F495928

General Info

Members Datasets Scaffolds Average Seq Length
1869 550 1869 78

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10457591|Ga0157370_104575912
Length 93
Sequence MARLGQRKSNTEESPMSETADRVKKIVVEHLGVEPDKVTEEASFIDDLGADSLDIVELVMAFEEEFNVEIPDDAAEKITTVKDAIDYIDQHQG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
137 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
138 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
139 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
140 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
141 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
144 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
145 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
146 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
147 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
168 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
174 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
175 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
179 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
270 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
271 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
272 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
276 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
277 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
280 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
281 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
282 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
283 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
284 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
285 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
286 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
287 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
288 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
289 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
290 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
291 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
292 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
293 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
294 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
295 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
299 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
300 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
301 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
302 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
314 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
320 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
321 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
322 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
323 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
324 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
325 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
326 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
327 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
328 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
329 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
330 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
331 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
332 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
333 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
334 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
335 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
336 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
337 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
338 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
339 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
340 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
341 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
342 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
343 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
344 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
345 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
346 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
347 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
348 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
349 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
350 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
351 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
352 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
353 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
354 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
355 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
356 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
357 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
358 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
359 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
360 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
361 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
362 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
363 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
364 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
365 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
366 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
367 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
368 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
369 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
370 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
371 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
372 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
373 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
374 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
375 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
376 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
377 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
378 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
379 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
380 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
381 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
384 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
388 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
389 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
390 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
391 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
392 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
393 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
394 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
395 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
396 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
397 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
398 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
399 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
404 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
405 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
406 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
407 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
408 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
409 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
412 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
413 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
414 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
415 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
416 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
417 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
418 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
419 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
420 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
421 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
422 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
423 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
424 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
425 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
426 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
427 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
428 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
429 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
430 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
431 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
432 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
433 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
434 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
435 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
436 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
439 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
440 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
441 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
442 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
443 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
445 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
446 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
447 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
470 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
471 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
472 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
473 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
474 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
475 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
476 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
477 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
478 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
479 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
480 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
481 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
482 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
483 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
484 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
485 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
486 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
487 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
488 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
489 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
490 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
491 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
492 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
493 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
494 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
495 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
496 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
497 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
498 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
499 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
500 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
503 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
504 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
505 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
506 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
507 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
508 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
509 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
510 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
511 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
512 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
513 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
514 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
515 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
516 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
517 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
518 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
519 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
520 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
521 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
522 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
523 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
524 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
525 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
526 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
527 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
528 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
529 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
530 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
531 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
532 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
533 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
534 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
535 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
536 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
537 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
538 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
539 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
540 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
541 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
542 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
543 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
544 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
545 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
546 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
547 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 3.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 2.41
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1170923 2162886007 Bacteria 1387
2 SwRhRL2b_contig_1467252 2162886007 Bacteria 2664
3 SwRhRL2b_contig_3357127 2162886007 Bacteria 1207
4 SwRhRL2b_contig_401845 2162886007 Bacteria 3180
5 LJQas_1017628 3300000549 Bacteria 832
6 ARCol0yngRDRAFT_1013171 3300000652 Bacteria 615
7 JGI24736J21556_1000067 3300001904 Bacteria 17042
8 JGI24736J21556_1000110 3300001904 Bacteria 13961
9 JGI24736J21556_1071132 3300001904 Bacteria 543
10 JGI24741J21665_1000129 3300001915 Bacteria 20677
11 JGI24741J21665_1032365 3300001915 Bacteria 781
12 JGI24741J21665_1040178 3300001915 Bacteria 691
13 JGI24752J21851_1000776 3300001976 Bacteria 4291
14 JGI24752J21851_1036600 3300001976 Bacteria 653
15 JGI24746J21847_1001743 3300001977 Bacteria 3489
16 JGI24740J21852_10002349 3300001979 Bacteria 8611
17 JGI24740J21852_10013222 3300001979 Bacteria 3087
18 JGI24740J21852_10016779 3300001979 Bacteria 2637
19 JGI24740J21852_10094265 3300001979 Bacteria 769
