Ga0495628_0366813 3300046516 Bacteria 1056
1714 Ga0495630_0120133 3300046517 Bacteria 1993
1715 Ga0495630_0138681 3300046517 Bacteria 1848
1716 Ga0495631_0367477 3300046518 Bacteria 612
1717 Ga0495631_0417591 3300046518 Bacteria 571
1718 Ga0495637_0077862 3300046520 Bacteria 1326
1719 Ga0495637_0218192 3300046520 Bacteria 695
1720 Ga0495644_0004855 3300046523 Bacteria 5279
1721 Ga0495648_0029415 3300046524 Bacteria 3647
1722 Ga0495663_0132536 3300046525 Bacteria 841
1723 Ga0495666_0082977 3300046526 Bacteria 1515
1724 Ga0495666_0104329 3300046526 Bacteria 1334
1725 Ga0495642_0137441 3300046528 Bacteria 1054
1726 Ga0495652_0023129 3300046529 Bacteria 5510
1727 Ga0495652_0093555 3300046529 Bacteria 2454
1728 Ga0495652_0271096 3300046529 Bacteria 1247
1729 Ga0495654_0089649 3300046530 Bacteria 1429
1730 Ga0495665_0010056 3300046531 Bacteria 5127
1731 Ga0495665_0034160 3300046531 Bacteria 2719
1732 Ga0495665_0113841 3300046531 Bacteria 1418
1733 Ga0495640_0127582 3300046533 Bacteria 1648
1734 Ga0495587_0012894 3300046536 Bacteria 5256
1735 Ga0495587_0073690 3300046536 Bacteria 1983
1736 Ga0495587_0250175 3300046536 Bacteria 996
1737 Ga0495598_0022419 3300046537 Bacteria 1690
1738 Ga0495621_0035985 3300046539 Bacteria 1716
1739 Ga0495621_0290289 3300046539 Bacteria 676
1740 Ga0495597_0123852 3300046542 Bacteria 1076
1741 Ga0495597_0222070 3300046542 Bacteria 750
1742 Ga0495645_0251612 3300046543 Bacteria 1174
1743 Ga0495645_0499474 3300046543 Bacteria 760
1744 Ga0495645_0576617 3300046543 Bacteria 694
1745 Ga0495622_0007792 3300046557 Bacteria 4973
1746 Ga0495622_0045046 3300046557 Bacteria 2050
1747 Ga0495622_0115509 3300046557 Bacteria 1227
1748 Ga0495633_0010414 3300046558 Bacteria 5073
1749 Ga0495667_0001067 3300046559 Bacteria 17817
1750 Ga0495667_0190073 3300046559 Bacteria 1316
1751 Ga0495656_0002593 3300046615 Bacteria 6029
1752 Ga0495668_0069169 3300046616 Bacteria 1942
1753 Ga0495668_0166571 3300046616 Bacteria 1207
1754 Ga0495634_0087401 3300046642 Bacteria 2028
1755 Ga0495634_0270406 3300046642 Bacteria 1034
1756 Ga0495611_0011534 3300046648 Bacteria 3748
1757 Ga0495611_0480115 3300046648 Bacteria 565
1758 Ga0495625_0377117 3300046660 Bacteria 891
1759 Ga0495635_0004976 3300046663 Bacteria 9253
1760 Ga0495635_0019587 3300046663 Bacteria 4715
1761 Ga0495635_0134022 3300046663 Bacteria 1688
1762 Ga0495635_0690255 3300046663 Bacteria 662
1763 Ga0495659_0006541 3300046664 Bacteria 3680
1764 Ga0495661_0140129 3300046665 Bacteria 1316
1765 Ga0495661_0270384 3300046665 Bacteria 860
1766 Ga0495588_0095190 3300046674 Bacteria 1561
1767 Ga0495588_0201425 3300046674 Bacteria 1051
1768 Ga0495657_0016143 3300046675 Bacteria 5445
1769 Ga0495657_0033154 3300046675 Bacteria 3598
1770 Ga0495657_0072227 3300046675 Bacteria 2251
1771 Ga0495657_0080448 3300046675 Bacteria 2109
1772 Ga0495599_0002423 3300046678 Bacteria 10863
1773 Ga0495599_0002462 3300046678 Bacteria 10788
1774 Ga0495599_0027197 3300046678 Bacteria 3585
1775 Ga0495623_0003667 3300046679 Bacteria 10141
1776 Ga0495623_0056435 3300046679 Bacteria 2472
1777 Ga0495646_0001912 3300046680 Bacteria 12528
1778 Ga0495646_0024134 3300046680 Bacteria 3829
1779 Ga0495647_0014983 3300046681 Bacteria 2709
1780 Ga0495647_0041385 3300046681 Bacteria 1754
1781 Ga0495647_0328579 3300046681 Bacteria 693
1782 Ga0495658_0257189 3300046683 Bacteria 1099
1783 Ga0495658_0322245 3300046683 Bacteria 979
1784 Ga0495658_0975604 3300046683 Bacteria 541
1785 Ga0495669_0019701 3300046684 Bacteria 2914
1786 Ga0495669_0376577 3300046684 Bacteria 687
1787 Ga0495613_0030125 3300046689 Bacteria 4031
1788 Ga0495613_0122285 3300046689 Bacteria 1868
1789 Ga0495624_0041293 3300046690 Bacteria 2951
1790 Ga0495624_0287394 3300046690 Bacteria 992
1791 Ga0495670_0001352 3300046691 Bacteria 11967
1792 Ga0495649_0018395 3300046694 Bacteria 3932
1793 Ga0495589_0151315 3300046794 Bacteria 1108
1794 Ga0495600_0005044 3300046809 Bacteria 7932
1795 Ga0495600_0030328 3300046809 Bacteria 3503
1796 Ga0495600_0051833 3300046809 Bacteria 2679
1797 Ga0495600_0227248 3300046809 Bacteria 1192
1798 Ga0495581_0013989 3300047315 Bacteria 4654
1799 Ga0495581_0032458 3300047315 Bacteria 3023
1800 Ga0495581_0255675 3300047315 Bacteria 1024
1801 Ga0495604_0004097 3300047317 Bacteria 11579
1802 Ga0495604_0013822 3300047317 Bacteria 6438
1803 Ga0495604_0028326 3300047317 Bacteria 4456
1804 Ga0495674_0082135 3300047319 Bacteria 2763
1805 Ga0495674_0254432 3300047319 Bacteria 1444
1806 Ga0495674_0755191 3300047319 Bacteria 759
1807 Ga0495672_0043033 3300047320 Bacteria 2718
1808 Ga0495672_0056432 3300047320 Bacteria 2285
1809 Ga0495672_0254586 3300047320 Bacteria 850
1810 Ga0495676_0148759 3300047321 Bacteria 1669
1811 Ga0495676_0313301 3300047321 Bacteria 1055
1812 Ga0495680_0017386 3300047322 Bacteria 6143
1813 Ga0495680_0046812 3300047322 Bacteria 3407
1814 Ga0495680_0153286 3300047322 Bacteria 1678
1815 Ga0495680_0165418 3300047322 Bacteria 1604
1816 Ga0495680_0298501 3300047322 Bacteria 1131
1817 Ga0495683_0008656 3300047323 Bacteria 5434
1818 Ga0495683_0142059 3300047323 Bacteria 1124
1819 Ga0495687_014365 3300047443 Bacteria 4080
1820 Ga0495675_0001338 3300047444 Bacteria 14916
1821 Ga0495675_0035048 3300047444 Bacteria 3206
1822 Ga0495675_0046152 3300047444 Bacteria 2774
1823 Ga0495677_0294857 3300047445 Bacteria 637
1824 Ga0495677_0350572 3300047445 Bacteria 582
1825 Ga0495673_0023241 3300047469 Bacteria 3020
1826 Ga0495673_0048119 3300047469 Bacteria 1881
1827 Ga0495681_0000342 3300047470 Bacteria 36568
1828 Ga0495684_0034589 3300047471 Bacteria 3876
1829 Ga0495684_0148419 3300047471 Bacteria 1754
1830 Ga0495686_0100346 3300047472 Bacteria 1746
1831 Ga0495686_0716094 3300047472 Bacteria 510
1832 Ga0495593_0279731 3300047673 Bacteria 834
1833 Ga0495602_0002392 3300048088 Bacteria 19051
1834 Ga0495602_0040040 3300048088 Bacteria 4306
1835 Ga0495602_0082810 3300048088 Bacteria 2691
1836 Ga0495614_0055908 3300048089 Bacteria 1693
1837 Ga0495626_0076797 3300048091 Bacteria 1490
1838 Ga0495626_0389562 3300048091 Bacteria 540
1839 Ga0496100_0002059 3300048903 Bacteria 10095
1840 Ga0496100_0024304 3300048903 Bacteria 3695
1841 Ga0496100_0232286 3300048903 Bacteria 1357
1842 Ga0496100_0251167 3300048903 Bacteria 1308
1843 Ga0496100_0591321 3300048903 Bacteria 861
1844 Ga0496100_0934434 3300048903 Bacteria 681
1845 Ga0496101_0001738 3300048904 Bacteria 13045
1846 Ga0496101_0017395 3300048904 Bacteria 4876
1847 Ga0496101_0101087 3300048904 Bacteria 2158
1848 Ga0496101_0129623 3300048904 Bacteria 1914
1849 Ga0496101_0449887 3300048904 Bacteria 1016
1850 Ga0496101_0665436 3300048904 Bacteria 822
1851 Ga0496101_1095292 3300048904 Bacteria 625
1852 Ga0496101_1342341 3300048904 Bacteria 558
1853 Ga0496102_0009899 3300048905 Bacteria 8196
1854 Ga0496102_0010993 3300048905 Bacteria 7800
1855 Ga0496102_0036336 3300048905 Bacteria 4437
1856 Ga0496102_0181160 3300048905 Bacteria 1985
1857 Ga0496103_0004101 3300048906 Bacteria 8854
1858 Ga0496103_0013730 3300048906 Bacteria 4806
1859 Ga0496103_0028858 3300048906 Bacteria 3369
1860 Ga0496103_0030009 3300048906 Bacteria 3306
1861 Ga0496103_0269638 3300048906 Bacteria 1095
1862 Ga0496104_0000016 3300048907 Bacteria 335025
1863 Ga0496104_0000528 3300048907 Bacteria 32836
1864 Ga0496104_0053102 3300048907 Bacteria 3828
1865 Ga0496104_0072883 3300048907 Bacteria 3266
1866 Ga0496104_0199375 3300048907 Bacteria 1913
1867 Ga0496104_0271984 3300048907 Bacteria 1607
1868 Ga0496104_1473270 3300048907 Bacteria 583
1869 Ga0496105_0000010 3300048908 Bacteria 309880
1870 Ga0496105_0001587 3300048908 Bacteria 16099
1871 Ga0496105_0004501 3300048908 Bacteria 10491
1872 Ga0496105_0043606 3300048908 Bacteria 3699
1873 Ga0496105_0304050 3300048908 Bacteria 1281
1874 Ga0496105_0367796 3300048908 Bacteria 1146
1875 Ga0496105_0795112 3300048908 Bacteria 720
1876 Ga0496106_0000369 3300048909 Bacteria 31918
1877 Ga0496106_0000644 3300048909 Bacteria 24997
1878 Ga0496106_0016186 3300048909 Bacteria 5515
1879 Ga0496106_0087961 3300048909 Bacteria 2394
1880 Ga0496106_0170349 3300048909 Bacteria 1725
1881 Ga0496106_0265595 3300048909 Bacteria 1373
1882 Ga0496106_0281047 3300048909 Bacteria 1333
1883 Ga0496106_0755067 3300048909 Bacteria 773
1884 Ga0496107_0010373 3300048910 Bacteria 6474
1885 Ga0496107_0021482 3300048910 Bacteria 4561
1886 Ga0496107_0034610 3300048910 Bacteria 3618
1887 Ga0496107_0137319 3300048910 Bacteria 1806
1888 Ga0496107_0673926 3300048910 Bacteria 761
1889 Ga0496107_0781731 3300048910 Bacteria 699
1890 Ga0496108_0002310 3300048911 Bacteria 15266
1891 Ga0496108_0037952 3300048911 Bacteria 4013
1892 Ga0496108_0054442 3300048911 Bacteria 3357
1893 Ga0496108_0060640 3300048911 Bacteria 3183
1894 Ga0496108_0089179 3300048911 Bacteria 2621
1895 Ga0496108_0138113 3300048911 Bacteria 2099
1896 Ga0496108_0398658 3300048911 Bacteria 1202
1897 Ga0496108_0665475 3300048911 Bacteria 904
1898 Ga0496108_1802047 3300048911 Bacteria 501
1899 Ga0496109_0004152 3300048912 Bacteria 12092
1900 Ga0496109_0012832 3300048912 Bacteria 7242
1901 Ga0496109_0018831 3300048912 Bacteria 6074
1902 Ga0496109_0241206 3300048912 Bacteria 1701
1903 Ga0496109_0313256 3300048912 Bacteria 1480
1904 Ga0496109_0404516 3300048912 Bacteria 1289
1905 Ga0496109_0746607 3300048912 Bacteria 916
1906 Ga0496109_1181467 3300048912 Bacteria 702
1907 Ga0496110_0001254 3300048913 Bacteria 18141
1908 Ga0496110_0049068 3300048913 Bacteria 3702
1909 Ga0496110_0096464 3300048913 Bacteria 2649
1910 Ga0496110_0121143 3300048913 Bacteria 2357
1911 Ga0496110_0283956 3300048913 Bacteria 1507
1912 Ga0496110_1122634 3300048913 Bacteria 694
1913 Ga0496110_1667467 3300048913 Bacteria 548
1914 Ga0496111_0014228 3300048914 Bacteria 5430
1915 Ga0496111_0051267 3300048914 Bacteria 2979
1916 Ga0496111_0184429 3300048914 Bacteria 1551
1917 Ga0496111_0330606 3300048914 Bacteria 1128
1918 Ga0496111_0423340 3300048914 Bacteria 983
1919 Ga0496111_0566093 3300048914 Bacteria 833
1920 Ga0496111_0616402 3300048914 Bacteria 794
1921 Ga0496111_0622817 3300048914 Bacteria 789
1922 Ga0496112_0020414 3300048915 Bacteria 6280
1923 Ga0496112_0080250 3300048915 Bacteria 3226
1924 Ga0496112_0144505 3300048915 Bacteria 2347
1925 Ga0496112_0368937 3300048915 Bacteria 1377
1926 Ga0496112_1013030 3300048915 Bacteria 750
1927 Ga0496113_0068360 3300048916 Bacteria 2695
1928 Ga0496113_0083605 3300048916 Bacteria 2449
1929 Ga0496113_0088624 3300048916 Bacteria 2380
1930 Ga0496113_0887074 3300048916 Bacteria 706
1931 Ga0496113_1490911 3300048916 Bacteria 522
1932 Ga0496114_0011312 3300048917 Bacteria 7128
1933 Ga0496114_0029429 3300048917 Bacteria 4514
1934 Ga0496114_0056359 3300048917 Bacteria 3279
1935 Ga0496114_0247718 3300048917 Bacteria 1567
1936 Ga0496114_0913311 3300048917 Bacteria 759
1937 Ga0496114_1261322 3300048917 Bacteria 625
1938 Ga0496114_1614497 3300048917 Bacteria 536
1939 Ga0496114_1643556 3300048917 Bacteria 530
1940 Ga0496115_0024374 3300048918 Bacteria 4701
1941 Ga0496115_0076549 3300048918 Bacteria 2719
1942 Ga0496115_0132483 3300048918 Bacteria 2054
1943 Ga0496115_0341759 3300048918 Bacteria 1221
1944 Ga0496116_0079013 3300048919 Bacteria 2049
1945 Ga0496116_0138813 3300048919 Bacteria 1371
1946 Ga0496117_0015671 3300048920 Bacteria 6440
1947 Ga0496117_0295257 3300048920 Bacteria 861
1948 Ga0496117_0377016 3300048920 Bacteria 723
1949 Ga0496118_0017573 3300048921 Bacteria 6501
1950 Ga0496118_0311094 3300048921 Bacteria 859
1951 Ga0496119_0118637 3300048922 Bacteria 1458
1952 Ga0496120_0094916 3300048923 Bacteria 1586
1953 Ga0496121_0001812 3300048924 Bacteria 34516
1954 Ga0496121_0025847 3300048924 Bacteria 5554
1955 Ga0496121_0205637 3300048924 Bacteria 1399
1956 Ga0496122_0060396 3300048925 Bacteria 2792
1957 Ga0496123_0077554 3300048926 Bacteria 2040
1958 Ga0496124_0083375 3300048927 Bacteria 2622
1959 Ga0496124_0181194 3300048927 Bacteria 1621
1960 Ga0496125_0035348 3300048928 Bacteria 4385
1961 Ga0496125_0116172 3300048928 Bacteria 1922
1962 Ga0496126_0000974 3300048929 Bacteria 49119
1963 Ga0496126_0033365 3300048929 Bacteria 4843
1964 Ga0496126_0626676 3300048929 Bacteria 844
1965 Ga0496126_1327300 3300048929 Bacteria 523
1966 Ga0501309_061335 3300049129 Bacteria 605
1967 Ga0501304_025674 3300049160 Bacteria 605
1968 Ga0495678_020931 3300049459 Bacteria 2887
1969 Ga0495678_201177 3300049459 Bacteria 614
1970 Ga0495682_0007087 3300049460 Bacteria 4483
1971 Ga0501292_101713 3300049515 Bacteria 570
1972 Ga0501299_108047 3300049522 Bacteria 655
1973 Ga0501301_029780 3300049524 Bacteria 574
1974 Ga0501321_041986 3300049537 Bacteria 646
1975 Ga0501033_0017679 3300049570 Bacteria 5385
1976 Ga0501034_0807007 3300049571 Bacteria 831
1977 Ga0501034_1010855 3300049571 Bacteria 715
1978 Ga0501036_1366233 3300049572 Bacteria 575
1979 Ga0501036_1474385 3300049572 Bacteria 551
1980 Ga0501037_0258045 3300049573 Bacteria 1218
1981 Ga0501038_0072406 3300049574 Bacteria 2921
1982 Ga0501039_0140133 3300049575 Bacteria 1900
1983 Ga0501039_0887596 3300049575 Bacteria 694
1984 Ga0501041_0655354 3300049577 Bacteria 671
1985 Ga0501042_0010602 3300049578 Bacteria 6189
1986 Ga0501042_0177376 3300049578 Bacteria 1537
1987 Ga0501042_0640523 3300049578 Bacteria 773
1988 Ga0501043_1051912 3300049579 Bacteria 577
1989 Ga0501046_0053374 3300049580 Bacteria 3184
1990 Ga0501047_0004958 3300049581 Bacteria 12500
1991 Ga0501047_0024305 3300049581 Bacteria 5817
1992 Ga0501047_0200214 3300049581 Bacteria 1858
1993 Ga0501047_0550503 3300049581 Bacteria 978
1994 Ga0501047_0721840 3300049581 Bacteria 813
1995 Ga0501047_0929548 3300049581 Bacteria 683
1996 Ga0501048_0939793 3300049582 Bacteria 622
1997 Ga0501068_0268903 3300049584 Bacteria 1088
1998 Ga0501069_0060418 3300049585 Bacteria 2116
1999 Ga0501069_0348891 3300049585 Bacteria 872
2000 Ga0501069_0415145 3300049585 Bacteria 797
2001 Ga0501071_0283068 3300049587 Bacteria 1255
2002 Ga0501071_0329926 3300049587 Bacteria 1160
2003 Ga0501074_0274216 3300049590 Bacteria 1199
2004 Ga0501075_0959062 3300049591 Bacteria 650
2005 Ga0501076_0195529 3300049592 Bacteria 1651
2006 Ga0501076_1810795 3300049592 Bacteria 500
2007 Ga0501077_0023267 3300049593 Bacteria 3928
2008 Ga0501198_121919 3300049649 Bacteria 550
2009 Ga0501079_0217373 3300049741 Bacteria 1493
2010 Ga0501079_1000043 3300049741 Bacteria 659
2011 Ga0501079_1499817 3300049741 Bacteria 530
2012 Ga0501080_0054775 3300049742 Bacteria 3714
2013 Ga0501080_0405210 3300049742 Bacteria 1227
2014 Ga0501080_1067666 3300049742 Bacteria 698
2015 Ga0501080_1663977 3300049742 Bacteria 539
2016 Ga0501083_0073184 3300049744 Bacteria 2278
2017 Ga0501083_1076460 3300049744 Bacteria 523
2018 Ga0501044_0002082 3300049823 Bacteria 23049
2019 Ga0501045_1393604 3300049824 Bacteria 509
2020 nmdc:mga03683_312446_c1 3300050489 Bacteria 739
2021 nmdc:mga00v17_1067489_c1 3300050491 Bacteria 506
2022 nmdc:mga00v17_185167_c1 3300050491 Bacteria 1344
2023 nmdc:mga00v17_657536_c1 3300050491 Bacteria 674
2024 nmdc:mga00v17_738641_c1 3300050491 Bacteria 630
2025 nmdc:mga0yw44_214618_c1 3300050492 Bacteria 1274
2026 nmdc:mga0yw44_886089_c1 3300050492 Bacteria 605
2027 nmdc:mga0k408_445993_c1 3300050493 Bacteria 769
2028 nmdc:mga0k408_454410_c1 3300050493 Bacteria 761
2029 nmdc:mga0k408_908784_c1 3300050493 Bacteria 511
2030 nmdc:mga06z11_191019_c1 3300050494 Bacteria 1186
2031 nmdc:mga06z11_448134_c1 3300050494 Bacteria 780
2032 nmdc:mga04h51_15883_c1 3300050495 Bacteria 2177
2033 nmdc:mga04h51_454390_c1 3300050495 Bacteria 542
2034 nmdc:mga04h51_495401_c1 3300050495 Bacteria 521
2035 nmdc:mga07m45_17616_c1 3300050496 Bacteria 3841
2036 nmdc:mga07m45_617241_c1 3300050496 Bacteria 626
2037 nmdc:mga05p37_122210_c1 3300050507 Bacteria 3198
2038 nmdc:mga05p37_19_c3 3300050507 Bacteria 27587
2039 nmdc:mga05p37_553537_c1 3300050507 Bacteria 1309
2040 nmdc:mga09592_1578599_c1 3300050508 Unclassified 532
2041 nmdc:mga09592_312826_c1 3300050508 Bacteria 1361
2042 nmdc:mga09592_758_c1 3300050508 Bacteria 24836
2043 nmdc:mga0qj67_1779_c1 3300050509 Bacteria 15251
2044 nmdc:mga0qj67_267341_c1 3300050509 Bacteria 1387
2045 nmdc:mga0qj67_416503_c1 3300050509 Bacteria 1083
2046 nmdc:mga0qj67_761683_c1 3300050509 Bacteria 768
2047 nmdc:mga06r32_4145_c1 3300050510 Bacteria 12980
2048 nmdc:mga08y16_100889_c1 3300050511 Bacteria 3005
2049 nmdc:mga08y16_1062596_c1 3300050511 Bacteria 786
2050 nmdc:mga08y16_1881985_c1 3300050511 Bacteria 550
2051 nmdc:mga08y16_198791_c1 3300050511 Bacteria 2078
2052 nmdc:mga08y16_92670_c1 3300050511 Bacteria 3148
2053 nmdc:mga0n895_1573_c1 3300050512 Bacteria 17177
2054 nmdc:mga0n895_199825_c1 3300050512 Bacteria 2030
2055 nmdc:mga0n895_226825_c1 3300050512 Bacteria 1896
2056 nmdc:mga0n895_353537_c1 3300050512 Bacteria 1488
2057 nmdc:mga0n895_46597_c1 3300050512 Bacteria 4236
2058 nmdc:mga0n895_77348_c1 3300050512 Bacteria 3310
2059 nmdc:mga0rr50_1394565_c1 3300050513 Bacteria 593
2060 nmdc:mga0rr50_236933_c1 3300050513 Bacteria 1512
2061 nmdc:mga0rr50_390_c1 3300050513 Bacteria 23898
2062 nmdc:mga0rr50_40012_c1 3300050513 Bacteria 3405
2063 nmdc:mga0rr50_407392_c1 3300050513 Bacteria 1149
2064 nmdc:mga0rr50_435828_c1 3300050513 Bacteria 1110
2065 nmdc:mga0rr50_472729_c1 3300050513 Bacteria 1064
2066 nmdc:mga0rr50_566229_c1 3300050513 Bacteria 968
2067 nmdc:mga08x19_114422_c1 3300050514 Bacteria 1802
2068 nmdc:mga08x19_125557_c1 3300050514 Bacteria 1723
2069 nmdc:mga08x19_652609_c1 3300050514 Bacteria 746
2070 nmdc:mga0a205_1424708_c1 3300050515 Bacteria 541
2071 nmdc:mga0a205_355408_c1 3300050515 Bacteria 1332
2072 nmdc:mga0a205_368814_c1 3300050515 Bacteria 1302
2073 nmdc:mga0a205_573514_c1 3300050515 Bacteria 983
2074 nmdc:mga0a205_674860_c1 3300050515 Bacteria 884
2075 nmdc:mga0a205_681_c1 3300050515 Bacteria 27171
2076 nmdc:mga0sz30_37840_c1 3300050516 Bacteria 2021
2077 Ga0495601_0000680 3300053077 Bacteria 18168
2078 Ga0495601_0003107 3300053077 Bacteria 9484
2079 Ga0495601_0006627 3300053077 Bacteria 6776
2080 Ga0495601_0068588 3300053077 Bacteria 2260
2081 Ga0495601_0139512 3300053077 Bacteria 1581
2082 Ga0495601_0521639 3300053077 Bacteria 765
2083 Ga0495612_0004246 3300053078 Bacteria 5948
2084 Ga0495612_0044087 3300053078 Bacteria 1824
2085 Ga0495612_0052416 3300053078 Bacteria 1678
2086 Ga0495612_0378255 3300053078 Bacteria 642
2087 Ga0495595_0000365 3300053084 Bacteria 17161
2088 Ga0495595_0000883 3300053084 Bacteria 11520
2089 Ga0495595_0003679 3300053084 Bacteria 6096
2090 Ga0495595_0008490 3300053084 Bacteria 4217
2091 Ga0495595_0011680 3300053084 Bacteria 3675
2092 Ga0495595_0098409 3300053084 Bacteria 1410
2093 Ga0495595_0416378 3300053084 Bacteria 681
2094 Ga0495619_0000378 3300053085 Bacteria 30722
2095 Ga0495619_0000897 3300053085 Bacteria 19498
2096 Ga0495619_0024786 3300053085 Bacteria 3848
2097 Ga0495619_0026193 3300053085 Bacteria 3750
2098 Ga0495619_0104606 3300053085 Bacteria 1929
2099 Ga0495619_0722582 3300053085 Bacteria 676
2100 Ga0500566_0090643 3300053094 Bacteria 1690
2101 Ga0500566_0365795 3300053094 Bacteria 656
2102 Ga0500566_0402633 3300053094 Bacteria 612
2103 Ga0500641_0005408 3300053096 Bacteria 4528
2104 Ga0500650_0252789 3300053098 Bacteria 790