20 JGI24740J21852_10121571 3300001979 Bacteria 654
21 JGI24740J21852_10150809 3300001979 Bacteria 578
22 JGI24739J22299_10001367 3300001989 Bacteria 9159
23 JGI24739J22299_10038329 3300001989 Bacteria 1611
24 JGI24739J22299_10093754 3300001989 Bacteria 912
25 JGI24739J22299_10098816 3300001989 Bacteria 882
26 JGI24737J22298_10003855 3300001990 Bacteria 5272
27 JGI24737J22298_10043396 3300001990 Bacteria 1376
28 JGI24737J22298_10079838 3300001990 Bacteria 974
29 JGI24737J22298_10146429 3300001990 Bacteria 697
30 JGI24737J22298_10161522 3300001990 Bacteria 661
31 JGI24735J21928_10003135 3300002067 Bacteria 5664
32 JGI24735J21928_10039634 3300002067 Bacteria 1377
33 JGI24735J21928_10045625 3300002067 Bacteria 1273
34 JGI24735J21928_10132173 3300002067 Bacteria 719
35 JGI24750J21931_1000571 3300002070 Bacteria 5646
36 JGI24748J21848_1000029 3300002074 Bacteria 90134
37 JGI24748J21848_1019169 3300002074 Bacteria 822
38 JGI24738J21930_10005099 3300002075 Bacteria 3175
39 JGI24738J21930_10040297 3300002075 Bacteria 949
40 JGI24738J21930_10074966 3300002075 Bacteria 704
41 JGI24738J21930_10151560 3300002075 Bacteria 515
42 JGI24749J21850_1000184 3300002076 Bacteria 10048
43 JGI24749J21850_1001544 3300002076 Bacteria 3257
44 JGI24749J21850_1009786 3300002076 Bacteria 1340
45 JGI24744J21845_10106846 3300002077 Bacteria 518
46 JGI24035J26624_1012719 3300002126 Bacteria 850
47 JGI24033J26618_1014861 3300002155 Bacteria 956
48 JGI24034J26672_10000006 3300002239 Bacteria 294495
49 JGI24034J26672_10012412 3300002239 Bacteria 1283
50 JGI24034J26672_10033096 3300002239 Bacteria 848
51 JGI24742J22300_10007943 3300002244 Bacteria 1752
52 JGI24742J22300_10010284 3300002244 Bacteria 1549
53 JGI24751J29686_10000311 3300002459 Bacteria 18341
54 JGI24751J29686_10013619 3300002459 Bacteria 1678
55 JGI24751J29686_10048147 3300002459 Bacteria 880
56 JGI24751J29686_10052246 3300002459 Bacteria 843
57 JGI24751J29686_10101161 3300002459 Bacteria 602
58 JGI25151J46595_10118985 3300003187 Bacteria 676
59 JGI25165J46597_1000032 3300003214 Bacteria 294371
60 rootH1_10219905 3300003323 Bacteria 1475
61 Ga0007429J51699_1094910 3300003579 Bacteria 538
62 Ga0055532_1018923 3300003758 Bacteria 730
63 Ga0055536_1001940 3300003781 Bacteria 11924
64 Ga0055530_10000065 3300003791 Bacteria 94009
65 Ga0055531_10054018 3300003794 Bacteria 1033
66 JGI25405J52794_10003004 3300003911 Bacteria 2934
67 Ga0058861_11573036 3300004800 Bacteria 519
68 Ga0065714_10151266 3300005288 Bacteria 1105
69 Ga0065714_10279097 3300005288 Bacteria 726
70 Ga0065714_10303611 3300005288 Bacteria 690
71 Ga0065714_10387755 3300005288 Bacteria 601
72 Ga0065714_10446091 3300005288 Bacteria 557
73 Ga0065704_10000743 3300005289 Bacteria 24338
74 Ga0065704_10075680 3300005289 Bacteria 5468
75 Ga0065704_10081635 3300005289 Bacteria 3726
76 Ga0065704_10145942 3300005289 Bacteria 1472
77 Ga0065704_10415476 3300005289 Bacteria 734
78 Ga0065704_10730684 3300005289 Bacteria 549
79 Ga0065712_10039431 3300005290 Bacteria 971
80 Ga0065712_10103545 3300005290 Bacteria 1982
81 Ga0065712_10317213 3300005290 Bacteria 834
82 Ga0065712_10332836 3300005290 Bacteria 811
83 Ga0065712_10420220 3300005290 Bacteria 713
84 Ga0065712_10630688 3300005290 Bacteria 576
85 Ga0065715_10089927 3300005293 Bacteria 8105
86 Ga0065715_10144459 3300005293 Bacteria 1807
87 Ga0065715_10167147 3300005293 Bacteria 1548
88 Ga0065715_10201242 3300005293 Bacteria 1360
89 Ga0065715_10327560 3300005293 Bacteria 976
90 Ga0065715_10666951 3300005293 Bacteria 670
91 Ga0065707_10083015 3300005295 Bacteria 10847
92 Ga0065707_10085258 3300005295 Bacteria 6310
93 Ga0065707_10086202 3300005295 Bacteria 5600
94 Ga0065707_10110487 3300005295 Bacteria 2428
95 Ga0065707_10253202 3300005295 Bacteria 1119
96 Ga0065707_10315029 3300005295 Bacteria 977
97 Ga0070658_10000001 3300005327 Bacteria 856789
98 Ga0070658_10005310 3300005327 Bacteria 10457
99 Ga0070658_10034919 3300005327 Bacteria 4047
100 Ga0070658_10226584 3300005327 Bacteria 1582
101 Ga0070658_10254004 3300005327 Bacteria 1492
102 Ga0070658_10526794 3300005327 Bacteria 1022
103 Ga0070658_10742267 3300005327 Bacteria 852
104 Ga0070658_10772402 3300005327 Bacteria 834
105 Ga0070676_10006232 3300005328 Bacteria 6372
106 Ga0070676_10104011 3300005328 Bacteria 1759
107 Ga0070676_10115548 3300005328 Bacteria 1677
108 Ga0070683_100118125 3300005329 Bacteria 2504
109 Ga0070683_100127345 3300005329 Bacteria 2408
110 Ga0070683_100181524 3300005329 Bacteria 1998
111 Ga0070683_100638197 3300005329 Bacteria 1020
112 Ga0070683_100961616 3300005329 Bacteria 820
113 Ga0070683_101430248 3300005329 Bacteria 664
114 Ga0070690_100000002 3300005330 Bacteria 176748
115 Ga0070670_100000005 3300005331 Bacteria 351569
116 Ga0070670_100000016 3300005331 Bacteria 226440
117 Ga0070670_100000565 3300005331 Bacteria 29356
118 Ga0070670_100003401 3300005331 Bacteria 13190
119 Ga0070670_100004789 3300005331 Bacteria 11364
120 Ga0070670_100027482 3300005331 Bacteria 4893
121 Ga0070670_100057823 3300005331 Bacteria 3328
122 Ga0070670_100143580 3300005331 Bacteria 2065
123 Ga0070670_100339546 3300005331 Bacteria 1318
124 Ga0070670_100517730 3300005331 Bacteria 1062
125 Ga0070670_101182151 3300005331 Bacteria 699
126 Ga0070670_102245490 3300005331 Bacteria 503
127 Ga0070677_10003186 3300005333 Bacteria 5279
128 Ga0070677_10084386 3300005333 Bacteria 1367
129 Ga0070677_10553814 3300005333 Bacteria 631
130 Ga0068869_100333989 3300005334 Bacteria 1232
131 Ga0068869_100527117 3300005334 Bacteria 989
132 Ga0068869_100624241 3300005334 Bacteria 912
133 Ga0070666_10000002 3300005335 Bacteria 478684
134 Ga0070666_10242698 3300005335 Bacteria 1274
135 Ga0070680_100004292 3300005336 Bacteria 10715
136 Ga0070680_100179076 3300005336 Bacteria 1785
137 Ga0070682_100318290 3300005337 Bacteria 1148
138 Ga0070682_100740733 3300005337 Bacteria 792
139 Ga0070682_100886894 3300005337 Bacteria 732
140 Ga0068868_100546147 3300005338 Bacteria 1021
141 Ga0070660_100001280 3300005339 Bacteria 17152
142 Ga0070660_100041816 3300005339 Bacteria 3495
143 Ga0070660_100208003 3300005339 Bacteria 1588
144 Ga0070660_100211306 3300005339 Bacteria 1575
145 Ga0070660_100218247 3300005339 Bacteria 1550
146 Ga0070660_100325277 3300005339 Bacteria 1263
147 Ga0070660_100968134 3300005339 Bacteria 718
148 Ga0070660_100999795 3300005339 Bacteria 707
149 Ga0070689_100129951 3300005340 Bacteria 2019
150 Ga0070691_10576049 3300005341 Bacteria 661
151 Ga0070687_100183426 3300005343 Bacteria 1255
152 Ga0070661_100338284 3300005344 Bacteria 1178
153 Ga0070661_100353926 3300005344 Bacteria 1153
154 Ga0070661_100364257 3300005344 Bacteria 1137
155 Ga0070661_100385440 3300005344 Bacteria 1106
156 Ga0070661_101045863 3300005344 Bacteria 679
157 Ga0070661_101095216 3300005344 Bacteria 663
158 Ga0070661_101196113 3300005344 Bacteria 635
159 Ga0070661_101204080 3300005344 Bacteria 633
160 Ga0070692_10022145 3300005345 Bacteria 3101
161 Ga0070692_10184127 3300005345 Bacteria 1212
162 Ga0070692_10814587 3300005345 Bacteria 639
163 Ga0070668_100000005 3300005347 Bacteria 187511
164 Ga0070668_100000311 3300005347 Bacteria 32092
165 Ga0070668_100001843 3300005347 Bacteria 15442
166 Ga0070668_100004667 3300005347 Bacteria 10153
167 Ga0070668_100005484 3300005347 Bacteria 9414
168 Ga0070668_100027382 3300005347 Bacteria 4328
169 Ga0070668_100088505 3300005347 Bacteria 2438
170 Ga0070668_100281634 3300005347 Bacteria 1389
171 Ga0070668_100287716 3300005347 Bacteria 1374
172 Ga0070668_100290601 3300005347 Bacteria 1368
173 Ga0070668_100511667 3300005347 Bacteria 1041
174 Ga0070668_100739864 3300005347 Bacteria 870
175 Ga0070668_100759943 3300005347 Bacteria 859
176 Ga0070669_100000078 3300005353 Bacteria 94641
177 Ga0070669_100000141 3300005353 Bacteria 64131
178 Ga0070669_100000577 3300005353 Bacteria 27254
179 Ga0070669_100016584 3300005353 Bacteria 5258
180 Ga0070669_100106170 3300005353 Bacteria 2125
181 Ga0070669_100127806 3300005353 Bacteria 1946
182 Ga0070669_100314228 3300005353 Bacteria 1264
183 Ga0070669_100332683 3300005353 Bacteria 1229
184 Ga0070669_100451827 3300005353 Bacteria 1059
185 Ga0070669_100605020 3300005353 Bacteria 918
186 Ga0070669_101051046 3300005353 Bacteria 700
187 Ga0070675_100000241 3300005354 Bacteria 35442
188 Ga0070675_100003187 3300005354 Bacteria 12421
189 Ga0070675_100147593 3300005354 Bacteria 2015
190 Ga0070675_100178755 3300005354 Bacteria 1834
191 Ga0070675_100849445 3300005354 Bacteria 835
192 Ga0070671_100000069 3300005355 Bacteria 67279
193 Ga0070671_100016626 3300005355 Bacteria 5946
194 Ga0070671_100017136 3300005355 Bacteria 5862
195 Ga0070671_100141121 3300005355 Bacteria 2033
196 Ga0070671_100301446 3300005355 Bacteria 1364
197 Ga0070674_100002690 3300005356 Bacteria 9836
198 Ga0070674_100492144 3300005356 Bacteria 1020
199 Ga0070674_101329529 3300005356 Bacteria 642
200 Ga0070673_100012928 3300005364 Bacteria 5751
201 Ga0070673_100027506 3300005364 Bacteria 4217
202 Ga0070673_100197629 3300005364 Bacteria 1730
203 Ga0070673_100374335 3300005364 Bacteria 1268
204 Ga0070673_101568354 3300005364 Bacteria 622
205 Ga0070688_100018458 3300005365 Bacteria 4025
206 Ga0070688_100704704 3300005365 Bacteria 782
207 Ga0070659_100004749 3300005366 Bacteria 9706
208 Ga0070659_100006775 3300005366 Bacteria 8290
209 Ga0070659_100015232 3300005366 Bacteria 5755
210 Ga0070659_100024202 3300005366 Bacteria 4653
211 Ga0070659_100031820 3300005366 Bacteria 4088
212 Ga0070659_100091066 3300005366 Bacteria 2444
213 Ga0070659_100200067 3300005366 Bacteria 1644
214 Ga0070659_100280233 3300005366 Bacteria 1387
215 Ga0070659_100443115 3300005366 Bacteria 1101
216 Ga0070659_100491586 3300005366 Bacteria 1045
217 Ga0070659_100590646 3300005366 Bacteria 953
218 Ga0070659_100605616 3300005366 Bacteria 942
219 Ga0070659_100898875 3300005366 Bacteria 774
220 Ga0070659_100918330 3300005366 Bacteria 766
221 Ga0070667_100000004 3300005367 Bacteria 444091
222 Ga0070667_100000670 3300005367 Bacteria 33199
223 Ga0070667_100003740 3300005367 Bacteria 12920
224 Ga0070667_100015295 3300005367 Bacteria 6343
225 Ga0070667_100030252 3300005367 Bacteria 4515
226 Ga0070667_100781941 3300005367 Bacteria 886
227 Ga0070667_101328557 3300005367 Bacteria 674
228 Ga0070667_101947116 3300005367 Bacteria 553
229 Ga0070667_102045563 3300005367 Bacteria 539
230 Ga0070714_100211616 3300005435 Bacteria 1777
231 Ga0070713_100075070 3300005436 Bacteria 2866
232 Ga0070701_10151952 3300005438 Bacteria 1334
233 Ga0070700_100014819 3300005441 Bacteria 4406
234 Ga0070694_100042064 3300005444 Bacteria 3050
235 Ga0070663_100006999 3300005455 Bacteria 6830
236 Ga0070663_100109543 3300005455 Bacteria 2073
237 Ga0070663_100148341 3300005455 Bacteria 1796
238 Ga0070663_100199874 3300005455 Bacteria 1559
239 Ga0070663_100229736 3300005455 Bacteria 1460
240 Ga0070663_100719668 3300005455 Bacteria 850
241 Ga0070678_100014156 3300005456 Bacteria 5024
242 Ga0070678_100558019 3300005456 Bacteria 1017
243 Ga0070678_101474492 3300005456 Bacteria 636
244 Ga0070678_101492570 3300005456 Bacteria 633
245 Ga0070662_100000920 3300005457 Bacteria 18004
246 Ga0070662_100004489 3300005457 Bacteria 8839
247 Ga0070662_100079214 3300005457 Bacteria 2442
248 Ga0070662_100163838 3300005457 Bacteria 1741
249 Ga0070662_100324658 3300005457 Bacteria 1256
250 Ga0070662_100642864 3300005457 Bacteria 894
251 Ga0070662_101363958 3300005457 Bacteria 611
252 Ga0070681_10147455 3300005458 Bacteria 2281
253 Ga0070681_10254922 3300005458 Bacteria 1667
254 Ga0070681_10279922 3300005458 Bacteria 1579
255 Ga0070681_10319699 3300005458 Bacteria 1462
256 Ga0070681_10580449 3300005458 Bacteria 1035
257 Ga0070681_11687256 3300005458 Bacteria 560
258 Ga0068867_100010850 3300005459 Bacteria 6425
259 Ga0068867_100016992 3300005459 Bacteria 5170
260 Ga0068867_100064427 3300005459 Bacteria 2725
261 Ga0068867_100333851 3300005459 Bacteria 1260
262 Ga0070685_10000056 3300005466 Bacteria 68183
263 Ga0070685_10257114 3300005466 Bacteria 1159
264 Ga0070706_101138992 3300005467 Bacteria 718
265 Ga0070698_100651167 3300005471 Bacteria 995
266 Ga0070679_100000025 3300005530 Bacteria 118724
267 Ga0070679_100286000 3300005530 Bacteria 1601
268 Ga0070679_101098061 3300005530 Bacteria 740
269 Ga0070679_101265391 3300005530 Bacteria 683
270 Ga0070679_101350191 3300005530 Bacteria 659
271 Ga0070684_100374066 3300005535 Bacteria 1312
272 Ga0070684_100572786 3300005535 Unclassified 1049
273 Ga0068853_100001390 3300005539 Bacteria 17494
274 Ga0068853_100051030 3300005539 Bacteria 3560
275 Ga0068853_100061648 3300005539 Bacteria 3244
276 Ga0068853_100124244 3300005539 Bacteria 2304
277 Ga0068853_100140002 3300005539 Bacteria 2172
278 Ga0068853_100152907 3300005539 Bacteria 2078
279 Ga0068853_100687346 3300005539 Bacteria 975
280 Ga0068853_100725911 3300005539 Bacteria 949
281 Ga0068853_100885909 3300005539 Bacteria 857
282 Ga0068853_101818484 3300005539 Bacteria 590
283 Ga0068853_101823038 3300005539 Bacteria 590
284 Ga0068853_102144935 3300005539 Bacteria 542
285 Ga0070672_100000788 3300005543 Bacteria 18842
286 Ga0070672_100009819 3300005543 Bacteria 6615
287 Ga0070672_100012979 3300005543 Bacteria 5871
288 Ga0070672_100240067 3300005543 Bacteria 1524
289 Ga0070672_101059399 3300005543 Bacteria 720
290 Ga0070672_101887035 3300005543 Bacteria 538
291 Ga0070686_100000002 3300005544 Bacteria 336303
292 Ga0070695_100092734 3300005545 Bacteria 2020
293 Ga0070696_100015724 3300005546 Bacteria 5086
294 Ga0070696_100304529 3300005546 Bacteria 1222
295 Ga0070693_100378287 3300005547 Bacteria 976
296 Ga0070693_100504753 3300005547 Bacteria 858
297 Ga0070693_100755648 3300005547 Bacteria 717
298 Ga0070665_100000025 3300005548 Bacteria 367488
299 Ga0070665_100112634 3300005548 Bacteria 2724
300 Ga0070665_100341200 3300005548 Bacteria 1503
301 Ga0070665_101179536 3300005548 Bacteria 777
302 Ga0070665_102084741 3300005548 Bacteria 572
303 Ga0068855_100075313 3300005563 Bacteria 3919
304 Ga0068855_100143563 3300005563 Bacteria 2719
305 Ga0068855_100269055 3300005563 Bacteria 1895
306 Ga0068855_100333642 3300005563 Bacteria 1674
307 Ga0068855_100336282 3300005563 Bacteria 1666
308 Ga0068855_100413261 3300005563 Bacteria 1477
309 Ga0068855_100811825 3300005563 Bacteria 993
310 Ga0068855_100923464 3300005563 Unclassified 921
311 Ga0068855_101941874 3300005563 Bacteria 595
312 Ga0070664_100113168 3300005564 Bacteria 2370
313 Ga0070664_100157066 3300005564 Bacteria 2010
314 Ga0070664_100199645 3300005564 Bacteria 1784
315 Ga0070664_100304936 3300005564 Bacteria 1440
316 Ga0070664_100487380 3300005564 Bacteria 1135
317 Ga0070664_100767213 3300005564 Bacteria 901
318 Ga0070664_101304521 3300005564 Bacteria 686