2105 Ga0500650_0488230 3300053098 Bacteria 525
2106 Ga0500555_067326 3300053103 Bacteria 951
2107 Ga0500595_206930 3300053119 Bacteria 540
2108 Ga0500595_212302 3300053119 Bacteria 533
2109 Ga0500597_103913 3300053120 Bacteria 1235
2110 Ga0500642_0332032 3300053130 Bacteria 679
2111 Ga0500655_011455 3300053133 Bacteria 1607
2112 Ga0500658_0043929 3300053134 Bacteria 1801
2113 Ga0500568_0214450 3300053139 Bacteria 704
2114 Ga0500568_0308044 3300053139 Bacteria 575
2115 Ga0500604_0046397 3300053151 Bacteria 1329
2116 Ga0500604_0088536 3300053151 Bacteria 1009
2117 Ga0500616_0042970 3300053153 Bacteria 2418
2118 Ga0500636_0220693 3300053177 Bacteria 988
2119 Ga0500637_0001827 3300053178 Bacteria 9218
2120 Ga0501084_0101211 3300054114 Bacteria 2420
2121 Ga0590075_191211 3300059424 Bacteria 542
2122 Ga0587084_108915 3300059477 Bacteria 570
2123 Ga0587066_102475 3300059490 Bacteria 652
2124 Ga0587083_0141600 3300059505 Bacteria 641
2125 Ga0587083_0160644 3300059505 Bacteria 614
2126 Ga0587088_019955 3300059508 Bacteria 1107
2127 Ga0587089_031854 3300059509 Bacteria 782
2128 Ga0587091_067579 3300059511 Bacteria 774
2129 Ga0587092_104203 3300059512 Bacteria 588
2130 Ga0587092_128847 3300059512 Bacteria 547
2131 Ga0587094_090291 3300059513 Bacteria 579
2132 Ga0587106_056199 3300059605 Bacteria 711
2133 Ga0587109_046457 3300059624 Bacteria 878
2134 Ga0587067_168625 3300059640 Bacteria 562
2135 Ga0587068_099437 3300059641 Bacteria 609
2136 Ga0587069_053929 3300059642 Bacteria 723
2137 Ga0587069_106770 3300059642 Bacteria 579
2138 Ga0587072_137517 3300059643 Bacteria 580
2139 Ga0587075_057480 3300059644 Bacteria 694
2140 Ga0587075_105573 3300059644 Bacteria 567
2141 Ga0587079_011859 3300059647 Bacteria 1412
2142 Ga0587079_248242 3300059647 Bacteria 505
2143 Ga0587107_060070 3300059652 Bacteria 668
2144 Ga0587114_038670 3300059655 Bacteria 764
2145 Ga0587118_17615 3300059657 Bacteria 580
2146 Ga0587124_035590 3300059660 Bacteria 566
2147 Ga0587124_051688 3300059660 Bacteria 502
2148 Ga0587071_145096 3300060344 Bacteria 586
2149 Ga0587071_173793 3300060344 Bacteria 549
2150 Ga0501082_0900935 3300060353 Bacteria 774
2151 Ga0501082_0926411 3300060353 Bacteria 762
2152 Ga0466962_0108923 3300061719 Bacteria 1333
2153 Ga0530510_0211558 3300061734 Bacteria 1441

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10216041 Ga0316576_102160412 80
2 3300003214 JGI25165J46597_1000047 JGI25165J46597_1000047215 81
3 3300003214 JGI25165J46597_1000066 JGI25165J46597_1000066112 81
4 3300021441 Ga0213871_10119801 Ga0213871_101198012 81
5 3300025261 Ga0209233_1000045 Ga0209233_1000045322 81
6 3300039438 Ga0436360_1080288 Ga0436360_1080288_239_523 81
7 3300049578 Ga0501042_0177376 Ga0501042_0177376_853_1119 81
8 3300005518 Ga0070699_102002956 Ga0070699_1020029562 82
9 3300031995 Ga0307409_101855116 Ga0307409_1018551161 82
10 3300053153 Ga0500616_0042970 Ga0500616_0042970_1416_1673 82
11 3300059490 Ga0587066_102475 Ga0587066_102475_308_562 82
12 3300025941 Ga0207711_10008985 Ga0207711_100089858 83
13 3300031733 Ga0316577_10379747 Ga0316577_103797472 83
14 3300005288 Ga0065714_10003265 Ga0065714_100032651 84
15 3300005457 Ga0070662_100053740 Ga0070662_1000537402 84
16 3300032168 Ga0316593_10037266 Ga0316593_100372662 84
17 3300033529 Ga0316587_1060900 Ga0316587_10609001 84
18 3300033541 Ga0316596_1127341 Ga0316596_11273412 84
19 3300036647 Ga0316582_0506191 Ga0316582_0506191_495_749 84
20 3300037471 Ga0395905_0000002 Ga0395905_0000002_244818_245072 84
21 3300003575 Ga0007409J51694_1055017 Ga0007409J51694_10550172 85
22 3300005289 Ga0065704_10003559 Ga0065704_100035591 85
23 3300005289 Ga0065704_10563289 Ga0065704_105632891 85
24 3300005290 Ga0065712_10114297 Ga0065712_101142971 85
25 3300005329 Ga0070683_100000546 Ga0070683_10000054630 85
26 3300005330 Ga0070690_100547596 Ga0070690_1005475962 85
27 3300005331 Ga0070670_100001363 Ga0070670_1000013636 85
28 3300005331 Ga0070670_100622504 Ga0070670_1006225041 85
29 3300005336 Ga0070680_100822154 Ga0070680_1008221542 85
30 3300005337 Ga0070682_100248989 Ga0070682_1002489892 85
31 3300005338 Ga0068868_100001840 Ga0068868_1000018404 85
32 3300005344 Ga0070661_100003030 Ga0070661_1000030306 85
33 3300005345 Ga0070692_10587146 Ga0070692_105871461 85
34 3300005347 Ga0070668_101598553 Ga0070668_1015985532 85
35 3300005354 Ga0070675_100000177 Ga0070675_1000001773 85
36 3300005354 Ga0070675_100217408 Ga0070675_1002174082 85
37 3300005354 Ga0070675_100581128 Ga0070675_1005811282 85
38 3300005355 Ga0070671_100000840 Ga0070671_10000084022 85
39 3300005355 Ga0070671_100477239 Ga0070671_1004772392 85
40 3300005355 Ga0070671_102013377 Ga0070671_1020133771 85
41 3300005356 Ga0070674_100297066 Ga0070674_1002970661 85
42 3300005364 Ga0070673_100003991 Ga0070673_1000039915 85
43 3300005366 Ga0070659_100582651 Ga0070659_1005826511 85
44 3300005367 Ga0070667_100037514 Ga0070667_1000375146 85
45 3300005434 Ga0070709_11745307 Ga0070709_117453072 85
46 3300005435 Ga0070714_100003798 Ga0070714_10000379812 85
47 3300005436 Ga0070713_100218537 Ga0070713_1002185372 85
48 3300005439 Ga0070711_102073370 Ga0070711_1020733701 85
49 3300005440 Ga0070705_100145755 Ga0070705_1001457552 85
50 3300005441 Ga0070700_100214809 Ga0070700_1002148093 85
51 3300005455 Ga0070663_100132302 Ga0070663_1001323023 85
52 3300005456 Ga0070678_100000295 Ga0070678_10000029525 85
53 3300005457 Ga0070662_100040552 Ga0070662_1000405522 85
54 3300005457 Ga0070662_100518040 Ga0070662_1005180401 85
55 3300005458 Ga0070681_10017107 Ga0070681_100171078 85
56 3300005459 Ga0068867_100006141 Ga0068867_1000061418 85
57 3300005467 Ga0070706_100229554 Ga0070706_1002295542 85
58 3300005468 Ga0070707_100114201 Ga0070707_1001142012 85
59 3300005471 Ga0070698_101756437 Ga0070698_1017564371 85
60 3300005530 Ga0070679_100103467 Ga0070679_1001034675 85
61 3300005539 Ga0068853_100254632 Ga0068853_1002546323 85
62 3300005543 Ga0070672_100000029 Ga0070672_1000000294 85
63 3300005543 Ga0070672_100706616 Ga0070672_1007066162 85
64 3300005543 Ga0070672_101002931 Ga0070672_1010029312 85
65 3300005547 Ga0070693_100049790 Ga0070693_1000497902 85
66 3300005548 Ga0070665_100152807 Ga0070665_1001528072 85
67 3300005548 Ga0070665_100365128 Ga0070665_1003651283 85
68 3300005563 Ga0068855_100136502 Ga0068855_1001365024 85
69 3300005564 Ga0070664_100000185 Ga0070664_10000018510 85
70 3300005564 Ga0070664_100361207 Ga0070664_1003612072 85
71 3300005577 Ga0068857_101206443 Ga0068857_1012064432 85
72 3300005578 Ga0068854_100006654 Ga0068854_1000066549 85
73 3300005614 Ga0068856_100166571 Ga0068856_1001665712 85
74 3300005615 Ga0070702_100760182 Ga0070702_1007601821 85
75 3300005616 Ga0068852_100000016 Ga0068852_10000001661 85
76 3300005618 Ga0068864_100024487 Ga0068864_1000244876 85
77 3300005718 Ga0068866_10178043 Ga0068866_101780432 85
78 3300005834 Ga0068851_10025793 Ga0068851_100257933 85
79 3300005840 Ga0068870_10050340 Ga0068870_100503403 85
80 3300005840 Ga0068870_11175018 Ga0068870_111750182 85
81 3300005841 Ga0068863_100019083 Ga0068863_1000190833 85
82 3300005844 Ga0068862_102305306 Ga0068862_1023053061 85
83 3300005937 Ga0081455_10218124 Ga0081455_102181243 85
84 3300006163 Ga0070715_10506401 Ga0070715_105064012 85
85 3300006237 Ga0097621_100000378 Ga0097621_10000037816 85
86 3300006358 Ga0068871_100001533 Ga0068871_10000153316 85
87 3300006844 Ga0075428_100024997 Ga0075428_1000249975 85
88 3300006846 Ga0075430_100078624 Ga0075430_1000786244 85
89 3300006852 Ga0075433_10387708 Ga0075433_103877082 85
90 3300006871 Ga0075434_101039773 Ga0075434_1010397731 85
91 3300006880 Ga0075429_100050698 Ga0075429_1000506985 85
92 3300006881 Ga0068865_100142173 Ga0068865_1001421733 85
93 3300006881 Ga0068865_100667405 Ga0068865_1006674052 85
94 3300006881 Ga0068865_102007719 Ga0068865_1020077192 85
95 3300006914 Ga0075436_100796905 Ga0075436_1007969052 85
96 3300007076 Ga0075435_100600199 Ga0075435_1006001992 85
97 3300007265 Ga0099794_10143464 Ga0099794_101434643 85
98 3300009093 Ga0105240_10232895 Ga0105240_102328953 85
99 3300009093 Ga0105240_11090266 Ga0105240_110902662 85
100 3300009093 Ga0105240_11996874 Ga0105240_119968742 85
101 3300009094 Ga0111539_10069152 Ga0111539_100691525 85
102 3300009094 Ga0111539_10268805 Ga0111539_102688051 85
103 3300009094 Ga0111539_13217547 Ga0111539_132175471 85
104 3300009098 Ga0105245_12845782 Ga0105245_128457822 85
105 3300009101 Ga0105247_11133877 Ga0105247_111338772 85
106 3300009148 Ga0105243_10033559 Ga0105243_100335591 85
107 3300009148 Ga0105243_10293542 Ga0105243_102935422 85
108 3300009174 Ga0105241_10753354 Ga0105241_107533542 85
109 3300009176 Ga0105242_10187238 Ga0105242_101872382 85
110 3300009176 Ga0105242_10507433 Ga0105242_105074331 85
111 3300009176 Ga0105242_11448057 Ga0105242_114480572 85
112 3300009177 Ga0105248_10239921 Ga0105248_102399212 85
113 3300009551 Ga0105238_10399317 Ga0105238_103993173 85
114 3300009551 Ga0105238_11443176 Ga0105238_114431762 85
115 3300009553 Ga0105249_10000643 Ga0105249_1000064317 85
116 3300009553 Ga0105249_12692896 Ga0105249_126928961 85
117 3300010375 Ga0105239_10083669 Ga0105239_100836692 85
118 3300010375 Ga0105239_10661150 Ga0105239_106611503 85
119 3300011119 Ga0105246_11892129 Ga0105246_118921292 85
120 3300013104 Ga0157370_10359280 Ga0157370_103592802 85
121 3300013104 Ga0157370_10621428 Ga0157370_106214282 85
122 3300013105 Ga0157369_10364302 Ga0157369_103643022 85
123 3300013105 Ga0157369_10904189 Ga0157369_109041892 85
124 3300013296 Ga0157374_10003722 Ga0157374_100037226 85
125 3300013296 Ga0157374_11104102 Ga0157374_111041022 85
126 3300013297 Ga0157378_10070094 Ga0157378_100700942 85
127 3300013297 Ga0157378_10086735 Ga0157378_100867353 85
128 3300013297 Ga0157378_10150556 Ga0157378_101505563 85
129 3300013297 Ga0157378_10167047 Ga0157378_101670474 85
130 3300013297 Ga0157378_10343624 Ga0157378_103436241 85
131 3300013306 Ga0163162_10000015 Ga0163162_10000015102 85
132 3300013306 Ga0163162_10014534 Ga0163162_100145349 85
133 3300013306 Ga0163162_10087395 Ga0163162_100873953 85
134 3300013306 Ga0163162_10294888 Ga0163162_102948882 85
135 3300013307 Ga0157372_10050524 Ga0157372_100505244 85
136 3300013308 Ga0157375_10000426 Ga0157375_1000042628 85
137 3300013308 Ga0157375_10006612 Ga0157375_100066126 85
138 3300013308 Ga0157375_10157051 Ga0157375_101570514 85
139 3300013308 Ga0157375_13698520 Ga0157375_136985201 85
140 3300014326 Ga0157380_12930518 Ga0157380_129305182 85
141 3300014745 Ga0157377_10105786 Ga0157377_101057862 85
142 3300014745 Ga0157377_10238340 Ga0157377_102383403 85
143 3300014969 Ga0157376_10002952 Ga0157376_1000295213 85
144 3300014969 Ga0157376_10101370 Ga0157376_101013704 85
145 3300014969 Ga0157376_11212415 Ga0157376_112124152 85
146 3300014969 Ga0157376_12540643 Ga0157376_125406432 85
147 3300017792 Ga0163161_10037777 Ga0163161_100377773 85
148 3300017792 Ga0163161_10680552 Ga0163161_106805522 85
149 3300021388 Ga0213875_10402609 Ga0213875_104026092 85
150 3300025315 Ga0207697_10054568 Ga0207697_100545683 85
151 3300025321 Ga0207656_10006343 Ga0207656_100063432 85
152 3300025903 Ga0207680_10657471 Ga0207680_106574711 85
153 3300025906 Ga0207699_10279965 Ga0207699_102799652 85
154 3300025908 Ga0207643_10185746 Ga0207643_101857461 85
155 3300025909 Ga0207705_11522419 Ga0207705_115224191 85
156 3300025910 Ga0207684_10588808 Ga0207684_105888082 85
157 3300025911 Ga0207654_10249488 Ga0207654_102494883 85
158 3300025912 Ga0207707_10085111 Ga0207707_100851112 85
159 3300025916 Ga0207663_10506524 Ga0207663_105065242 85
160 3300025916 Ga0207663_11605451 Ga0207663_116054512 85
161 3300025917 Ga0207660_10707106 Ga0207660_107071062 85
162 3300025920 Ga0207649_10003027 Ga0207649_100030278 85
163 3300025920 Ga0207649_11271525 Ga0207649_112715252 85
164 3300025921 Ga0207652_10081716 Ga0207652_100817162 85
165 3300025922 Ga0207646_10095685 Ga0207646_100956853 85
166 3300025924 Ga0207694_10292043 Ga0207694_102920433 85
167 3300025925 Ga0207650_10000507 Ga0207650_1000050733 85
168 3300025925 Ga0207650_11320783 Ga0207650_113207832 85
169 3300025926 Ga0207659_10032751 Ga0207659_100327513 85
170 3300025926 Ga0207659_10377861 Ga0207659_103778612 85
171 3300025929 Ga0207664_10003549 Ga0207664_100035493 85
172 3300025931 Ga0207644_10000157 Ga0207644_100001576 85
173 3300025931 Ga0207644_10700703 Ga0207644_107007032 85
174 3300025933 Ga0207706_10087052 Ga0207706_100870522 85
175 3300025933 Ga0207706_10964075 Ga0207706_109640752 85
176 3300025934 Ga0207686_10002682 Ga0207686_100026827 85
177 3300025935 Ga0207709_10648295 Ga0207709_106482952 85
178 3300025936 Ga0207670_11255076 Ga0207670_112550762 85
179 3300025937 Ga0207669_10120938 Ga0207669_101209382 85
180 3300025938 Ga0207704_10073258 Ga0207704_100732583 85
181 3300025938 Ga0207704_11053833 Ga0207704_110538332 85
182 3300025939 Ga0207665_10795262 Ga0207665_107952622 85
183 3300025940 Ga0207691_10000937 Ga0207691_1000093721 85
184 3300025940 Ga0207691_10794167 Ga0207691_107941672 85
185 3300025941 Ga0207711_11636323 Ga0207711_116363232 85
186 3300025944 Ga0207661_10155987 Ga0207661_101559872 85
187 3300025945 Ga0207679_10003550 Ga0207679_100035504 85
188 3300025945 Ga0207679_11007552 Ga0207679_110075522 85
189 3300025949 Ga0207667_10718035 Ga0207667_107180352 85
190 3300025960 Ga0207651_10001380 Ga0207651_1000138011 85
191 3300025961 Ga0207712_10000512 Ga0207712_1000051215 85
192 3300025981 Ga0207640_10004765 Ga0207640_100047652 85
193 3300025986 Ga0207658_10094771 Ga0207658_100947712 85
194 3300026023 Ga0207677_10000212 Ga0207677_1000021237 85
195 3300026041 Ga0207639_10313275 Ga0207639_103132752 85
196 3300026078 Ga0207702_11188339 Ga0207702_111883392 85
197 3300026088 Ga0207641_10031392 Ga0207641_100313921 85
198 3300026095 Ga0207676_10047503 Ga0207676_100475034 85
199 3300026095 Ga0207676_11139697 Ga0207676_111396971 85
200 3300026095 Ga0207676_11293707 Ga0207676_112937072 85
201 3300026116 Ga0207674_11089683 Ga0207674_110896832 85
202 3300026121 Ga0207683_10000010 Ga0207683_1000001064 85
203 3300026121 Ga0207683_12114743 Ga0207683_121147432 85
204 3300026142 Ga0207698_10000086 Ga0207698_1000008656 85
205 3300026142 Ga0207698_10449346 Ga0207698_104493462 85
206 3300026142 Ga0207698_11809248 Ga0207698_118092481 85
207 3300027395 Ga0209996_1026772 Ga0209996_10267722 85
208 3300027526 Ga0209968_1082878 Ga0209968_10828782 85
209 3300027543 Ga0209999_1114876 Ga0209999_11148761 85
210 3300027907 Ga0207428_10087415 Ga0207428_100874154 85
211 3300028379 Ga0268266_10715821 Ga0268266_107158212 85
212 3300028380 Ga0268265_10904141 Ga0268265_109041412 85
213 3300028573 Ga0265334_10000295 Ga0265334_1000029516 85
214 3300030762 Ga0265775_107380 Ga0265775_1073801 85
215 3300031456 Ga0307513_10020341 Ga0307513_100203416 85
216 3300031616 Ga0307508_10326921 Ga0307508_103269212 85
217 3300031665 Ga0316575_10009680 Ga0316575_100096803 85
218 3300031665 Ga0316575_10019501 Ga0316575_100195014 85
219 3300031665 Ga0316575_10150158 Ga0316575_101501583 85
220 3300031691 Ga0316579_10006229 Ga0316579_100062293 85
221 3300031691 Ga0316579_10057999 Ga0316579_100579993 85
222 3300031727 Ga0316576_10116527 Ga0316576_101165272 85
223 3300031727 Ga0316576_10121021 Ga0316576_101210213 85
224 3300031727 Ga0316576_10314598 Ga0316576_103145981 85
225 3300031727 Ga0316576_10819654 Ga0316576_108196542 85
226 3300031728 Ga0316578_10001340 Ga0316578_1000134010 85
227 3300031728 Ga0316578_10127409 Ga0316578_101274092 85
228 3300031728 Ga0316578_10326112 Ga0316578_103261122 85
229 3300031731 Ga0307405_10356009 Ga0307405_103560092 85
230 3300031731 Ga0307405_10688390 Ga0307405_106883902 85
231 3300031733 Ga0316577_10019529 Ga0316577_100195295 85
232 3300031733 Ga0316577_10039954 Ga0316577_100399542 85
233 3300031733 Ga0316577_10903851 Ga0316577_109038512 85
234 3300031824 Ga0307413_10306424 Ga0307413_103064243 85
235 3300031901 Ga0307406_10749990 Ga0307406_107499902 85
236 3300031903 Ga0307407_10577904 Ga0307407_105779042 85
237 3300031903 Ga0307407_10777738 Ga0307407_107777382 85
238 3300031911 Ga0307412_11089558 Ga0307412_110895582 85
239 3300031995 Ga0307409_101341792 Ga0307409_1013417922 85
240 3300032002 Ga0307416_100685740 Ga0307416_1006857402 85
241 3300032002 Ga0307416_100699197 Ga0307416_1006991972 85
242 3300032004 Ga0307414_10622995 Ga0307414_106229952 85
243 3300032004 Ga0307414_10876922 Ga0307414_108769222 85
244 3300032005 Ga0307411_10172328 Ga0307411_101723283 85
245 3300032005 Ga0307411_10307152 Ga0307411_103071523 85
246 3300032005 Ga0307411_10501367 Ga0307411_105013672 85
247 3300032126 Ga0307415_100384934 Ga0307415_1003849342 85
248 3300032133 Ga0316583_10034064 Ga0316583_100340642 85
249 3300032133 Ga0316583_10035108 Ga0316583_100351082 85
250 3300032133 Ga0316583_10036633 Ga0316583_100366332 85
251 3300032137 Ga0316585_10001610 Ga0316585_100016105 85
252 3300032139 Ga0316580_10015835 Ga0316580_100158352 85
253 3300032139 Ga0316580_10204428 Ga0316580_102044282 85
254 3300032168 Ga0316593_10019580 Ga0316593_100195802 85
255 3300032168 Ga0316593_10032057 Ga0316593_100320572 85
256 3300032168 Ga0316593_10063144 Ga0316593_100631442 85
257 3300032168 Ga0316593_10195267 Ga0316593_101952671 85
258 3300032168 Ga0316593_10236833 Ga0316593_102368332 85
259 3300033524 Ga0316592_1050128 Ga0316592_10501282 85
260 3300033524 Ga0316592_1096363 Ga0316592_10963632 85
261 3300033524 Ga0316592_1102111 Ga0316592_11021111 85
262 3300033527 Ga0316586_1072608 Ga0316586_10726082 85
263 3300033527 Ga0316586_1077255 Ga0316586_10772551 85
264 3300033528 Ga0316588_1063921 Ga0316588_10639211 85
265 3300033528 Ga0316588_1130965 Ga0316588_11309651 85
266 3300033529 Ga0316587_1011564 Ga0316587_10115641 85
267 3300033529 Ga0316587_1052693 Ga0316587_10526931 85
268 3300033529 Ga0316587_1053284 Ga0316587_10532842 85
269 3300033529 Ga0316587_1066617 Ga0316587_10666171 85
270 3300033529 Ga0316587_1068580 Ga0316587_10685802 85
271 3300033529 Ga0316587_1070462 Ga0316587_10704621 85
272 3300033529 Ga0316587_1074048 Ga0316587_10740482 85
273 3300033529 Ga0316587_1082102 Ga0316587_10821021 85
274 3300033541 Ga0316596_1033532 Ga0316596_10335321 85
275 3300033541 Ga0316596_1141781 Ga0316596_11417811 85
276 3300033541 Ga0316596_1157461 Ga0316596_11574612 85
277 3300033541 Ga0316596_1170954 Ga0316596_11709542 85
278 3300033541 Ga0316596_1180345 Ga0316596_11803452 85
279 3300034957 Ga0373938_0045951 Ga0373938_0045951_175_432 85
280 3300035115 Ga0373941_0152644 Ga0373941_0152644_198_455 85
281 3300035119 Ga0373956_0123385 Ga0373956_0123385_799_1056 85
282 3300035120 Ga0373957_0389196 Ga0373957_0389196_308_565 85
283 3300035241 Ga0373961_0006660 Ga0373961_0006660_72_329 85
284 3300035241 Ga0373961_0387327 Ga0373961_0387327_103_360 85
285 3300035398 Ga0316574_0000656 Ga0316574_0000656_13514_13771 85
286 3300035398 Ga0316574_0028331 Ga0316574_0028331_2745_3002 85
287 3300035398 Ga0316574_0091258 Ga0316574_0091258_524_781 85
288 3300035398 Ga0316574_0114342 Ga0316574_0114342_1446_1703 85
289 3300035398 Ga0316574_0222818 Ga0316574_0222818_383_640 85
290 3300035398 Ga0316574_0491967 Ga0316574_0491967_102_359 85
291 3300035724 Ga0373933_1001965 Ga0373933_1001965_152_409 85