319 Ga0068857_100038993 3300005577 Bacteria 4206
320 Ga0068857_100048544 3300005577 Bacteria 3768
321 Ga0068857_100079797 3300005577 Bacteria 2921
322 Ga0068857_100099439 3300005577 Bacteria 2609
323 Ga0068857_100136984 3300005577 Bacteria 2211
324 Ga0068857_100174040 3300005577 Bacteria 1957
325 Ga0068857_101582845 3300005577 Bacteria 639
326 Ga0068857_102083018 3300005577 Bacteria 557
327 Ga0068854_100040893 3300005578 Bacteria 3273
328 Ga0068854_100096461 3300005578 Bacteria 2209
329 Ga0068854_100108040 3300005578 Bacteria 2095
330 Ga0068854_100251074 3300005578 Bacteria 1412
331 Ga0068854_100325905 3300005578 Bacteria 1250
332 Ga0068854_100342951 3300005578 Bacteria 1220
333 Ga0068854_100577753 3300005578 Bacteria 957
334 Ga0068854_100808307 3300005578 Bacteria 818
335 Ga0068854_101142741 3300005578 Bacteria 695
336 Ga0068854_101266594 3300005578 Bacteria 663
337 Ga0068854_101474579 3300005578 Bacteria 617
338 Ga0068854_101846953 3300005578 Bacteria 555
339 Ga0068856_100007187 3300005614 Bacteria 10860
340 Ga0068856_100133225 3300005614 Bacteria 2490
341 Ga0068856_100296382 3300005614 Bacteria 1634
342 Ga0068856_100400886 3300005614 Bacteria 1391
343 Ga0068856_100528688 3300005614 Bacteria 1200
344 Ga0068856_101071795 3300005614 Bacteria 823
345 Ga0068856_101604464 3300005614 Bacteria 664
346 Ga0068856_102205352 3300005614 Bacteria 560
347 Ga0070702_100167883 3300005615 Bacteria 1425
348 Ga0068852_100021324 3300005616 Bacteria 5171
349 Ga0068852_100052642 3300005616 Bacteria 3499
350 Ga0068852_100119012 3300005616 Bacteria 2414
351 Ga0068852_100164820 3300005616 Bacteria 2073
352 Ga0068852_100181684 3300005616 Bacteria 1978
353 Ga0068852_100399676 3300005616 Bacteria 1351
354 Ga0068852_100497178 3300005616 Bacteria 1214
355 Ga0068852_100527756 3300005616 Bacteria 1178
356 Ga0068852_101319373 3300005616 Unclassified 743
357 Ga0068859_100001534 3300005617 Bacteria 23567
358 Ga0068859_100001912 3300005617 Bacteria 21244
359 Ga0068859_100002233 3300005617 Bacteria 19640
360 Ga0068859_100010510 3300005617 Bacteria 9315
361 Ga0068859_100040483 3300005617 Bacteria 4678
362 Ga0068859_100067943 3300005617 Bacteria 3599
363 Ga0068859_100084948 3300005617 Bacteria 3210
364 Ga0068859_100110159 3300005617 Bacteria 2815
365 Ga0068859_100578136 3300005617 Bacteria 1217
366 Ga0068859_101598857 3300005617 Bacteria 720
367 Ga0068864_100000011 3300005618 Bacteria 350056
368 Ga0068864_100000017 3300005618 Bacteria 285607
369 Ga0068864_100034989 3300005618 Bacteria 4274
370 Ga0068864_100053264 3300005618 Bacteria 3490
371 Ga0068864_100102808 3300005618 Bacteria 2536
372 Ga0068864_100134514 3300005618 Bacteria 2225
373 Ga0068864_100643829 3300005618 Bacteria 1032
374 Ga0068866_10092560 3300005718 Bacteria 1650
375 Ga0068861_100000005 3300005719 Bacteria 101677
376 Ga0068861_100003486 3300005719 Bacteria 10446
377 Ga0068861_100003714 3300005719 Bacteria 10185
378 Ga0068861_100238258 3300005719 Bacteria 1546
379 Ga0068861_100318828 3300005719 Bacteria 1353
380 Ga0068861_100413740 3300005719 Bacteria 1200
381 Ga0068861_102691819 3300005719 Bacteria 502
382 Ga0068851_10013293 3300005834 Bacteria 3895
383 Ga0068851_10021275 3300005834 Bacteria 3149
384 Ga0068851_10072277 3300005834 Bacteria 1787
385 Ga0068851_10112552 3300005834 Bacteria 1454
386 Ga0068870_10188231 3300005840 Bacteria 1244
387 Ga0068870_10350009 3300005840 Bacteria 948
388 Ga0068870_10392705 3300005840 Bacteria 901
389 Ga0068863_100000018 3300005841 Bacteria 206948
390 Ga0068863_100000030 3300005841 Bacteria 176023
391 Ga0068863_100000070 3300005841 Bacteria 115715
392 Ga0068863_100000901 3300005841 Bacteria 29874
393 Ga0068863_100009881 3300005841 Bacteria 9293
394 Ga0068863_101778784 3300005841 Bacteria 626
395 Ga0068858_100000248 3300005842 Bacteria 57728
396 Ga0068858_100002601 3300005842 Bacteria 18179
397 Ga0068858_100012541 3300005842 Bacteria 7993
398 Ga0068858_100058143 3300005842 Bacteria 3575
399 Ga0068858_101340271 3300005842 Bacteria 704
400 Ga0068860_100000001 3300005843 Bacteria 703043
401 Ga0068860_100000002 3300005843 Bacteria 627849
402 Ga0068860_100011736 3300005843 Bacteria 8633
403 Ga0068860_100282145 3300005843 Bacteria 1623
404 Ga0068860_100323963 3300005843 Bacteria 1513
405 Ga0068860_101824518 3300005843 Bacteria 630
406 Ga0068862_100000010 3300005844 Bacteria 285607
407 Ga0068862_100000011 3300005844 Bacteria 270105
408 Ga0068862_100000020 3300005844 Bacteria 219516
409 Ga0068862_100000255 3300005844 Bacteria 59738
410 Ga0068862_100036790 3300005844 Bacteria 4149
411 Ga0068862_100050926 3300005844 Bacteria 3540
412 Ga0068862_100069882 3300005844 Bacteria 3031
413 Ga0068862_100157758 3300005844 Bacteria 2024
414 Ga0068862_100338467 3300005844 Bacteria 1393
415 Ga0068862_100343286 3300005844 Bacteria 1383
416 Ga0068862_100633598 3300005844 Bacteria 1030
417 Ga0068862_100839644 3300005844 Bacteria 899
418 Ga0068862_101448692 3300005844 Bacteria 691
419 Ga0068862_101793863 3300005844 Bacteria 623
420 Ga0068862_102488036 3300005844 Bacteria 529
421 Ga0081455_10000477 3300005937 Bacteria 51914
422 Ga0081539_10008339 3300005985 Bacteria 9056
423 Ga0081539_10034793 3300005985 Bacteria 3038
424 Ga0081539_10135348 3300005985 Bacteria 1205
425 Ga0075368_10000012 3300006042 Bacteria 43578
426 Ga0075363_100271328 3300006048 Bacteria 980
427 Ga0075363_100593850 3300006048 Bacteria 663
428 Ga0075432_10545598 3300006058 Bacteria 523
429 Ga0075362_10057504 3300006177 Bacteria 1753
430 Ga0075367_10077753 3300006178 Bacteria 2003
431 Ga0075366_10191525 3300006195 Bacteria 1243
432 Ga0075366_10289984 3300006195 Bacteria 1001
433 Ga0075366_11053918 3300006195 Bacteria 508
434 Ga0097621_100015046 3300006237 Bacteria 5809
435 Ga0097621_102298419 3300006237 Bacteria 516
436 Ga0075370_10039836 3300006353 Bacteria 2649
437 Ga0075370_10181747 3300006353 Bacteria 1238
438 Ga0075370_10526009 3300006353 Bacteria 714
439 Ga0068871_100635875 3300006358 Bacteria 973
440 Ga0068871_101423172 3300006358 Bacteria 654
441 Ga0075428_100162259 3300006844 Bacteria 2425
442 Ga0075428_100459352 3300006844 Bacteria 1364
443 Ga0075430_100142608 3300006846 Bacteria 1995
444 Ga0075430_100152834 3300006846 Bacteria 1922
445 Ga0075431_100002601 3300006847 Bacteria 17453
446 Ga0075434_100651820 3300006871 Bacteria 1071
447 Ga0075429_100168465 3300006880 Bacteria 1919
448 Ga0068865_100010982 3300006881 Bacteria 5652
449 Ga0097620_100001534 3300006931 Bacteria 23567
450 Ga0097620_100001912 3300006931 Bacteria 21244
451 Ga0097620_100002233 3300006931 Bacteria 19640
452 Ga0097620_100010510 3300006931 Bacteria 9315
453 Ga0097620_100040484 3300006931 Bacteria 4678
454 Ga0097620_100067944 3300006931 Bacteria 3599
455 Ga0097620_100084946 3300006931 Bacteria 3210
456 Ga0097620_100110159 3300006931 Bacteria 2815
457 Ga0097620_100578220 3300006931 Bacteria 1217
458 Ga0097620_101598710 3300006931 Bacteria 720
459 Ga0099794_10078745 3300007265 Bacteria 1623
460 Ga0099795_10535447 3300007788 Bacteria 550
461 Ga0105251_10002397 3300009011 Bacteria 14810
462 Ga0105251_10037097 3300009011 Bacteria 2393
463 Ga0105250_10267487 3300009092 Bacteria 733
464 Ga0105250_10396659 3300009092 Bacteria 611
465 Ga0105250_10433087 3300009092 Bacteria 588
466 Ga0105240_10007112 3300009093 Bacteria 16308
467 Ga0105240_10013152 3300009093 Bacteria 11385
468 Ga0105240_10035093 3300009093 Bacteria 6467
469 Ga0105240_10044699 3300009093 Bacteria 5625
470 Ga0105240_10258816 3300009093 Bacteria 2008
471 Ga0105240_10326080 3300009093 Bacteria 1749
472 Ga0105240_10368136 3300009093 Bacteria 1626
473 Ga0105240_10961671 3300009093 Bacteria 915
474 Ga0105240_11968366 3300009093 Bacteria 607
475 Ga0105240_12596872 3300009093 Bacteria 523
476 Ga0111539_10088855 3300009094 Bacteria 3630
477 Ga0111539_10275559 3300009094 Bacteria 1958
478 Ga0111539_10823079 3300009094 Bacteria 1080
479 Ga0111539_11146779 3300009094 Bacteria 903
480 Ga0105245_10004049 3300009098 Bacteria 13025
481 Ga0105247_10034327 3300009101 Bacteria 3089
482 Ga0105247_10051265 3300009101 Bacteria 2541
483 Ga0114129_10073524 3300009147 Bacteria 4763
484 Ga0114129_10316914 3300009147 Bacteria 2074
485 Ga0114129_11129727 3300009147 Bacteria 979
486 Ga0114129_11167469 3300009147 Bacteria 961
487 Ga0105243_10214400 3300009148 Bacteria 1697
488 Ga0105243_10246884 3300009148 Bacteria 1591
489 Ga0105243_10598297 3300009148 Bacteria 1061
490 Ga0105243_10670454 3300009148 Bacteria 1007
491 Ga0105243_12414960 3300009148 Bacteria 564
492 Ga0105241_10055904 3300009174 Bacteria 3024
493 Ga0105241_10298488 3300009174 Bacteria 1382
494 Ga0105241_10458444 3300009174 Bacteria 1129
495 Ga0105241_11622954 3300009174 Bacteria 626
496 Ga0105242_13018527 3300009176 Bacteria 521
497 Ga0105248_10000921 3300009177 Bacteria 32763
498 Ga0105248_10001148 3300009177 Bacteria 29534
499 Ga0105248_10002326 3300009177 Bacteria 21082
500 Ga0105248_10109542 3300009177 Bacteria 3114
501 Ga0105248_10126111 3300009177 Bacteria 2888
502 Ga0105248_10229360 3300009177 Bacteria 2090
503 Ga0105248_11122103 3300009177 Bacteria 889
504 Ga0105237_10003097 3300009545 Bacteria 20039
505 Ga0105237_10013689 3300009545 Bacteria 8495
506 Ga0105237_10142781 3300009545 Bacteria 2388
507 Ga0105237_10588228 3300009545 Bacteria 1120
508 Ga0105237_10590424 3300009545 Bacteria 1118
509 Ga0105237_10698836 3300009545 Bacteria 1021
510 Ga0105238_10083197 3300009551 Bacteria 3190
511 Ga0105238_10101457 3300009551 Bacteria 2860
512 Ga0105238_10199059 3300009551 Bacteria 1979
513 Ga0105238_10291589 3300009551 Bacteria 1614
514 Ga0105238_10376200 3300009551 Bacteria 1411
515 Ga0105238_10719275 3300009551 Bacteria 1011
516 Ga0105238_10790679 3300009551 Bacteria 964
517 Ga0105238_10957419 3300009551 Bacteria 876
518 Ga0105249_10000005 3300009553 Bacteria 362467
519 Ga0105249_10000489 3300009553 Bacteria 36715
520 Ga0105249_10020669 3300009553 Bacteria 5886
521 Ga0105249_10155669 3300009553 Bacteria 2204
522 Ga0105249_10155974 3300009553 Bacteria 2202
523 Ga0105249_10324300 3300009553 Bacteria 1552
524 Ga0105249_10325643 3300009553 Bacteria 1549
525 Ga0105249_10985142 3300009553 Bacteria 912
526 Ga0105249_11238004 3300009553 Bacteria 818
527 Ga0105249_12726551 3300009553 Bacteria 566
528 Ga0130086_1052251 3300009829 Bacteria 560
529 Ga0130085_1052616 3300009850 Bacteria 560
530 Ga0105148_100107 3300009978 Bacteria 13121
531 Ga0105148_117298 3300009978 Bacteria 572
532 Ga0105032_105966 3300009979 Bacteria 1022
533 Ga0105147_100777 3300009982 Bacteria 2579
534 Ga0105028_136136 3300009993 Bacteria 555
535 Ga0105239_10000104 3300010375 Bacteria 117927
536 Ga0105239_10097588 3300010375 Bacteria 3247
537 Ga0105239_10736233 3300010375 Bacteria 1128
538 Ga0105239_11154226 3300010375 Bacteria 892
539 Ga0105239_11975720 3300010375 Bacteria 677
540 Ga0105239_12129963 3300010375 Bacteria 652
541 Ga0157323_1049476 3300012495 Bacteria 507
542 Ga0157345_1031392 3300012498 Bacteria 597
543 Ga0157342_1005268 3300012507 Bacteria 1183
544 Ga0157316_1008431 3300012510 Bacteria 902
545 Ga0157326_1000620 3300012513 Bacteria 4161
546 Ga0157373_10003953 3300013100 Bacteria 11195
547 Ga0157373_10093168 3300013100 Bacteria 2122
548 Ga0157373_10147691 3300013100 Bacteria 1654
549 Ga0157373_10224784 3300013100 Bacteria 1325
550 Ga0157373_10260491 3300013100 Bacteria 1227
551 Ga0157373_10384666 3300013100 Bacteria 1004
552 Ga0157373_10406961 3300013100 Bacteria 976
553 Ga0157373_10408188 3300013100 Bacteria 974
554 Ga0157373_10752409 3300013100 Bacteria 716
555 Ga0157373_11223534 3300013100 Bacteria 567
556 Ga0157371_10027559 3300013102 Bacteria 4121
557 Ga0157371_10045505 3300013102 Bacteria 3123
558 Ga0157371_10126340 3300013102 Bacteria 1819
559 Ga0157371_10669992 3300013102 Bacteria 775
560 Ga0157371_11120168 3300013102 Bacteria 604
561 Ga0157370_10002107 3300013104 Bacteria 24312
562 Ga0157370_10037341 3300013104 Bacteria 4709
563 Ga0157370_10395335 3300013104 Bacteria 1273
564 Ga0157370_10411952 3300013104 Bacteria 1244
565 Ga0157370_10415913 3300013104 Bacteria 1237
566 Ga0157370_10457591 3300013104 Bacteria 1173
567 Ga0157370_10563423 3300013104 Bacteria 1044
568 Ga0157370_10599228 3300013104 Bacteria 1009
569 Ga0157370_11386059 3300013104 Bacteria 633
570 Ga0157370_11979282 3300013104 Bacteria 522
571 Ga0157370_12078253 3300013104 Bacteria 509
572 Ga0157369_10000833 3300013105 Bacteria 39452
573 Ga0157369_10002370 3300013105 Bacteria 22641
574 Ga0157369_10005676 3300013105 Bacteria 14502
575 Ga0157369_10023976 3300013105 Bacteria 6789
576 Ga0157369_10160855 3300013105 Bacteria 2370
577 Ga0157369_10261890 3300013105 Bacteria 1803
578 Ga0157369_10288736 3300013105 Bacteria 1708
579 Ga0157369_10379018 3300013105 Bacteria 1468
580 Ga0157369_10401582 3300013105 Unclassified 1422
581 Ga0157369_10560956 3300013105 Bacteria 1180
582 Ga0157369_10622649 3300013105 Bacteria 1114
583 Ga0157369_10877771 3300013105 Bacteria 920
584 Ga0157369_10934271 3300013105 Bacteria 889
585 Ga0157369_11930034 3300013105 Bacteria 599
586 Ga0157374_10083974 3300013296 Bacteria 3026
587 Ga0157374_10184723 3300013296 Bacteria 2038
588 Ga0157374_11741176 3300013296 Bacteria 648
589 Ga0157378_10079970 3300013297 Bacteria 2952
590 Ga0157378_10277844 3300013297 Bacteria 1613
591 Ga0157378_10550272 3300013297 Bacteria 1159
592 Ga0157378_13186711 3300013297 Bacteria 510
593 Ga0163162_10080600 3300013306 Bacteria 3323
594 Ga0163162_10245634 3300013306 Bacteria 1922
595 Ga0163162_10267966 3300013306 Bacteria 1839
596 Ga0163162_10604084 3300013306 Bacteria 1223
597 Ga0163162_10788502 3300013306 Bacteria 1068
598 Ga0163162_10854465 3300013306 Bacteria 1025
599 Ga0163162_11038897 3300013306 Bacteria 927
600 Ga0163162_11670708 3300013306 Bacteria 727
601 Ga0157372_10157109 3300013307 Bacteria 2627
602 Ga0157372_10637849 3300013307 Bacteria 1241
603 Ga0157372_10649167 3300013307 Bacteria 1229
604 Ga0157372_10868332 3300013307 Bacteria 1047
605 Ga0157372_10922764 3300013307 Bacteria 1013
606 Ga0157372_11089751 3300013307 Bacteria 924
607 Ga0157375_10427538 3300013308 Bacteria 1490
608 Ga0157375_10606942 3300013308 Bacteria 1253
609 Ga0157375_10737323 3300013308 Bacteria 1137
610 Ga0157375_12366502 3300013308 Bacteria 634
611 Ga0157375_12532656 3300013308 Bacteria 613
612 Ga0157375_13045609 3300013308 Bacteria 559
613 Ga0163163_10128874 3300014325 Bacteria 2569
614 Ga0163163_10188131 3300014325 Bacteria 2113
615 Ga0163163_10991935 3300014325 Bacteria 903
616 Ga0157380_10000280 3300014326 Bacteria 30637
617 Ga0157380_10000287 3300014326 Bacteria 30220
618 Ga0157380_10001415 3300014326 Bacteria 15694
619 Ga0157380_10003876 3300014326 Bacteria 10317
620 Ga0157380_10008397 3300014326 Bacteria 7369
621 Ga0157380_10073817 3300014326 Bacteria 2767
622 Ga0157380_10103919 3300014326 Bacteria 2371