292 3300036401 Ga0373937_1704295 Ga0373937_1704295_160_429 85
293 3300036647 Ga0316582_0012819 Ga0316582_0012819_629_886 85
294 3300036647 Ga0316582_0021843 Ga0316582_0021843_1921_2178 85
295 3300036647 Ga0316582_0028998 Ga0316582_0028998_2296_2553 85
296 3300036712 Ga0316584_0031836 Ga0316584_0031836_2141_2398 85
297 3300036712 Ga0316584_0054443 Ga0316584_0054443_831_1088 85
298 3300036712 Ga0316584_0090735 Ga0316584_0090735_691_948 85
299 3300036712 Ga0316584_0183729 Ga0316584_0183729_1232_1489 85
300 3300036712 Ga0316584_1031178 Ga0316584_1031178_145_402 85
301 3300037588 Ga0316581_0018561 Ga0316581_0018561_701_958 85
302 3300037588 Ga0316581_0037013 Ga0316581_0037013_71_328 85
303 3300037588 Ga0316581_0040259 Ga0316581_0040259_52_309 85
304 3300037588 Ga0316581_0151787 Ga0316581_0151787_356_613 85
305 3300038725 Ga0400484_34694 Ga0400484_34694_1431_1688 85
306 3300038726 Ga0400490_39445 Ga0400490_39445_100_357 85
307 3300038726 Ga0400490_51845 Ga0400490_51845_2131_2388 85
308 3300038726 Ga0400490_56549 Ga0400490_56549_6720_6977 85
309 3300038727 Ga0400491_07068 Ga0400491_07068_593_850 85
310 3300038727 Ga0400491_11788 Ga0400491_11788_485_742 85
311 3300038735 Ga0400485_17515 Ga0400485_17515_1067_1324 85
312 3300038741 Ga0400488_37652 Ga0400488_37652_1678_1935 85
313 3300038741 Ga0400488_49707 Ga0400488_49707_46_303 85
314 3300038741 Ga0400488_53412 Ga0400488_53412_119_376 85
315 3300038741 Ga0400488_54334 Ga0400488_54334_53_310 85
316 3300039062 Ga0400483_065089 Ga0400483_065089_165_422 85
317 3300039062 Ga0400483_244454 Ga0400483_244454_327_584 85
318 3300039093 Ga0400489_39930 Ga0400489_39930_2612_2869 85
319 3300039110 Ga0400487_09678 Ga0400487_09678_1087_1344 85
320 3300039110 Ga0400487_49956 Ga0400487_49956_821_1078 85
321 3300041451 Ga0451791_0660728 Ga0451791_0660728_259_516 85
322 3300041452 Ga0451793_1808283 Ga0451793_1808283_518_775 85
323 3300042137 Ga0450902_000129 Ga0450902_000129_3740_3997 85
324 3300042142 Ga0450905_001225 Ga0450905_001225_2203_2460 85
325 3300042184 Ga0450908_070369 Ga0450908_070369_93_350 85
326 3300042436 Ga0439435_0033180 Ga0439435_0033180_471_728 85
327 3300042533 Ga0450901_005170 Ga0450901_005170_273_530 85
328 3300042876 Ga0451577_0766331 Ga0451577_0766331_56_313 85
329 3300042876 Ga0451577_1347734 Ga0451577_1347734_202_459 85
330 3300046471 Ga0495650_0245057 Ga0495650_0245057_307_564 85
331 3300046491 Ga0495584_0130131 Ga0495584_0130131_420_677 85
332 3300046511 Ga0495608_0732563 Ga0495608_0732563_64_321 85
333 3300046616 Ga0495668_0069169 Ga0495668_0069169_240_497 85
334 3300046660 Ga0495625_0377117 Ga0495625_0377117_445_702 85
335 3300046683 Ga0495658_0975604 Ga0495658_0975604_182_439 85
336 3300047472 Ga0495686_0716094 Ga0495686_0716094_58_315 85
337 3300048091 Ga0495626_0389562 Ga0495626_0389562_145_402 85
338 3300048903 Ga0496100_0251167 Ga0496100_0251167_542_799 85
339 3300048906 Ga0496103_0269638 Ga0496103_0269638_212_469 85
340 3300048907 Ga0496104_0000016 Ga0496104_0000016_58448_58705 85
341 3300048907 Ga0496104_0271984 Ga0496104_0271984_1216_1473 85
342 3300048908 Ga0496105_0000010 Ga0496105_0000010_152924_153181 85
343 3300048908 Ga0496105_0367796 Ga0496105_0367796_317_574 85
344 3300048909 Ga0496106_0087961 Ga0496106_0087961_1618_1875 85
345 3300048910 Ga0496107_0781731 Ga0496107_0781731_242_499 85
346 3300048912 Ga0496109_0004152 Ga0496109_0004152_2501_2758 85
347 3300048913 Ga0496110_0001254 Ga0496110_0001254_13463_13720 85
348 3300048914 Ga0496111_0616402 Ga0496111_0616402_53_310 85
349 3300048914 Ga0496111_0622817 Ga0496111_0622817_74_331 85
350 3300048915 Ga0496112_1013030 Ga0496112_1013030_469_726 85
351 3300048916 Ga0496113_1490911 Ga0496113_1490911_248_505 85
352 3300048917 Ga0496114_0011312 Ga0496114_0011312_4515_4772 85
353 3300049129 Ga0501309_061335 Ga0501309_061335_20_277 85
354 3300049160 Ga0501304_025674 Ga0501304_025674_10_267 85
355 3300049515 Ga0501292_101713 Ga0501292_101713_78_335 85
356 3300049524 Ga0501301_029780 Ga0501301_029780_130_387 85
357 3300049537 Ga0501321_041986 Ga0501321_041986_379_636 85
358 3300049571 Ga0501034_0807007 Ga0501034_0807007_479_736 85
359 3300049575 Ga0501039_0140133 Ga0501039_0140133_1070_1327 85
360 3300049580 Ga0501046_0053374 Ga0501046_0053374_1992_2249 85
361 3300049581 Ga0501047_0004958 Ga0501047_0004958_11253_11510 85
362 3300049581 Ga0501047_0550503 Ga0501047_0550503_532_789 85
363 3300049581 Ga0501047_0721840 Ga0501047_0721840_141_398 85
364 3300049582 Ga0501048_0939793 Ga0501048_0939793_339_596 85
365 3300049585 Ga0501069_0348891 Ga0501069_0348891_525_782 85
366 3300049591 Ga0501075_0959062 Ga0501075_0959062_144_401 85
367 3300049592 Ga0501076_1810795 Ga0501076_1810795_190_447 85
368 3300049649 Ga0501198_121919 Ga0501198_121919_222_479 85
369 3300049741 Ga0501079_1000043 Ga0501079_1000043_268_525 85
370 3300049742 Ga0501080_0054775 Ga0501080_0054775_1463_1720 85
371 3300049823 Ga0501044_0002082 Ga0501044_0002082_20929_21186 85
372 3300050508 nmdc:mga09592_312826_c1 nmdc:mga09592_312826_c1_329_586 85
373 3300050509 nmdc:mga0qj67_267341_c1 nmdc:mga0qj67_267341_c1_329_586 85
374 3300050511 nmdc:mga08y16_100889_c1 nmdc:mga08y16_100889_c1_2333_2590 85
375 3300050511 nmdc:mga08y16_1062596_c1 nmdc:mga08y16_1062596_c1_503_760 85
376 3300050511 nmdc:mga08y16_1881985_c1 nmdc:mga08y16_1881985_c1_272_529 85
377 3300050512 nmdc:mga0n895_353537_c1 nmdc:mga0n895_353537_c1_481_738 85
378 3300050513 nmdc:mga0rr50_407392_c1 nmdc:mga0rr50_407392_c1_322_579 85
379 3300050514 nmdc:mga08x19_652609_c1 nmdc:mga08x19_652609_c1_154_411 85
380 3300050515 nmdc:mga0a205_368814_c1 nmdc:mga0a205_368814_c1_732_989 85
381 3300053151 Ga0500604_0046397 Ga0500604_0046397_233_490 85
382 3300059424 Ga0590075_191211 Ga0590075_191211_152_409 85
383 3300059647 Ga0587079_248242 Ga0587079_248242_10_267 85
384 3300059660 Ga0587124_035590 Ga0587124_035590_18_275 85
385 3300060353 Ga0501082_0900935 Ga0501082_0900935_154_411 85
386 3300060353 Ga0501082_0926411 Ga0501082_0926411_176_433 85
387 2162886007 SwRhRL2b_contig_3591334 SwRhRL2b_0126.00006440 86
388 3300001989 JGI24739J22299_10076955 JGI24739J22299_100769552 86
389 3300001989 JGI24739J22299_10243682 JGI24739J22299_102436822 86
390 3300002070 JGI24750J21931_1058269 JGI24750J21931_10582691 86
391 3300002074 JGI24748J21848_1024778 JGI24748J21848_10247781 86
392 3300002075 JGI24738J21930_10042619 JGI24738J21930_100426192 86
393 3300002076 JGI24749J21850_1003369 JGI24749J21850_10033692 86
394 3300002077 JGI24744J21845_10002561 JGI24744J21845_100025612 86
395 3300002126 JGI24035J26624_1001611 JGI24035J26624_10016114 86
396 3300002155 JGI24033J26618_1009627 JGI24033J26618_10096273 86
397 3300002239 JGI24034J26672_10003051 JGI24034J26672_100030513 86
398 3300002244 JGI24742J22300_10050496 JGI24742J22300_100504962 86
399 3300003382 JGI26139J50223_101259 JGI26139J50223_1012592 86
400 3300003383 JGI26140J50224_102677 JGI26140J50224_1026772 86
401 3300003502 JGI26143J51219_1007187 JGI26143J51219_10071871 86
402 3300003503 JGI26141J51220_1001596 JGI26141J51220_10015962 86
403 3300004801 Ga0058860_11986261 Ga0058860_119862611 86
404 3300005288 Ga0065714_10494008 Ga0065714_104940082 86
405 3300005289 Ga0065704_10005640 Ga0065704_100056403 86
406 3300005290 Ga0065712_10088144 Ga0065712_100881443 86
407 3300005293 Ga0065715_10226322 Ga0065715_102263223 86
408 3300005293 Ga0065715_10286218 Ga0065715_102862183 86
409 3300005327 Ga0070658_10375888 Ga0070658_103758882 86
410 3300005327 Ga0070658_11053169 Ga0070658_110531692 86
411 3300005328 Ga0070676_10004633 Ga0070676_100046336 86
412 3300005328 Ga0070676_10022670 Ga0070676_100226703 86
413 3300005328 Ga0070676_10080971 Ga0070676_100809711 86
414 3300005328 Ga0070676_10271039 Ga0070676_102710392 86
415 3300005329 Ga0070683_100023875 Ga0070683_1000238754 86
416 3300005329 Ga0070683_100096823 Ga0070683_1000968231 86
417 3300005330 Ga0070690_100152161 Ga0070690_1001521612 86
418 3300005331 Ga0070670_100028047 Ga0070670_1000280472 86
419 3300005331 Ga0070670_100039253 Ga0070670_1000392532 86
420 3300005331 Ga0070670_100047430 Ga0070670_1000474305 86
421 3300005331 Ga0070670_100207384 Ga0070670_1002073841 86
422 3300005331 Ga0070670_100303710 Ga0070670_1003037102 86
423 3300005333 Ga0070677_10001970 Ga0070677_100019704 86
424 3300005333 Ga0070677_10027068 Ga0070677_100270681 86
425 3300005333 Ga0070677_10205605 Ga0070677_102056051 86
426 3300005333 Ga0070677_10943637 Ga0070677_109436371 86
427 3300005334 Ga0068869_100206090 Ga0068869_1002060902 86
428 3300005334 Ga0068869_100508278 Ga0068869_1005082781 86
429 3300005334 Ga0068869_100828206 Ga0068869_1008282062 86
430 3300005335 Ga0070666_10026328 Ga0070666_100263286 86
431 3300005335 Ga0070666_10075172 Ga0070666_100751723 86
432 3300005335 Ga0070666_10117381 Ga0070666_101173811 86
433 3300005335 Ga0070666_10130096 Ga0070666_101300963 86
434 3300005335 Ga0070666_10394255 Ga0070666_103942551 86
435 3300005335 Ga0070666_10602096 Ga0070666_106020961 86
436 3300005337 Ga0070682_100539640 Ga0070682_1005396401 86
437 3300005338 Ga0068868_100004204 Ga0068868_1000042049 86
438 3300005338 Ga0068868_100019657 Ga0068868_1000196574 86
439 3300005338 Ga0068868_100074651 Ga0068868_1000746513 86
440 3300005338 Ga0068868_100536020 Ga0068868_1005360202 86
441 3300005339 Ga0070660_100744626 Ga0070660_1007446261 86
442 3300005339 Ga0070660_100845360 Ga0070660_1008453601 86
443 3300005340 Ga0070689_100025793 Ga0070689_1000257935 86
444 3300005340 Ga0070689_100064791 Ga0070689_1000647912 86
445 3300005341 Ga0070691_11093019 Ga0070691_110930192 86
446 3300005343 Ga0070687_100455451 Ga0070687_1004554511 86
447 3300005343 Ga0070687_101248954 Ga0070687_1012489541 86
448 3300005344 Ga0070661_100032576 Ga0070661_1000325762 86
449 3300005344 Ga0070661_100104257 Ga0070661_1001042573 86
450 3300005345 Ga0070692_10219291 Ga0070692_102192912 86
451 3300005347 Ga0070668_100004577 Ga0070668_10000457710 86
452 3300005347 Ga0070668_100352812 Ga0070668_1003528122 86
453 3300005347 Ga0070668_101513650 Ga0070668_1015136502 86
454 3300005353 Ga0070669_100024258 Ga0070669_1000242584 86
455 3300005353 Ga0070669_100154213 Ga0070669_1001542132 86
456 3300005353 Ga0070669_100430871 Ga0070669_1004308713 86
457 3300005354 Ga0070675_100016364 Ga0070675_1000163644 86
458 3300005354 Ga0070675_100036674 Ga0070675_1000366742 86
459 3300005354 Ga0070675_100172552 Ga0070675_1001725523 86
460 3300005355 Ga0070671_100001551 Ga0070671_10000155116 86
461 3300005355 Ga0070671_100001556 Ga0070671_10000155611 86
462 3300005355 Ga0070671_100035953 Ga0070671_1000359532 86
463 3300005355 Ga0070671_100196358 Ga0070671_1001963583 86
464 3300005356 Ga0070674_100002395 Ga0070674_10000239511 86
465 3300005356 Ga0070674_100009399 Ga0070674_1000093994 86
466 3300005356 Ga0070674_100064581 Ga0070674_1000645813 86
467 3300005364 Ga0070673_100002294 Ga0070673_1000022946 86
468 3300005364 Ga0070673_100079208 Ga0070673_1000792083 86
469 3300005364 Ga0070673_100081985 Ga0070673_1000819852 86
470 3300005364 Ga0070673_100235763 Ga0070673_1002357631 86
471 3300005364 Ga0070673_100931497 Ga0070673_1009314972 86
472 3300005365 Ga0070688_100006808 Ga0070688_1000068085 86
473 3300005366 Ga0070659_100002868 Ga0070659_1000028683 86
474 3300005366 Ga0070659_100017560 Ga0070659_1000175605 86
475 3300005366 Ga0070659_100021230 Ga0070659_1000212301 86
476 3300005366 Ga0070659_100344785 Ga0070659_1003447852 86
477 3300005367 Ga0070667_100161685 Ga0070667_1001616853 86
478 3300005367 Ga0070667_100464192 Ga0070667_1004641922 86
479 3300005367 Ga0070667_100879519 Ga0070667_1008795192 86
480 3300005367 Ga0070667_101430350 Ga0070667_1014303502 86
481 3300005434 Ga0070709_11644514 Ga0070709_116445141 86
482 3300005437 Ga0070710_10184838 Ga0070710_101848382 86
483 3300005438 Ga0070701_10009010 Ga0070701_100090103 86
484 3300005439 Ga0070711_100024568 Ga0070711_1000245682 86
485 3300005439 Ga0070711_101211873 Ga0070711_1012118732 86
486 3300005440 Ga0070705_100349431 Ga0070705_1003494313 86
487 3300005441 Ga0070700_100042710 Ga0070700_1000427101 86
488 3300005441 Ga0070700_100425305 Ga0070700_1004253053 86
489 3300005441 Ga0070700_101370247 Ga0070700_1013702472 86
490 3300005444 Ga0070694_100296399 Ga0070694_1002963992 86
491 3300005444 Ga0070694_101850916 Ga0070694_1018509161 86
492 3300005445 Ga0070708_101705258 Ga0070708_1017052582 86
493 3300005455 Ga0070663_100017102 Ga0070663_1000171025 86
494 3300005455 Ga0070663_100245419 Ga0070663_1002454192 86
495 3300005455 Ga0070663_101649007 Ga0070663_1016490071 86
496 3300005455 Ga0070663_101665971 Ga0070663_1016659712 86
497 3300005456 Ga0070678_100001549 Ga0070678_1000015498 86
498 3300005456 Ga0070678_102058050 Ga0070678_1020580501 86
499 3300005456 Ga0070678_102058052 Ga0070678_1020580521 86
500 3300005457 Ga0070662_100004198 Ga0070662_1000041984 86
501 3300005457 Ga0070662_100086491 Ga0070662_1000864912 86
502 3300005457 Ga0070662_100129688 Ga0070662_1001296882 86
503 3300005458 Ga0070681_11006947 Ga0070681_110069472 86
504 3300005459 Ga0068867_100010133 Ga0068867_1000101334 86
505 3300005459 Ga0068867_100017656 Ga0068867_1000176563 86
506 3300005459 Ga0068867_100037370 Ga0068867_1000373706 86
507 3300005459 Ga0068867_101193267 Ga0068867_1011932672 86
508 3300005466 Ga0070685_10001508 Ga0070685_100015089 86
509 3300005466 Ga0070685_10080740 Ga0070685_100807402 86
510 3300005518 Ga0070699_100041359 Ga0070699_1000413592 86
511 3300005530 Ga0070679_100113996 Ga0070679_1001139962 86
512 3300005530 Ga0070679_101075051 Ga0070679_1010750512 86
513 3300005535 Ga0070684_100078073 Ga0070684_1000780732 86
514 3300005539 Ga0068853_100033279 Ga0068853_1000332798 86
515 3300005539 Ga0068853_100050812 Ga0068853_1000508123 86
516 3300005539 Ga0068853_100084432 Ga0068853_1000844321 86
517 3300005539 Ga0068853_100972970 Ga0068853_1009729701 86
518 3300005543 Ga0070672_100002678 Ga0070672_10000267811 86
519 3300005543 Ga0070672_100045354 Ga0070672_1000453542 86
520 3300005543 Ga0070672_100084736 Ga0070672_1000847362 86
521 3300005543 Ga0070672_100197901 Ga0070672_1001979013 86
522 3300005543 Ga0070672_101031835 Ga0070672_1010318351 86
523 3300005544 Ga0070686_100005498 Ga0070686_1000054986 86
524 3300005546 Ga0070696_100000754 Ga0070696_10000075415 86
525 3300005547 Ga0070693_100088336 Ga0070693_1000883363 86
526 3300005548 Ga0070665_100002745 Ga0070665_10000274516 86
527 3300005548 Ga0070665_100018805 Ga0070665_1000188054 86
528 3300005563 Ga0068855_100002322 Ga0068855_10000232217 86
529 3300005563 Ga0068855_100459357 Ga0068855_1004593572 86
530 3300005564 Ga0070664_100007540 Ga0070664_10000754010 86
531 3300005564 Ga0070664_100015789 Ga0070664_1000157892 86
532 3300005564 Ga0070664_100030726 Ga0070664_1000307264 86
533 3300005564 Ga0070664_100275010 Ga0070664_1002750102 86
534 3300005577 Ga0068857_100010099 Ga0068857_1000100993 86
535 3300005577 Ga0068857_100037353 Ga0068857_1000373532 86
536 3300005577 Ga0068857_100232629 Ga0068857_1002326292 86
537 3300005577 Ga0068857_101374427 Ga0068857_1013744272 86
538 3300005578 Ga0068854_100005954 Ga0068854_1000059546 86
539 3300005578 Ga0068854_100010424 Ga0068854_1000104243 86
540 3300005578 Ga0068854_100135659 Ga0068854_1001356592 86
541 3300005578 Ga0068854_100716922 Ga0068854_1007169222 86
542 3300005614 Ga0068856_100000855 Ga0068856_10000085514 86
543 3300005614 Ga0068856_100306968 Ga0068856_1003069681 86
544 3300005614 Ga0068856_100725453 Ga0068856_1007254532 86
545 3300005614 Ga0068856_101189176 Ga0068856_1011891761 86
546 3300005614 Ga0068856_102708950 Ga0068856_1027089501 86
547 3300005615 Ga0070702_100022772 Ga0070702_1000227723 86
548 3300005615 Ga0070702_100075923 Ga0070702_1000759233 86
549 3300005615 Ga0070702_100179287 Ga0070702_1001792874 86
550 3300005616 Ga0068852_100001602 Ga0068852_1000016025 86
551 3300005616 Ga0068852_100005847 Ga0068852_10000584710 86
552 3300005616 Ga0068852_100011315 Ga0068852_1000113157 86
553 3300005616 Ga0068852_100019341 Ga0068852_1000193415 86
554 3300005616 Ga0068852_100081226 Ga0068852_1000812263 86
555 3300005617 Ga0068859_100013103 Ga0068859_1000131035 86
556 3300005617 Ga0068859_100538038 Ga0068859_1005380382 86
557 3300005618 Ga0068864_100011338 Ga0068864_1000113384 86
558 3300005618 Ga0068864_100021394 Ga0068864_1000213944 86
559 3300005618 Ga0068864_100389456 Ga0068864_1003894563 86
560 3300005618 Ga0068864_100815251 Ga0068864_1008152512 86
561 3300005718 Ga0068866_10012085 Ga0068866_100120853 86
562 3300005719 Ga0068861_100131918 Ga0068861_1001319183 86
563 3300005719 Ga0068861_100202694 Ga0068861_1002026943 86
564 3300005719 Ga0068861_100538805 Ga0068861_1005388052 86
565 3300005834 Ga0068851_10014095 Ga0068851_100140952 86
566 3300005834 Ga0068851_10029539 Ga0068851_100295392 86
567 3300005840 Ga0068870_10012155 Ga0068870_100121556 86
568 3300005840 Ga0068870_10045705 Ga0068870_100457052 86
569 3300005841 Ga0068863_100043298 Ga0068863_1000432983 86
570 3300005841 Ga0068863_100068228 Ga0068863_1000682286 86
571 3300005842 Ga0068858_100009515 Ga0068858_1000095155 86
572 3300005842 Ga0068858_100108493 Ga0068858_1001084933 86
573 3300005842 Ga0068858_100231612 Ga0068858_1002316123 86
574 3300005842 Ga0068858_100386386 Ga0068858_1003863862 86
575 3300005843 Ga0068860_100010336 Ga0068860_1000103363 86
576 3300005843 Ga0068860_100025558 Ga0068860_1000255584 86
577 3300005843 Ga0068860_100037681 Ga0068860_1000376817 86
578 3300005843 Ga0068860_100934673 Ga0068860_1009346732 86
579 3300005844 Ga0068862_100094829 Ga0068862_1000948293 86
580 3300005844 Ga0068862_100489577 Ga0068862_1004895773 86
581 3300005937 Ga0081455_10155142 Ga0081455_101551422 86
582 3300006173 Ga0070716_101771048 Ga0070716_1017710481 86
583 3300006175 Ga0070712_101279546 Ga0070712_1012795462 86
584 3300006237 Ga0097621_100011969 Ga0097621_1000119692 86
585 3300006237 Ga0097621_100020007 Ga0097621_1000200074 86
586 3300006237 Ga0097621_101122517 Ga0097621_1011225172 86
587 3300006237 Ga0097621_102165030 Ga0097621_1021650302 86
588 3300006358 Ga0068871_100035236 Ga0068871_1000352363 86
589 3300006358 Ga0068871_100091275 Ga0068871_1000912755 86
590 3300006358 Ga0068871_100185778 Ga0068871_1001857782 86
591 3300006844 Ga0075428_100070421 Ga0075428_1000704214 86
592 3300006844 Ga0075428_100256932 Ga0075428_1002569323 86
593 3300006844 Ga0075428_101459018 Ga0075428_1014590182 86
594 3300006871 Ga0075434_100238856 Ga0075434_1002388561 86
595 3300006881 Ga0068865_100012439 Ga0068865_1000124393 86
596 3300006881 Ga0068865_100056737 Ga0068865_1000567373 86
597 3300006881 Ga0068865_100365118 Ga0068865_1003651182 86
598 3300006914 Ga0075436_100089911 Ga0075436_1000899113 86
599 3300006931 Ga0097620_100013103 Ga0097620_1000131035 86
600 3300006931 Ga0097620_100538048 Ga0097620_1005380482 86
601 3300007076 Ga0075435_100666276 Ga0075435_1006662762 86
602 3300007076 Ga0075435_101344590 Ga0075435_1013445902 86
603 3300009011 Ga0105251_10587310 Ga0105251_105873102 86
604 3300009093 Ga0105240_10034871 Ga0105240_100348716 86
605 3300009094 Ga0111539_10118660 Ga0111539_101186602 86
606 3300009094 Ga0111539_10455428 Ga0111539_104554282 86
607 3300009098 Ga0105245_10296132 Ga0105245_102961322 86
608 3300009098 Ga0105245_10875349 Ga0105245_108753492 86
609 3300009101 Ga0105247_10053051 Ga0105247_100530511 86
610 3300009101 Ga0105247_10468344 Ga0105247_104683442 86
611 3300009101 Ga0105247_11289841 Ga0105247_112898411 86
612 3300009147 Ga0114129_10129586 Ga0114129_101295866 86
613 3300009147 Ga0114129_10628835 Ga0114129_106288352 86
614 3300009148 Ga0105243_10019984 Ga0105243_100199844 86
615 3300009148 Ga0105243_10624830 Ga0105243_106248302 86
616 3300009176 Ga0105242_10116331 Ga0105242_101163311 86
617 3300009176 Ga0105242_10156694 Ga0105242_101566943 86
618 3300009176 Ga0105242_11228772 Ga0105242_112287722 86
619 3300009177 Ga0105248_10006662 Ga0105248_100066622 86
620 3300009177 Ga0105248_10564611 Ga0105248_105646112 86
621 3300009177 Ga0105248_11827197 Ga0105248_118271972 86
622 3300009177 Ga0105248_11983222 Ga0105248_119832221 86
623 3300009545 Ga0105237_10135919 Ga0105237_101359195 86
624 3300009545 Ga0105237_11327976 Ga0105237_113279762 86
625 3300009551 Ga0105238_11868394 Ga0105238_118683942 86
626 3300009553 Ga0105249_10026179 Ga0105249_100261794 86
627 3300009553 Ga0105249_10561594 Ga0105249_105615942 86
628 3300009553 Ga0105249_10585417 Ga0105249_105854172 86
629 3300010375 Ga0105239_12040652 Ga0105239_120406521 86
630 3300010375 Ga0105239_12741927 Ga0105239_127419272 86
631 3300011119 Ga0105246_10084317 Ga0105246_100843174 86
632 3300011119 Ga0105246_10595737 Ga0105246_105957371 86
633 3300011119 Ga0105246_11341865 Ga0105246_113418651 86
634 3300012483 Ga0157337_1004632 Ga0157337_10046322 86
635 3300012500 Ga0157314_1014636 Ga0157314_10146361 86
636 3300013100 Ga0157373_10001165 Ga0157373_100011654 86
637 3300013100 Ga0157373_10528260 Ga0157373_105282602 86
638 3300013100 Ga0157373_10810746 Ga0157373_108107462 86
639 3300013100 Ga0157373_11182253 Ga0157373_111822531 86
640 3300013102 Ga0157371_10000371 Ga0157371_1000037117 86
641 3300013102 Ga0157371_10731026 Ga0157371_107310262 86
642 3300013104 Ga0157370_10004045 Ga0157370_1000404510 86
643 3300013104 Ga0157370_10977870 Ga0157370_109778702 86
644 3300013105 Ga0157369_10064607 Ga0157369_100646072 86
645 3300013105 Ga0157369_10758647 Ga0157369_107586473 86
646 3300013296 Ga0157374_10035202 Ga0157374_100352024 86
647 3300013296 Ga0157374_10052738 Ga0157374_100527383 86
648 3300013296 Ga0157374_10071691 Ga0157374_100716912 86
649 3300013296 Ga0157374_10101628 Ga0157374_101016283 86
650 3300013296 Ga0157374_12871393 Ga0157374_128713931 86
651 3300013297 Ga0157378_10013808 Ga0157378_100138084 86
652 3300013297 Ga0157378_10018715 Ga0157378_100187156 86
653 3300013297 Ga0157378_10070991 Ga0157378_100709912 86
654 3300013306 Ga0163162_10110048 Ga0163162_101100482 86
655 3300013306 Ga0163162_10150864 Ga0163162_101508642 86
656 3300013306 Ga0163162_11235430 Ga0163162_112354303 86
657 3300013306 Ga0163162_12037480 Ga0163162_120374801 86
658 3300013306 Ga0163162_12550794 Ga0163162_125507941 86
659 3300013307 Ga0157372_10002819 Ga0157372_1000281919 86
660 3300013307 Ga0157372_10046062 Ga0157372_100460626 86
661 3300013307 Ga0157372_10050777 Ga0157372_100507772 86
662 3300013307 Ga0157372_11576804 Ga0157372_115768042 86
663 3300013308 Ga0157375_10005891 Ga0157375_100058915 86
664 3300013308 Ga0157375_10006675 Ga0157375_1000667510 86
665 3300013308 Ga0157375_10067001 Ga0157375_100670012 86
666 3300013308 Ga0157375_10116734 Ga0157375_101167345 86
667 3300014325 Ga0163163_10004431 Ga0163163_100044316 86
668 3300014325 Ga0163163_11357856 Ga0163163_113578562 86
669 3300014326 Ga0157380_10047739 Ga0157380_100477393 86
670 3300014326 Ga0157380_12394832 Ga0157380_123948321 86
671 3300014745 Ga0157377_10004255 Ga0157377_100042555 86
672 3300014968 Ga0157379_10004682 Ga0157379_100046828 86
673 3300014968 Ga0157379_10010116 Ga0157379_100101166 86
674 3300014968 Ga0157379_10121834 Ga0157379_101218342 86
675 3300014968 Ga0157379_11548263 Ga0157379_115482632 86
676 3300014968 Ga0157379_12175613 Ga0157379_121756131 86
677 3300014969 Ga0157376_10035989 Ga0157376_100359893 86
678 3300014969 Ga0157376_10044669 Ga0157376_100446693 86
679 3300014969 Ga0157376_10616492 Ga0157376_106164921 86
680 3300017792 Ga0163161_10015375 Ga0163161_100153753 86
681 3300017792 Ga0163161_10114368 Ga0163161_101143683 86
682 3300017792 Ga0163161_10279755 Ga0163161_102797552 86
683 3300017792 Ga0163161_10512510 Ga0163161_105125102 86
684 3300017792 Ga0163161_11097379 Ga0163161_110973792 86
685 3300020075 Ga0206349_1351612 Ga0206349_13516122 86
686 3300021384 Ga0213876_10491303 Ga0213876_104913032 86
687 3300025229 Ga0209147_100667 Ga0209147_10066719 86
688 3300025271 Ga0207666_1003896 Ga0207666_10038962 86
689 3300025290 Ga0207673_1000425 Ga0207673_10004252 86
690 3300025315 Ga0207697_10003843 Ga0207697_100038436 86
691 3300025315 Ga0207697_10195600 Ga0207697_101956003 86
692 3300025321 Ga0207656_10002822 Ga0207656_100028222 86
693 3300025321 Ga0207656_10003030 Ga0207656_100030306 86
694 3300025893 Ga0207682_10000807 Ga0207682_1000080713 86
695 3300025893 Ga0207682_10003234 Ga0207682_100032346 86
696 3300025898 Ga0207692_10102115 Ga0207692_101021153 86
697 3300025899 Ga0207642_10016500 Ga0207642_100165002 86
698 3300025901 Ga0207688_10012429 Ga0207688_100124293 86
699 3300025901 Ga0207688_11067684 Ga0207688_110676841 86
700 3300025903 Ga0207680_10189805 Ga0207680_101898052 86
701 3300025903 Ga0207680_10321768 Ga0207680_103217683 86
702 3300025903 Ga0207680_10497229 Ga0207680_104972292 86
703 3300025903 Ga0207680_11110636 Ga0207680_111106362 86
704 3300025904 Ga0207647_10084374 Ga0207647_100843742 86
705 3300025904 Ga0207647_10273465 Ga0207647_102734651 86
706 3300025906 Ga0207699_10085525 Ga0207699_100855252 86
707 3300025907 Ga0207645_10000888 Ga0207645_1000088816 86
708 3300025907 Ga0207645_10000982 Ga0207645_1000098212 86
709 3300025907 Ga0207645_10127096 Ga0207645_101270962 86
710 3300025907 Ga0207645_10314895 Ga0207645_103148952 86
711 3300025907 Ga0207645_10786131 Ga0207645_107861311 86
712 3300025908 Ga0207643_10000322 Ga0207643_1000032225 86
713 3300025909 Ga0207705_10075154 Ga0207705_100751542 86
714 3300025909 Ga0207705_10851975 Ga0207705_108519751 86
715 3300025912 Ga0207707_10913485 Ga0207707_109134852 86
716 3300025913 Ga0207695_10067327 Ga0207695_100673275 86
717 3300025914 Ga0207671_10903796 Ga0207671_109037962 86
718 3300025916 Ga0207663_10079870 Ga0207663_100798703 86
719 3300025918 Ga0207662_10133633 Ga0207662_101336332 86
720 3300025918 Ga0207662_10145421 Ga0207662_101454212 86
721 3300025919 Ga0207657_10001665 Ga0207657_1000166520 86
722 3300025919 Ga0207657_10470352 Ga0207657_104703522 86
723 3300025919 Ga0207657_11334260 Ga0207657_113342601 86
724 3300025920 Ga0207649_10018411 Ga0207649_100184113 86
725 3300025920 Ga0207649_10070577 Ga0207649_100705771 86
726 3300025920 Ga0207649_10219937 Ga0207649_102199372 86
727 3300025920 Ga0207649_11068357 Ga0207649_110683571 86
728 3300025921 Ga0207652_10466197 Ga0207652_104661972 86
729 3300025921 Ga0207652_11545837 Ga0207652_115458371 86
730 3300025923 Ga0207681_10022861 Ga0207681_100228612 86
731 3300025923 Ga0207681_10023100 Ga0207681_100231004 86
732 3300025923 Ga0207681_10506244 Ga0207681_105062442 86
733 3300025923 Ga0207681_11326297 Ga0207681_113262972 86
734 3300025924 Ga0207694_10658891 Ga0207694_106588911 86
735 3300025925 Ga0207650_10001677 Ga0207650_1000167712 86
736 3300025925 Ga0207650_10018412 Ga0207650_100184122 86
737 3300025925 Ga0207650_10186302 Ga0207650_101863022 86
738 3300025925 Ga0207650_10691617 Ga0207650_106916172 86
739 3300025926 Ga0207659_10028374 Ga0207659_100283744 86
740 3300025926 Ga0207659_10073672 Ga0207659_100736723 86
741 3300025926 Ga0207659_10329218 Ga0207659_103292182 86
742 3300025927 Ga0207687_10302359 Ga0207687_103023592 86
743 3300025929 Ga0207664_10005612 Ga0207664_100056127 86
744 3300025931 Ga0207644_10001258 Ga0207644_1000125810 86
745 3300025931 Ga0207644_10003027 Ga0207644_100030272 86
746 3300025931 Ga0207644_10007021 Ga0207644_100070214 86
747 3300025931 Ga0207644_10022080 Ga0207644_100220804 86
748 3300025931 Ga0207644_10024638 Ga0207644_100246386 86
749 3300025932 Ga0207690_10002339 Ga0207690_100023398 86
750 3300025932 Ga0207690_10180975 Ga0207690_101809752 86
751 3300025932 Ga0207690_10488581 Ga0207690_104885812 86
752 3300025933 Ga0207706_10000002 Ga0207706_10000002152 86
753 3300025933 Ga0207706_10000542 Ga0207706_1000054228 86
754 3300025933 Ga0207706_10043246 Ga0207706_100432464 86
755 3300025933 Ga0207706_10330295 Ga0207706_103302952 86
756 3300025933 Ga0207706_10416015 Ga0207706_104160152 86
757 3300025934 Ga0207686_10329046 Ga0207686_103290462 86
758 3300025935 Ga0207709_10072573 Ga0207709_100725732 86
759 3300025936 Ga0207670_10030427 Ga0207670_100304272 86
760 3300025937 Ga0207669_10023174 Ga0207669_100231743 86
761 3300025937 Ga0207669_10064692 Ga0207669_100646921 86
762 3300025937 Ga0207669_11378430 Ga0207669_113784301 86
763 3300025938 Ga0207704_10037899 Ga0207704_100378991 86
764 3300025938 Ga0207704_10155154 Ga0207704_101551542 86
765 3300025938 Ga0207704_10633032 Ga0207704_106330322 86
766 3300025939 Ga0207665_10247395 Ga0207665_102473952 86
767 3300025939 Ga0207665_11522545 Ga0207665_115225451 86
768 3300025940 Ga0207691_10000040 Ga0207691_1000004074 86
769 3300025940 Ga0207691_10017121 Ga0207691_100171216 86
770 3300025940 Ga0207691_10104593 Ga0207691_101045934 86
771 3300025940 Ga0207691_10120560 Ga0207691_101205602 86
772 3300025941 Ga0207711_10176370 Ga0207711_101763702 86
773 3300025941 Ga0207711_10244981 Ga0207711_102449812 86
774 3300025941 Ga0207711_10255878 Ga0207711_102558782 86
775 3300025941 Ga0207711_10287043 Ga0207711_102870432 86
776 3300025941 Ga0207711_10607427 Ga0207711_106074272 86
777 3300025941 Ga0207711_10797604 Ga0207711_107976042 86
778 3300025941 Ga0207711_11206206 Ga0207711_112062062 86
779 3300025942 Ga0207689_10004890 Ga0207689_1000489010 86
780 3300025942 Ga0207689_10011199 Ga0207689_100111997 86
781 3300025942 Ga0207689_10739299 Ga0207689_107392992 86
782 3300025944 Ga0207661_10018577 Ga0207661_100185771 86
783 3300025944 Ga0207661_10272210 Ga0207661_102722102 86
784 3300025945 Ga0207679_10004596 Ga0207679_100045969 86
785 3300025945 Ga0207679_10006358 Ga0207679_100063586 86
786 3300025945 Ga0207679_10032735 Ga0207679_100327351 86
787 3300025945 Ga0207679_10915645 Ga0207679_109156451 86
788 3300025949 Ga0207667_10001575 Ga0207667_100015752 86
789 3300025949 Ga0207667_10157361 Ga0207667_101573612 86
790 3300025949 Ga0207667_10338873 Ga0207667_103388732 86
791 3300025949 Ga0207667_10515707 Ga0207667_105157072 86
792 3300025960 Ga0207651_10019572 Ga0207651_100195722 86
793 3300025960 Ga0207651_10044521 Ga0207651_100445215 86
794 3300025960 Ga0207651_10056540 Ga0207651_100565402 86
795 3300025960 Ga0207651_10175668 Ga0207651_101756683 86
796 3300025961 Ga0207712_10109076 Ga0207712_101090762 86
797 3300025961 Ga0207712_11005794 Ga0207712_110057942 86
798 3300025972 Ga0207668_10088546 Ga0207668_100885462 86
799 3300025972 Ga0207668_10089016 Ga0207668_100890162 86
800 3300025972 Ga0207668_10114557 Ga0207668_101145571 86
801 3300025972 Ga0207668_10278308 Ga0207668_102783082 86
802 3300025981 Ga0207640_11380651 Ga0207640_113806512 86
803 3300025986 Ga0207658_10027595 Ga0207658_100275952 86
804 3300025986 Ga0207658_10179602 Ga0207658_101796023 86
805 3300025986 Ga0207658_10377691 Ga0207658_103776912 86
806 3300025986 Ga0207658_10506001 Ga0207658_105060012 86
807 3300025986 Ga0207658_11163101 Ga0207658_111631011 86
808 3300026023 Ga0207677_10006404 Ga0207677_100064044 86
809 3300026023 Ga0207677_10146436 Ga0207677_101464363 86
810 3300026023 Ga0207677_10502649 Ga0207677_105026492 86
811 3300026035 Ga0207703_10012140 Ga0207703_100121404 86
812 3300026035 Ga0207703_10025491 Ga0207703_100254912 86
813 3300026041 Ga0207639_10003900 Ga0207639_100039005 86
814 3300026041 Ga0207639_10008828 Ga0207639_100088287 86
815 3300026041 Ga0207639_10078544 Ga0207639_100785442 86
816 3300026041 Ga0207639_10779085 Ga0207639_107790852 86
817 3300026041 Ga0207639_10836512 Ga0207639_108365122 86
818 3300026067 Ga0207678_10004864 Ga0207678_1000486410 86
819 3300026067 Ga0207678_10132741 Ga0207678_101327413 86
820 3300026067 Ga0207678_10428106 Ga0207678_104281062 86
821 3300026075 Ga0207708_10058304 Ga0207708_100583043 86
822 3300026075 Ga0207708_10102657 Ga0207708_101026572 86
823 3300026075 Ga0207708_10368662 Ga0207708_103686623 86
824 3300026075 Ga0207708_11514822 Ga0207708_115148221 86
825 3300026078 Ga0207702_10003362 Ga0207702_100033622 86
826 3300026078 Ga0207702_11182518 Ga0207702_111825182 86
827 3300026078 Ga0207702_11706858 Ga0207702_117068581 86
828 3300026078 Ga0207702_11958096 Ga0207702_119580962 86
829 3300026078 Ga0207702_12526250 Ga0207702_125262501 86
830 3300026088 Ga0207641_10026578 Ga0207641_100265782 86
831 3300026088 Ga0207641_10037513 Ga0207641_100375134 86
832 3300026088 Ga0207641_10238727 Ga0207641_102387271 86
833 3300026089 Ga0207648_10001508 Ga0207648_1000150812 86
834 3300026089 Ga0207648_10003734 Ga0207648_100037342 86
835 3300026089 Ga0207648_10012603 Ga0207648_100126036 86
836 3300026089 Ga0207648_10463942 Ga0207648_104639422 86
837 3300026089 Ga0207648_11048167 Ga0207648_110481671 86
838 3300026095 Ga0207676_10005710 Ga0207676_100057105 86
839 3300026095 Ga0207676_10026092 Ga0207676_100260924 86
840 3300026116 Ga0207674_10049405 Ga0207674_100494056 86
841 3300026116 Ga0207674_10101631 Ga0207674_101016312 86
842 3300026116 Ga0207674_10420880 Ga0207674_104208802 86
843 3300026118 Ga0207675_100000552 Ga0207675_1000005523 86
844 3300026118 Ga0207675_100041297 Ga0207675_1000412972 86
845 3300026118 Ga0207675_100310205 Ga0207675_1003102052 86
846 3300026121 Ga0207683_10003043 Ga0207683_1000304310 86
847 3300026121 Ga0207683_10004012 Ga0207683_100040126 86
848 3300026121 Ga0207683_10007349 Ga0207683_100073497 86
849 3300026142 Ga0207698_10015085 Ga0207698_100150856 86
850 3300026142 Ga0207698_10017117 Ga0207698_100171175 86
851 3300026142 Ga0207698_10029650 Ga0207698_100296502 86
852 3300026142 Ga0207698_10047047 Ga0207698_100470476 86
853 3300026142 Ga0207698_12095736 Ga0207698_120957362 86
854 3300027360 Ga0209969_1001288 Ga0209969_10012882 86
855 3300027364 Ga0209967_1024941 Ga0209967_10249412 86
856 3300027378 Ga0209981_1008718 Ga0209981_10087182 86
857 3300027462 Ga0210000_1006874 Ga0210000_10068742 86
858 3300027543 Ga0209999_1001111 Ga0209999_10011113 86
859 3300027552 Ga0209982_1002455 Ga0209982_10024553 86
860 3300027614 Ga0209970_1003037 Ga0209970_10030371 86
861 3300027617 Ga0210002_1001809 Ga0210002_10018092 86
862 3300027665 Ga0209983_1003000 Ga0209983_10030004 86
863 3300027682 Ga0209971_1002883 Ga0209971_10028832 86
864 3300027876 Ga0209974_10025130 Ga0209974_100251302 86
865 3300027907 Ga0207428_10206692 Ga0207428_102066922 86
866 3300028379 Ga0268266_10016359 Ga0268266_100163596 86
867 3300028379 Ga0268266_10031400 Ga0268266_100314005 86
868 3300028379 Ga0268266_10457351 Ga0268266_104573512 86
869 3300028380 Ga0268265_10039327 Ga0268265_100393272 86
870 3300028380 Ga0268265_10084203 Ga0268265_100842032 86
871 3300028381 Ga0268264_10213102 Ga0268264_102131023 86
872 3300028381 Ga0268264_10301638 Ga0268264_103016382 86
873 3300028381 Ga0268264_10764745 Ga0268264_107647452 86
874 3300028381 Ga0268264_11575188 Ga0268264_115751881 86
875 3300031344 Ga0265316_10268766 Ga0265316_102687661 86
876 3300031344 Ga0265316_10859958 Ga0265316_108599582 86
877 3300031727 Ga0316576_10386003 Ga0316576_103860032 86
878 3300031901 Ga0307406_10265111 Ga0307406_102651113 86
879 3300032168 Ga0316593_10181101 Ga0316593_101811012 86
880 3300032168 Ga0316593_10324047 Ga0316593_103240472 86
881 3300033541 Ga0316596_1070754 Ga0316596_10707542 86
882 3300035090 Ga0373949_0103708 Ga0373949_0103708_368_637 86
883 3300035112 Ga0373932_0110418 Ga0373932_0110418_452_721 86
884 3300035114 Ga0373939_0061339 Ga0373939_0061339_237_506 86
885 3300035114 Ga0373939_0196840 Ga0373939_0196840_109_378 86
886 3300035117 Ga0373953_0159593 Ga0373953_0159593_44_313 86
887 3300035118 Ga0373954_0340931 Ga0373954_0340931_28_297 86
888 3300035171 Ga0373946_0041938 Ga0373946_0041938_476_745 86
889 3300035172 Ga0373955_0452757 Ga0373955_0452757_433_702 86
890 3300035410 Ga0373924_0364235 Ga0373924_0364235_63_332 86
891 3300035691 Ga0373931_0395368 Ga0373931_0395368_365_628 86
892 3300035692 Ga0373935_0116625 Ga0373935_0116625_672_941 86
893 3300035692 Ga0373935_0538016 Ga0373935_0538016_368_637 86
894 3300035724 Ga0373933_0969783 Ga0373933_0969783_97_366 86
895 3300035725 Ga0373947_0062720 Ga0373947_0062720_985_1254 86
896 3300036401 Ga0373937_0136986 Ga0373937_0136986_1115_1384 86
897 3300036401 Ga0373937_0436988 Ga0373937_0436988_245_514 86
898 3300036647 Ga0316582_0051646 Ga0316582_0051646_2230_2490 86
899 3300036647 Ga0316582_0070995 Ga0316582_0070995_1539_1799 86
900 3300036712 Ga0316584_0029992 Ga0316584_0029992_1678_1938 86
901 3300037068 Ga0373925_0138738 Ga0373925_0138738_841_1110 86
902 3300039062 Ga0400483_067781 Ga0400483_067781_651_911 86
903 3300039062 Ga0400483_190225 Ga0400483_190225_2867_3127 86
904 3300039437 Ga0436365_0227448 Ga0436365_0227448_223_486 86
905 3300039447 Ga0436361_0127677 Ga0436361_0127677_2193_2453 86
906 3300041509 Ga0451843_0176270 Ga0451843_0176270_702_965 86
907 3300042001 Ga0439441_113674 Ga0439441_113674_127_390 86
908 3300042876 Ga0451577_0165426 Ga0451577_0165426_791_1060 86
909 3300044673 Ga0453683_0823317 Ga0453683_0823317_68_331 86
910 3300044712 Ga0453684_0275710 Ga0453684_0275710_33_302 86
911 3300044712 Ga0453684_1405627 Ga0453684_1405627_104_367 86
912 3300044719 Ga0466971_0297536 Ga0466971_0297536_445_714 86
913 3300045051 Ga0451576_0029113 Ga0451576_0029113_477_740 86
914 3300045051 Ga0451576_1096283 Ga0451576_1096283_399_668 86
915 3300045051 Ga0451576_1814892 Ga0451576_1814892_152_421 86
916 3300045051 Ga0451576_2062754 Ga0451576_2062754_294_563 86
917 3300046452 Ga0495617_043452 Ga0495617_043452_330_599 86
918 3300046453 Ga0495627_000094 Ga0495627_000094_77010_77279 86
919 3300046453 Ga0495627_000391 Ga0495627_000391_29131_29400 86
920 3300046459 Ga0495629_0296766 Ga0495629_0296766_349_618 86
921 3300046472 Ga0495580_0077968 Ga0495580_0077968_1321_1581 86
922 3300046491 Ga0495584_0700538 Ga0495584_0700538_74_343 86
923 3300046512 Ga0495610_0000886 Ga0495610_0000886_17228_17497 86
924 3300046518 Ga0495631_0367477 Ga0495631_0367477_23_292 86
925 3300046524 Ga0495648_0029415 Ga0495648_0029415_2948_3217 86
926 3300046528 Ga0495642_0137441 Ga0495642_0137441_86_355 86
927 3300046530 Ga0495654_0089649 Ga0495654_0089649_469_738 86
928 3300046539 Ga0495621_0035985 Ga0495621_0035985_929_1198 86
929 3300046539 Ga0495621_0290289 Ga0495621_0290289_348_611 86
930 3300046542 Ga0495597_0123852 Ga0495597_0123852_550_819 86
931 3300046616 Ga0495668_0166571 Ga0495668_0166571_324_593 86
932 3300046665 Ga0495661_0140129 Ga0495661_0140129_37_306 86
933 3300046681 Ga0495647_0328579 Ga0495647_0328579_134_403 86
934 3300046683 Ga0495658_0257189 Ga0495658_0257189_454_723 86
935 3300046694 Ga0495649_0018395 Ga0495649_0018395_2977_3246 86
936 3300046794 Ga0495589_0151315 Ga0495589_0151315_686_955 86
937 3300047320 Ga0495672_0043033 Ga0495672_0043033_1669_1938 86