623 Ga0157380_10548471 3300014326 Bacteria 1133
624 Ga0157380_13525983 3300014326 Bacteria 501
625 Ga0182008_10788773 3300014497 Bacteria 550
626 Ga0157377_10172942 3300014745 Bacteria 1352
627 Ga0157377_10215324 3300014745 Bacteria 1227
628 Ga0157379_10160772 3300014968 Bacteria 2027
629 Ga0157379_10283392 3300014968 Bacteria 1508
630 Ga0183363_1001 3300015690 Bacteria 611534
631 Ga0163161_10002791 3300017792 Bacteria 12382
632 Ga0163161_10051052 3300017792 Bacteria 2995
633 Ga0163161_10451042 3300017792 Bacteria 1040
634 Ga0163161_10677483 3300017792 Bacteria 857
635 Ga0163161_11000349 3300017792 Bacteria 714
636 Ga0163161_11504673 3300017792 Bacteria 591
637 Ga0197907_10371562 3300020069 Bacteria 552
638 Ga0197907_10636746 3300020069 Bacteria 734
639 Ga0197907_10789011 3300020069 Bacteria 798
640 Ga0197907_11433208 3300020069 Bacteria 833
641 Ga0197907_11463038 3300020069 Bacteria 1106
642 Ga0206356_10232349 3300020070 Bacteria 598
643 Ga0206356_11392980 3300020070 Bacteria 612
644 Ga0206349_1471077 3300020075 Bacteria 500
645 Ga0206349_1612579 3300020075 Bacteria 504
646 Ga0206349_1633633 3300020075 Bacteria 746
647 Ga0206355_1042636 3300020076 Bacteria 924
648 Ga0206355_1322866 3300020076 Bacteria 713
649 Ga0206355_1569335 3300020076 Bacteria 1263
650 Ga0206351_10176166 3300020077 Bacteria 553
651 Ga0206352_11327376 3300020078 Unclassified 610
652 Ga0206350_10216588 3300020080 Bacteria 557
653 Ga0206350_10528454 3300020080 Bacteria 864
654 Ga0206354_10799011 3300020081 Bacteria 549
655 Ga0206354_10900097 3300020081 Bacteria 510
656 Ga0206354_10916235 3300020081 Bacteria 607
657 Ga0206354_11225530 3300020081 Bacteria 550
658 Ga0206354_11251771 3300020081 Bacteria 503
659 Ga0206354_11323271 3300020081 Bacteria 823
660 Ga0206353_10888205 3300020082 Bacteria 702
661 Ga0206353_11404047 3300020082 Unclassified 594
662 Ga0206353_11643594 3300020082 Bacteria 529
663 Ga0206353_11883278 3300020082 Bacteria 500
664 Ga0213873_10000009 3300021358 Bacteria 237102
665 Ga0213873_10325015 3300021358 Bacteria 501
666 Ga0213872_10071737 3300021361 Bacteria 1561
667 Ga0213872_10188882 3300021361 Bacteria 887
668 Ga0213874_10246781 3300021377 Bacteria 657
669 Ga0213876_10000004 3300021384 Bacteria 943822
670 Ga0213876_10004806 3300021384 Bacteria 7495
671 Ga0213876_10012151 3300021384 Bacteria 4587
672 Ga0213876_10105760 3300021384 Bacteria 1493
673 Ga0213876_10302052 3300021384 Bacteria 851
674 Ga0213875_10000394 3300021388 Bacteria 38563
675 Ga0213875_10268652 3300021388 Bacteria 805
676 Ga0213871_10011291 3300021441 Bacteria 2048
677 Ga0224712_10198930 3300022467 Bacteria 910
678 Ga0224712_10272885 3300022467 Bacteria 786
679 Ga0224712_10351621 3300022467 Bacteria 696
680 Ga0224712_10652851 3300022467 Bacteria 516
681 Ga0207672_1001090 3300025223 Bacteria 2460
682 Ga0207672_1005545 3300025223 Bacteria 721
683 Ga0209147_105068 3300025229 Bacteria 2044
684 Ga0207427_119234 3300025231 Bacteria 622
685 Ga0209437_113268 3300025233 Bacteria 1180
686 Ga0209026_1048449 3300025250 Bacteria 607
687 Ga0209233_1000066 3300025261 Bacteria 381218
688 Ga0207666_1040503 3300025271 Bacteria 728
689 Ga0207666_1043211 3300025271 Bacteria 707
690 Ga0209455_1037683 3300025272 Bacteria 759
691 Ga0207673_1034985 3300025290 Bacteria 700
692 Ga0209675_1000833 3300025291 Bacteria 20261
693 Ga0209676_1000070 3300025292 Bacteria 312074
694 Ga0209676_1000236 3300025292 Bacteria 118705
695 Ga0209676_1000296 3300025292 Bacteria 100635
696 Ga0209676_1050598 3300025292 Bacteria 1095
697 Ga0209025_1016016 3300025294 Bacteria 4463
698 Ga0209025_1047301 3300025294 Bacteria 1758
699 Ga0209050_1000132 3300025298 Bacteria 185906
700 Ga0209050_1037474 3300025298 Bacteria 1398
701 Ga0209257_1000250 3300025304 Bacteria 124024
702 Ga0209257_1000517 3300025304 Bacteria 67082
703 Ga0209257_1002076 3300025304 Bacteria 21106
704 Ga0209257_1026973 3300025304 Bacteria 1922
705 Ga0207697_10001194 3300025315 Bacteria 14240
706 Ga0207697_10029183 3300025315 Bacteria 2257
707 Ga0207697_10165297 3300025315 Bacteria 966
708 Ga0207697_10243643 3300025315 Bacteria 795
709 Ga0207656_10089641 3300025321 Bacteria 1394
710 Ga0207656_10157092 3300025321 Bacteria 1080
711 Ga0207656_10165581 3300025321 Bacteria 1054
712 Ga0207656_10166623 3300025321 Bacteria 1051
713 Ga0207696_1143538 3300025711 Bacteria 639
714 Ga0207713_1002993 3300025735 Bacteria 11810
715 Ga0207713_1041068 3300025735 Bacteria 1933
716 Ga0207682_10001410 3300025893 Bacteria 11107
717 Ga0207682_10090862 3300025893 Bacteria 1323
718 Ga0207682_10114856 3300025893 Bacteria 1188
719 Ga0207710_10029536 3300025900 Bacteria 2386
720 Ga0207710_10095048 3300025900 Bacteria 1400
721 Ga0207688_10022901 3300025901 Bacteria 3419
722 Ga0207688_10035051 3300025901 Bacteria 2780
723 Ga0207688_10290983 3300025901 Bacteria 997
724 Ga0207680_10000004 3300025903 Bacteria 827324
725 Ga0207680_10267408 3300025903 Bacteria 1185
726 Ga0207680_10634105 3300025903 Bacteria 765
727 Ga0207647_10000376 3300025904 Bacteria 36290
728 Ga0207647_10069037 3300025904 Bacteria 2137
729 Ga0207647_10085390 3300025904 Bacteria 1888
730 Ga0207647_10419225 3300025904 Bacteria 753
731 Ga0207647_10589405 3300025904 Bacteria 614
732 Ga0207699_11124315 3300025906 Bacteria 582
733 Ga0207645_10003349 3300025907 Bacteria 12219
734 Ga0207645_10007869 3300025907 Bacteria 7496
735 Ga0207645_10056219 3300025907 Bacteria 2512
736 Ga0207645_10315192 3300025907 Bacteria 1043
737 Ga0207643_10123878 3300025908 Bacteria 1533
738 Ga0207643_10313556 3300025908 Bacteria 978
739 Ga0207705_10000002 3300025909 Bacteria 2046852
740 Ga0207705_10002599 3300025909 Bacteria 13873
741 Ga0207705_10043461 3300025909 Bacteria 3228
742 Ga0207705_10452377 3300025909 Bacteria 996
743 Ga0207705_10463279 3300025909 Bacteria 983
744 Ga0207705_10926773 3300025909 Bacteria 674
745 Ga0207684_11207438 3300025910 Bacteria 626
746 Ga0207654_10002603 3300025911 Bacteria 9152
747 Ga0207654_10032763 3300025911 Bacteria 2875
748 Ga0207654_10875114 3300025911 Bacteria 651
749 Ga0207654_10941192 3300025911 Bacteria 627
750 Ga0207707_10206991 3300025912 Bacteria 1710
751 Ga0207707_10276059 3300025912 Bacteria 1456
752 Ga0207707_10376581 3300025912 Bacteria 1221
753 Ga0207707_10439424 3300025912 Bacteria 1117
754 Ga0207707_11049544 3300025912 Bacteria 666
755 Ga0207695_10012776 3300025913 Bacteria 10055
756 Ga0207695_10015462 3300025913 Bacteria 8984
757 Ga0207695_10017424 3300025913 Bacteria 8360
758 Ga0207695_10027914 3300025913 Bacteria 6274
759 Ga0207695_10058321 3300025913 Bacteria 4008
760 Ga0207695_10095536 3300025913 Bacteria 2976
761 Ga0207695_10499395 3300025913 Bacteria 1099
762 Ga0207695_10636433 3300025913 Bacteria 948
763 Ga0207695_10912089 3300025913 Bacteria 758
764 Ga0207671_10001907 3300025914 Bacteria 23137
765 Ga0207671_10027831 3300025914 Bacteria 4226
766 Ga0207671_10035937 3300025914 Bacteria 3674
767 Ga0207671_10259591 3300025914 Bacteria 1367
768 Ga0207671_10729917 3300025914 Bacteria 787
769 Ga0207671_11064615 3300025914 Bacteria 636
770 Ga0207660_10000730 3300025917 Bacteria 21859
771 Ga0207660_10454896 3300025917 Bacteria 1036
772 Ga0207660_10505044 3300025917 Bacteria 981
773 Ga0207662_10097273 3300025918 Bacteria 1819
774 Ga0207662_11208081 3300025918 Bacteria 537
775 Ga0207657_10000763 3300025919 Bacteria 34137
776 Ga0207657_10003354 3300025919 Bacteria 17131
777 Ga0207657_10011736 3300025919 Bacteria 8679
778 Ga0207657_10029902 3300025919 Bacteria 4951
779 Ga0207657_10033116 3300025919 Bacteria 4662
780 Ga0207657_10378106 3300025919 Bacteria 1116
781 Ga0207649_10000536 3300025920 Bacteria 26302
782 Ga0207649_10160061 3300025920 Bacteria 1559
783 Ga0207649_10184895 3300025920 Bacteria 1461
784 Ga0207649_10485630 3300025920 Bacteria 937
785 Ga0207649_10608622 3300025920 Bacteria 841
786 Ga0207649_11245497 3300025920 Bacteria 588
787 Ga0207652_10000042 3300025921 Bacteria 130485
788 Ga0207652_10041079 3300025921 Bacteria 3930
789 Ga0207652_10395581 3300025921 Bacteria 1247
790 Ga0207652_10561506 3300025921 Bacteria 1025
791 Ga0207652_10901012 3300025921 Bacteria 781
792 Ga0207681_10000001 3300025923 Bacteria 1105841
793 Ga0207681_10000130 3300025923 Bacteria 61067
794 Ga0207681_10001009 3300025923 Bacteria 18362
795 Ga0207681_10021225 3300025923 Bacteria 4125
796 Ga0207681_10059518 3300025923 Bacteria 2619
797 Ga0207681_10146486 3300025923 Bacteria 1765
798 Ga0207681_10182921 3300025923 Bacteria 1598
799 Ga0207681_10249388 3300025923 Bacteria 1385
800 Ga0207681_10391942 3300025923 Bacteria 1120
801 Ga0207681_10510291 3300025923 Bacteria 985
802 Ga0207681_10532161 3300025923 Bacteria 965
803 Ga0207681_10623207 3300025923 Bacteria 893
804 Ga0207681_10698801 3300025923 Bacteria 843
805 Ga0207694_10003700 3300025924 Bacteria 12110
806 Ga0207694_10037001 3300025924 Bacteria 3746
807 Ga0207694_10061168 3300025924 Bacteria 2931
808 Ga0207694_10062325 3300025924 Bacteria 2904
809 Ga0207694_10125700 3300025924 Bacteria 2051
810 Ga0207694_10215878 3300025924 Bacteria 1563
811 Ga0207694_10223696 3300025924 Bacteria 1536
812 Ga0207694_10400438 3300025924 Bacteria 1141
813 Ga0207694_10612031 3300025924 Bacteria 916
814 Ga0207694_10784808 3300025924 Unclassified 805
815 Ga0207694_10798891 3300025924 Bacteria 797
816 Ga0207694_10895931 3300025924 Bacteria 750
817 Ga0207694_11622580 3300025924 Bacteria 545
818 Ga0207650_10000018 3300025925 Bacteria 352120
819 Ga0207650_10000196 3300025925 Bacteria 69604
820 Ga0207650_10002118 3300025925 Bacteria 13867
821 Ga0207650_10005659 3300025925 Bacteria 8534
822 Ga0207650_10022534 3300025925 Bacteria 4458
823 Ga0207650_10028323 3300025925 Bacteria 4016
824 Ga0207650_10067278 3300025925 Bacteria 2688
825 Ga0207650_10076428 3300025925 Bacteria 2530
826 Ga0207650_10101939 3300025925 Bacteria 2211
827 Ga0207650_10429505 3300025925 Bacteria 1097
828 Ga0207650_11130728 3300025925 Bacteria 667
829 Ga0207659_10003573 3300025926 Bacteria 9362
830 Ga0207659_10276532 3300025926 Bacteria 1371
831 Ga0207659_10621112 3300025926 Bacteria 922
832 Ga0207659_10766559 3300025926 Bacteria 828
833 Ga0207687_10004338 3300025927 Bacteria 9468
834 Ga0207700_10038154 3300025928 Bacteria 3485
835 Ga0207700_10196533 3300025928 Bacteria 1697
836 Ga0207664_10023835 3300025929 Bacteria 4592
837 Ga0207664_10066816 3300025929 Bacteria 2884
838 Ga0207644_10000029 3300025931 Bacteria 139264
839 Ga0207644_10000096 3300025931 Bacteria 63618
840 Ga0207644_10001859 3300025931 Bacteria 13733
841 Ga0207644_10084083 3300025931 Bacteria 2358
842 Ga0207644_10550954 3300025931 Bacteria 954
843 Ga0207690_10003860 3300025932 Bacteria 8859
844 Ga0207690_10022506 3300025932 Bacteria 3923
845 Ga0207690_10174914 3300025932 Bacteria 1611
846 Ga0207690_10178970 3300025932 Bacteria 1595
847 Ga0207690_10184819 3300025932 Bacteria 1572
848 Ga0207690_10246785 3300025932 Bacteria 1377
849 Ga0207690_10485371 3300025932 Bacteria 998
850 Ga0207690_10941878 3300025932 Bacteria 717
851 Ga0207690_11053117 3300025932 Bacteria 677
852 Ga0207690_11221328 3300025932 Bacteria 628
853 Ga0207706_10000401 3300025933 Bacteria 46630
854 Ga0207706_10005540 3300025933 Bacteria 11774
855 Ga0207706_10030894 3300025933 Bacteria 4776
856 Ga0207706_10101549 3300025933 Bacteria 2531
857 Ga0207706_10162322 3300025933 Bacteria 1964
858 Ga0207706_10463068 3300025933 Bacteria 1096
859 Ga0207706_10679394 3300025933 Bacteria 880
860 Ga0207706_10760624 3300025933 Bacteria 825
861 Ga0207706_11436647 3300025933 Bacteria 565
862 Ga0207709_10444855 3300025935 Bacteria 1000
863 Ga0207670_10034886 3300025936 Bacteria 3257
864 Ga0207670_10550434 3300025936 Bacteria 943
865 Ga0207669_10018828 3300025937 Bacteria 3580
866 Ga0207669_10535697 3300025937 Bacteria 942
867 Ga0207669_11886905 3300025937 Bacteria 511
868 Ga0207704_10099860 3300025938 Bacteria 1931
869 Ga0207704_10468528 3300025938 Bacteria 1009
870 Ga0207691_10005155 3300025940 Bacteria 12620
871 Ga0207691_10007278 3300025940 Bacteria 10676
872 Ga0207691_10184786 3300025940 Bacteria 1820
873 Ga0207691_10206199 3300025940 Bacteria 1709
874 Ga0207691_11054826 3300025940 Bacteria 677
875 Ga0207711_10000031 3300025941 Bacteria 203323
876 Ga0207711_10004033 3300025941 Bacteria 12603
877 Ga0207711_10010695 3300025941 Bacteria 7631
878 Ga0207711_10059741 3300025941 Bacteria 3283
879 Ga0207711_11155258 3300025941 Bacteria 715
880 Ga0207689_10094296 3300025942 Bacteria 2458
881 Ga0207689_10199886 3300025942 Bacteria 1650
882 Ga0207689_10843300 3300025942 Bacteria 773
883 Ga0207661_10081167 3300025944 Unclassified 2678
884 Ga0207661_10128194 3300025944 Bacteria 2170
885 Ga0207661_10705128 3300025944 Bacteria 928
886 Ga0207661_11235048 3300025944 Bacteria 687
887 Ga0207679_10339968 3300025945 Bacteria 1305
888 Ga0207679_10447129 3300025945 Bacteria 1145
889 Ga0207679_10742477 3300025945 Bacteria 892
890 Ga0207679_11450824 3300025945 Bacteria 629
891 Ga0207679_11629854 3300025945 Bacteria 591
892 Ga0207679_11759717 3300025945 Bacteria 567
893 Ga0207679_11761720 3300025945 Bacteria 566
894 Ga0207667_10036815 3300025949 Bacteria 5239
895 Ga0207667_10085889 3300025949 Bacteria 3257
896 Ga0207667_10096186 3300025949 Bacteria 3056
897 Ga0207667_10134292 3300025949 Bacteria 2548
898 Ga0207667_10357577 3300025949 Bacteria 1489
899 Ga0207667_10434364 3300025949 Bacteria 1335
900 Ga0207667_10643427 3300025949 Bacteria 1066
901 Ga0207667_11330468 3300025949 Bacteria 694
902 Ga0207667_11358599 3300025949 Bacteria 685
903 Ga0207651_10001720 3300025960 Bacteria 10112
904 Ga0207651_10038906 3300025960 Bacteria 3130
905 Ga0207651_10386437 3300025960 Bacteria 1187
906 Ga0207651_10914535 3300025960 Bacteria 782
907 Ga0207712_10000001 3300025961 Bacteria 750309
908 Ga0207712_10000550 3300025961 Bacteria 30264
909 Ga0207712_10015962 3300025961 Bacteria 4854
910 Ga0207712_10211097 3300025961 Bacteria 1546
911 Ga0207712_10235082 3300025961 Bacteria 1473
912 Ga0207712_10315862 3300025961 Bacteria 1287
913 Ga0207712_10351104 3300025961 Bacteria 1226
914 Ga0207712_10381660 3300025961 Bacteria 1180
915 Ga0207712_11277930 3300025961 Bacteria 656
916 Ga0207668_10000008 3300025972 Bacteria 189904
917 Ga0207668_10000021 3300025972 Bacteria 137592
918 Ga0207668_10000624 3300025972 Bacteria 21955
919 Ga0207668_10002999 3300025972 Bacteria 9892
920 Ga0207668_10004145 3300025972 Bacteria 8504
921 Ga0207668_10062560 3300025972 Bacteria 2621
922 Ga0207668_10080343 3300025972 Bacteria 2362
923 Ga0207668_10082031 3300025972 Bacteria 2341
924 Ga0207668_10087733 3300025972 Bacteria 2276
925 Ga0207668_10190011 3300025972 Bacteria 1627
926 Ga0207668_10316001 3300025972 Bacteria 1294
927 Ga0207668_10356715 3300025972 Bacteria 1224
928 Ga0207668_10906976 3300025972 Bacteria 784