938 3300047320 Ga0495672_0254586 Ga0495672_0254586_106_375 86
939 3300047323 Ga0495683_0142059 Ga0495683_0142059_38_307 86
940 3300047469 Ga0495673_0048119 Ga0495673_0048119_1123_1392 86
941 3300047470 Ga0495681_0000342 Ga0495681_0000342_28217_28486 86
942 3300047472 Ga0495686_0100346 Ga0495686_0100346_621_890 86
943 3300048903 Ga0496100_0024304 Ga0496100_0024304_2110_2379 86
944 3300048903 Ga0496100_0591321 Ga0496100_0591321_320_589 86
945 3300048904 Ga0496101_0101087 Ga0496101_0101087_184_453 86
946 3300048904 Ga0496101_0129623 Ga0496101_0129623_1536_1805 86
947 3300048904 Ga0496101_0449887 Ga0496101_0449887_62_331 86
948 3300048904 Ga0496101_1095292 Ga0496101_1095292_241_510 86
949 3300048905 Ga0496102_0181160 Ga0496102_0181160_656_925 86
950 3300048909 Ga0496106_0000369 Ga0496106_0000369_27921_28190 86
951 3300048909 Ga0496106_0016186 Ga0496106_0016186_3366_3635 86
952 3300048909 Ga0496106_0755067 Ga0496106_0755067_440_709 86
953 3300048910 Ga0496107_0010373 Ga0496107_0010373_2760_3029 86
954 3300048911 Ga0496108_0054442 Ga0496108_0054442_1597_1866 86
955 3300048911 Ga0496108_0060640 Ga0496108_0060640_2811_3080 86
956 3300048911 Ga0496108_0138113 Ga0496108_0138113_1769_2038 86
957 3300048912 Ga0496109_0018831 Ga0496109_0018831_3089_3358 86
958 3300048912 Ga0496109_1181467 Ga0496109_1181467_202_471 86
959 3300048913 Ga0496110_0049068 Ga0496110_0049068_1702_1971 86
960 3300048913 Ga0496110_0121143 Ga0496110_0121143_2058_2327 86
961 3300048913 Ga0496110_1667467 Ga0496110_1667467_22_282 86
962 3300048914 Ga0496111_0051267 Ga0496111_0051267_1753_2022 86
963 3300048914 Ga0496111_0566093 Ga0496111_0566093_485_754 86
964 3300048916 Ga0496113_0887074 Ga0496113_0887074_325_594 86
965 3300048917 Ga0496114_0247718 Ga0496114_0247718_259_528 86
966 3300048917 Ga0496114_1643556 Ga0496114_1643556_157_426 86
967 3300048919 Ga0496116_0079013 Ga0496116_0079013_820_1089 86
968 3300048920 Ga0496117_0295257 Ga0496117_0295257_542_811 86
969 3300048924 Ga0496121_0001812 Ga0496121_0001812_15940_16209 86
970 3300048927 Ga0496124_0083375 Ga0496124_0083375_2158_2427 86
971 3300048928 Ga0496125_0035348 Ga0496125_0035348_945_1214 86
972 3300048929 Ga0496126_0033365 Ga0496126_0033365_3674_3943 86
973 3300049459 Ga0495678_020931 Ga0495678_020931_1261_1530 86
974 3300049572 Ga0501036_1474385 Ga0501036_1474385_128_388 86
975 3300049573 Ga0501037_0258045 Ga0501037_0258045_360_629 86
976 3300049574 Ga0501038_0072406 Ga0501038_0072406_757_1026 86
977 3300049578 Ga0501042_0010602 Ga0501042_0010602_5668_5928 86
978 3300049578 Ga0501042_0640523 Ga0501042_0640523_53_325 86
979 3300049579 Ga0501043_1051912 Ga0501043_1051912_180_449 86
980 3300049585 Ga0501069_0060418 Ga0501069_0060418_1360_1629 86
981 3300049585 Ga0501069_0415145 Ga0501069_0415145_195_464 86
982 3300049587 Ga0501071_0283068 Ga0501071_0283068_862_1128 86
983 3300049741 Ga0501079_1499817 Ga0501079_1499817_185_445 86
984 3300049824 Ga0501045_1393604 Ga0501045_1393604_205_471 86
985 3300050507 nmdc:mga05p37_553537_c1 nmdc:mga05p37_553537_c1_447_716 86
986 3300050509 nmdc:mga0qj67_761683_c1 nmdc:mga0qj67_761683_c1_458_724 86
987 3300050511 nmdc:mga08y16_198791_c1 nmdc:mga08y16_198791_c1_170_439 86
988 3300050511 nmdc:mga08y16_92670_c1 nmdc:mga08y16_92670_c1_757_1026 86
989 3300050512 nmdc:mga0n895_226825_c1 nmdc:mga0n895_226825_c1_123_392 86
990 3300050513 nmdc:mga0rr50_1394565_c1 nmdc:mga0rr50_1394565_c1_309_578 86
991 3300050513 nmdc:mga0rr50_566229_c1 nmdc:mga0rr50_566229_c1_685_951 86
992 3300050514 nmdc:mga08x19_114422_c1 nmdc:mga08x19_114422_c1_1373_1642 86
993 3300050515 nmdc:mga0a205_674860_c1 nmdc:mga0a205_674860_c1_552_821 86
994 3300053078 Ga0495612_0378255 Ga0495612_0378255_65_334 86
995 3300053084 Ga0495595_0098409 Ga0495595_0098409_779_1048 86
996 3300053098 Ga0500650_0252789 Ga0500650_0252789_505_774 86
997 3300053133 Ga0500655_011455 Ga0500655_011455_723_992 86
998 3300053139 Ga0500568_0308044 Ga0500568_0308044_121_390 86
999 3300053178 Ga0500637_0001827 Ga0500637_0001827_7481_7750 86
1000 3300059505 Ga0587083_0141600 Ga0587083_0141600_13_273 86
1001 3300059640 Ga0587067_168625 Ga0587067_168625_281_541 86
1002 3300059644 Ga0587075_057480 Ga0587075_057480_60_329 86
1003 3300059644 Ga0587075_105573 Ga0587075_105573_281_541 86
1004 3300059655 Ga0587114_038670 Ga0587114_038670_481_741 86
1005 3300060344 Ga0587071_173793 Ga0587071_173793_266_526 86
1006 2209111006 2214828539 2213866835 87
1007 2209111006 2214860512 2213907867 87
1008 3300000042 ARSoilYngRDRAFT_c00047 ARSoilYngRDRAFT_000472 87
1009 3300000043 ARcpr5yngRDRAFT_c000047 ARcpr5yngRDRAFT_00004721 87
1010 3300000044 ARSoilOldRDRAFT_c000056 ARSoilOldRDRAFT_00005621 87
1011 3300000045 ARCol0oldRDRAFT_c00903 ARCol0oldRDRAFT_009032 87
1012 3300000652 ARCol0yngRDRAFT_1000188 ARCol0yngRDRAFT_100018813 87
1013 3300001915 JGI24741J21665_1013392 JGI24741J21665_10133922 87
1014 3300001976 JGI24752J21851_1005681 JGI24752J21851_10056813 87
1015 3300001977 JGI24746J21847_1001650 JGI24746J21847_10016504 87
1016 3300001978 JGI24747J21853_1003522 JGI24747J21853_10035222 87
1017 3300001989 JGI24739J22299_10002198 JGI24739J22299_100021982 87
1018 3300001989 JGI24739J22299_10159588 JGI24739J22299_101595882 87
1019 3300001990 JGI24737J22298_10020399 JGI24737J22298_100203991 87
1020 3300002070 JGI24750J21931_1000565 JGI24750J21931_10005656 87
1021 3300002073 JGI24745J21846_1002000 JGI24745J21846_10020003 87
1022 3300002074 JGI24748J21848_1000820 JGI24748J21848_10008204 87
1023 3300002075 JGI24738J21930_10000068 JGI24738J21930_1000006818 87
1024 3300002075 JGI24738J21930_10051603 JGI24738J21930_100516031 87
1025 3300002076 JGI24749J21850_1002631 JGI24749J21850_10026313 87
1026 3300002126 JGI24035J26624_1000806 JGI24035J26624_10008062 87
1027 3300002239 JGI24034J26672_10016234 JGI24034J26672_100162342 87
1028 3300002239 JGI24034J26672_10017419 JGI24034J26672_100174192 87
1029 3300002244 JGI24742J22300_10000478 JGI24742J22300_100004786 87
1030 3300002244 JGI24742J22300_10005731 JGI24742J22300_100057312 87
1031 3300002459 JGI24751J29686_10015828 JGI24751J29686_100158281 87
1032 3300003300 Ga0006758J48902_1019684 Ga0006758J48902_10196842 87
1033 3300003322 rootL2_10033783 rootL2_100337835 87
1034 3300003323 rootH1_10017260 rootH1_100172604 87
1035 3300003347 JGI26128J50194_1008847 JGI26128J50194_10088471 87
1036 3300003347 JGI26128J50194_1011354 JGI26128J50194_10113541 87
1037 3300003349 JGI26129J50193_1013618 JGI26129J50193_10136182 87
1038 3300003354 JGI25160J50197_1000155 JGI25160J50197_100015539 87
1039 3300003383 JGI26140J50224_103316 JGI26140J50224_1033161 87
1040 3300003503 JGI26141J51220_1011422 JGI26141J51220_10114221 87
1041 3300003574 Ga0007410J51695_1024736 Ga0007410J51695_10247362 87
1042 3300003575 Ga0007409J51694_1020325 Ga0007409J51694_10203252 87
1043 3300004798 Ga0058859_10015097 Ga0058859_100150972 87
1044 3300004798 Ga0058859_10072815 Ga0058859_100728151 87
1045 3300004801 Ga0058860_12217485 Ga0058860_122174852 87
1046 3300005262 Ga0065165_1000502 Ga0065165_100050240 87
1047 3300005276 Ga0065717_1002291 Ga0065717_10022914 87
1048 3300005277 Ga0065716_1000773 Ga0065716_10007732 87
1049 3300005289 Ga0065704_10096858 Ga0065704_100968581 87
1050 3300005290 Ga0065712_10774846 Ga0065712_107748462 87
1051 3300005293 Ga0065715_10007102 Ga0065715_100071022 87
1052 3300005295 Ga0065707_10353394 Ga0065707_103533941 87
1053 3300005327 Ga0070658_10246966 Ga0070658_102469662 87
1054 3300005327 Ga0070658_10496049 Ga0070658_104960492 87
1055 3300005327 Ga0070658_10548482 Ga0070658_105484822 87
1056 3300005329 Ga0070683_100006589 Ga0070683_1000065892 87
1057 3300005329 Ga0070683_100227123 Ga0070683_1002271233 87
1058 3300005329 Ga0070683_101685802 Ga0070683_1016858021 87
1059 3300005330 Ga0070690_100147828 Ga0070690_1001478282 87
1060 3300005330 Ga0070690_101223728 Ga0070690_1012237282 87
1061 3300005331 Ga0070670_100061724 Ga0070670_1000617244 87
1062 3300005331 Ga0070670_100111026 Ga0070670_1001110262 87
1063 3300005333 Ga0070677_10004240 Ga0070677_100042403 87
1064 3300005334 Ga0068869_100002241 Ga0068869_1000022415 87
1065 3300005334 Ga0068869_100072509 Ga0068869_1000725094 87
1066 3300005336 Ga0070680_100008073 Ga0070680_1000080735 87
1067 3300005336 Ga0070680_100011943 Ga0070680_1000119432 87
1068 3300005336 Ga0070680_100244828 Ga0070680_1002448282 87
1069 3300005336 Ga0070680_101004365 Ga0070680_1010043652 87
1070 3300005336 Ga0070680_101059583 Ga0070680_1010595832 87
1071 3300005337 Ga0070682_100048795 Ga0070682_1000487954 87
1072 3300005338 Ga0068868_100078617 Ga0068868_1000786172 87
1073 3300005338 Ga0068868_100197230 Ga0068868_1001972301 87
1074 3300005338 Ga0068868_100578477 Ga0068868_1005784772 87
1075 3300005339 Ga0070660_100018589 Ga0070660_1000185895 87
1076 3300005339 Ga0070660_100087626 Ga0070660_1000876263 87
1077 3300005339 Ga0070660_100157902 Ga0070660_1001579022 87
1078 3300005339 Ga0070660_100164825 Ga0070660_1001648253 87
1079 3300005339 Ga0070660_100172308 Ga0070660_1001723082 87
1080 3300005341 Ga0070691_10202860 Ga0070691_102028602 87
1081 3300005343 Ga0070687_100036398 Ga0070687_1000363983 87
1082 3300005343 Ga0070687_100245934 Ga0070687_1002459341 87
1083 3300005343 Ga0070687_100296192 Ga0070687_1002961922 87
1084 3300005344 Ga0070661_100005403 Ga0070661_1000054037 87
1085 3300005344 Ga0070661_100115127 Ga0070661_1001151273 87
1086 3300005344 Ga0070661_101926868 Ga0070661_1019268681 87
1087 3300005345 Ga0070692_10118639 Ga0070692_101186392 87
1088 3300005347 Ga0070668_100584199 Ga0070668_1005841992 87
1089 3300005347 Ga0070668_101375312 Ga0070668_1013753121 87
1090 3300005353 Ga0070669_101135943 Ga0070669_1011359432 87
1091 3300005354 Ga0070675_100000441 Ga0070675_1000004417 87
1092 3300005354 Ga0070675_100184402 Ga0070675_1001844023 87
1093 3300005355 Ga0070671_100012431 Ga0070671_1000124316 87
1094 3300005355 Ga0070671_100076018 Ga0070671_1000760184 87
1095 3300005355 Ga0070671_100740267 Ga0070671_1007402672 87
1096 3300005356 Ga0070674_100012746 Ga0070674_1000127462 87
1097 3300005364 Ga0070673_100006931 Ga0070673_1000069314 87
1098 3300005364 Ga0070673_101402383 Ga0070673_1014023832 87
1099 3300005365 Ga0070688_100025708 Ga0070688_1000257084 87
1100 3300005365 Ga0070688_100092698 Ga0070688_1000926982 87
1101 3300005366 Ga0070659_100100191 Ga0070659_1001001913 87
1102 3300005366 Ga0070659_100142223 Ga0070659_1001422233 87
1103 3300005367 Ga0070667_100028530 Ga0070667_1000285304 87
1104 3300005367 Ga0070667_100072231 Ga0070667_1000722312 87
1105 3300005367 Ga0070667_101867082 Ga0070667_1018670822 87
1106 3300005434 Ga0070709_10012396 Ga0070709_100123964 87
1107 3300005434 Ga0070709_11078116 Ga0070709_110781161 87
1108 3300005435 Ga0070714_100029453 Ga0070714_1000294536 87
1109 3300005435 Ga0070714_100379171 Ga0070714_1003791712 87
1110 3300005435 Ga0070714_100597416 Ga0070714_1005974161 87
1111 3300005436 Ga0070713_100017742 Ga0070713_1000177422 87
1112 3300005436 Ga0070713_100025030 Ga0070713_1000250307 87
1113 3300005436 Ga0070713_100317342 Ga0070713_1003173422 87
1114 3300005437 Ga0070710_10004585 Ga0070710_100045853 87
1115 3300005437 Ga0070710_10014117 Ga0070710_100141172 87
1116 3300005437 Ga0070710_10205217 Ga0070710_102052171 87
1117 3300005437 Ga0070710_10454254 Ga0070710_104542542 87
1118 3300005439 Ga0070711_100013093 Ga0070711_1000130937 87
1119 3300005439 Ga0070711_100035659 Ga0070711_1000356593 87
1120 3300005439 Ga0070711_100612453 Ga0070711_1006124531 87
1121 3300005439 Ga0070711_100709485 Ga0070711_1007094852 87
1122 3300005440 Ga0070705_100052378 Ga0070705_1000523783 87
1123 3300005440 Ga0070705_100194504 Ga0070705_1001945041 87
1124 3300005440 Ga0070705_100505133 Ga0070705_1005051331 87
1125 3300005444 Ga0070694_100324635 Ga0070694_1003246352 87
1126 3300005445 Ga0070708_100322007 Ga0070708_1003220072 87
1127 3300005455 Ga0070663_100055519 Ga0070663_1000555192 87
1128 3300005455 Ga0070663_100105068 Ga0070663_1001050683 87
1129 3300005455 Ga0070663_100484607 Ga0070663_1004846071 87
1130 3300005456 Ga0070678_100000199 Ga0070678_1000001996 87
1131 3300005456 Ga0070678_100032267 Ga0070678_1000322672 87
1132 3300005456 Ga0070678_100282376 Ga0070678_1002823762 87
1133 3300005457 Ga0070662_100277443 Ga0070662_1002774431 87
1134 3300005457 Ga0070662_100295457 Ga0070662_1002954573 87
1135 3300005457 Ga0070662_100476694 Ga0070662_1004766942 87
1136 3300005458 Ga0070681_10022099 Ga0070681_100220997 87
1137 3300005458 Ga0070681_10316431 Ga0070681_103164312 87
1138 3300005458 Ga0070681_10426324 Ga0070681_104263242 87
1139 3300005458 Ga0070681_10447038 Ga0070681_104470381 87
1140 3300005459 Ga0068867_100010552 Ga0068867_1000105522 87
1141 3300005466 Ga0070685_10012971 Ga0070685_100129714 87
1142 3300005466 Ga0070685_10070280 Ga0070685_100702804 87
1143 3300005467 Ga0070706_100239108 Ga0070706_1002391083 87
1144 3300005468 Ga0070707_100429992 Ga0070707_1004299922 87
1145 3300005507 Ga0074259_11716343 Ga0074259_117163431 87
1146 3300005518 Ga0070699_100659131 Ga0070699_1006591311 87
1147 3300005530 Ga0070679_100034451 Ga0070679_1000344516 87
1148 3300005530 Ga0070679_100054841 Ga0070679_1000548412 87
1149 3300005530 Ga0070679_100694621 Ga0070679_1006946211 87
1150 3300005535 Ga0070684_100008219 Ga0070684_1000082194 87
1151 3300005535 Ga0070684_100114904 Ga0070684_1001149043 87
1152 3300005536 Ga0070697_100156186 Ga0070697_1001561863 87
1153 3300005536 Ga0070697_100669475 Ga0070697_1006694752 87
1154 3300005539 Ga0068853_100418324 Ga0068853_1004183241 87
1155 3300005539 Ga0068853_101440580 Ga0068853_1014405801 87
1156 3300005539 Ga0068853_101483536 Ga0068853_1014835362 87
1157 3300005543 Ga0070672_100512608 Ga0070672_1005126082 87
1158 3300005544 Ga0070686_100003612 Ga0070686_1000036127 87
1159 3300005544 Ga0070686_100773877 Ga0070686_1007738772 87
1160 3300005545 Ga0070695_100194138 Ga0070695_1001941382 87
1161 3300005545 Ga0070695_100428755 Ga0070695_1004287552 87
1162 3300005545 Ga0070695_100824996 Ga0070695_1008249962 87
1163 3300005546 Ga0070696_100045926 Ga0070696_1000459264 87
1164 3300005546 Ga0070696_100460079 Ga0070696_1004600792 87
1165 3300005546 Ga0070696_100470026 Ga0070696_1004700261 87
1166 3300005546 Ga0070696_100734356 Ga0070696_1007343561 87
1167 3300005547 Ga0070693_100025946 Ga0070693_1000259463 87
1168 3300005547 Ga0070693_100097889 Ga0070693_1000978892 87
1169 3300005547 Ga0070693_101607833 Ga0070693_1016078331 87
1170 3300005548 Ga0070665_100056129 Ga0070665_1000561295 87
1171 3300005548 Ga0070665_100585725 Ga0070665_1005857251 87
1172 3300005563 Ga0068855_100771544 Ga0068855_1007715442 87
1173 3300005563 Ga0068855_101502555 Ga0068855_1015025552 87
1174 3300005563 Ga0068855_101613475 Ga0068855_1016134751 87
1175 3300005563 Ga0068855_102285631 Ga0068855_1022856312 87
1176 3300005564 Ga0070664_100330207 Ga0070664_1003302073 87
1177 3300005577 Ga0068857_100220438 Ga0068857_1002204383 87
1178 3300005577 Ga0068857_101847406 Ga0068857_1018474061 87
1179 3300005578 Ga0068854_100004779 Ga0068854_1000047792 87
1180 3300005578 Ga0068854_100180560 Ga0068854_1001805602 87
1181 3300005578 Ga0068854_100620040 Ga0068854_1006200402 87
1182 3300005614 Ga0068856_100001340 Ga0068856_1000013405 87
1183 3300005614 Ga0068856_100287023 Ga0068856_1002870233 87
1184 3300005614 Ga0068856_100655388 Ga0068856_1006553882 87
1185 3300005614 Ga0068856_100815705 Ga0068856_1008157052 87
1186 3300005615 Ga0070702_100000293 Ga0070702_10000029313 87
1187 3300005615 Ga0070702_100005192 Ga0070702_1000051926 87
1188 3300005615 Ga0070702_100076023 Ga0070702_1000760233 87
1189 3300005616 Ga0068852_100004733 Ga0068852_1000047332 87
1190 3300005616 Ga0068852_100025768 Ga0068852_1000257688 87
1191 3300005616 Ga0068852_100114102 Ga0068852_1001141022 87
1192 3300005616 Ga0068852_100835011 Ga0068852_1008350112 87
1193 3300005616 Ga0068852_102303163 Ga0068852_1023031631 87
1194 3300005617 Ga0068859_100001767 Ga0068859_1000017671 87
1195 3300005617 Ga0068859_100348107 Ga0068859_1003481072 87
1196 3300005618 Ga0068864_100028741 Ga0068864_1000287413 87
1197 3300005618 Ga0068864_100088909 Ga0068864_1000889092 87
1198 3300005718 Ga0068866_10008945 Ga0068866_100089453 87
1199 3300005718 Ga0068866_10024670 Ga0068866_100246704 87
1200 3300005719 Ga0068861_100090261 Ga0068861_1000902614 87
1201 3300005719 Ga0068861_100345443 Ga0068861_1003454432 87
1202 3300005834 Ga0068851_10042021 Ga0068851_100420213 87
1203 3300005842 Ga0068858_100004999 Ga0068858_1000049995 87
1204 3300005842 Ga0068858_100183275 Ga0068858_1001832753 87
1205 3300005842 Ga0068858_100547671 Ga0068858_1005476711 87
1206 3300005843 Ga0068860_100019087 Ga0068860_10001908710 87
1207 3300005843 Ga0068860_100110596 Ga0068860_1001105962 87
1208 3300005843 Ga0068860_100570744 Ga0068860_1005707442 87
1209 3300005844 Ga0068862_100277998 Ga0068862_1002779983 87
1210 3300005937 Ga0081455_10000002 Ga0081455_10000002478 87
1211 3300005937 Ga0081455_10018858 Ga0081455_100188584 87
1212 3300005937 Ga0081455_10326135 Ga0081455_103261351 87
1213 3300005983 Ga0081540_1013929 Ga0081540_10139293 87
1214 3300006028 Ga0070717_10023506 Ga0070717_100235062 87
1215 3300006038 Ga0075365_10647113 Ga0075365_106471132 87
1216 3300006038 Ga0075365_11321993 Ga0075365_113219931 87
1217 3300006042 Ga0075368_10177725 Ga0075368_101777252 87
1218 3300006042 Ga0075368_10211460 Ga0075368_102114602 87
1219 3300006042 Ga0075368_10431808 Ga0075368_104318081 87
1220 3300006048 Ga0075363_100224005 Ga0075363_1002240052 87
1221 3300006048 Ga0075363_100531447 Ga0075363_1005314471 87
1222 3300006051 Ga0075364_10011774 Ga0075364_100117742 87
1223 3300006051 Ga0075364_10499658 Ga0075364_104996581 87
1224 3300006058 Ga0075432_10010313 Ga0075432_100103134 87
1225 3300006058 Ga0075432_10456828 Ga0075432_104568281 87
1226 3300006163 Ga0070715_10032343 Ga0070715_100323431 87
1227 3300006173 Ga0070716_100002237 Ga0070716_1000022378 87
1228 3300006175 Ga0070712_100048653 Ga0070712_1000486533 87
1229 3300006175 Ga0070712_100220045 Ga0070712_1002200452 87
1230 3300006175 Ga0070712_100507689 Ga0070712_1005076892 87
1231 3300006175 Ga0070712_101197713 Ga0070712_1011977131 87
1232 3300006175 Ga0070712_101340397 Ga0070712_1013403971 87
1233 3300006177 Ga0075362_10111986 Ga0075362_101119862 87
1234 3300006177 Ga0075362_10333219 Ga0075362_103332191 87
1235 3300006186 Ga0075369_10020166 Ga0075369_100201665 87
1236 3300006186 Ga0075369_10358718 Ga0075369_103587181 87
1237 3300006186 Ga0075369_10502268 Ga0075369_105022682 87
1238 3300006195 Ga0075366_10437501 Ga0075366_104375012 87
1239 3300006195 Ga0075366_10496452 Ga0075366_104964521 87
1240 3300006237 Ga0097621_100074431 Ga0097621_1000744314 87
1241 3300006237 Ga0097621_100182157 Ga0097621_1001821572 87
1242 3300006353 Ga0075370_10247891 Ga0075370_102478912 87
1243 3300006358 Ga0068871_100007149 Ga0068871_10000714910 87
1244 3300006358 Ga0068871_100007371 Ga0068871_1000073717 87
1245 3300006844 Ga0075428_100010200 Ga0075428_1000102005 87
1246 3300006846 Ga0075430_100001483 Ga0075430_1000014835 87
1247 3300006846 Ga0075430_100296990 Ga0075430_1002969902 87
1248 3300006847 Ga0075431_100017410 Ga0075431_1000174106 87
1249 3300006852 Ga0075433_10002052 Ga0075433_100020529 87
1250 3300006852 Ga0075433_10019693 Ga0075433_100196934 87
1251 3300006852 Ga0075433_10113614 Ga0075433_101136141 87
1252 3300006852 Ga0075433_10697133 Ga0075433_106971332 87
1253 3300006852 Ga0075433_11023804 Ga0075433_110238042 87
1254 3300006871 Ga0075434_100001473 Ga0075434_1000014735 87
1255 3300006871 Ga0075434_100910128 Ga0075434_1009101282 87
1256 3300006880 Ga0075429_100005294 Ga0075429_10000529410 87
1257 3300006880 Ga0075429_101444655 Ga0075429_1014446551 87
1258 3300006881 Ga0068865_100463108 Ga0068865_1004631082 87
1259 3300006914 Ga0075436_100149631 Ga0075436_1001496312 87
1260 3300006914 Ga0075436_100198680 Ga0075436_1001986803 87
1261 3300006914 Ga0075436_101312623 Ga0075436_1013126231 87
1262 3300006931 Ga0097620_100001767 Ga0097620_1000017671 87
1263 3300006931 Ga0097620_100348120 Ga0097620_1003481202 87
1264 3300007076 Ga0075435_100024384 Ga0075435_1000243846 87
1265 3300007076 Ga0075435_100362455 Ga0075435_1003624552 87
1266 3300007076 Ga0075435_100536393 Ga0075435_1005363932 87
1267 3300009011 Ga0105251_10070903 Ga0105251_100709031 87
1268 3300009011 Ga0105251_10144257 Ga0105251_101442572 87
1269 3300009036 Ga0105244_10042238 Ga0105244_100422382 87
1270 3300009092 Ga0105250_10089444 Ga0105250_100894441 87
1271 3300009093 Ga0105240_10209167 Ga0105240_102091674 87
1272 3300009093 Ga0105240_10305213 Ga0105240_103052132 87
1273 3300009093 Ga0105240_12392972 Ga0105240_123929721 87
1274 3300009094 Ga0111539_10008538 Ga0111539_1000853811 87
1275 3300009098 Ga0105245_10000888 Ga0105245_1000088810 87
1276 3300009098 Ga0105245_10130933 Ga0105245_101309334 87
1277 3300009101 Ga0105247_10136072 Ga0105247_101360722 87
1278 3300009101 Ga0105247_10154172 Ga0105247_101541722 87
1279 3300009147 Ga0114129_10046549 Ga0114129_100465495 87
1280 3300009147 Ga0114129_10061852 Ga0114129_100618527 87
1281 3300009148 Ga0105243_10009700 Ga0105243_100097002 87
1282 3300009148 Ga0105243_10445895 Ga0105243_104458952 87
1283 3300009148 Ga0105243_10832933 Ga0105243_108329332 87
1284 3300009174 Ga0105241_10000662 Ga0105241_100006629 87
1285 3300009174 Ga0105241_10223435 Ga0105241_102234351 87
1286 3300009174 Ga0105241_10658778 Ga0105241_106587782 87
1287 3300009176 Ga0105242_10003386 Ga0105242_100033862 87
1288 3300009176 Ga0105242_10014624 Ga0105242_100146245 87
1289 3300009177 Ga0105248_10028745 Ga0105248_100287457 87
1290 3300009177 Ga0105248_10488622 Ga0105248_104886222 87
1291 3300009177 Ga0105248_11622780 Ga0105248_116227802 87
1292 3300009177 Ga0105248_12203723 Ga0105248_122037231 87
1293 3300009545 Ga0105237_10067784 Ga0105237_100677841 87
1294 3300009545 Ga0105237_10242146 Ga0105237_102421462 87
1295 3300009545 Ga0105237_11046530 Ga0105237_110465302 87
1296 3300009551 Ga0105238_10056035 Ga0105238_100560354 87
1297 3300009551 Ga0105238_10470315 Ga0105238_104703153 87
1298 3300009551 Ga0105238_10508731 Ga0105238_105087312 87
1299 3300009551 Ga0105238_10721315 Ga0105238_107213152 87
1300 3300009551 Ga0105238_11778975 Ga0105238_117789751 87
1301 3300009553 Ga0105249_10292150 Ga0105249_102921503 87
1302 3300010375 Ga0105239_10840656 Ga0105239_108406562 87
1303 3300011119 Ga0105246_10007028 Ga0105246_100070286 87
1304 3300011119 Ga0105246_11527198 Ga0105246_115271981 87
1305 3300012473 Ga0157340_1003731 Ga0157340_10037311 87
1306 3300012475 Ga0157317_1035201 Ga0157317_10352011 87
1307 3300012477 Ga0157336_1035594 Ga0157336_10355942 87
1308 3300012483 Ga0157337_1041167 Ga0157337_10411672 87
1309 3300012487 Ga0157321_1011031 Ga0157321_10110312 87
1310 3300012491 Ga0157329_1017635 Ga0157329_10176352 87
1311 3300012492 Ga0157335_1001442 Ga0157335_10014421 87
1312 3300012492 Ga0157335_1001701 Ga0157335_10017012 87
1313 3300012494 Ga0157341_1001441 Ga0157341_10014412 87
1314 3300012495 Ga0157323_1000760 Ga0157323_10007603 87
1315 3300012497 Ga0157319_1001829 Ga0157319_10018291 87
1316 3300012498 Ga0157345_1020153 Ga0157345_10201532 87
1317 3300012500 Ga0157314_1003958 Ga0157314_10039582 87
1318 3300012502 Ga0157347_1017328 Ga0157347_10173281 87
1319 3300012505 Ga0157339_1001931 Ga0157339_10019313 87
1320 3300012506 Ga0157324_1018218 Ga0157324_10182181 87
1321 3300012507 Ga0157342_1001855 Ga0157342_10018552 87
1322 3300012510 Ga0157316_1001319 Ga0157316_10013192 87
1323 3300012513 Ga0157326_1036482 Ga0157326_10364822 87
1324 3300012515 Ga0157338_1008116 Ga0157338_10081161 87
1325 3300013100 Ga0157373_10021687 Ga0157373_100216872 87
1326 3300013100 Ga0157373_10352621 Ga0157373_103526212 87
1327 3300013102 Ga0157371_10065058 Ga0157371_100650584 87
1328 3300013102 Ga0157371_10226966 Ga0157371_102269662 87
1329 3300013102 Ga0157371_10263846 Ga0157371_102638462 87
1330 3300013102 Ga0157371_10580790 Ga0157371_105807901 87
1331 3300013102 Ga0157371_11386880 Ga0157371_113868801 87
1332 3300013104 Ga0157370_10035333 Ga0157370_100353335 87
1333 3300013104 Ga0157370_10173814 Ga0157370_101738143 87
1334 3300013104 Ga0157370_10433103 Ga0157370_104331031 87
1335 3300013105 Ga0157369_10011164 Ga0157369_1001116411 87
1336 3300013105 Ga0157369_10279794 Ga0157369_102797942 87
1337 3300013105 Ga0157369_10530976 Ga0157369_105309762 87
1338 3300013105 Ga0157369_11065173 Ga0157369_110651732 87
1339 3300013105 Ga0157369_11150938 Ga0157369_111509382 87
1340 3300013296 Ga0157374_10247425 Ga0157374_102474252 87
1341 3300013296 Ga0157374_10441201 Ga0157374_104412013 87
1342 3300013296 Ga0157374_10570099 Ga0157374_105700992 87
1343 3300013297 Ga0157378_10026894 Ga0157378_100268946 87
1344 3300013297 Ga0157378_10970315 Ga0157378_109703152 87
1345 3300013306 Ga0163162_11538364 Ga0163162_115383641 87
1346 3300013307 Ga0157372_10349163 Ga0157372_103491631 87
1347 3300013307 Ga0157372_11070640 Ga0157372_110706402 87
1348 3300013307 Ga0157372_11114573 Ga0157372_111145732 87
1349 3300013307 Ga0157372_12188521 Ga0157372_121885212 87
1350 3300013307 Ga0157372_13188435 Ga0157372_131884352 87
1351 3300013308 Ga0157375_10001031 Ga0157375_1000103118 87
1352 3300013308 Ga0157375_10027552 Ga0157375_100275524 87
1353 3300014325 Ga0163163_10178936 Ga0163163_101789363 87
1354 3300014326 Ga0157380_10005584 Ga0157380_100055849 87
1355 3300014497 Ga0182008_10278669 Ga0182008_102786692 87
1356 3300014745 Ga0157377_10038573 Ga0157377_100385734 87
1357 3300014745 Ga0157377_11159979 Ga0157377_111599792 87
1358 3300014968 Ga0157379_10034362 Ga0157379_100343626 87
1359 3300014968 Ga0157379_10810996 Ga0157379_108109961 87
1360 3300014968 Ga0157379_10823658 Ga0157379_108236581 87
1361 3300014968 Ga0157379_11286706 Ga0157379_112867062 87
1362 3300014969 Ga0157376_10012211 Ga0157376_100122114 87
1363 3300014969 Ga0157376_10036819 Ga0157376_100368194 87
1364 3300014969 Ga0157376_10072518 Ga0157376_100725182 87
1365 3300017792 Ga0163161_10061205 Ga0163161_100612054 87
1366 3300017792 Ga0163161_10066417 Ga0163161_100664172 87
1367 3300017792 Ga0163161_10882382 Ga0163161_108823822 87
1368 3300020070 Ga0206356_11040495 Ga0206356_110404952 87
1369 3300020070 Ga0206356_11148339 Ga0206356_111483391 87
1370 3300020081 Ga0206354_11000226 Ga0206354_110002261 87
1371 3300020081 Ga0206354_11125984 Ga0206354_111259842 87
1372 3300020081 Ga0206354_11201073 Ga0206354_112010732 87
1373 3300020081 Ga0206354_11321297 Ga0206354_113212971 87
1374 3300020082 Ga0206353_11112049 Ga0206353_111120491 87
1375 3300020082 Ga0206353_11364463 Ga0206353_113644631 87
1376 3300020610 Ga0154015_1561563 Ga0154015_15615632 87
1377 3300022467 Ga0224712_10578391 Ga0224712_105783912 87
1378 3300025223 Ga0207672_1007501 Ga0207672_10075012 87
1379 3300025271 Ga0207666_1000034 Ga0207666_100003418 87
1380 3300025284 Ga0209130_1009775 Ga0209130_10097752 87
1381 3300025290 Ga0207673_1000061 Ga0207673_10000618 87
1382 3300025295 Ga0209564_1002084 Ga0209564_100208418 87
1383 3300025302 Ga0207426_1000037 Ga0207426_100003740 87
1384 3300025315 Ga0207697_10000280 Ga0207697_1000028018 87
1385 3300025321 Ga0207656_10033434 Ga0207656_100334343 87
1386 3300025711 Ga0207696_1132341 Ga0207696_11323411 87
1387 3300025728 Ga0207655_1079570 Ga0207655_10795701 87
1388 3300025735 Ga0207713_1212633 Ga0207713_12126332 87
1389 3300025735 Ga0207713_1234019 Ga0207713_12340192 87
1390 3300025885 Ga0207653_10060296 Ga0207653_100602962 87
1391 3300025893 Ga0207682_10000134 Ga0207682_1000013413 87
1392 3300025898 Ga0207692_10006215 Ga0207692_100062156 87
1393 3300025898 Ga0207692_10456061 Ga0207692_104560612 87
1394 3300025899 Ga0207642_10010308 Ga0207642_100103083 87
1395 3300025899 Ga0207642_10012830 Ga0207642_100128304 87
1396 3300025900 Ga0207710_10003581 Ga0207710_100035814 87
1397 3300025900 Ga0207710_10131861 Ga0207710_101318612 87
1398 3300025901 Ga0207688_10003819 Ga0207688_100038193 87
1399 3300025903 Ga0207680_10014420 Ga0207680_100144202 87
1400 3300025903 Ga0207680_10027255 Ga0207680_100272552 87
1401 3300025904 Ga0207647_10027189 Ga0207647_100271891 87
1402 3300025904 Ga0207647_10339846 Ga0207647_103398462 87
1403 3300025906 Ga0207699_10001462 Ga0207699_100014624 87
1404 3300025906 Ga0207699_10087035 Ga0207699_100870354 87
1405 3300025906 Ga0207699_10554598 Ga0207699_105545982 87
1406 3300025907 Ga0207645_10037279 Ga0207645_100372794 87
1407 3300025907 Ga0207645_10548843 Ga0207645_105488432 87
1408 3300025908 Ga0207643_10000475 Ga0207643_1000047524 87
1409 3300025909 Ga0207705_10050336 Ga0207705_100503364 87
1410 3300025909 Ga0207705_10111895 Ga0207705_101118953 87
1411 3300025909 Ga0207705_10699015 Ga0207705_106990152 87
1412 3300025909 Ga0207705_10712429 Ga0207705_107124292 87
1413 3300025911 Ga0207654_10006328 Ga0207654_100063285 87
1414 3300025911 Ga0207654_10237782 Ga0207654_102377822 87
1415 3300025911 Ga0207654_10417862 Ga0207654_104178622 87
1416 3300025911 Ga0207654_10640543 Ga0207654_106405431 87
1417 3300025912 Ga0207707_10015137 Ga0207707_100151378 87
1418 3300025912 Ga0207707_10026952 Ga0207707_100269525 87
1419 3300025912 Ga0207707_10089927 Ga0207707_100899272 87
1420 3300025912 Ga0207707_10377450 Ga0207707_103774502 87
1421 3300025913 Ga0207695_10118940 Ga0207695_101189403 87
1422 3300025913 Ga0207695_10154207 Ga0207695_101542072 87
1423 3300025914 Ga0207671_10203233 Ga0207671_102032332 87
1424 3300025915 Ga0207693_10005568 Ga0207693_1000556811 87
1425 3300025915 Ga0207693_10022202 Ga0207693_100222025 87
1426 3300025915 Ga0207693_10107745 Ga0207693_101077451 87
1427 3300025915 Ga0207693_10321183 Ga0207693_103211832 87
1428 3300025916 Ga0207663_10077423 Ga0207663_100774234 87
1429 3300025916 Ga0207663_10148346 Ga0207663_101483462 87
1430 3300025917 Ga0207660_10005579 Ga0207660_100055792 87
1431 3300025917 Ga0207660_10026462 Ga0207660_100264622 87
1432 3300025917 Ga0207660_10459972 Ga0207660_104599721 87
1433 3300025917 Ga0207660_10641068 Ga0207660_106410681 87
1434 3300025917 Ga0207660_10889638 Ga0207660_108896382 87
1435 3300025917 Ga0207660_11065188 Ga0207660_110651881 87
1436 3300025917 Ga0207660_11341311 Ga0207660_113413112 87
1437 3300025918 Ga0207662_10305668 Ga0207662_103056681 87
1438 3300025919 Ga0207657_10036372 Ga0207657_100363723 87
1439 3300025919 Ga0207657_10047632 Ga0207657_100476325 87
1440 3300025919 Ga0207657_10198306 Ga0207657_101983062 87
1441 3300025919 Ga0207657_10414921 Ga0207657_104149211 87
1442 3300025919 Ga0207657_10753659 Ga0207657_107536592 87
1443 3300025920 Ga0207649_10000271 Ga0207649_1000027118 87
1444 3300025920 Ga0207649_10338544 Ga0207649_103385441 87
1445 3300025920 Ga0207649_10652213 Ga0207649_106522132 87
1446 3300025920 Ga0207649_11197839 Ga0207649_111978391 87
1447 3300025921 Ga0207652_10021096 Ga0207652_100210962 87
1448 3300025921 Ga0207652_10047524 Ga0207652_100475243 87
1449 3300025921 Ga0207652_10095312 Ga0207652_100953122 87
1450 3300025921 Ga0207652_10187554 Ga0207652_101875542 87
1451 3300025921 Ga0207652_10560927 Ga0207652_105609272 87
1452 3300025922 Ga0207646_10477264 Ga0207646_104772641 87
1453 3300025922 Ga0207646_11685356 Ga0207646_116853561 87
1454 3300025923 Ga0207681_10000658 Ga0207681_1000065818 87
1455 3300025924 Ga0207694_10091237 Ga0207694_100912373 87
1456 3300025924 Ga0207694_10642090 Ga0207694_106420902 87
1457 3300025925 Ga0207650_10034215 Ga0207650_100342152 87
1458 3300025925 Ga0207650_10282604 Ga0207650_102826041 87
1459 3300025925 Ga0207650_11548794 Ga0207650_115487941 87
1460 3300025926 Ga0207659_10000177 Ga0207659_100001776 87
1461 3300025926 Ga0207659_10317447 Ga0207659_103174472 87
1462 3300025927 Ga0207687_10000495 Ga0207687_1000049518 87
1463 3300025927 Ga0207687_10011220 Ga0207687_100112206 87
1464 3300025928 Ga0207700_10000624 Ga0207700_1000062421 87
1465 3300025929 Ga0207664_10026183 Ga0207664_100261831 87
1466 3300025929 Ga0207664_10355167 Ga0207664_103551671 87
1467 3300025931 Ga0207644_10000279 Ga0207644_1000027917 87
1468 3300025931 Ga0207644_10006733 Ga0207644_100067338 87
1469 3300025932 Ga0207690_10008301 Ga0207690_100083011 87
1470 3300025932 Ga0207690_10035634 Ga0207690_100356342 87
1471 3300025932 Ga0207690_10049383 Ga0207690_100493832 87
1472 3300025932 Ga0207690_11225515 Ga0207690_112255151 87
1473 3300025932 Ga0207690_11371159 Ga0207690_113711591 87
1474 3300025933 Ga0207706_10043058 Ga0207706_100430583 87
1475 3300025933 Ga0207706_10492595 Ga0207706_104925951 87
1476 3300025934 Ga0207686_10005492 Ga0207686_100054924 87
1477 3300025934 Ga0207686_10006144 Ga0207686_100061447 87
1478 3300025934 Ga0207686_10028899 Ga0207686_100288994 87
1479 3300025935 Ga0207709_10002372 Ga0207709_100023723 87
1480 3300025935 Ga0207709_10415027 Ga0207709_104150272 87
1481 3300025936 Ga0207670_10021268 Ga0207670_100212682 87
1482 3300025936 Ga0207670_10263810 Ga0207670_102638102 87
1483 3300025937 Ga0207669_10000808 Ga0207669_1000080812 87
1484 3300025938 Ga0207704_10016281 Ga0207704_100162815 87
1485 3300025938 Ga0207704_10044678 Ga0207704_100446783 87
1486 3300025938 Ga0207704_10130157 Ga0207704_101301572 87
1487 3300025939 Ga0207665_10001758 Ga0207665_100017582 87
1488 3300025940 Ga0207691_10002815 Ga0207691_1000281517 87
1489 3300025940 Ga0207691_10110030 Ga0207691_101100304 87
1490 3300025940 Ga0207691_10391596 Ga0207691_103915961 87
1491 3300025942 Ga0207689_10003227 Ga0207689_1000322712 87
1492 3300025942 Ga0207689_10050098 Ga0207689_100500983 87
1493 3300025944 Ga0207661_10023815 Ga0207661_100238152 87
1494 3300025944 Ga0207661_10210058 Ga0207661_102100583 87
1495 3300025944 Ga0207661_10325061 Ga0207661_103250612 87
1496 3300025944 Ga0207661_11856490 Ga0207661_118564902 87
1497 3300025945 Ga0207679_10000046 Ga0207679_100000464 87
1498 3300025945 Ga0207679_10384382 Ga0207679_103843822 87
1499 3300025945 Ga0207679_11128903 Ga0207679_111289032 87
1500 3300025949 Ga0207667_10007962 Ga0207667_1000796215 87
1501 3300025949 Ga0207667_10119555 Ga0207667_101195552 87
1502 3300025949 Ga0207667_10149382 Ga0207667_101493822 87
1503 3300025949 Ga0207667_11304817 Ga0207667_113048171 87
1504 3300025949 Ga0207667_12177179 Ga0207667_121771791 87
1505 3300025960 Ga0207651_10000214 Ga0207651_1000021418 87
1506 3300025960 Ga0207651_10037055 Ga0207651_100370552 87
1507 3300025960 Ga0207651_10653343 Ga0207651_106533432 87
1508 3300025961 Ga0207712_10035776 Ga0207712_100357764 87
1509 3300025961 Ga0207712_10501542 Ga0207712_105015421 87
1510 3300025972 Ga0207668_10000537 Ga0207668_1000053718 87
1511 3300025981 Ga0207640_10002737 Ga0207640_100027377 87
1512 3300025981 Ga0207640_10244052 Ga0207640_102440521 87
1513 3300025981 Ga0207640_10332954 Ga0207640_103329542 87
1514 3300025986 Ga0207658_10011593 Ga0207658_100115932 87
1515 3300025986 Ga0207658_10055880 Ga0207658_100558803 87
1516 3300026023 Ga0207677_10037467 Ga0207677_100374674 87
1517 3300026023 Ga0207677_10047121 Ga0207677_100471214 87
1518 3300026035 Ga0207703_10000940 Ga0207703_100009408 87
1519 3300026035 Ga0207703_10023508 Ga0207703_100235084 87
1520 3300026035 Ga0207703_10729671 Ga0207703_107296711 87
1521 3300026035 Ga0207703_11555631 Ga0207703_115556312 87
1522 3300026041 Ga0207639_10284988 Ga0207639_102849882 87
1523 3300026041 Ga0207639_11668184 Ga0207639_116681841 87
1524 3300026067 Ga0207678_10007136 Ga0207678_100071368 87
1525 3300026067 Ga0207678_10015442 Ga0207678_100154424 87
1526 3300026067 Ga0207678_10018849 Ga0207678_100188494 87
1527 3300026067 Ga0207678_10842087 Ga0207678_108420872 87
1528 3300026078 Ga0207702_10002642 Ga0207702_100026426 87
1529 3300026078 Ga0207702_10278000 Ga0207702_102780002 87
1530 3300026078 Ga0207702_10288004 Ga0207702_102880042 87
1531 3300026078 Ga0207702_10313681 Ga0207702_103136811 87
1532 3300026078 Ga0207702_11060320 Ga0207702_110603202 87
1533 3300026078 Ga0207702_11493070 Ga0207702_114930702 87
1534 3300026088 Ga0207641_10001370 Ga0207641_1000137018 87
1535 3300026089 Ga0207648_10002036 Ga0207648_1000203618 87
1536 3300026089 Ga0207648_10104232 Ga0207648_101042323 87
1537 3300026089 Ga0207648_10703749 Ga0207648_107037491 87
1538 3300026095 Ga0207676_10009322 Ga0207676_100093227 87
1539 3300026095 Ga0207676_10010200 Ga0207676_100102004 87
1540 3300026116 Ga0207674_10152530 Ga0207674_101525303 87
1541 3300026118 Ga0207675_100759538 Ga0207675_1007595381 87
1542 3300026121 Ga0207683_10004449 Ga0207683_100044495 87
1543 3300026121 Ga0207683_10032902 Ga0207683_100329026 87
1544 3300026142 Ga0207698_10007930 Ga0207698_100079305 87
1545 3300026142 Ga0207698_10236695 Ga0207698_102366952 87
1546 3300026142 Ga0207698_10819944 Ga0207698_108199442 87
1547 3300026142 Ga0207698_11093502 Ga0207698_110935021 87
1548 3300026142 Ga0207698_11335979 Ga0207698_113359792 87
1549 3300026142 Ga0207698_12392163 Ga0207698_123921631 87
1550 3300027364 Ga0209967_1011091 Ga0209967_10110912 87
1551 3300027378 Ga0209981_1012434 Ga0209981_10124342 87
1552 3300027424 Ga0209984_1002948 Ga0209984_10029482 87
1553 3300027462 Ga0210000_1032288 Ga0210000_10322882 87
1554 3300027543 Ga0209999_1004725 Ga0209999_10047253 87
1555 3300027614 Ga0209970_1006403 Ga0209970_10064033 87
1556 3300027665 Ga0209983_1003857 Ga0209983_10038574 87
1557 3300027682 Ga0209971_1050177 Ga0209971_10501772 87
1558 3300027695 Ga0209966_1001182 Ga0209966_10011825 87
1559 3300027717 Ga0209998_10088350 Ga0209998_100883502 87
1560 3300027866 Ga0209813_10031067 Ga0209813_100310673 87
1561 3300027876 Ga0209974_10046397 Ga0209974_100463973 87
1562 3300027907 Ga0207428_10000082 Ga0207428_1000008217 87
1563 3300028379 Ga0268266_10006793 Ga0268266_100067934 87
1564 3300028379 Ga0268266_10117705 Ga0268266_101177053 87
1565 3300028379 Ga0268266_11160095 Ga0268266_111600952 87
1566 3300028380 Ga0268265_10000817 Ga0268265_100008178 87
1567 3300028380 Ga0268265_11222801 Ga0268265_112228012 87
1568 3300028381 Ga0268264_10001227 Ga0268264_1000122718 87
1569 3300028381 Ga0268264_10016466 Ga0268264_100164664 87
1570 3300028381 Ga0268264_11006952 Ga0268264_110069522 87
1571 3300028563 Ga0265319_1242520 Ga0265319_12425201 87
1572 3300028573 Ga0265334_10052011 Ga0265334_100520111 87
1573 3300028577 Ga0265318_10278608 Ga0265318_102786082 87
1574 3300028800 Ga0265338_10000409 Ga0265338_1000040936 87
1575 3300028800 Ga0265338_10681684 Ga0265338_106816841 87
1576 3300031235 Ga0265330_10193759 Ga0265330_101937592 87
1577 3300031241 Ga0265325_10000043 Ga0265325_1000004361 87