929 Ga0207668_11041062 3300025972 Bacteria 732
930 Ga0207668_11138021 3300025972 Bacteria 700
931 Ga0207668_11275072 3300025972 Bacteria 661
932 Ga0207640_10000560 3300025981 Bacteria 22254
933 Ga0207640_10014052 3300025981 Bacteria 4601
934 Ga0207640_10031495 3300025981 Bacteria 3277
935 Ga0207640_10083055 3300025981 Bacteria 2195
936 Ga0207640_10140789 3300025981 Bacteria 1758
937 Ga0207640_10174590 3300025981 Bacteria 1605
938 Ga0207640_10199803 3300025981 Bacteria 1514
939 Ga0207640_10203333 3300025981 Bacteria 1503
940 Ga0207640_11002240 3300025981 Bacteria 735
941 Ga0207640_11662959 3300025981 Bacteria 576
942 Ga0207640_11785253 3300025981 Bacteria 556
943 Ga0207658_10000002 3300025986 Bacteria 1364188
944 Ga0207658_10001041 3300025986 Bacteria 22533
945 Ga0207658_10003252 3300025986 Bacteria 11550
946 Ga0207658_10003274 3300025986 Bacteria 11501
947 Ga0207658_10013577 3300025986 Bacteria 5570
948 Ga0207658_10023418 3300025986 Bacteria 4310
949 Ga0207658_10219927 3300025986 Bacteria 1597
950 Ga0207658_10535682 3300025986 Bacteria 1046
951 Ga0207658_11510205 3300025986 Bacteria 614
952 Ga0207703_10000564 3300026035 Bacteria 38136
953 Ga0207703_10000572 3300026035 Bacteria 37665
954 Ga0207703_10005970 3300026035 Bacteria 9756
955 Ga0207703_10162538 3300026035 Bacteria 1957
956 Ga0207703_10709461 3300026035 Bacteria 957
957 Ga0207639_10003713 3300026041 Bacteria 10272
958 Ga0207639_10006054 3300026041 Bacteria 8208
959 Ga0207639_10043787 3300026041 Bacteria 3362
960 Ga0207639_10074549 3300026041 Bacteria 2665
961 Ga0207639_10313533 3300026041 Bacteria 1390
962 Ga0207639_10531088 3300026041 Bacteria 1078
963 Ga0207639_10538214 3300026041 Bacteria 1071
964 Ga0207639_11486241 3300026041 Bacteria 636
965 Ga0207678_10003288 3300026067 Bacteria 14580
966 Ga0207678_10024245 3300026067 Bacteria 5299
967 Ga0207678_10082416 3300026067 Bacteria 2752
968 Ga0207678_10460838 3300026067 Bacteria 1106
969 Ga0207678_10462484 3300026067 Bacteria 1104
970 Ga0207678_10642136 3300026067 Bacteria 932
971 Ga0207678_10801633 3300026067 Bacteria 831
972 Ga0207678_11096053 3300026067 Bacteria 705
973 Ga0207708_10090171 3300026075 Bacteria 2363
974 Ga0207702_10003840 3300026078 Bacteria 13552
975 Ga0207702_10005198 3300026078 Bacteria 11437
976 Ga0207702_10039424 3300026078 Bacteria 3957
977 Ga0207702_10045584 3300026078 Bacteria 3688
978 Ga0207702_11709218 3300026078 Bacteria 622
979 Ga0207641_10000001 3300026088 Bacteria 1180841
980 Ga0207641_10000002 3300026088 Bacteria 981004
981 Ga0207641_10000033 3300026088 Bacteria 219261
982 Ga0207641_10000339 3300026088 Bacteria 56902
983 Ga0207641_10001579 3300026088 Bacteria 22244
984 Ga0207641_10015149 3300026088 Bacteria 6318
985 Ga0207641_11073703 3300026088 Bacteria 803
986 Ga0207641_12068434 3300026088 Bacteria 570
987 Ga0207648_10001456 3300026089 Bacteria 26049
988 Ga0207648_10014544 3300026089 Bacteria 7267
989 Ga0207648_10036654 3300026089 Bacteria 4320
990 Ga0207648_12262152 3300026089 Bacteria 504
991 Ga0207676_10000004 3300026095 Bacteria 725417
992 Ga0207676_10000005 3300026095 Bacteria 698744
993 Ga0207676_10002304 3300026095 Bacteria 13699
994 Ga0207676_10005071 3300026095 Bacteria 9321
995 Ga0207676_10052804 3300026095 Bacteria 3179
996 Ga0207676_10722984 3300026095 Bacteria 966
997 Ga0207674_10005417 3300026116 Bacteria 15165
998 Ga0207674_10014991 3300026116 Bacteria 8538
999 Ga0207674_10022369 3300026116 Bacteria 6789
1000 Ga0207674_10024479 3300026116 Bacteria 6451
1001 Ga0207674_10030327 3300026116 Bacteria 5686
1002 Ga0207674_10201680 3300026116 Bacteria 1939
1003 Ga0207674_10355806 3300026116 Bacteria 1416
1004 Ga0207674_10545106 3300026116 Bacteria 1120
1005 Ga0207674_11680794 3300026116 Bacteria 603
1006 Ga0207675_100000020 3300026118 Bacteria 117374
1007 Ga0207675_100000119 3300026118 Bacteria 64605
1008 Ga0207675_100003055 3300026118 Bacteria 16418
1009 Ga0207675_100004282 3300026118 Bacteria 13797
1010 Ga0207675_100708945 3300026118 Bacteria 1016
1011 Ga0207675_101115614 3300026118 Bacteria 809
1012 Ga0207675_101408004 3300026118 Bacteria 718
1013 Ga0207683_10007786 3300026121 Bacteria 9168
1014 Ga0207683_10321678 3300026121 Bacteria 1417
1015 Ga0207683_11156329 3300026121 Bacteria 717
1016 Ga0207698_10003570 3300026142 Bacteria 9386
1017 Ga0207698_10009383 3300026142 Bacteria 6237
1018 Ga0207698_10055488 3300026142 Bacteria 3054
1019 Ga0207698_10077791 3300026142 Bacteria 2661
1020 Ga0207698_10113585 3300026142 Bacteria 2276
1021 Ga0207698_10118457 3300026142 Bacteria 2236
1022 Ga0207698_10134761 3300026142 Bacteria 2117
1023 Ga0207698_10281234 3300026142 Bacteria 1539
1024 Ga0207698_10399368 3300026142 Bacteria 1313
1025 Ga0207698_10767939 3300026142 Bacteria 964
1026 Ga0207698_10972598 3300026142 Bacteria 859
1027 Ga0207698_11122319 3300026142 Bacteria 799
1028 Ga0209973_1058083 3300027252 Bacteria 592
1029 Ga0209967_1027913 3300027364 Bacteria 840
1030 Ga0209984_1062255 3300027424 Bacteria 553
1031 Ga0210000_1018670 3300027462 Bacteria 1054
1032 Ga0209982_1038949 3300027552 Bacteria 756
1033 Ga0209970_1010809 3300027614 Bacteria 1496
1034 Ga0209970_1104397 3300027614 Bacteria 543
1035 Ga0210002_1033102 3300027617 Bacteria 864
1036 Ga0209983_1025530 3300027665 Bacteria 1246
1037 Ga0209983_1075880 3300027665 Bacteria 751
1038 Ga0209998_10023105 3300027717 Bacteria 1343
1039 Ga0209813_10000035 3300027866 Bacteria 58691
1040 Ga0209974_10022979 3300027876 Bacteria 2064
1041 Ga0209974_10032661 3300027876 Bacteria 1725
1042 Ga0209974_10041640 3300027876 Bacteria 1529
1043 Ga0209974_10302553 3300027876 Bacteria 612
1044 Ga0209974_10380993 3300027876 Bacteria 551
1045 Ga0207428_10111455 3300027907 Bacteria 2105
1046 Ga0207428_10185644 3300027907 Bacteria 1569
1047 Ga0207428_10985896 3300027907 Bacteria 593
1048 Ga0268266_10000028 3300028379 Bacteria 425294
1049 Ga0268266_10039582 3300028379 Bacteria 4016
1050 Ga0268266_10192573 3300028379 Bacteria 1862
1051 Ga0268266_10445783 3300028379 Bacteria 1230
1052 Ga0268265_10000002 3300028380 Bacteria 1035381
1053 Ga0268265_10000003 3300028380 Bacteria 949201
1054 Ga0268265_10000524 3300028380 Bacteria 39127
1055 Ga0268265_10006450 3300028380 Bacteria 7954
1056 Ga0268265_10010863 3300028380 Bacteria 6150
1057 Ga0268265_10012136 3300028380 Bacteria 5833
1058 Ga0268265_10057726 3300028380 Bacteria 2960
1059 Ga0268265_10178086 3300028380 Bacteria 1824
1060 Ga0268265_10235511 3300028380 Bacteria 1612
1061 Ga0268265_11325652 3300028380 Bacteria 720
1062 Ga0268265_12100627 3300028380 Bacteria 572
1063 Ga0268265_12231601 3300028380 Bacteria 554
1064 Ga0268264_10000001 3300028381 Bacteria 1221000
1065 Ga0268264_10000006 3300028381 Bacteria 827324
1066 Ga0268264_10005384 3300028381 Bacteria 10835
1067 Ga0268264_10007580 3300028381 Bacteria 9051
1068 Ga0265338_10011755 3300028800 Bacteria 10068
1069 Ga0265338_10543080 3300028800 Bacteria 814
1070 Ga0316183_1215396 3300030742 Bacteria 726
1071 Ga0316182_1197276 3300030745 Bacteria 1155
1072 Ga0316182_1271905 3300030745 Bacteria 714
1073 Ga0265762_1029412 3300030760 Bacteria 1039
1074 Ga0265764_113426 3300030882 Bacteria 547
1075 Ga0265768_117228 3300030963 Bacteria 512
1076 Ga0265331_10012351 3300031250 Bacteria 4629
1077 Ga0265316_10135723 3300031344 Bacteria 1851
1078 Ga0307513_10562316 3300031456 Bacteria 852
1079 Ga0307408_100016833 3300031548 Bacteria 4886
1080 Ga0307408_100053905 3300031548 Bacteria 2906
1081 Ga0307408_100065510 3300031548 Bacteria 2664
1082 Ga0307408_100074863 3300031548 Bacteria 2514
1083 Ga0307408_100085330 3300031548 Bacteria 2371
1084 Ga0307408_100088017 3300031548 Bacteria 2338
1085 Ga0307408_100102881 3300031548 Bacteria 2179
1086 Ga0307408_100110730 3300031548 Bacteria 2109
1087 Ga0307408_100196118 3300031548 Bacteria 1631
1088 Ga0307408_100215463 3300031548 Bacteria 1563
1089 Ga0307408_100216422 3300031548 Bacteria 1560
1090 Ga0307408_100222919 3300031548 Bacteria 1539
1091 Ga0307408_100290812 3300031548 Bacteria 1364
1092 Ga0307408_100453784 3300031548 Bacteria 1112
1093 Ga0307408_100607454 3300031548 Bacteria 973
1094 Ga0307408_100632948 3300031548 Bacteria 954
1095 Ga0307408_100881694 3300031548 Bacteria 818
1096 Ga0307408_100973782 3300031548 Bacteria 780
1097 Ga0307408_102002464 3300031548 Bacteria 557
1098 Ga0307408_102436768 3300031548 Bacteria 508
1099 Ga0307508_10007262 3300031616 Bacteria 10318
1100 Ga0316575_10555492 3300031665 Bacteria 501
1101 Ga0316576_10215189 3300031727 Unclassified 1446
1102 Ga0307405_10000836 3300031731 Bacteria 12118
1103 Ga0307405_10007251 3300031731 Bacteria 5527
1104 Ga0307405_10030541 3300031731 Bacteria 3161
1105 Ga0307405_10104357 3300031731 Bacteria 1907
1106 Ga0307405_10181360 3300031731 Bacteria 1512
1107 Ga0307405_10209585 3300031731 Bacteria 1421
1108 Ga0307405_10228251 3300031731 Bacteria 1371
1109 Ga0307405_10268331 3300031731 Bacteria 1278
1110 Ga0307405_10287764 3300031731 Bacteria 1240
1111 Ga0307405_10357047 3300031731 Bacteria 1129
1112 Ga0307405_10363716 3300031731 Bacteria 1120
1113 Ga0307405_10472303 3300031731 Bacteria 999
1114 Ga0307405_10546535 3300031731 Bacteria 936
1115 Ga0307405_10559912 3300031731 Bacteria 926
1116 Ga0307405_10721799 3300031731 Bacteria 827
1117 Ga0307405_10776358 3300031731 Bacteria 800
1118 Ga0307405_11047534 3300031731 Bacteria 698
1119 Ga0307405_11177529 3300031731 Bacteria 662
1120 Ga0316577_10661546 3300031733 Bacteria 594
1121 Ga0307413_10004092 3300031824 Bacteria 6276
1122 Ga0307413_10007986 3300031824 Bacteria 4959
1123 Ga0307413_10016308 3300031824 Bacteria 3834
1124 Ga0307413_10022312 3300031824 Bacteria 3409
1125 Ga0307413_10028267 3300031824 Bacteria 3120
1126 Ga0307413_10043841 3300031824 Bacteria 2639
1127 Ga0307413_10054417 3300031824 Bacteria 2428
1128 Ga0307413_10067270 3300031824 Bacteria 2239
1129 Ga0307413_10067955 3300031824 Bacteria 2230
1130 Ga0307413_10073499 3300031824 Bacteria 2161
1131 Ga0307413_10102822 3300031824 Bacteria 1892
1132 Ga0307413_10309016 3300031824 Bacteria 1202
1133 Ga0307413_10314035 3300031824 Bacteria 1194
1134 Ga0307413_10325735 3300031824 Bacteria 1175
1135 Ga0307413_10393473 3300031824 Bacteria 1083
1136 Ga0307413_10571520 3300031824 Bacteria 920
1137 Ga0307413_10680180 3300031824 Bacteria 852
1138 Ga0307413_10689220 3300031824 Bacteria 847
1139 Ga0307410_10004200 3300031852 Bacteria 7400
1140 Ga0307410_10013509 3300031852 Bacteria 4767
1141 Ga0307410_10017442 3300031852 Bacteria 4312
1142 Ga0307410_10022803 3300031852 Bacteria 3877
1143 Ga0307410_10026784 3300031852 Bacteria 3634
1144 Ga0307410_10052189 3300031852 Bacteria 2760
1145 Ga0307410_10097012 3300031852 Bacteria 2105
1146 Ga0307410_10145359 3300031852 Bacteria 1759
1147 Ga0307410_10160589 3300031852 Bacteria 1683
1148 Ga0307410_10176673 3300031852 Bacteria 1613
1149 Ga0307410_10178160 3300031852 Bacteria 1607
1150 Ga0307410_10230238 3300031852 Bacteria 1430
1151 Ga0307410_10232731 3300031852 Bacteria 1423
1152 Ga0307410_10266737 3300031852 Bacteria 1337
1153 Ga0307410_10513675 3300031852 Bacteria 987
1154 Ga0307410_11422098 3300031852 Bacteria 609
1155 Ga0307410_11581458 3300031852 Bacteria 579
1156 Ga0307410_11880338 3300031852 Bacteria 533
1157 Ga0307406_10002316 3300031901 Bacteria 10342
1158 Ga0307406_10029352 3300031901 Bacteria 3330
1159 Ga0307406_10044981 3300031901 Bacteria 2769
1160 Ga0307406_10063519 3300031901 Bacteria 2392
1161 Ga0307406_10082890 3300031901 Bacteria 2137
1162 Ga0307406_10110661 3300031901 Bacteria 1890
1163 Ga0307406_10110905 3300031901 Bacteria 1888
1164 Ga0307406_10118490 3300031901 Bacteria 1836
1165 Ga0307406_10189468 3300031901 Bacteria 1504
1166 Ga0307406_10194998 3300031901 Bacteria 1486
1167 Ga0307406_10251002 3300031901 Bacteria 1333
1168 Ga0307406_10291493 3300031901 Bacteria 1249
1169 Ga0307406_10456672 3300031901 Bacteria 1026
1170 Ga0307406_10682901 3300031901 Bacteria 855
1171 Ga0307406_10833860 3300031901 Bacteria 780
1172 Ga0307407_10001288 3300031903 Bacteria 8956
1173 Ga0307407_10010206 3300031903 Bacteria 4417
1174 Ga0307407_10013593 3300031903 Bacteria 3956
1175 Ga0307407_10017136 3300031903 Bacteria 3626
1176 Ga0307407_10023847 3300031903 Bacteria 3198
1177 Ga0307407_10041166 3300031903 Bacteria 2581
1178 Ga0307407_10054398 3300031903 Bacteria 2308
1179 Ga0307407_10099952 3300031903 Bacteria 1798
1180 Ga0307407_10121095 3300031903 Bacteria 1659
1181 Ga0307407_10124814 3300031903 Bacteria 1638
1182 Ga0307407_10340621 3300031903 Bacteria 1058
1183 Ga0307407_10361126 3300031903 Bacteria 1031
1184 Ga0307407_10725638 3300031903 Bacteria 750
1185 Ga0307407_10855696 3300031903 Bacteria 695
1186 Ga0307407_10951155 3300031903 Bacteria 661
1187 Ga0307412_10002969 3300031911 Bacteria 9411
1188 Ga0307412_10010772 3300031911 Bacteria 5275
1189 Ga0307412_10011266 3300031911 Bacteria 5173
1190 Ga0307412_10016186 3300031911 Bacteria 4436
1191 Ga0307412_10018552 3300031911 Bacteria 4190
1192 Ga0307412_10053068 3300031911 Bacteria 2686
1193 Ga0307412_10055034 3300031911 Bacteria 2644
1194 Ga0307412_10099710 3300031911 Bacteria 2051
1195 Ga0307412_10166430 3300031911 Bacteria 1644
1196 Ga0307412_10194928 3300031911 Bacteria 1534
1197 Ga0307412_10216595 3300031911 Bacteria 1465
1198 Ga0307412_10219663 3300031911 Bacteria 1456
1199 Ga0307412_10275773 3300031911 Bacteria 1318
1200 Ga0307412_10313203 3300031911 Bacteria 1245
1201 Ga0307412_10369629 3300031911 Bacteria 1157
1202 Ga0307412_10468344 3300031911 Bacteria 1042
1203 Ga0307412_10539900 3300031911 Bacteria 977
1204 Ga0307412_10765969 3300031911 Bacteria 835
1205 Ga0307412_10772969 3300031911 Bacteria 831
1206 Ga0307412_10813936 3300031911 Bacteria 812
1207 Ga0307412_11018619 3300031911 Bacteria 732
1208 Ga0307412_11052856 3300031911 Bacteria 721
1209 Ga0307412_11098731 3300031911 Bacteria 707
1210 Ga0307412_11391942 3300031911 Bacteria 634
1211 Ga0307412_11552718 3300031911 Bacteria 603
1212 Ga0307412_12114205 3300031911 Bacteria 523
1213 Ga0307412_12156228 3300031911 Bacteria 518
1214 Ga0307409_100007579 3300031995 Bacteria 6505
1215 Ga0307409_100028571 3300031995 Bacteria 3975
1216 Ga0307409_100039825 3300031995 Bacteria 3491
1217 Ga0307409_100046658 3300031995 Bacteria 3282
1218 Ga0307409_100055447 3300031995 Bacteria 3060
1219 Ga0307409_100063561 3300031995 Bacteria 2895
1220 Ga0307409_100081330 3300031995 Bacteria 2618
1221 Ga0307409_100105950 3300031995 Bacteria 2345
1222 Ga0307409_100142175 3300031995 Bacteria 2069
1223 Ga0307409_100155841 3300031995 Bacteria 1990
1224 Ga0307409_100223512 3300031995 Bacteria 1701
1225 Ga0307409_100231658 3300031995 Bacteria 1675
1226 Ga0307409_100266485 3300031995 Bacteria 1575
1227 Ga0307409_100284359 3300031995 Bacteria 1530
1228 Ga0307409_100392190 3300031995 Bacteria 1323
1229 Ga0307409_100478103 3300031995 Bacteria 1208
1230 Ga0307409_100497348 3300031995 Bacteria 1186
1231 Ga0307409_100546700 3300031995 Bacteria 1136
1232 Ga0307409_100614039 3300031995 Bacteria 1076
1233 Ga0307409_100812011 3300031995 Bacteria 944
1234 Ga0307409_100881312 3300031995 Bacteria 907
1235 Ga0307409_101229969 3300031995 Bacteria 773
1236 Ga0307409_101953492 3300031995 Bacteria 616
1237 Ga0307409_102508441 3300031995 Bacteria 544
1238 Ga0307416_100006179 3300032002 Bacteria 7470
1239 Ga0307416_100012349 3300032002 Bacteria 5750
1240 Ga0307416_100016125 3300032002 Bacteria 5181
1241 Ga0307416_100066042 3300032002 Bacteria 2976
1242 Ga0307416_100083655 3300032002 Bacteria 2709
1243 Ga0307416_100180123 3300032002 Bacteria 1979
1244 Ga0307416_100183290 3300032002 Bacteria 1965
1245 Ga0307416_100517850 3300032002 Bacteria 1260
1246 Ga0307416_100676047 3300032002 Bacteria 1119
1247 Ga0307416_100746471 3300032002 Bacteria 1071
1248 Ga0307416_100822753 3300032002 Bacteria 1025
1249 Ga0307416_100990204 3300032002 Bacteria 943
1250 Ga0307416_101017113 3300032002 Bacteria 932
1251 Ga0307416_101163670 3300032002 Bacteria 876
1252 Ga0307416_101208719 3300032002 Bacteria 861
1253 Ga0307416_101589215 3300032002 Bacteria 759
1254 Ga0307416_102245799 3300032002 Bacteria 646
1255 Ga0307416_102300467 3300032002 Bacteria 639
1256 Ga0307416_103543880 3300032002 Bacteria 522
1257 Ga0307414_10000422 3300032004 Bacteria 22803
1258 Ga0307414_10001282 3300032004 Bacteria 12971
1259 Ga0307414_10010861 3300032004 Bacteria 5311
1260 Ga0307414_10018635 3300032004 Bacteria 4280
1261 Ga0307414_10020449 3300032004 Bacteria 4126
1262 Ga0307414_10037704 3300032004 Bacteria 3239
1263 Ga0307414_10038761 3300032004 Bacteria 3203
1264 Ga0307414_10045170 3300032004 Bacteria 3015
1265 Ga0307414_10051971 3300032004 Bacteria 2849
1266 Ga0307414_10053687 3300032004 Bacteria 2812
1267 Ga0307414_10072381 3300032004 Bacteria 2489
1268 Ga0307414_10083368 3300032004 Bacteria 2347
1269 Ga0307414_10112156 3300032004 Bacteria 2078
1270 Ga0307414_10113810 3300032004 Bacteria 2066
1271 Ga0307414_10271559 3300032004 Bacteria 1420
1272 Ga0307414_10285744 3300032004 Bacteria 1388
1273 Ga0307414_10359404 3300032004 Bacteria 1252
1274 Ga0307414_10393245 3300032004 Bacteria 1202
1275 Ga0307414_10572274 3300032004 Bacteria 1009
1276 Ga0307414_10653563 3300032004 Bacteria 948
1277 Ga0307414_10707972 3300032004 Bacteria 912
1278 Ga0307414_10820595 3300032004 Bacteria 849
1279 Ga0307414_10859544 3300032004 Bacteria 830
1280 Ga0307414_10913306 3300032004 Bacteria 805
1281 Ga0307414_10967831 3300032004 Bacteria 782
1282 Ga0307414_10997577 3300032004 Bacteria 771
1283 Ga0307414_11071942 3300032004 Bacteria 743
1284 Ga0307414_11210774 3300032004 Bacteria 699
1285 Ga0307414_12055516 3300032004 Bacteria 533
1286 Ga0307414_12312080 3300032004 Bacteria 502
1287 Ga0307411_10001661 3300032005 Bacteria 9300
1288 Ga0307411_10004359 3300032005 Bacteria 6765
1289 Ga0307411_10004416 3300032005 Bacteria 6731
1290 Ga0307411_10005780 3300032005 Bacteria 6121
1291 Ga0307411_10017903 3300032005 Bacteria 4052
1292 Ga0307411_10028117 3300032005 Bacteria 3414
1293 Ga0307411_10033079 3300032005 Bacteria 3203
1294 Ga0307411_10036999 3300032005 Bacteria 3064
1295 Ga0307411_10037289 3300032005 Bacteria 3055
1296 Ga0307411_10051590 3300032005 Bacteria 2684
1297 Ga0307411_10058766 3300032005 Bacteria 2546
1298 Ga0307411_10136957 3300032005 Bacteria 1799
1299 Ga0307411_10186754 3300032005 Bacteria 1578
1300 Ga0307411_10203022 3300032005 Bacteria 1524
1301 Ga0307411_10228924 3300032005 Bacteria 1447
1302 Ga0307411_10265226 3300032005 Bacteria 1358
1303 Ga0307411_10288711 3300032005 Bacteria 1309
1304 Ga0307411_10291459 3300032005 Bacteria 1304
1305 Ga0307411_10322159 3300032005 Bacteria 1248
1306 Ga0307411_10360371 3300032005 Bacteria 1189
1307 Ga0307411_10449318 3300032005 Bacteria 1078
1308 Ga0307411_10465174 3300032005 Bacteria 1061
1309 Ga0307411_10509165 3300032005 Bacteria 1019
1310 Ga0307411_10695047 3300032005 Bacteria 885
1311 Ga0307411_10934485 3300032005 Bacteria 772
1312 Ga0307411_10980632 3300032005 Bacteria 755
1313 Ga0307411_11076779 3300032005 Bacteria 723
1314 Ga0307411_11161975 3300032005 Bacteria 698
1315 Ga0307411_11808938 3300032005 Bacteria 567
1316 Ga0307415_100002260 3300032126 Bacteria 9545
1317 Ga0307415_100013706 3300032126 Bacteria 4741
1318 Ga0307415_100019428 3300032126 Bacteria 4125
1319 Ga0307415_100137356 3300032126 Bacteria 1861
1320 Ga0307415_100165568 3300032126 Bacteria 1718
1321 Ga0307415_100176156 3300032126 Bacteria 1673
1322 Ga0307415_100226222 3300032126 Bacteria 1503
1323 Ga0307415_100250608 3300032126 Bacteria 1438
1324 Ga0307415_100309870 3300032126 Bacteria 1311
1325 Ga0307415_100325471 3300032126 Bacteria 1283
1326 Ga0307415_100419873 3300032126 Bacteria 1147
1327 Ga0307415_100668171 3300032126 Bacteria 933
1328 Ga0307415_100686730 3300032126 Bacteria 922
1329 Ga0307415_101256626 3300032126 Bacteria 700
1330 Ga0307415_101641406 3300032126 Bacteria 618
1331 Ga0307415_101792021 3300032126 Bacteria 594
1332 Ga0307415_102570286 3300032126 Bacteria 502
1333 Ga0307510_10134724 3300033180 Bacteria 2132
1334 Ga0316588_1211960 3300033528 Unclassified 508
1335 Ga0316587_1029651 3300033529 Bacteria 963
1336 Ga0316596_1019259 3300033541 Bacteria 1731
1337 Ga0316596_1242168 3300033541 Unclassified 507
1338 Ga0373938_0188906 3300034957 Bacteria 566
1339 Ga0373934_0272395 3300035086 Bacteria 701
1340 Ga0373941_0520568 3300035115 Bacteria 508
1341 Ga0373960_0132424 3300035121 Bacteria 837
1342 Ga0373943_0080466 3300035170 Bacteria 1670
1343 Ga0373955_0494243 3300035172 Bacteria 747
1344 Ga0373933_0327233 3300035724 Bacteria 994
1345 Ga0265778_059191 3300036457 Bacteria 534
1346 Ga0316582_0642652 3300036647 Bacteria 730
1347 Ga0395899_0028010 3300037312 Bacteria 4243
1348 Ga0395899_0077235 3300037312 Bacteria 2429
1349 Ga0395899_0112751 3300037312 Bacteria 1953
1350 Ga0395899_0122307 3300037312 Bacteria 1863
1351 Ga0395899_0159313 3300037312 Bacteria 1595
1352 Ga0395899_0183129 3300037312 Bacteria 1469
1353 Ga0395899_0346568 3300037312 Bacteria 994
1354 Ga0395900_0001420 3300037418 Bacteria 28683
1355 Ga0395900_0002862 3300037418 Bacteria 18816
1356 Ga0395900_0061087 3300037418 Bacteria 3876
1357 Ga0395900_0072352 3300037418 Bacteria 3545
1358 Ga0395900_0077414 3300037418 Bacteria 3416
1359 Ga0395900_0194991 3300037418 Bacteria 2052
1360 Ga0395900_0400653 3300037418 Bacteria 1336
1361 Ga0395900_0675815 3300037418 Bacteria 967
1362 Ga0395900_1561879 3300037418 Bacteria 571
1363 Ga0395898_0008799 3300037466 Bacteria 10638
1364 Ga0395898_0137711 3300037466 Bacteria 2337
1365 Ga0395898_0163595 3300037466 Bacteria 2128
1366 Ga0395898_0165772 3300037466 Bacteria 2113
1367 Ga0395898_0506140 3300037466 Bacteria 1148
1368 Ga0395898_1383781 3300037466 Bacteria 631
1369 Ga0395898_1405540 3300037466 Bacteria 625
1370 Ga0395905_0000264 3300037471 Bacteria 78482
1371 Ga0395905_0041060 3300037471 Bacteria 4340
1372 Ga0395905_0069236 3300037471 Bacteria 3305
1373 Ga0395905_0386684 3300037471 Bacteria 1293
1374 Ga0395905_0750159 3300037471 Bacteria 878
1375 Ga0395905_0956564 3300037471 Bacteria 759
1376 Ga0395905_1061799 3300037471 Bacteria 713
1377 Ga0395905_1236922 3300037471 Bacteria 650
1378 Ga0436364_0159976 3300037853 Bacteria 597
1379 Ga0436364_0246018 3300037853 Bacteria 623
1380 Ga0436364_0427266 3300037853 Bacteria 503
1381 Ga0436364_0494432 3300037853 Bacteria 6008
1382 Ga0436364_1063999 3300037853 Bacteria 552
1383 Ga0436364_1203033 3300037853 Bacteria 1080
1384 Ga0436364_1265123 3300037853 Bacteria 88807
1385 Ga0436364_1537497 3300037853 Bacteria 4864
1386 Ga0395901_0002684 3300038443 Bacteria 17951
1387 Ga0395901_0030373 3300038443 Bacteria 5567
1388 Ga0395901_0035019 3300038443 Bacteria 5188
1389 Ga0395901_0070988 3300038443 Bacteria 3628
1390 Ga0395901_0091926 3300038443 Bacteria 3176
1391 Ga0395901_0259573 3300038443 Bacteria 1808
1392 Ga0395901_0365845 3300038443 Bacteria 1486
1393 Ga0395901_0711934 3300038443 Bacteria 1000
1394 Ga0395901_0828195 3300038443 Bacteria 912
1395 Ga0395901_1909207 3300038443 Bacteria 541
1396 Ga0237819_00792 3300038705 Bacteria 10103
1397 Ga0237816_03508 3300039145 Bacteria 1146
1398 Ga0436365_0137032 3300039437 Bacteria 18768
1399 Ga0436365_0192103 3300039437 Bacteria 182879
1400 Ga0436365_0389735 3300039437 Bacteria 936
1401 Ga0436365_0516245 3300039437 Bacteria 1203
1402 Ga0436365_0630238 3300039437 Bacteria 1025
1403 Ga0436365_0676110 3300039437 Bacteria 3454
1404 Ga0436365_1132339 3300039437 Bacteria 1338
1405 Ga0436365_1667566 3300039437 Bacteria 3908
1406 Ga0436360_0671368 3300039438 Bacteria 910
1407 Ga0436360_1089737 3300039438 Bacteria 3691
1408 Ga0436360_1104798 3300039438 Bacteria 875
1409 Ga0436361_0766879 3300039447 Bacteria 7058
1410 Ga0436363_0222229 3300039450 Bacteria 940
1411 Ga0436363_0703065 3300039450 Bacteria 605
1412 Ga0436363_1287325 3300039450 Bacteria 1488
1413 Ga0436363_1457002 3300039450 Bacteria 959
1414 Ga0436362_0321149 3300039453 Bacteria 654
1415 Ga0436362_1073687 3300039453 Bacteria 111211
1416 Ga0436362_1230371 3300039453 Bacteria 529
1417 Ga0439436_0159180 3300041404 Bacteria 638
1418 Ga0439438_045215 3300041405 Bacteria 1133
1419 Ga0439447_079162 3300041407 Bacteria 760
1420 Ga0439453_0057474 3300041408 Bacteria 799
1421 Ga0439466_0202426 3300041411 Bacteria 604
1422 Ga0451791_0488539 3300041451 Bacteria 989
1423 Ga0451791_1720350 3300041451 Bacteria 816
1424 Ga0451793_0066913 3300041452 Bacteria 1066
1425 Ga0451793_0534558 3300041452 Bacteria 597
1426 Ga0451793_1104239 3300041452 Bacteria 523
1427 Ga0451797_0487713 3300041453 Bacteria 585
1428 Ga0451800_0039576 3300041459 Bacteria 507
1429 Ga0451802_0221331 3300041460 Bacteria 735
1430 Ga0451802_0380036 3300041460 Bacteria 621
1431 Ga0451805_036337 3300041461 Bacteria 544
1432 Ga0451805_076480 3300041461 Bacteria 536
1433 Ga0451806_016836 3300041462 Bacteria 779
1434 Ga0451807_0963126 3300041486 Bacteria 553
1435 Ga0451833_0069387 3300041491 Bacteria 866
1436 Ga0451835_0820366 3300041492 Bacteria 543
1437 Ga0451849_0914951 3300041505 Bacteria 841
1438 Ga0451843_0531416 3300041509 Bacteria 507
1439 Ga0451843_0612048 3300041509 Bacteria 638
1440 Ga0451843_1776115 3300041509 Bacteria 775
1441 Ga0451855_0821017 3300041511 Bacteria 528
1442 Ga0451853_2949821 3300041512 Bacteria 842
1443 Ga0439433_0107977 3300041999 Bacteria 695
1444 Ga0439441_043326 3300042001 Bacteria 908
1445 Ga0439442_042059 3300042002 Bacteria 961
1446 Ga0439445_0007676 3300042004 Bacteria 2509
1447 Ga0439445_0016648 3300042004 Bacteria 1810
1448 Ga0439445_0043387 3300042004 Bacteria 1200
1449 Ga0439432_036385 3300042006 Bacteria 1575
1450 Ga0439432_131238 3300042006 Bacteria 739
1451 Ga0439449_0100281 3300042007 Bacteria 1070
1452 Ga0439449_0323686 3300042007 Bacteria 582
1453 Ga0439450_151619 3300042008 Bacteria 608
1454 Ga0439452_109393 3300042010 Bacteria 591
1455 Ga0450914_003199 3300042118 Bacteria 1241
1456 Ga0450914_003983 3300042118 Bacteria 1172
1457 Ga0450917_000634 3300042120 Bacteria 2607
1458 Ga0450920_019806 3300042122 Bacteria 1293
1459 Ga0450888_074543 3300042126 Bacteria 514
1460 Ga0450898_094401 3300042134 Bacteria 620
1461 Ga0450904_035417 3300042139 Bacteria 528
1462 Ga0450905_001347 3300042142 Bacteria 3120
1463 Ga0450889_000126 3300042144 Bacteria 7587
1464 Ga0450889_026471 3300042144 Bacteria 664
1465 Ga0450910_095518 3300042147 Bacteria 530
1466 Ga0439446_0257212 3300042156 Bacteria 604
1467 Ga0439434_0061241 3300042435 Bacteria 1177
1468 Ga0439434_0087471 3300042435 Bacteria 994
1469 Ga0439464_0299183 3300042439 Bacteria 525
1470 Ga0450916_028010 3300042530 Bacteria 808
1471 Ga0451577_0241428 3300042876 Bacteria 1635
1472 Ga0466969_0126901 3300044656 Bacteria 1185
1473 Ga0466973_0346498 3300044659 Bacteria 957
1474 Ga0466965_0206501 3300044683 Bacteria 1043
1475 Ga0466966_0000007 3300044684 Bacteria 155702
1476 Ga0466966_0041208 3300044684 Bacteria 2967
1477 Ga0466966_0075625 3300044684 Bacteria 2104
1478 Ga0466961_0272641 3300044693 Bacteria 1036
1479 Ga0466961_0384416 3300044693 Bacteria 852
1480 Ga0466961_0431252 3300044693 Bacteria 798
1481 Ga0466963_0016472 3300044694 Bacteria 4596
1482 Ga0466963_0261753 3300044694 Bacteria 1214
1483 Ga0466963_0644989 3300044694 Bacteria 747
1484 Ga0466963_1219995 3300044694 Bacteria 528
1485 Ga0466964_0106341 3300044706 Bacteria 1245
1486 Ga0453684_0244512 3300044712 Bacteria 2064
1487 Ga0453684_2417312 3300044712 Bacteria 520
1488 Ga0466971_0111738 3300044719 Bacteria 1261
1489 Ga0466971_0280582 3300044719 Bacteria 797
1490 Ga0466968_0188107 3300044735 Bacteria 962
1491 Ga0466970_0063304 3300044765 Bacteria 1983
1492 Ga0466970_0158964 3300044765 Bacteria 1249
1493 Ga0466970_0267722 3300044765 Bacteria 959
1494 Ga0466957_0004838 3300044842 Bacteria 7534
1495 Ga0466957_0170624 3300044842 Bacteria 1417
1496 Ga0466957_0230365 3300044842 Bacteria 1226
1497 Ga0466957_0344396 3300044842 Bacteria 1010
1498 Ga0466960_0140949 3300044901 Bacteria 1281
1499 Ga0466959_0008366 3300045049 Bacteria 7312
1500 Ga0466959_0164340 3300045049 Bacteria 1559
1501 Ga0466959_1212424 3300045049 Bacteria 501
1502 Ga0451576_0520096 3300045051 Bacteria 1250
1503 Ga0466958_0000625 3300045836 Bacteria 15150
1504 Ga0466967_0020455 3300045976 Bacteria 5350
1505 Ga0466967_0204045 3300045976 Bacteria 1873
1506 Ga0466967_0928692 3300045976 Bacteria 866
1507 Ga0466967_2257636 3300045976 Bacteria 540
1508 Ga0495617_089336 3300046452 Bacteria 1006
1509 Ga0495627_064470 3300046453 Bacteria 1078
1510 Ga0495638_0000344 3300046460 Bacteria 58565
1511 Ga0495638_0064577 3300046460 Bacteria 2255
1512 Ga0495638_0129180 3300046460 Bacteria 1486
1513 Ga0495638_0193423 3300046460 Bacteria 1153
1514 Ga0495584_0033167 3300046491 Bacteria 2612
1515 Ga0495584_0416537 3300046491 Bacteria 683
1516 Ga0495585_0062407 3300046492 Bacteria 2047
1517 Ga0495585_0071988 3300046492 Bacteria 1884
1518 Ga0495596_0053326 3300046500 Bacteria 1582
1519 Ga0495607_0268600 3300046501 Bacteria 814
1520 Ga0495607_0482850 3300046501 Bacteria 552
1521 Ga0495606_0160172 3300046507 Bacteria 1313
1522 Ga0495610_0000072 3300046512 Bacteria 120618
1523 Ga0495610_0020051 3300046512 Bacteria 3723
1524 Ga0495620_0197666 3300046515 Bacteria 774
1525 Ga0495620_0269934 3300046515 Bacteria 648
1526 Ga0495628_1211733 3300046516 Bacteria 512
1527 Ga0495631_0162284 3300046518 Bacteria 959
1528 Ga0495631_0207680 3300046518 Bacteria 837
1529 Ga0495632_0000007 3300046519 Bacteria 343246
1530 Ga0495632_0108991 3300046519 Bacteria 1301
1531 Ga0495632_0343771 3300046519 Bacteria 657
1532 Ga0495637_0000971 3300046520 Bacteria 18217
1533 Ga0495637_0050727 3300046520 Bacteria 1740
1534 Ga0495643_0000005 3300046522 Bacteria 443135