1578 3300031241 Ga0265325_10070091 Ga0265325_100700912 87
1579 3300031247 Ga0265340_10399095 Ga0265340_103990952 87
1580 3300031247 Ga0265340_10442845 Ga0265340_104428452 87
1581 3300031249 Ga0265339_10118890 Ga0265339_101188902 87
1582 3300031249 Ga0265339_10445323 Ga0265339_104453231 87
1583 3300031344 Ga0265316_10197680 Ga0265316_101976802 87
1584 3300031344 Ga0265316_10253914 Ga0265316_102539142 87
1585 3300031595 Ga0265313_10011598 Ga0265313_100115986 87
1586 3300031595 Ga0265313_10070035 Ga0265313_100700352 87
1587 3300031691 Ga0316579_10051146 Ga0316579_100511462 87
1588 3300031711 Ga0265314_10017254 Ga0265314_100172547 87
1589 3300031712 Ga0265342_10000417 Ga0265342_1000041715 87
1590 3300031712 Ga0265342_10309079 Ga0265342_103090792 87
1591 3300031728 Ga0316578_10018543 Ga0316578_100185434 87
1592 3300031733 Ga0316577_10002986 Ga0316577_100029863 87
1593 3300031824 Ga0307413_11205537 Ga0307413_112055372 87
1594 3300031901 Ga0307406_11076450 Ga0307406_110764501 87
1595 3300031911 Ga0307412_12087721 Ga0307412_120877211 87
1596 3300031995 Ga0307409_102855072 Ga0307409_1028550722 87
1597 3300032005 Ga0307411_11983072 Ga0307411_119830721 87
1598 3300032137 Ga0316585_10035680 Ga0316585_100356803 87
1599 3300032168 Ga0316593_10003203 Ga0316593_100032033 87
1600 3300032168 Ga0316593_10016699 Ga0316593_100166991 87
1601 3300033527 Ga0316586_1098468 Ga0316586_10984682 87
1602 3300033528 Ga0316588_1003589 Ga0316588_10035893 87
1603 3300033529 Ga0316587_1042868 Ga0316587_10428682 87
1604 3300033541 Ga0316596_1002275 Ga0316596_10022754 87
1605 3300033541 Ga0316596_1022875 Ga0316596_10228752 87
1606 3300034816 Ga0373930_0002970 Ga0373930_0002970_657_929 87
1607 3300034817 Ga0373948_0000117 Ga0373948_0000117_4768_5040 87
1608 3300034817 Ga0373948_0060778 Ga0373948_0060778_129_401 87
1609 3300034817 Ga0373948_0083666 Ga0373948_0083666_21_293 87
1610 3300034818 Ga0373950_0000224 Ga0373950_0000224_374_646 87
1611 3300034818 Ga0373950_0024172 Ga0373950_0024172_127_399 87
1612 3300034819 Ga0373958_0000053 Ga0373958_0000053_237_509 87
1613 3300034819 Ga0373958_0011792 Ga0373958_0011792_1069_1341 87
1614 3300034820 Ga0373959_0000295 Ga0373959_0000295_922_1194 87
1615 3300034957 Ga0373938_0002791 Ga0373938_0002791_369_641 87
1616 3300034957 Ga0373938_0060371 Ga0373938_0060371_50_322 87
1617 3300035083 Ga0373926_0006274 Ga0373926_0006274_3060_3332 87
1618 3300035083 Ga0373926_0037624 Ga0373926_0037624_783_1055 87
1619 3300035084 Ga0373928_0016467 Ga0373928_0016467_1094_1366 87
1620 3300035085 Ga0373929_0000961 Ga0373929_0000961_4407_4679 87
1621 3300035085 Ga0373929_0007665 Ga0373929_0007665_383_655 87
1622 3300035086 Ga0373934_0013852 Ga0373934_0013852_2316_2588 87
1623 3300035086 Ga0373934_0292246 Ga0373934_0292246_350_622 87
1624 3300035088 Ga0373940_0025371 Ga0373940_0025371_590_862 87
1625 3300035088 Ga0373940_0032827 Ga0373940_0032827_575_847 87
1626 3300035088 Ga0373940_0081877 Ga0373940_0081877_532_810 87
1627 3300035089 Ga0373944_0003334 Ga0373944_0003334_1551_1823 87
1628 3300035089 Ga0373944_0007277 Ga0373944_0007277_782_1054 87
1629 3300035090 Ga0373949_0016985 Ga0373949_0016985_1252_1524 87
1630 3300035091 Ga0373951_0023631 Ga0373951_0023631_698_970 87
1631 3300035091 Ga0373951_0038591 Ga0373951_0038591_148_420 87
1632 3300035092 Ga0373952_0007306 Ga0373952_0007306_903_1175 87
1633 3300035092 Ga0373952_0037647 Ga0373952_0037647_50_322 87
1634 3300035111 Ga0373923_0007076 Ga0373923_0007076_3514_3786 87
1635 3300035111 Ga0373923_0046637 Ga0373923_0046637_1223_1495 87
1636 3300035111 Ga0373923_0396465 Ga0373923_0396465_107_379 87
1637 3300035112 Ga0373932_0024159 Ga0373932_0024159_50_322 87
1638 3300035113 Ga0373936_0005552 Ga0373936_0005552_3889_4161 87
1639 3300035114 Ga0373939_0031296 Ga0373939_0031296_52_324 87
1640 3300035114 Ga0373939_0047406 Ga0373939_0047406_445_717 87
1641 3300035114 Ga0373939_0048780 Ga0373939_0048780_446_724 87
1642 3300035114 Ga0373939_0301945 Ga0373939_0301945_74_346 87
1643 3300035114 Ga0373939_0396955 Ga0373939_0396955_227_499 87
1644 3300035115 Ga0373941_0003204 Ga0373941_0003204_2250_2522 87
1645 3300035115 Ga0373941_0004229 Ga0373941_0004229_553_825 87
1646 3300035115 Ga0373941_0062605 Ga0373941_0062605_359_631 87
1647 3300035116 Ga0373945_0001310 Ga0373945_0001310_754_1026 87
1648 3300035116 Ga0373945_0043279 Ga0373945_0043279_401_673 87
1649 3300035117 Ga0373953_0001186 Ga0373953_0001186_2839_3111 87
1650 3300035117 Ga0373953_0052698 Ga0373953_0052698_1349_1621 87
1651 3300035117 Ga0373953_0126621 Ga0373953_0126621_396_668 87
1652 3300035118 Ga0373954_0004854 Ga0373954_0004854_4324_4596 87
1653 3300035118 Ga0373954_0050560 Ga0373954_0050560_1520_1792 87
1654 3300035119 Ga0373956_0021954 Ga0373956_0021954_701_973 87
1655 3300035119 Ga0373956_0088421 Ga0373956_0088421_1125_1397 87
1656 3300035119 Ga0373956_0105376 Ga0373956_0105376_244_516 87
1657 3300035120 Ga0373957_0304241 Ga0373957_0304241_365_637 87
1658 3300035120 Ga0373957_0324141 Ga0373957_0324141_80_352 87
1659 3300035121 Ga0373960_0051086 Ga0373960_0051086_552_824 87
1660 3300035121 Ga0373960_0060028 Ga0373960_0060028_826_1098 87
1661 3300035170 Ga0373943_0008559 Ga0373943_0008559_2316_2588 87
1662 3300035171 Ga0373946_0184145 Ga0373946_0184145_580_852 87
1663 3300035172 Ga0373955_0009863 Ga0373955_0009863_505_777 87
1664 3300035172 Ga0373955_0377997 Ga0373955_0377997_173_445 87
1665 3300035207 Ga0373942_0016976 Ga0373942_0016976_1388_1660 87
1666 3300035207 Ga0373942_0050409 Ga0373942_0050409_744_1016 87
1667 3300035207 Ga0373942_0127742 Ga0373942_0127742_290_568 87
1668 3300035207 Ga0373942_0154622 Ga0373942_0154622_428_700 87
1669 3300035241 Ga0373961_0003260 Ga0373961_0003260_2998_3270 87
1670 3300035241 Ga0373961_0014900 Ga0373961_0014900_658_930 87
1671 3300035242 Ga0373962_0022813 Ga0373962_0022813_1260_1532 87
1672 3300035242 Ga0373962_0025696 Ga0373962_0025696_574_846 87
1673 3300035242 Ga0373962_0102127 Ga0373962_0102127_58_330 87
1674 3300035398 Ga0316574_0186637 Ga0316574_0186637_460_741 87
1675 3300035410 Ga0373924_0006926 Ga0373924_0006926_3735_4007 87
1676 3300035410 Ga0373924_0061878 Ga0373924_0061878_466_729 87
1677 3300035410 Ga0373924_0130223 Ga0373924_0130223_273_545 87
1678 3300035410 Ga0373924_0209701 Ga0373924_0209701_463_735 87
1679 3300035691 Ga0373931_0085163 Ga0373931_0085163_889_1161 87
1680 3300035691 Ga0373931_0173763 Ga0373931_0173763_410_682 87
1681 3300035691 Ga0373931_0343629 Ga0373931_0343629_530_802 87
1682 3300035692 Ga0373935_0116801 Ga0373935_0116801_189_461 87
1683 3300035692 Ga0373935_0210671 Ga0373935_0210671_495_767 87
1684 3300035692 Ga0373935_0442047 Ga0373935_0442047_47_319 87
1685 3300035695 Ga0373927_0035890 Ga0373927_0035890_1062_1334 87
1686 3300035695 Ga0373927_0066394 Ga0373927_0066394_1101_1373 87
1687 3300035724 Ga0373933_0001224 Ga0373933_0001224_331_603 87
1688 3300035724 Ga0373933_0013762 Ga0373933_0013762_1147_1419 87
1689 3300035724 Ga0373933_0024904 Ga0373933_0024904_796_1068 87
1690 3300035724 Ga0373933_0224576 Ga0373933_0224576_904_1176 87
1691 3300035725 Ga0373947_0248962 Ga0373947_0248962_695_967 87
1692 3300035725 Ga0373947_1012894 Ga0373947_1012894_128_400 87
1693 3300036401 Ga0373937_0000849 Ga0373937_0000849_11546_11818 87
1694 3300036401 Ga0373937_0034021 Ga0373937_0034021_3019_3291 87
1695 3300036401 Ga0373937_0047581 Ga0373937_0047581_258_530 87
1696 3300036401 Ga0373937_0480437 Ga0373937_0480437_87_374 87
1697 3300036401 Ga0373937_1348213 Ga0373937_1348213_139_411 87
1698 3300036647 Ga0316582_0059421 Ga0316582_0059421_330_599 87
1699 3300036647 Ga0316582_0140660 Ga0316582_0140660_159_440 87
1700 3300036712 Ga0316584_0040828 Ga0316584_0040828_2700_2981 87
1701 3300036712 Ga0316584_0066848 Ga0316584_0066848_2140_2409 87
1702 3300037068 Ga0373925_0042182 Ga0373925_0042182_684_956 87
1703 3300037068 Ga0373925_0104468 Ga0373925_0104468_556_828 87
1704 3300037312 Ga0395899_0165840 Ga0395899_0165840_91_363 87
1705 3300037312 Ga0395899_0461093 Ga0395899_0461093_70_342 87
1706 3300037418 Ga0395900_0030469 Ga0395900_0030469_1891_2163 87
1707 3300037418 Ga0395900_0723577 Ga0395900_0723577_488_760 87
1708 3300037466 Ga0395898_0054212 Ga0395898_0054212_2609_2881 87
1709 3300037466 Ga0395898_0177855 Ga0395898_0177855_712_984 87
1710 3300037853 Ga0436364_0700652 Ga0436364_0700652_134_415 87
1711 3300038443 Ga0395901_0096101 Ga0395901_0096101_2360_2632 87
1712 3300038443 Ga0395901_0635615 Ga0395901_0635615_358_630 87
1713 3300038996 Ga0242420_015008 Ga0242420_015008_904_1176 87
1714 3300039437 Ga0436365_0227568 Ga0436365_0227568_3082_3357 87
1715 3300041486 Ga0451807_0884989 Ga0451807_0884989_310_585 87
1716 3300041503 Ga0451847_0069475 Ga0451847_0069475_169_441 87
1717 3300042001 Ga0439441_117533 Ga0439441_117533_75_347 87
1718 3300042005 Ga0439448_0030987 Ga0439448_0030987_598_870 87
1719 3300042012 Ga0439455_0016936 Ga0439455_0016936_494_766 87
1720 3300042012 Ga0439455_0224523 Ga0439455_0224523_25_297 87
1721 3300042016 Ga0439463_081108 Ga0439463_081108_94_366 87
1722 3300042134 Ga0450898_019218 Ga0450898_019218_661_930 87
1723 3300042157 Ga0439458_0028953 Ga0439458_0028953_780_1052 87
1724 3300042437 Ga0439444_0135382 Ga0439444_0135382_141_413 87
1725 3300042438 Ga0439459_0063962 Ga0439459_0063962_342_614 87
1726 3300042439 Ga0439464_0017743 Ga0439464_0017743_590_862 87
1727 3300042532 Ga0450893_0037904 Ga0450893_0037904_277_546 87
1728 3300042876 Ga0451577_0052576 Ga0451577_0052576_700_972 87
1729 3300044673 Ga0453683_0113707 Ga0453683_0113707_1088_1360 87
1730 3300044683 Ga0466965_0210906 Ga0466965_0210906_653_925 87
1731 3300044684 Ga0466966_0091758 Ga0466966_0091758_593_865 87
1732 3300044693 Ga0466961_0150592 Ga0466961_0150592_1092_1364 87
1733 3300044694 Ga0466963_0001905 Ga0466963_0001905_6305_6577 87
1734 3300044694 Ga0466963_0447515 Ga0466963_0447515_529_801 87
1735 3300044712 Ga0453684_0271593 Ga0453684_0271593_399_671 87
1736 3300044719 Ga0466971_0027572 Ga0466971_0027572_1489_1761 87
1737 3300044719 Ga0466971_0401466 Ga0466971_0401466_157_429 87
1738 3300044765 Ga0466970_0382954 Ga0466970_0382954_158_430 87
1739 3300044842 Ga0466957_0095267 Ga0466957_0095267_1301_1573 87
1740 3300044842 Ga0466957_0108577 Ga0466957_0108577_1109_1381 87
1741 3300044842 Ga0466957_0310599 Ga0466957_0310599_610_882 87
1742 3300044901 Ga0466960_0064485 Ga0466960_0064485_550_822 87
1743 3300045049 Ga0466959_0243074 Ga0466959_0243074_326_598 87
1744 3300045051 Ga0451576_0125728 Ga0451576_0125728_1848_2120 87
1745 3300045836 Ga0466958_0262088 Ga0466958_0262088_52_324 87
1746 3300045836 Ga0466958_0294067 Ga0466958_0294067_97_369 87
1747 3300045836 Ga0466958_0878338 Ga0466958_0878338_286_558 87
1748 3300045976 Ga0466967_0001722 Ga0466967_0001722_6442_6714 87
1749 3300045976 Ga0466967_0621687 Ga0466967_0621687_498_770 87
1750 3300045976 Ga0466967_2254810 Ga0466967_2254810_83_355 87
1751 3300046452 Ga0495617_013564 Ga0495617_013564_1817_2089 87
1752 3300046454 Ga0495592_0002856 Ga0495592_0002856_11425_11697 87
1753 3300046454 Ga0495592_0031170 Ga0495592_0031170_1222_1494 87
1754 3300046455 Ga0495603_0033576 Ga0495603_0033576_556_828 87
1755 3300046455 Ga0495603_0207612 Ga0495603_0207612_584_847 87
1756 3300046458 Ga0495591_053196 Ga0495591_053196_572_844 87
1757 3300046459 Ga0495629_0000062 Ga0495629_0000062_86843_87115 87
1758 3300046459 Ga0495629_0056444 Ga0495629_0056444_1514_1786 87
1759 3300046459 Ga0495629_0969950 Ga0495629_0969950_271_543 87
1760 3300046461 Ga0495641_0053694 Ga0495641_0053694_979_1251 87
1761 3300046461 Ga0495641_0247975 Ga0495641_0247975_158_430 87
1762 3300046462 Ga0495651_0007412 Ga0495651_0007412_8030_8302 87
1763 3300046462 Ga0495651_0020865 Ga0495651_0020865_38_310 87
1764 3300046462 Ga0495651_0267190 Ga0495651_0267190_383_655 87
1765 3300046462 Ga0495651_0268733 Ga0495651_0268733_800_1072 87
1766 3300046463 Ga0495653_0005558 Ga0495653_0005558_9360_9632 87
1767 3300046463 Ga0495653_0048987 Ga0495653_0048987_1629_1901 87
1768 3300046463 Ga0495653_0199896 Ga0495653_0199896_102_374 87
1769 3300046472 Ga0495580_0006383 Ga0495580_0006383_4876_5139 87
1770 3300046472 Ga0495580_0092029 Ga0495580_0092029_310_582 87
1771 3300046472 Ga0495580_0225975 Ga0495580_0225975_273_545 87
1772 3300046473 Ga0495582_0019358 Ga0495582_0019358_2049_2321 87
1773 3300046473 Ga0495582_0138476 Ga0495582_0138476_968_1240 87
1774 3300046473 Ga0495582_0173026 Ga0495582_0173026_132_404 87
1775 3300046474 Ga0495605_0007540 Ga0495605_0007540_4239_4502 87
1776 3300046475 Ga0495639_0008961 Ga0495639_0008961_2359_2631 87
1777 3300046475 Ga0495639_0043988 Ga0495639_0043988_1079_1351 87
1778 3300046476 Ga0495662_0006739 Ga0495662_0006739_2147_2419 87
1779 3300046476 Ga0495662_0022613 Ga0495662_0022613_2216_2488 87
1780 3300046477 Ga0495664_0293185 Ga0495664_0293185_652_924 87
1781 3300046477 Ga0495664_0799181 Ga0495664_0799181_258_530 87
1782 3300046491 Ga0495584_0021105 Ga0495584_0021105_1745_2017 87
1783 3300046491 Ga0495584_0118449 Ga0495584_0118449_839_1102 87
1784 3300046491 Ga0495584_0267792 Ga0495584_0267792_72_344 87
1785 3300046492 Ga0495585_0002429 Ga0495585_0002429_8644_8916 87
1786 3300046499 Ga0495594_0142540 Ga0495594_0142540_551_823 87
1787 3300046501 Ga0495607_0003759 Ga0495607_0003759_9787_10059 87
1788 3300046506 Ga0495583_0040733 Ga0495583_0040733_285_548 87
1789 3300046511 Ga0495608_0001948 Ga0495608_0001948_2455_2727 87
1790 3300046511 Ga0495608_0276011 Ga0495608_0276011_519_791 87
1791 3300046513 Ga0495616_0056878 Ga0495616_0056878_846_1109 87
1792 3300046514 Ga0495618_0025063 Ga0495618_0025063_2840_3112 87
1793 3300046514 Ga0495618_0061003 Ga0495618_0061003_1517_1789 87
1794 3300046515 Ga0495620_0189770 Ga0495620_0189770_207_479 87
1795 3300046516 Ga0495628_0009783 Ga0495628_0009783_3284_3556 87
1796 3300046516 Ga0495628_0366813 Ga0495628_0366813_139_411 87
1797 3300046517 Ga0495630_0120133 Ga0495630_0120133_1221_1493 87
1798 3300046517 Ga0495630_0138681 Ga0495630_0138681_371_649 87
1799 3300046518 Ga0495631_0417591 Ga0495631_0417591_77_349 87
1800 3300046520 Ga0495637_0077862 Ga0495637_0077862_342_614 87
1801 3300046520 Ga0495637_0218192 Ga0495637_0218192_74_346 87
1802 3300046523 Ga0495644_0004855 Ga0495644_0004855_1831_2103 87
1803 3300046525 Ga0495663_0132536 Ga0495663_0132536_87_359 87
1804 3300046526 Ga0495666_0082977 Ga0495666_0082977_54_326 87
1805 3300046526 Ga0495666_0104329 Ga0495666_0104329_261_533 87
1806 3300046529 Ga0495652_0023129 Ga0495652_0023129_3288_3560 87
1807 3300046529 Ga0495652_0093555 Ga0495652_0093555_258_530 87
1808 3300046529 Ga0495652_0271096 Ga0495652_0271096_139_411 87
1809 3300046531 Ga0495665_0010056 Ga0495665_0010056_4035_4307 87
1810 3300046531 Ga0495665_0034160 Ga0495665_0034160_1637_1909 87
1811 3300046531 Ga0495665_0113841 Ga0495665_0113841_282_545 87
1812 3300046533 Ga0495640_0127582 Ga0495640_0127582_948_1220 87
1813 3300046536 Ga0495587_0012894 Ga0495587_0012894_1485_1757 87
1814 3300046536 Ga0495587_0073690 Ga0495587_0073690_629_901 87
1815 3300046536 Ga0495587_0250175 Ga0495587_0250175_633_905 87
1816 3300046537 Ga0495598_0022419 Ga0495598_0022419_121_393 87
1817 3300046542 Ga0495597_0222070 Ga0495597_0222070_314_577 87
1818 3300046543 Ga0495645_0251612 Ga0495645_0251612_76_348 87
1819 3300046543 Ga0495645_0499474 Ga0495645_0499474_231_503 87
1820 3300046543 Ga0495645_0576617 Ga0495645_0576617_392_664 87
1821 3300046557 Ga0495622_0007792 Ga0495622_0007792_3329_3601 87
1822 3300046557 Ga0495622_0045046 Ga0495622_0045046_676_948 87
1823 3300046557 Ga0495622_0115509 Ga0495622_0115509_260_523 87
1824 3300046558 Ga0495633_0010414 Ga0495633_0010414_1351_1623 87
1825 3300046559 Ga0495667_0001067 Ga0495667_0001067_14595_14867 87
1826 3300046559 Ga0495667_0190073 Ga0495667_0190073_783_1055 87
1827 3300046615 Ga0495656_0002593 Ga0495656_0002593_4738_5010 87
1828 3300046642 Ga0495634_0087401 Ga0495634_0087401_356_628 87
1829 3300046642 Ga0495634_0270406 Ga0495634_0270406_135_407 87
1830 3300046648 Ga0495611_0011534 Ga0495611_0011534_700_972 87
1831 3300046648 Ga0495611_0480115 Ga0495611_0480115_210_473 87
1832 3300046663 Ga0495635_0004976 Ga0495635_0004976_8553_8825 87
1833 3300046663 Ga0495635_0019587 Ga0495635_0019587_151_423 87
1834 3300046663 Ga0495635_0134022 Ga0495635_0134022_174_446 87
1835 3300046663 Ga0495635_0690255 Ga0495635_0690255_171_443 87
1836 3300046664 Ga0495659_0006541 Ga0495659_0006541_3329_3601 87
1837 3300046665 Ga0495661_0270384 Ga0495661_0270384_80_352 87
1838 3300046674 Ga0495588_0095190 Ga0495588_0095190_1228_1500 87
1839 3300046674 Ga0495588_0201425 Ga0495588_0201425_130_402 87
1840 3300046675 Ga0495657_0016143 Ga0495657_0016143_4060_4332 87
1841 3300046675 Ga0495657_0033154 Ga0495657_0033154_88_360 87
1842 3300046675 Ga0495657_0072227 Ga0495657_0072227_1618_1890 87
1843 3300046675 Ga0495657_0080448 Ga0495657_0080448_1483_1755 87
1844 3300046678 Ga0495599_0002423 Ga0495599_0002423_6719_6991 87
1845 3300046678 Ga0495599_0002462 Ga0495599_0002462_379_651 87
1846 3300046678 Ga0495599_0027197 Ga0495599_0027197_139_411 87
1847 3300046679 Ga0495623_0003667 Ga0495623_0003667_3678_3950 87
1848 3300046679 Ga0495623_0056435 Ga0495623_0056435_1598_1870 87
1849 3300046680 Ga0495646_0001912 Ga0495646_0001912_8024_8296 87
1850 3300046680 Ga0495646_0024134 Ga0495646_0024134_1231_1503 87
1851 3300046681 Ga0495647_0014983 Ga0495647_0014983_2358_2630 87
1852 3300046681 Ga0495647_0041385 Ga0495647_0041385_693_965 87
1853 3300046683 Ga0495658_0322245 Ga0495658_0322245_136_408 87
1854 3300046684 Ga0495669_0019701 Ga0495669_0019701_1250_1513 87
1855 3300046684 Ga0495669_0376577 Ga0495669_0376577_74_346 87
1856 3300046689 Ga0495613_0030125 Ga0495613_0030125_10_282 87
1857 3300046689 Ga0495613_0122285 Ga0495613_0122285_1159_1431 87
1858 3300046690 Ga0495624_0041293 Ga0495624_0041293_619_891 87
1859 3300046690 Ga0495624_0287394 Ga0495624_0287394_560_832 87
1860 3300046691 Ga0495670_0001352 Ga0495670_0001352_5484_5756 87
1861 3300046809 Ga0495600_0005044 Ga0495600_0005044_1655_1927 87
1862 3300046809 Ga0495600_0030328 Ga0495600_0030328_2563_2835 87
1863 3300046809 Ga0495600_0051833 Ga0495600_0051833_2256_2528 87
1864 3300046809 Ga0495600_0227248 Ga0495600_0227248_568_840 87
1865 3300047315 Ga0495581_0013989 Ga0495581_0013989_2352_2624 87
1866 3300047315 Ga0495581_0032458 Ga0495581_0032458_1368_1640 87
1867 3300047315 Ga0495581_0255675 Ga0495581_0255675_23_295 87
1868 3300047317 Ga0495604_0004097 Ga0495604_0004097_8124_8396 87
1869 3300047317 Ga0495604_0013822 Ga0495604_0013822_3839_4111 87
1870 3300047317 Ga0495604_0028326 Ga0495604_0028326_1150_1422 87
1871 3300047319 Ga0495674_0082135 Ga0495674_0082135_285_548 87
1872 3300047319 Ga0495674_0254432 Ga0495674_0254432_191_463 87
1873 3300047319 Ga0495674_0755191 Ga0495674_0755191_463_735 87
1874 3300047320 Ga0495672_0056432 Ga0495672_0056432_1376_1639 87
1875 3300047321 Ga0495676_0148759 Ga0495676_0148759_43_315 87
1876 3300047321 Ga0495676_0313301 Ga0495676_0313301_648_920 87
1877 3300047322 Ga0495680_0017386 Ga0495680_0017386_5286_5558 87
1878 3300047322 Ga0495680_0046812 Ga0495680_0046812_1245_1517 87
1879 3300047322 Ga0495680_0153286 Ga0495680_0153286_779_1051 87