1535 Ga0495643_0113143 3300046522 Bacteria 1378
1536 Ga0495643_0188561 3300046522 Bacteria 997
1537 Ga0495648_0019030 3300046524 Bacteria 4843
1538 Ga0495648_0053126 3300046524 Bacteria 2457
1539 Ga0495648_0055981 3300046524 Bacteria 2375
1540 Ga0495648_0439633 3300046524 Bacteria 573
1541 Ga0495663_0000005 3300046525 Bacteria 342265
1542 Ga0495663_0005839 3300046525 Bacteria 3407
1543 Ga0495663_0006586 3300046525 Bacteria 3206
1544 Ga0495663_0059004 3300046525 Bacteria 1203
1545 Ga0495663_0098439 3300046525 Bacteria 960
1546 Ga0495663_0176093 3300046525 Bacteria 739
1547 Ga0495642_0042851 3300046528 Bacteria 1845
1548 Ga0495642_0137171 3300046528 Bacteria 1055
1549 Ga0495654_0001737 3300046530 Bacteria 14615
1550 Ga0495654_0163607 3300046530 Bacteria 975
1551 Ga0495598_0102127 3300046537 Bacteria 950
1552 Ga0495621_0264348 3300046539 Bacteria 705
1553 Ga0495597_0114772 3300046542 Bacteria 1127
1554 Ga0495597_0162965 3300046542 Bacteria 909
1555 Ga0495622_0069143 3300046557 Bacteria 1630
1556 Ga0495633_0000550 3300046558 Bacteria 36970
1557 Ga0495633_0096849 3300046558 Bacteria 1370
1558 Ga0495633_0123148 3300046558 Bacteria 1201
1559 Ga0495633_0248338 3300046558 Bacteria 812
1560 Ga0495668_0000079 3300046616 Bacteria 157703
1561 Ga0495668_0008515 3300046616 Bacteria 6391
1562 Ga0495668_0011125 3300046616 Bacteria 5405
1563 Ga0495668_0071990 3300046616 Bacteria 1899
1564 Ga0495668_0191300 3300046616 Bacteria 1121
1565 Ga0495668_0435840 3300046616 Bacteria 721
1566 Ga0495625_0000064 3300046660 Bacteria 174730
1567 Ga0495625_0095108 3300046660 Bacteria 2054
1568 Ga0495625_0243212 3300046660 Bacteria 1171
1569 Ga0495625_0433525 3300046660 Bacteria 815
1570 Ga0495625_0459653 3300046660 Bacteria 785
1571 Ga0495625_0531490 3300046660 Bacteria 715
1572 Ga0495659_0174299 3300046664 Bacteria 874
1573 Ga0495659_0335889 3300046664 Bacteria 643
1574 Ga0495669_0111155 3300046684 Bacteria 1279
1575 Ga0495669_0131739 3300046684 Bacteria 1177
1576 Ga0495670_0196887 3300046691 Bacteria 1066
1577 Ga0495670_0459375 3300046691 Bacteria 690
1578 Ga0495670_0462756 3300046691 Bacteria 687
1579 Ga0495670_0784023 3300046691 Bacteria 520
1580 Ga0495670_0805191 3300046691 Bacteria 513
1581 Ga0495671_0000007 3300046692 Bacteria 443069
1582 Ga0495671_0029410 3300046692 Bacteria 2822
1583 Ga0495589_0058439 3300046794 Bacteria 1896
1584 Ga0495636_0119069 3300047318 Bacteria 1167
1585 Ga0495672_0242256 3300047320 Bacteria 880
1586 Ga0495677_0043186 3300047445 Bacteria 1652
1587 Ga0495679_073810 3300047446 Bacteria 978
1588 Ga0495685_072741 3300047447 Bacteria 1150
1589 Ga0495673_0075622 3300047469 Bacteria 1406
1590 Ga0495681_0000043 3300047470 Bacteria 115514
1591 Ga0495681_0002043 3300047470 Bacteria 14700
1592 Ga0495681_0100780 3300047470 Bacteria 1263
1593 Ga0495686_0000060 3300047472 Bacteria 237402
1594 Ga0495686_0015162 3300047472 Bacteria 5277
1595 Ga0495686_0034080 3300047472 Bacteria 3282
1596 Ga0495686_0052135 3300047472 Bacteria 2566
1597 Ga0495686_0062563 3300047472 Bacteria 2308
1598 Ga0495686_0254925 3300047472 Bacteria 984
1599 Ga0495614_0457879 3300048089 Bacteria 604
1600 Ga0495615_0243375 3300048090 Bacteria 568
1601 Ga0495615_0260026 3300048090 Bacteria 552
1602 Ga0495626_0156483 3300048091 Bacteria 958
1603 Ga0496101_0262625 3300048904 Bacteria 1347
1604 Ga0496102_0108686 3300048905 Bacteria 2583
1605 Ga0496102_0534542 3300048905 Bacteria 1095
1606 Ga0496102_0645633 3300048905 Bacteria 981
1607 Ga0496103_0000643 3300048906 Bacteria 26435
1608 Ga0496103_0055995 3300048906 Bacteria 2447
1609 Ga0496103_0093529 3300048906 Bacteria 1898
1610 Ga0496104_0065671 3300048907 Bacteria 3444
1611 Ga0496105_0277070 3300048908 Bacteria 1353
1612 Ga0496107_0054481 3300048910 Bacteria 2887
1613 Ga0496108_0001779 3300048911 Bacteria 17174
1614 Ga0496108_0378522 3300048911 Bacteria 1236
1615 Ga0496108_0684040 3300048911 Bacteria 890
1616 Ga0496108_0781638 3300048911 Bacteria 824
1617 Ga0496108_0893976 3300048911 Bacteria 763
1618 Ga0496108_1378091 3300048911 Bacteria 591
1619 Ga0496109_0005285 3300048912 Bacteria 10789
1620 Ga0496109_0427489 3300048912 Bacteria 1251
1621 Ga0496109_0942644 3300048912 Bacteria 801
1622 Ga0496109_0949216 3300048912 Bacteria 798
1623 Ga0496109_0958490 3300048912 Bacteria 793
1624 Ga0496110_0017508 3300048913 Bacteria 5996
1625 Ga0496110_0171671 3300048913 Bacteria 1967
1626 Ga0496110_0187573 3300048913 Bacteria 1878
1627 Ga0496110_1295115 3300048913 Bacteria 638
1628 Ga0496111_0081045 3300048914 Bacteria 2369
1629 Ga0496111_0098941 3300048914 Bacteria 2142
1630 Ga0496111_0560943 3300048914 Bacteria 838
1631 Ga0496111_0597108 3300048914 Bacteria 808
1632 Ga0496112_0828155 3300048915 Bacteria 849
1633 Ga0496113_0040449 3300048916 Bacteria 3436
1634 Ga0496113_0923147 3300048916 Bacteria 690
1635 Ga0496116_0011628 3300048919 Bacteria 7263
1636 Ga0496116_0092735 3300048919 Bacteria 1831
1637 Ga0496117_0005240 3300048920 Bacteria 13757
1638 Ga0496117_0009671 3300048920 Bacteria 8920
1639 Ga0496117_0010121 3300048920 Bacteria 8659
1640 Ga0496117_0011933 3300048920 Bacteria 7722
1641 Ga0496117_0078040 3300048920 Bacteria 2188
1642 Ga0496118_0001107 3300048921 Bacteria 41821
1643 Ga0496118_0001361 3300048921 Bacteria 36837
1644 Ga0496118_0020836 3300048921 Bacteria 5800
1645 Ga0496118_0025899 3300048921 Bacteria 5015
1646 Ga0496118_0362924 3300048921 Bacteria 767
1647 Ga0496119_0002497 3300048922 Bacteria 20107
1648 Ga0496119_0105087 3300048922 Bacteria 1578
1649 Ga0496119_0112028 3300048922 Bacteria 1513
1650 Ga0496120_0188010 3300048923 Bacteria 1009
1651 Ga0496120_0206344 3300048923 Bacteria 948
1652 Ga0496121_0000072 3300048924 Bacteria 244975
1653 Ga0496121_0000349 3300048924 Bacteria 96428
1654 Ga0496121_0006869 3300048924 Bacteria 13914
1655 Ga0496121_0052513 3300048924 Bacteria 3423
1656 Ga0496121_0089973 3300048924 Bacteria 2401
1657 Ga0496121_0244505 3300048924 Bacteria 1248
1658 Ga0496121_0338717 3300048924 Bacteria 1006
1659 Ga0496122_0000504 3300048925 Bacteria 80683
1660 Ga0496122_0001301 3300048925 Bacteria 41201
1661 Ga0496122_0079829 3300048925 Bacteria 2284
1662 Ga0496122_0148093 3300048925 Bacteria 1455
1663 Ga0496122_0179271 3300048925 Bacteria 1266
1664 Ga0496122_0459787 3300048925 Bacteria 629
1665 Ga0496123_0000111 3300048926 Bacteria 164592
1666 Ga0496123_0001067 3300048926 Bacteria 41431
1667 Ga0496123_0006586 3300048926 Bacteria 11220
1668 Ga0496123_0098951 3300048926 Bacteria 1704
1669 Ga0496123_0172775 3300048926 Bacteria 1138
1670 Ga0496123_0228279 3300048926 Bacteria 934
1671 Ga0496124_0005100 3300048927 Bacteria 14956
1672 Ga0496124_0015198 3300048927 Bacteria 7391
1673 Ga0496124_0075292 3300048927 Bacteria 2789
1674 Ga0496124_0095988 3300048927 Bacteria 2409
1675 Ga0496124_0102418 3300048927 Bacteria 2317
1676 Ga0496124_0220954 3300048927 Bacteria 1425
1677 Ga0496124_0279949 3300048927 Bacteria 1216
1678 Ga0496124_0976915 3300048927 Bacteria 507
1679 Ga0496125_0015192 3300048928 Bacteria 7457
1680 Ga0496125_0019677 3300048928 Bacteria 6356
1681 Ga0496125_0042848 3300048928 Bacteria 3849
1682 Ga0496125_0075884 3300048928 Bacteria 2598
1683 Ga0496125_0098367 3300048928 Bacteria 2165
1684 Ga0496125_0293037 3300048928 Bacteria 1001
1685 Ga0496125_0549372 3300048928 Bacteria 640
1686 Ga0496125_0592038 3300048928 Bacteria 607
1687 Ga0496126_0038024 3300048929 Bacteria 4481
1688 Ga0496126_0060278 3300048929 Bacteria 3414
1689 Ga0496126_0257576 3300048929 Bacteria 1452
1690 Ga0496126_0881411 3300048929 Bacteria 680
1691 Ga0496126_0894607 3300048929 Bacteria 674
1692 Ga0496126_0978172 3300048929 Bacteria 636
1693 Ga0496126_1148676 3300048929 Bacteria 574
1694 Ga0496126_1305338 3300048929 Bacteria 528
1695 Ga0501307_030519 3300049162 Bacteria 745
1696 Ga0495678_108227 3300049459 Bacteria 952
1697 Ga0501296_028526 3300049519 Bacteria 743
1698 Ga0501297_007607 3300049520 Bacteria 1181
1699 Ga0501314_050622 3300049530 Bacteria 502
1700 Ga0501315_078810 3300049531 Bacteria 557
1701 Ga0501316_063150 3300049532 Bacteria 550
1702 Ga0501316_064475 3300049532 Bacteria 546
1703 Ga0501323_085355 3300049539 Bacteria 520
1704 Ga0501325_054035 3300049541 Bacteria 517
1705 Ga0501329_11307 3300049545 Bacteria 567
1706 Ga0501335_001328 3300049551 Bacteria 1881
1707 Ga0501031_0046396 3300049568 Bacteria 2833
1708 Ga0501031_0495590 3300049568 Bacteria 788
1709 Ga0501031_0834112 3300049568 Bacteria 591
1710 Ga0501032_0022036 3300049569 Bacteria 4422
1711 Ga0501032_0026782 3300049569 Bacteria 3963
1712 Ga0501032_0359666 3300049569 Bacteria 937
1713 Ga0501032_0639612 3300049569 Bacteria 676
1714 Ga0501033_0093854 3300049570 Bacteria 2194
1715 Ga0501033_0097255 3300049570 Bacteria 2151
1716 Ga0501034_0000088 3300049571 Bacteria 166615
1717 Ga0501034_0113919 3300049571 Bacteria 2693
1718 Ga0501034_0254566 3300049571 Bacteria 1700
1719 Ga0501036_1217750 3300049572 Bacteria 613
1720 Ga0501036_1303379 3300049572 Bacteria 590
1721 Ga0501037_0107974 3300049573 Bacteria 2005
1722 Ga0501038_0031543 3300049574 Bacteria 4682
1723 Ga0501038_0984568 3300049574 Bacteria 620
1724 Ga0501038_1147500 3300049574 Bacteria 566
1725 Ga0501038_1244585 3300049574 Bacteria 539
1726 Ga0501039_0103982 3300049575 Bacteria 2217
1727 Ga0501039_0638226 3300049575 Bacteria 834
1728 Ga0501039_1572663 3300049575 Bacteria 505
1729 Ga0501041_0892512 3300049577 Bacteria 571
1730 Ga0501043_0025985 3300049579 Bacteria 4594
1731 Ga0501043_0047711 3300049579 Bacteria 3367
1732 Ga0501043_0202331 3300049579 Bacteria 1541
1733 Ga0501046_0702251 3300049580 Bacteria 713
1734 Ga0501046_1141951 3300049580 Bacteria 537
1735 Ga0501047_0002184 3300049581 Bacteria 18725
1736 Ga0501047_0284352 3300049581 Bacteria 1498
1737 Ga0501047_0719899 3300049581 Bacteria 815
1738 Ga0501048_0463682 3300049582 Bacteria 908
1739 Ga0501048_0942093 3300049582 Bacteria 621
1740 Ga0501068_0617291 3300049584 Bacteria 707
1741 Ga0501071_0221180 3300049587 Bacteria 1425
1742 Ga0501071_1344473 3300049587 Bacteria 552
1743 Ga0501072_0693336 3300049588 Bacteria 801
1744 Ga0501073_0221301 3300049589 Bacteria 1308
1745 Ga0501076_0786603 3300049592 Bacteria 785
1746 Ga0501077_0959298 3300049593 Bacteria 550
1747 Ga0501201_017900 3300049651 Bacteria 734
1748 Ga0501202_076526 3300049652 Bacteria 780
1749 Ga0501217_003366 3300049661 Bacteria 3228
1750 Ga0501223_000012 3300049663 Bacteria 75953
1751 Ga0501235_003056 3300049669 Bacteria 3609
1752 Ga0501236_030806 3300049670 Bacteria 847
1753 Ga0501239_017061 3300049672 Bacteria 863
1754 Ga0501247_041314 3300049677 Bacteria 660
1755 Ga0501249_000081 3300049679 Bacteria 30894
1756 Ga0501249_106212 3300049679 Bacteria 675
1757 Ga0501250_108908 3300049680 Bacteria 501
1758 Ga0501251_011865 3300049681 Bacteria 1045
1759 Ga0501253_054649 3300049683 Bacteria 846
1760 Ga0501256_010588 3300049685 Bacteria 882
1761 Ga0501256_022412 3300049685 Bacteria 671
1762 Ga0501257_042240 3300049686 Bacteria 1122
1763 Ga0501259_209920 3300049688 Bacteria 501
1764 Ga0501221_091303 3300049704 Bacteria 745
1765 Ga0501225_0000500 3300049705 Bacteria 12204
1766 Ga0501225_0002430 3300049705 Bacteria 5758
1767 Ga0501225_0306185 3300049705 Bacteria 539
1768 Ga0501234_002192 3300049707 Bacteria 3083
1769 Ga0501245_107247 3300049708 Bacteria 573
1770 Ga0501079_0377357 3300049741 Bacteria 1112
1771 Ga0501080_0677811 3300049742 Bacteria 911
1772 Ga0501080_1759949 3300049742 Bacteria 521
1773 Ga0501081_0168469 3300049743 Bacteria 1581
1774 Ga0501264_003192 3300049761 Bacteria 1493
1775 Ga0501267_018110 3300049764 Bacteria 761
1776 Ga0501268_025217 3300049765 Bacteria 1043
1777 Ga0501268_030694 3300049765 Bacteria 971
1778 Ga0501268_105821 3300049765 Bacteria 608
1779 Ga0501268_180703 3300049765 Bacteria 502
1780 Ga0501270_061237 3300049767 Bacteria 706
1781 Ga0501273_089049 3300049770 Bacteria 522
1782 Ga0501035_0025892 3300049822 Bacteria 5375
1783 Ga0501035_0220204 3300049822 Bacteria 1621
1784 Ga0501035_1493566 3300049822 Bacteria 515
1785 Ga0501044_0009404 3300049823 Bacteria 10648
1786 Ga0501044_0708869 3300049823 Bacteria 891
1787 Ga0501212_057866 3300049851 Bacteria 667
1788 nmdc:mga03683_137644_c1 3300050489 Bacteria 1096
1789 nmdc:mga03n38_65880_c1 3300050490 Bacteria 1662
1790 nmdc:mga0yw44_1032226_c1 3300050492 Bacteria 556
1791 nmdc:mga0k408_443972_c1 3300050493 Bacteria 771
1792 nmdc:mga0k408_921332_c1 3300050493 Bacteria 507
1793 nmdc:mga06z11_30_c1 3300050494 Bacteria 58764
1794 nmdc:mga06z11_630531_c1 3300050494 Bacteria 652
1795 nmdc:mga04h51_93_c1 3300050495 Bacteria 27352
1796 nmdc:mga07m45_132908_c1 3300050496 Bacteria 1440
1797 nmdc:mga07m45_383246_c1 3300050496 Bacteria 816
1798 nmdc:mga05p37_105778_c1 3300050507 Bacteria 3461
1799 nmdc:mga05p37_1448994_c1 3300050507 Bacteria 688
1800 nmdc:mga05p37_466271_c1 3300050507 Bacteria 1458
1801 nmdc:mga09592_356660_c1 3300050508 Bacteria 1265
1802 nmdc:mga0qj67_1086296_c1 3300050509 Bacteria 625
1803 nmdc:mga0qj67_147987_c1 3300050509 Bacteria 1904
1804 nmdc:mga0qj67_300384_c1 3300050509 Bacteria 1301
1805 nmdc:mga06r32_1302965_c1 3300050510 Bacteria 670
1806 nmdc:mga06r32_5128_c1 3300050510 Bacteria 11781
1807 nmdc:mga08y16_259973_c1 3300050511 Bacteria 1793
1808 nmdc:mga0n895_1117221_c1 3300050512 Bacteria 765
1809 nmdc:mga0rr50_1335560_c1 3300050513 Bacteria 608
1810 Ga0500643_000166 3300053087 Bacteria 65586
1811 Ga0500643_004300 3300053087 Bacteria 6498
1812 Ga0500643_007289 3300053087 Bacteria 4490
1813 Ga0500643_013345 3300053087 Bacteria 2904
1814 Ga0500643_019505 3300053087 Bacteria 2230
1815 Ga0500643_081747 3300053087 Bacteria 886
1816 Ga0500643_128577 3300053087 Bacteria 681
1817 Ga0500644_0328279 3300053088 Bacteria 659
1818 Ga0500641_0041486 3300053096 Bacteria 1862
1819 Ga0500650_0096894 3300053098 Bacteria 1381
1820 Ga0500556_0000136 3300053104 Bacteria 62226
1821 Ga0500557_065418 3300053105 Bacteria 1186
1822 Ga0500562_049677 3300053108 Bacteria 1121
1823 Ga0500592_001051 3300053116 Bacteria 4517
1824 Ga0500592_004853 3300053116 Bacteria 2137
1825 Ga0500594_0002435 3300053118 Bacteria 4050
1826 Ga0500594_0070406 3300053118 Bacteria 1027
1827 Ga0500595_169366 3300053119 Bacteria 607
1828 Ga0500597_048749 3300053120 Bacteria 1799
1829 Ga0500608_033939 3300053122 Bacteria 2429
1830 Ga0500642_0000003 3300053130 Bacteria 544899
1831 Ga0500655_010685 3300053133 Bacteria 1659
1832 Ga0500658_0004244 3300053134 Bacteria 5377
1833 Ga0500658_0071407 3300053134 Bacteria 1466
1834 Ga0500658_0074626 3300053134 Bacteria 1438
1835 Ga0500559_0146737 3300053136 Bacteria 1106
1836 Ga0500559_0558062 3300053136 Bacteria 522
1837 Ga0500568_0002097 3300053139 Bacteria 12068
1838 Ga0500568_0025764 3300053139 Bacteria 2476
1839 Ga0500568_0138671 3300053139 Bacteria 902