1880 3300047322 Ga0495680_0165418 Ga0495680_0165418_203_475 87
1881 3300047322 Ga0495680_0298501 Ga0495680_0298501_624_896 87
1882 3300047323 Ga0495683_0008656 Ga0495683_0008656_3619_3882 87
1883 3300047443 Ga0495687_014365 Ga0495687_014365_285_548 87
1884 3300047444 Ga0495675_0001338 Ga0495675_0001338_14387_14659 87
1885 3300047444 Ga0495675_0035048 Ga0495675_0035048_171_443 87
1886 3300047444 Ga0495675_0046152 Ga0495675_0046152_1569_1841 87
1887 3300047445 Ga0495677_0294857 Ga0495677_0294857_26_298 87
1888 3300047445 Ga0495677_0350572 Ga0495677_0350572_111_383 87
1889 3300047469 Ga0495673_0023241 Ga0495673_0023241_1926_2189 87
1890 3300047471 Ga0495684_0034589 Ga0495684_0034589_808_1080 87
1891 3300047471 Ga0495684_0148419 Ga0495684_0148419_1402_1674 87
1892 3300047673 Ga0495593_0279731 Ga0495593_0279731_213_485 87
1893 3300048088 Ga0495602_0002392 Ga0495602_0002392_4385_4657 87
1894 3300048088 Ga0495602_0040040 Ga0495602_0040040_761_1033 87
1895 3300048088 Ga0495602_0082810 Ga0495602_0082810_1254_1526 87
1896 3300048089 Ga0495614_0055908 Ga0495614_0055908_896_1168 87
1897 3300048091 Ga0495626_0076797 Ga0495626_0076797_127_390 87
1898 3300048903 Ga0496100_0002059 Ga0496100_0002059_7483_7755 87
1899 3300048903 Ga0496100_0232286 Ga0496100_0232286_1057_1320 87
1900 3300048903 Ga0496100_0934434 Ga0496100_0934434_129_401 87
1901 3300048904 Ga0496101_0001738 Ga0496101_0001738_6120_6392 87
1902 3300048904 Ga0496101_0017395 Ga0496101_0017395_4292_4564 87
1903 3300048904 Ga0496101_0665436 Ga0496101_0665436_398_670 87
1904 3300048904 Ga0496101_1342341 Ga0496101_1342341_39_311 87
1905 3300048905 Ga0496102_0009899 Ga0496102_0009899_2827_3099 87
1906 3300048905 Ga0496102_0010993 Ga0496102_0010993_2253_2516 87
1907 3300048905 Ga0496102_0036336 Ga0496102_0036336_495_767 87
1908 3300048906 Ga0496103_0004101 Ga0496103_0004101_4345_4617 87
1909 3300048906 Ga0496103_0013730 Ga0496103_0013730_1041_1313 87
1910 3300048906 Ga0496103_0028858 Ga0496103_0028858_2969_3241 87
1911 3300048906 Ga0496103_0030009 Ga0496103_0030009_1068_1331 87
1912 3300048907 Ga0496104_0000528 Ga0496104_0000528_28800_29072 87
1913 3300048907 Ga0496104_0053102 Ga0496104_0053102_651_923 87
1914 3300048907 Ga0496104_0072883 Ga0496104_0072883_982_1245 87
1915 3300048907 Ga0496104_0199375 Ga0496104_0199375_203_475 87
1916 3300048907 Ga0496104_1473270 Ga0496104_1473270_100_372 87
1917 3300048908 Ga0496105_0001587 Ga0496105_0001587_9522_9794 87
1918 3300048908 Ga0496105_0004501 Ga0496105_0004501_9469_9741 87
1919 3300048908 Ga0496105_0043606 Ga0496105_0043606_974_1237 87
1920 3300048908 Ga0496105_0304050 Ga0496105_0304050_720_992 87
1921 3300048908 Ga0496105_0795112 Ga0496105_0795112_73_345 87
1922 3300048909 Ga0496106_0000644 Ga0496106_0000644_21670_21942 87
1923 3300048909 Ga0496106_0170349 Ga0496106_0170349_945_1217 87
1924 3300048909 Ga0496106_0265595 Ga0496106_0265595_1030_1302 87
1925 3300048909 Ga0496106_0281047 Ga0496106_0281047_10_282 87
1926 3300048910 Ga0496107_0021482 Ga0496107_0021482_883_1155 87
1927 3300048910 Ga0496107_0034610 Ga0496107_0034610_1485_1757 87
1928 3300048910 Ga0496107_0137319 Ga0496107_0137319_289_561 87
1929 3300048910 Ga0496107_0673926 Ga0496107_0673926_437_700 87
1930 3300048911 Ga0496108_0002310 Ga0496108_0002310_9646_9918 87
1931 3300048911 Ga0496108_0037952 Ga0496108_0037952_720_992 87
1932 3300048911 Ga0496108_0089179 Ga0496108_0089179_1508_1780 87
1933 3300048911 Ga0496108_0398658 Ga0496108_0398658_30_293 87
1934 3300048911 Ga0496108_0665475 Ga0496108_0665475_581_853 87
1935 3300048912 Ga0496109_0012832 Ga0496109_0012832_5030_5302 87
1936 3300048912 Ga0496109_0241206 Ga0496109_0241206_1050_1328 87
1937 3300048912 Ga0496109_0313256 Ga0496109_0313256_764_1036 87
1938 3300048912 Ga0496109_0404516 Ga0496109_0404516_728_1000 87
1939 3300048912 Ga0496109_0746607 Ga0496109_0746607_627_899 87
1940 3300048913 Ga0496110_0096464 Ga0496110_0096464_1279_1551 87
1941 3300048913 Ga0496110_0283956 Ga0496110_0283956_647_919 87
1942 3300048913 Ga0496110_1122634 Ga0496110_1122634_19_282 87
1943 3300048914 Ga0496111_0014228 Ga0496111_0014228_84_356 87
1944 3300048914 Ga0496111_0184429 Ga0496111_0184429_1157_1429 87
1945 3300048914 Ga0496111_0330606 Ga0496111_0330606_77_349 87
1946 3300048914 Ga0496111_0423340 Ga0496111_0423340_128_400 87
1947 3300048915 Ga0496112_0020414 Ga0496112_0020414_278_550 87
1948 3300048915 Ga0496112_0080250 Ga0496112_0080250_893_1156 87
1949 3300048915 Ga0496112_0144505 Ga0496112_0144505_976_1248 87
1950 3300048915 Ga0496112_0368937 Ga0496112_0368937_599_871 87
1951 3300048916 Ga0496113_0068360 Ga0496113_0068360_503_775 87
1952 3300048916 Ga0496113_0083605 Ga0496113_0083605_242_505 87
1953 3300048916 Ga0496113_0088624 Ga0496113_0088624_46_318 87
1954 3300048917 Ga0496114_0029429 Ga0496114_0029429_723_995 87
1955 3300048917 Ga0496114_0056359 Ga0496114_0056359_2610_2882 87
1956 3300048917 Ga0496114_0913311 Ga0496114_0913311_382_645 87
1957 3300048917 Ga0496114_1261322 Ga0496114_1261322_157_429 87
1958 3300048917 Ga0496114_1614497 Ga0496114_1614497_226_498 87
1959 3300048918 Ga0496115_0024374 Ga0496115_0024374_628_900 87
1960 3300048918 Ga0496115_0076549 Ga0496115_0076549_377_649 87
1961 3300048918 Ga0496115_0132483 Ga0496115_0132483_318_590 87
1962 3300048918 Ga0496115_0341759 Ga0496115_0341759_702_965 87
1963 3300048919 Ga0496116_0138813 Ga0496116_0138813_745_1008 87
1964 3300048920 Ga0496117_0015671 Ga0496117_0015671_5243_5506 87
1965 3300048920 Ga0496117_0377016 Ga0496117_0377016_345_608 87
1966 3300048921 Ga0496118_0017573 Ga0496118_0017573_1016_1279 87
1967 3300048921 Ga0496118_0311094 Ga0496118_0311094_279_542 87
1968 3300048922 Ga0496119_0118637 Ga0496119_0118637_769_1041 87
1969 3300048923 Ga0496120_0094916 Ga0496120_0094916_909_1172 87
1970 3300048924 Ga0496121_0025847 Ga0496121_0025847_4555_4818 87
1971 3300048924 Ga0496121_0205637 Ga0496121_0205637_293_565 87
1972 3300048925 Ga0496122_0060396 Ga0496122_0060396_794_1057 87
1973 3300048926 Ga0496123_0077554 Ga0496123_0077554_1412_1675 87
1974 3300048927 Ga0496124_0181194 Ga0496124_0181194_490_753 87
1975 3300048928 Ga0496125_0116172 Ga0496125_0116172_873_1145 87
1976 3300048929 Ga0496126_0000974 Ga0496126_0000974_43374_43637 87
1977 3300048929 Ga0496126_0626676 Ga0496126_0626676_322_585 87
1978 3300048929 Ga0496126_1327300 Ga0496126_1327300_109_381 87
1979 3300049459 Ga0495678_201177 Ga0495678_201177_225_488 87
1980 3300049460 Ga0495682_0007087 Ga0495682_0007087_2668_2931 87
1981 3300049522 Ga0501299_108047 Ga0501299_108047_174_446 87
1982 3300049571 Ga0501034_1010855 Ga0501034_1010855_308_580 87
1983 3300049572 Ga0501036_1366233 Ga0501036_1366233_133_405 87
1984 3300049575 Ga0501039_0887596 Ga0501039_0887596_44_316 87
1985 3300049577 Ga0501041_0655354 Ga0501041_0655354_232_504 87
1986 3300049581 Ga0501047_0024305 Ga0501047_0024305_4577_4849 87
1987 3300049584 Ga0501068_0268903 Ga0501068_0268903_429_701 87
1988 3300049587 Ga0501071_0329926 Ga0501071_0329926_350_622 87
1989 3300049590 Ga0501074_0274216 Ga0501074_0274216_874_1146 87
1990 3300049592 Ga0501076_0195529 Ga0501076_0195529_68_340 87
1991 3300049593 Ga0501077_0023267 Ga0501077_0023267_3254_3526 87
1992 3300049741 Ga0501079_0217373 Ga0501079_0217373_412_684 87
1993 3300049742 Ga0501080_0405210 Ga0501080_0405210_725_997 87
1994 3300049742 Ga0501080_1067666 Ga0501080_1067666_17_289 87
1995 3300049742 Ga0501080_1663977 Ga0501080_1663977_207_479 87
1996 3300049744 Ga0501083_0073184 Ga0501083_0073184_1485_1757 87
1997 3300049744 Ga0501083_1076460 Ga0501083_1076460_182_451 87
1998 3300050489 nmdc:mga03683_312446_c1 nmdc:mga03683_312446_c1_83_355 87
1999 3300050491 nmdc:mga00v17_1067489_c1 nmdc:mga00v17_1067489_c1_44_316 87
2000 3300050491 nmdc:mga00v17_185167_c1 nmdc:mga00v17_185167_c1_752_1021 87
2001 3300050491 nmdc:mga00v17_657536_c1 nmdc:mga00v17_657536_c1_282_554 87
2002 3300050491 nmdc:mga00v17_738641_c1 nmdc:mga00v17_738641_c1_168_440 87
2003 3300050492 nmdc:mga0yw44_214618_c1 nmdc:mga0yw44_214618_c1_589_861 87
2004 3300050492 nmdc:mga0yw44_886089_c1 nmdc:mga0yw44_886089_c1_301_573 87
2005 3300050493 nmdc:mga0k408_445993_c1 nmdc:mga0k408_445993_c1_245_517 87
2006 3300050493 nmdc:mga0k408_454410_c1 nmdc:mga0k408_454410_c1_80_352 87
2007 3300050493 nmdc:mga0k408_908784_c1 nmdc:mga0k408_908784_c1_144_416 87
2008 3300050494 nmdc:mga06z11_191019_c1 nmdc:mga06z11_191019_c1_837_1109 87
2009 3300050494 nmdc:mga06z11_448134_c1 nmdc:mga06z11_448134_c1_140_412 87
2010 3300050495 nmdc:mga04h51_15883_c1 nmdc:mga04h51_15883_c1_259_531 87
2011 3300050495 nmdc:mga04h51_454390_c1 nmdc:mga04h51_454390_c1_191_463 87
2012 3300050495 nmdc:mga04h51_495401_c1 nmdc:mga04h51_495401_c1_194_466 87
2013 3300050496 nmdc:mga07m45_17616_c1 nmdc:mga07m45_17616_c1_3386_3658 87
2014 3300050496 nmdc:mga07m45_617241_c1 nmdc:mga07m45_617241_c1_303_575 87
2015 3300050507 nmdc:mga05p37_122210_c1 nmdc:mga05p37_122210_c1_1620_1892 87
2016 3300050507 nmdc:mga05p37_19_c3 nmdc:mga05p37_19_c3_18254_18526 87
2017 3300050508 nmdc:mga09592_1578599_c1 nmdc:mga09592_1578599_c1_190_462 87
2018 3300050508 nmdc:mga09592_758_c1 nmdc:mga09592_758_c1_17009_17281 87
2019 3300050509 nmdc:mga0qj67_1779_c1 nmdc:mga0qj67_1779_c1_8338_8610 87
2020 3300050509 nmdc:mga0qj67_416503_c1 nmdc:mga0qj67_416503_c1_747_1028 87
2021 3300050510 nmdc:mga06r32_4145_c1 nmdc:mga06r32_4145_c1_5153_5425 87
2022 3300050512 nmdc:mga0n895_1573_c1 nmdc:mga0n895_1573_c1_4537_4809 87
2023 3300050512 nmdc:mga0n895_199825_c1 nmdc:mga0n895_199825_c1_348_614 87
2024 3300050512 nmdc:mga0n895_46597_c1 nmdc:mga0n895_46597_c1_1134_1406 87
2025 3300050512 nmdc:mga0n895_77348_c1 nmdc:mga0n895_77348_c1_92_364 87
2026 3300050513 nmdc:mga0rr50_236933_c1 nmdc:mga0rr50_236933_c1_910_1182 87
2027 3300050513 nmdc:mga0rr50_390_c1 nmdc:mga0rr50_390_c1_16319_16591 87
2028 3300050513 nmdc:mga0rr50_40012_c1 nmdc:mga0rr50_40012_c1_3063_3335 87
2029 3300050513 nmdc:mga0rr50_435828_c1 nmdc:mga0rr50_435828_c1_693_965 87
2030 3300050513 nmdc:mga0rr50_472729_c1 nmdc:mga0rr50_472729_c1_17_283 87
2031 3300050514 nmdc:mga08x19_125557_c1 nmdc:mga08x19_125557_c1_1207_1479 87
2032 3300050515 nmdc:mga0a205_1424708_c1 nmdc:mga0a205_1424708_c1_83_349 87
2033 3300050515 nmdc:mga0a205_355408_c1 nmdc:mga0a205_355408_c1_29_301 87
2034 3300050515 nmdc:mga0a205_573514_c1 nmdc:mga0a205_573514_c1_630_902 87
2035 3300050515 nmdc:mga0a205_681_c1 nmdc:mga0a205_681_c1_20309_20581 87
2036 3300050516 nmdc:mga0sz30_37840_c1 nmdc:mga0sz30_37840_c1_494_766 87
2037 3300053077 Ga0495601_0000680 Ga0495601_0000680_12588_12860 87
2038 3300053077 Ga0495601_0003107 Ga0495601_0003107_3867_4139 87
2039 3300053077 Ga0495601_0006627 Ga0495601_0006627_5815_6087 87
2040 3300053077 Ga0495601_0068588 Ga0495601_0068588_141_413 87
2041 3300053077 Ga0495601_0139512 Ga0495601_0139512_527_799 87
2042 3300053077 Ga0495601_0521639 Ga0495601_0521639_451_723 87
2043 3300053078 Ga0495612_0004246 Ga0495612_0004246_5124_5396 87
2044 3300053078 Ga0495612_0044087 Ga0495612_0044087_1529_1801 87
2045 3300053078 Ga0495612_0052416 Ga0495612_0052416_497_769 87
2046 3300053084 Ga0495595_0000365 Ga0495595_0000365_16310_16582 87
2047 3300053084 Ga0495595_0000883 Ga0495595_0000883_379_651 87
2048 3300053084 Ga0495595_0003679 Ga0495595_0003679_686_958 87
2049 3300053084 Ga0495595_0008490 Ga0495595_0008490_3424_3696 87
2050 3300053084 Ga0495595_0011680 Ga0495595_0011680_390_662 87
2051 3300053084 Ga0495595_0416378 Ga0495595_0416378_69_341 87
2052 3300053085 Ga0495619_0000378 Ga0495619_0000378_14890_15162 87
2053 3300053085 Ga0495619_0000897 Ga0495619_0000897_12577_12849 87
2054 3300053085 Ga0495619_0024786 Ga0495619_0024786_1527_1799 87
2055 3300053085 Ga0495619_0026193 Ga0495619_0026193_1930_2202 87
2056 3300053085 Ga0495619_0104606 Ga0495619_0104606_574_846 87
2057 3300053085 Ga0495619_0722582 Ga0495619_0722582_391_663 87
2058 3300053094 Ga0500566_0090643 Ga0500566_0090643_1383_1655 87
2059 3300053094 Ga0500566_0365795 Ga0500566_0365795_82_354 87
2060 3300053094 Ga0500566_0402633 Ga0500566_0402633_100_375 87
2061 3300053096 Ga0500641_0005408 Ga0500641_0005408_1105_1377 87
2062 3300053098 Ga0500650_0488230 Ga0500650_0488230_82_354 87
2063 3300053119 Ga0500595_206930 Ga0500595_206930_208_480 87
2064 3300053120 Ga0500597_103913 Ga0500597_103913_514_786 87
2065 3300053130 Ga0500642_0332032 Ga0500642_0332032_172_444 87
2066 3300053134 Ga0500658_0043929 Ga0500658_0043929_859_1131 87
2067 3300053139 Ga0500568_0214450 Ga0500568_0214450_294_566 87
2068 3300053151 Ga0500604_0088536 Ga0500604_0088536_65_337 87
2069 3300054114 Ga0501084_0101211 Ga0501084_0101211_1217_1489 87
2070 3300059477 Ga0587084_108915 Ga0587084_108915_281_544 87
2071 3300059505 Ga0587083_0160644 Ga0587083_0160644_208_471 87
2072 3300059508 Ga0587088_019955 Ga0587088_019955_281_544 87
2073 3300059509 Ga0587089_031854 Ga0587089_031854_477_740 87
2074 3300059511 Ga0587091_067579 Ga0587091_067579_472_735 87
2075 3300059512 Ga0587092_104203 Ga0587092_104203_281_544 87
2076 3300059512 Ga0587092_128847 Ga0587092_128847_19_282 87
2077 3300059513 Ga0587094_090291 Ga0587094_090291_281_544 87
2078 3300059605 Ga0587106_056199 Ga0587106_056199_424_687 87
2079 3300059624 Ga0587109_046457 Ga0587109_046457_548_820 87
2080 3300059641 Ga0587068_099437 Ga0587068_099437_301_564 87
2081 3300059642 Ga0587069_053929 Ga0587069_053929_442_705 87
2082 3300059642 Ga0587069_106770 Ga0587069_106770_58_330 87
2083 3300059643 Ga0587072_137517 Ga0587072_137517_281_544 87
2084 3300059647 Ga0587079_011859 Ga0587079_011859_281_544 87
2085 3300059652 Ga0587107_060070 Ga0587107_060070_13_276 87
2086 3300059657 Ga0587118_17615 Ga0587118_17615_281_544 87
2087 3300059660 Ga0587124_051688 Ga0587124_051688_27_290 87
2088 3300060344 Ga0587071_145096 Ga0587071_145096_281_544 87
2089 3300061719 Ga0466962_0108923 Ga0466962_0108923_347_619 87
2090 3300061734 Ga0530510_0211558 Ga0530510_0211558_771_1043 87
2091 3300025981 Ga0207640_11501123 Ga0207640_115011232 88
2092 3300031731 Ga0307405_11031693 Ga0307405_110316931 88
2093 3300031824 Ga0307413_10102597 Ga0307413_101025972 88
2094 3300031901 Ga0307406_10299972 Ga0307406_102999721 88
2095 3300031911 Ga0307412_10063803 Ga0307412_100638034 88
2096 3300031995 Ga0307409_100018222 Ga0307409_1000182224 88
2097 3300032002 Ga0307416_100490663 Ga0307416_1004906632 88
2098 3300032004 Ga0307414_10357215 Ga0307414_103572153 88
2099 3300032005 Ga0307411_10293135 Ga0307411_102931352 88
2100 3300053103 Ga0500555_067326 Ga0500555_067326_161_439 88
2101 3300053177 Ga0500636_0220693 Ga0500636_0220693_14_295 88
2102 3300005329 Ga0070683_100212345 Ga0070683_1002123452 89
2103 3300005331 Ga0070670_102139665 Ga0070670_1021396652 89
2104 3300005338 Ga0068868_100666662 Ga0068868_1006666622 89
2105 3300005339 Ga0070660_100824681 Ga0070660_1008246812 89
2106 3300005344 Ga0070661_100337719 Ga0070661_1003377192 89
2107 3300005355 Ga0070671_100175400 Ga0070671_1001754001 89
2108 3300005367 Ga0070667_100685256 Ga0070667_1006852562 89
2109 3300005455 Ga0070663_100422486 Ga0070663_1004224862 89
2110 3300005456 Ga0070678_100801024 Ga0070678_1008010242 89
2111 3300005457 Ga0070662_100293484 Ga0070662_1002934843 89
2112 3300005543 Ga0070672_100270843 Ga0070672_1002708432 89
2113 3300005548 Ga0070665_100200351 Ga0070665_1002003513 89
2114 3300005564 Ga0070664_100113154 Ga0070664_1001131543 89
2115 3300005577 Ga0068857_102312949 Ga0068857_1023129491 89
2116 3300005616 Ga0068852_100191806 Ga0068852_1001918063 89
2117 3300005834 Ga0068851_10070254 Ga0068851_100702542 89
2118 3300005841 Ga0068863_100900900 Ga0068863_1009009001 89
2119 3300009177 Ga0105248_12312838 Ga0105248_123128382 89
2120 3300013306 Ga0163162_12563921 Ga0163162_125639212 89
2121 3300013307 Ga0157372_11232952 Ga0157372_112329521 89
2122 3300025893 Ga0207682_10079376 Ga0207682_100793761 89
2123 3300025909 Ga0207705_10722240 Ga0207705_107222401 89
2124 3300025919 Ga0207657_10840002 Ga0207657_108400022 89
2125 3300025920 Ga0207649_10155037 Ga0207649_101550372 89
2126 3300025925 Ga0207650_10290250 Ga0207650_102902502 89
2127 3300025926 Ga0207659_10706798 Ga0207659_107067982 89
2128 3300025931 Ga0207644_10162709 Ga0207644_101627091 89
2129 3300025933 Ga0207706_10395876 Ga0207706_103958761 89
2130 3300025941 Ga0207711_11373769 Ga0207711_113737692 89
2131 3300025981 Ga0207640_10733543 Ga0207640_107335431 89
2132 3300026023 Ga0207677_10817633 Ga0207677_108176331 89
2133 3300026041 Ga0207639_10166064 Ga0207639_101660642 89
2134 3300026067 Ga0207678_10569758 Ga0207678_105697582 89
2135 3300026142 Ga0207698_10499383 Ga0207698_104993831 89
2136 3300026142 Ga0207698_11467696 Ga0207698_114676961 89
2137 3300028379 Ga0268266_10147525 Ga0268266_101475252 89
2138 3300048911 Ga0496108_1802047 Ga0496108_1802047_79_357 89
2139 3300049570 Ga0501033_0017679 Ga0501033_0017679_2202_2483 89
2140 3300049581 Ga0501047_0929548 Ga0501047_0929548_256_537 89
2141 3300006237 Ga0097621_100864083 Ga0097621_1008640832 90
2142 3300006358 Ga0068871_100807571 Ga0068871_1008075712 90
2143 3300026041 Ga0207639_10002004 Ga0207639_1000200410 90
2144 3300049581 Ga0501047_0200214 Ga0501047_0200214_1012_1299 90
2145 3300053119 Ga0500595_212302 Ga0500595_212302_89_379 90
2146 2124908027 MRS2a_Contig_176 MRS2a_00075130 91
2147 3300005530 Ga0070679_101053685 Ga0070679_1010536851 91
2148 3300005616 Ga0068852_101779462 Ga0068852_1017794622 91
2149 3300013104 Ga0157370_10005866 Ga0157370_1000586610 91
2150 3300013307 Ga0157372_10399621 Ga0157372_103996212 91
2151 3300014497 Ga0182008_10372705 Ga0182008_103727051 91
2152 3300025921 Ga0207652_10577155 Ga0207652_105771552 91
2153 3300026142 Ga0207698_11973766 Ga0207698_119737662 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

82

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.909 18 80
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8971 17 80
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8881 19 80
7o9k-assembly1.cif.gz_W human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.8724 19 79
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.8625 20 79
ID Description Score Start End Superfamily
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8758 22 79 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8625 20 79 2.40.50.100
2ba0C01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7896 45 79 2.40.50.100
4ifdH01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7853 29 80 2.40.50.100
5oomW00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.78 13 79 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A842V1Q2-F1-model_v4 Exosome complex component Rrp4 0.8156 22 80 GO:0000178
GO:0000467
GO:0005737
GO:0006401
GO:0008143
GO:0034475
GO:0071034
GO:0071051
AF-A0A396IJ69-F1-model_v4 Putative ribosomal protein L27 0.8145 19 86 GO:0003735
GO:0005840
GO:0006412
AF-A0A7V4V6L3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.8058 12 79 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-E0VE64-F1-model_v4 Mitochondrial 50S ribosomal protein L27, putative 0.7797 16 80 GO:0003735
GO:0005762
GO:0006412
AF-A0A2D5JGL9-F1-model_v4 deleted 0.774 8 80

Feature Viewer

pLDDT pTM Quality
81.78 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map