1840 Ga0500568_0318989 3300053139 Bacteria 564
1841 Ga0500573_0084974 3300053140 Bacteria 1795
1842 Ga0500573_0417937 3300053140 Bacteria 630
1843 Ga0500603_296304 3300053150 Bacteria 524
1844 Ga0500604_0009664 3300053151 Bacteria 2571
1845 Ga0500604_0061600 3300053151 Bacteria 1179
1846 Ga0500604_0145179 3300053151 Bacteria 804
1847 Ga0500616_0008998 3300053153 Bacteria 6116
1848 Ga0500616_0035993 3300053153 Bacteria 2689
1849 Ga0500616_0236250 3300053153 Bacteria 788
1850 Ga0500622_0171960 3300053156 Bacteria 1008
1851 Ga0500624_000001 3300053157 Bacteria 284974
1852 Ga0500624_000009 3300053157 Bacteria 178763
1853 Ga0500627_0000012 3300053158 Bacteria 140613
1854 Ga0500627_0000164 3300053158 Bacteria 19590
1855 Ga0500627_0206961 3300053158 Bacteria 878
1856 Ga0500637_0000010 3300053178 Bacteria 81649
1857 Ga0500645_000962 3300053730 Bacteria 16361
1858 Ga0500645_025530 3300053730 Bacteria 1803
1859 Ga0500645_117617 3300053730 Bacteria 743
1860 Ga0501084_1377102 3300054114 Bacteria 591
1861 Ga0590071_054107 3300059421 Bacteria 976
1862 Ga0590071_073645 3300059421 Bacteria 844
1863 Ga0590075_084551 3300059424 Bacteria 823
1864 Ga0590077_048986 3300059426 Bacteria 947
1865 Ga0587090_082715 3300059510 Bacteria 646
1866 Ga0587109_195984 3300059624 Bacteria 524
1867 Ga0587111_0191919 3300060346 Bacteria 574
1868 Ga0466962_0019709 3300061719 Bacteria 3241
1869 Ga0466962_0089286 3300061719 Bacteria 1476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0703065 Ga0436363_0703065_154_387 73
2 3300005329 Ga0070683_100181524 Ga0070683_1001815242 74
3 3300005535 Ga0070684_100572786 Ga0070684_1005727862 74
4 3300005563 Ga0068855_100923464 Ga0068855_1009234642 74
5 3300005616 Ga0068852_101319373 Ga0068852_1013193732 74
6 3300009093 Ga0105240_10013152 Ga0105240_100131521 74
7 3300009829 Ga0130086_1052251 Ga0130086_10522512 74
8 3300009850 Ga0130085_1052616 Ga0130085_10526162 74
9 3300013104 Ga0157370_10415913 Ga0157370_104159132 74
10 3300013105 Ga0157369_10401582 Ga0157369_104015823 74
11 3300013307 Ga0157372_10922764 Ga0157372_109227642 74
12 3300020069 Ga0197907_10789011 Ga0197907_107890111 74
13 3300020078 Ga0206352_11327376 Ga0206352_113273761 74
14 3300020081 Ga0206354_11225530 Ga0206354_112255301 74
15 3300020082 Ga0206353_11404047 Ga0206353_114040472 74
16 3300022467 Ga0224712_10272885 Ga0224712_102728852 74
17 3300025913 Ga0207695_10027914 Ga0207695_100279145 74
18 3300025914 Ga0207671_10729917 Ga0207671_107299172 74
19 3300025924 Ga0207694_10784808 Ga0207694_107848081 74
20 3300025944 Ga0207661_10081167 Ga0207661_100811672 74
21 3300045051 Ga0451576_0520096 Ga0451576_0520096_926_1165 74
22 3300049571 Ga0501034_0000088 Ga0501034_0000088_8497_8730 74
23 3300049575 Ga0501039_0638226 Ga0501039_0638226_550_783 74
24 3300007265 Ga0099794_10078745 Ga0099794_100787452 75
25 3300050513 nmdc:mga0rr50_1335560_c1 nmdc:mga0rr50_1335560_c1_89_334 75
26 3300031548 Ga0307408_102436768 Ga0307408_1024367681 76
27 3300041512 Ga0451853_2949821 Ga0451853_2949821_157_390 76
28 3300049741 Ga0501079_0377357 Ga0501079_0377357_267_518 76
29 3300049743 Ga0501081_0168469 Ga0501081_0168469_565_816 76
30 2162886007 SwRhRL2b_contig_1170923 SwRhRL2b_0871.00001140 77
31 2162886007 SwRhRL2b_contig_1467252 SwRhRL2b_0946.00005210 77
32 2162886007 SwRhRL2b_contig_3357127 SwRhRL2b_0637.00003970 77
33 2162886007 SwRhRL2b_contig_401845 SwRhRL2b_0428.00006000 77
34 3300000549 LJQas_1017628 LJQas_10176281 77
35 3300000652 ARCol0yngRDRAFT_1013171 ARCol0yngRDRAFT_10131711 77
36 3300001904 JGI24736J21556_1000067 JGI24736J21556_10000675 77
37 3300001904 JGI24736J21556_1000110 JGI24736J21556_10001103 77
38 3300001904 JGI24736J21556_1071132 JGI24736J21556_10711321 77
39 3300001915 JGI24741J21665_1000129 JGI24741J21665_100012918 77
40 3300001915 JGI24741J21665_1032365 JGI24741J21665_10323651 77
41 3300001915 JGI24741J21665_1040178 JGI24741J21665_10401781 77
42 3300001976 JGI24752J21851_1000776 JGI24752J21851_10007764 77
43 3300001976 JGI24752J21851_1036600 JGI24752J21851_10366002 77
44 3300001977 JGI24746J21847_1001743 JGI24746J21847_10017433 77
45 3300001979 JGI24740J21852_10002349 JGI24740J21852_100023495 77
46 3300001979 JGI24740J21852_10013222 JGI24740J21852_100132224 77
47 3300001979 JGI24740J21852_10016779 JGI24740J21852_100167793 77
48 3300001979 JGI24740J21852_10094265 JGI24740J21852_100942652 77
49 3300001979 JGI24740J21852_10121571 JGI24740J21852_101215712 77
50 3300001979 JGI24740J21852_10150809 JGI24740J21852_101508092 77
51 3300001989 JGI24739J22299_10001367 JGI24739J22299_100013676 77
52 3300001989 JGI24739J22299_10038329 JGI24739J22299_100383292 77
53 3300001989 JGI24739J22299_10093754 JGI24739J22299_100937542 77
54 3300001989 JGI24739J22299_10098816 JGI24739J22299_100988162 77
55 3300001990 JGI24737J22298_10003855 JGI24737J22298_100038555 77
56 3300001990 JGI24737J22298_10043396 JGI24737J22298_100433963 77
57 3300001990 JGI24737J22298_10079838 JGI24737J22298_100798382 77
58 3300001990 JGI24737J22298_10146429 JGI24737J22298_101464292 77
59 3300001990 JGI24737J22298_10161522 JGI24737J22298_101615222 77
60 3300002067 JGI24735J21928_10003135 JGI24735J21928_100031354 77
61 3300002067 JGI24735J21928_10039634 JGI24735J21928_100396341 77
62 3300002067 JGI24735J21928_10045625 JGI24735J21928_100456251 77
63 3300002067 JGI24735J21928_10132173 JGI24735J21928_101321732 77
64 3300002070 JGI24750J21931_1000571 JGI24750J21931_10005712 77
65 3300002074 JGI24748J21848_1000029 JGI24748J21848_100002995 77
66 3300002074 JGI24748J21848_1019169 JGI24748J21848_10191692 77
67 3300002075 JGI24738J21930_10005099 JGI24738J21930_100050994 77
68 3300002075 JGI24738J21930_10040297 JGI24738J21930_100402971 77
69 3300002075 JGI24738J21930_10074966 JGI24738J21930_100749662 77
70 3300002075 JGI24738J21930_10151560 JGI24738J21930_101515602 77
71 3300002076 JGI24749J21850_1000184 JGI24749J21850_10001846 77
72 3300002076 JGI24749J21850_1001544 JGI24749J21850_10015443 77
73 3300002076 JGI24749J21850_1009786 JGI24749J21850_10097862 77
74 3300002077 JGI24744J21845_10106846 JGI24744J21845_101068462 77
75 3300002126 JGI24035J26624_1012719 JGI24035J26624_10127192 77
76 3300002155 JGI24033J26618_1014861 JGI24033J26618_10148612 77
77 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006242 77
78 3300002239 JGI24034J26672_10012412 JGI24034J26672_100124122 77
79 3300002239 JGI24034J26672_10033096 JGI24034J26672_100330962 77
80 3300002244 JGI24742J22300_10007943 JGI24742J22300_100079431 77
81 3300002244 JGI24742J22300_10010284 JGI24742J22300_100102843 77
82 3300002459 JGI24751J29686_10000311 JGI24751J29686_1000031115 77
83 3300002459 JGI24751J29686_10013619 JGI24751J29686_100136192 77
84 3300002459 JGI24751J29686_10048147 JGI24751J29686_100481471 77
85 3300002459 JGI24751J29686_10052246 JGI24751J29686_100522461 77
86 3300002459 JGI24751J29686_10101161 JGI24751J29686_101011611 77
87 3300003187 JGI25151J46595_10118985 JGI25151J46595_101189851 77
88 3300003214 JGI25165J46597_1000032 JGI25165J46597_10000322 77
89 3300003323 rootH1_10219905 rootH1_102199053 77
90 3300003579 Ga0007429J51699_1094910 Ga0007429J51699_10949101 77
91 3300003758 Ga0055532_1018923 Ga0055532_10189231 77
92 3300003781 Ga0055536_1001940 Ga0055536_10019402 77
93 3300003791 Ga0055530_10000065 Ga0055530_1000006539 77
94 3300003794 Ga0055531_10054018 Ga0055531_100540181 77
95 3300003911 JGI25405J52794_10003004 JGI25405J52794_100030043 77
96 3300004800 Ga0058861_11573036 Ga0058861_115730361 77
97 3300005288 Ga0065714_10151266 Ga0065714_101512662 77
98 3300005288 Ga0065714_10279097 Ga0065714_102790972 77
99 3300005288 Ga0065714_10303611 Ga0065714_103036111 77
100 3300005288 Ga0065714_10387755 Ga0065714_103877551 77
101 3300005288 Ga0065714_10446091 Ga0065714_104460912 77
102 3300005289 Ga0065704_10000743 Ga0065704_1000074318 77
103 3300005289 Ga0065704_10075680 Ga0065704_100756804 77
104 3300005289 Ga0065704_10081635 Ga0065704_100816354 77
105 3300005289 Ga0065704_10145942 Ga0065704_101459422 77
106 3300005289 Ga0065704_10415476 Ga0065704_104154761 77
107 3300005289 Ga0065704_10730684 Ga0065704_107306842 77
108 3300005290 Ga0065712_10039431 Ga0065712_100394312 77
109 3300005290 Ga0065712_10103545 Ga0065712_101035452 77
110 3300005290 Ga0065712_10317213 Ga0065712_103172132 77
111 3300005290 Ga0065712_10332836 Ga0065712_103328362 77
112 3300005290 Ga0065712_10420220 Ga0065712_104202201 77
113 3300005290 Ga0065712_10630688 Ga0065712_106306882 77
114 3300005293 Ga0065715_10089927 Ga0065715_100899275 77
115 3300005293 Ga0065715_10144459 Ga0065715_101444591 77
116 3300005293 Ga0065715_10167147 Ga0065715_101671472 77
117 3300005293 Ga0065715_10201242 Ga0065715_102012422 77
118 3300005293 Ga0065715_10327560 Ga0065715_103275602 77
119 3300005293 Ga0065715_10666951 Ga0065715_106669511 77
120 3300005295 Ga0065707_10083015 Ga0065707_100830158 77
121 3300005295 Ga0065707_10085258 Ga0065707_100852586 77
122 3300005295 Ga0065707_10086202 Ga0065707_100862025 77
123 3300005295 Ga0065707_10110487 Ga0065707_101104871 77
124 3300005295 Ga0065707_10253202 Ga0065707_102532022 77
125 3300005295 Ga0065707_10315029 Ga0065707_103150292 77
126 3300005327 Ga0070658_10000001 Ga0070658_10000001309 77
127 3300005327 Ga0070658_10005310 Ga0070658_100053102 77
128 3300005327 Ga0070658_10034919 Ga0070658_100349192 77
129 3300005327 Ga0070658_10226584 Ga0070658_102265843 77
130 3300005327 Ga0070658_10254004 Ga0070658_102540042 77
131 3300005327 Ga0070658_10526794 Ga0070658_105267941 77
132 3300005327 Ga0070658_10742267 Ga0070658_107422672 77
133 3300005327 Ga0070658_10772402 Ga0070658_107724022 77
134 3300005328 Ga0070676_10006232 Ga0070676_100062323 77
135 3300005328 Ga0070676_10104011 Ga0070676_101040112 77
136 3300005328 Ga0070676_10115548 Ga0070676_101155482 77
137 3300005329 Ga0070683_100118125 Ga0070683_1001181253 77
138 3300005329 Ga0070683_100127345 Ga0070683_1001273453 77
139 3300005329 Ga0070683_100638197 Ga0070683_1006381972 77
140 3300005329 Ga0070683_100961616 Ga0070683_1009616162 77
141 3300005329 Ga0070683_101430248 Ga0070683_1014302481 77
142 3300005330 Ga0070690_100000002 Ga0070690_100000002110 77
143 3300005331 Ga0070670_100000005 Ga0070670_10000000532 77
144 3300005331 Ga0070670_100000016 Ga0070670_100000016174 77
145 3300005331 Ga0070670_100000565 Ga0070670_1000005655 77
146 3300005331 Ga0070670_100003401 Ga0070670_1000034015 77
147 3300005331 Ga0070670_100004789 Ga0070670_10000478912 77
148 3300005331 Ga0070670_100027482 Ga0070670_1000274824 77
149 3300005331 Ga0070670_100057823 Ga0070670_1000578233 77
150 3300005331 Ga0070670_100143580 Ga0070670_1001435802 77
151 3300005331 Ga0070670_100339546 Ga0070670_1003395462 77
152 3300005331 Ga0070670_100517730 Ga0070670_1005177302 77
153 3300005331 Ga0070670_101182151 Ga0070670_1011821512 77
154 3300005331 Ga0070670_102245490 Ga0070670_1022454901 77
155 3300005333 Ga0070677_10003186 Ga0070677_100031862 77
156 3300005333 Ga0070677_10084386 Ga0070677_100843861 77
157 3300005333 Ga0070677_10553814 Ga0070677_105538142 77
158 3300005334 Ga0068869_100333989 Ga0068869_1003339892 77
159 3300005334 Ga0068869_100527117 Ga0068869_1005271171 77
160 3300005334 Ga0068869_100624241 Ga0068869_1006242412 77
161 3300005335 Ga0070666_10000002 Ga0070666_10000002472 77
162 3300005335 Ga0070666_10242698 Ga0070666_102426982 77
163 3300005336 Ga0070680_100004292 Ga0070680_1000042926 77
164 3300005336 Ga0070680_100179076 Ga0070680_1001790762 77
165 3300005337 Ga0070682_100318290 Ga0070682_1003182902 77
166 3300005337 Ga0070682_100740733 Ga0070682_1007407332 77
167 3300005337 Ga0070682_100886894 Ga0070682_1008868942 77
168 3300005338 Ga0068868_100546147 Ga0068868_1005461471 77
169 3300005339 Ga0070660_100001280 Ga0070660_10000128014 77
170 3300005339 Ga0070660_100041816 Ga0070660_1000418162 77
171 3300005339 Ga0070660_100208003 Ga0070660_1002080032 77
172 3300005339 Ga0070660_100211306 Ga0070660_1002113062 77
173 3300005339 Ga0070660_100218247 Ga0070660_1002182472 77
174 3300005339 Ga0070660_100325277 Ga0070660_1003252772 77
175 3300005339 Ga0070660_100968134 Ga0070660_1009681341 77
176 3300005339 Ga0070660_100999795 Ga0070660_1009997951 77
177 3300005340 Ga0070689_100129951 Ga0070689_1001299512 77
178 3300005341 Ga0070691_10576049 Ga0070691_105760492 77
179 3300005343 Ga0070687_100183426 Ga0070687_1001834261 77
180 3300005344 Ga0070661_100338284 Ga0070661_1003382842 77
181 3300005344 Ga0070661_100353926 Ga0070661_1003539262 77
182 3300005344 Ga0070661_100364257 Ga0070661_1003642571 77
183 3300005344 Ga0070661_100385440 Ga0070661_1003854402 77
184 3300005344 Ga0070661_101045863 Ga0070661_1010458632 77
185 3300005344 Ga0070661_101095216 Ga0070661_1010952161 77
186 3300005344 Ga0070661_101196113 Ga0070661_1011961132 77
187 3300005344 Ga0070661_101204080 Ga0070661_1012040801 77
188 3300005345 Ga0070692_10022145 Ga0070692_100221452 77
189 3300005345 Ga0070692_10184127 Ga0070692_101841271 77
190 3300005345 Ga0070692_10814587 Ga0070692_108145871 77
191 3300005347 Ga0070668_100000005 Ga0070668_100000005148 77
192 3300005347 Ga0070668_100000311 Ga0070668_10000031121 77
193 3300005347 Ga0070668_100001843 Ga0070668_1000018432 77
194 3300005347 Ga0070668_100004667 Ga0070668_10000466711 77
195 3300005347 Ga0070668_100005484 Ga0070668_1000054842 77
196 3300005347 Ga0070668_100027382 Ga0070668_1000273822 77
197 3300005347 Ga0070668_100088505 Ga0070668_1000885053 77
198 3300005347 Ga0070668_100281634 Ga0070668_1002816342 77
199 3300005347 Ga0070668_100287716 Ga0070668_1002877162 77
200 3300005347 Ga0070668_100290601 Ga0070668_1002906012 77
201 3300005347 Ga0070668_100511667 Ga0070668_1005116672 77
202 3300005347 Ga0070668_100739864 Ga0070668_1007398642 77
203 3300005347 Ga0070668_100759943 Ga0070668_1007599431 77
204 3300005353 Ga0070669_100000078 Ga0070669_10000007884 77
205 3300005353 Ga0070669_100000141 Ga0070669_10000014158 77
206 3300005353 Ga0070669_100000577 Ga0070669_10000057711 77
207 3300005353 Ga0070669_100016584 Ga0070669_1000165843 77
208 3300005353 Ga0070669_100106170 Ga0070669_1001061702 77
209 3300005353 Ga0070669_100127806 Ga0070669_1001278062 77
210 3300005353 Ga0070669_100314228 Ga0070669_1003142283 77
211 3300005353 Ga0070669_100332683 Ga0070669_1003326832 77
212 3300005353 Ga0070669_100451827 Ga0070669_1004518271 77
213 3300005353 Ga0070669_100605020 Ga0070669_1006050201 77
214 3300005353 Ga0070669_101051046 Ga0070669_1010510462 77
215 3300005354 Ga0070675_100000241 Ga0070675_10000024111 77
216 3300005354 Ga0070675_100003187 Ga0070675_1000031873 77
217 3300005354 Ga0070675_100147593 Ga0070675_1001475932 77
218 3300005354 Ga0070675_100178755 Ga0070675_1001787552 77
219 3300005354 Ga0070675_100849445 Ga0070675_1008494452 77
220 3300005355 Ga0070671_100000069 Ga0070671_10000006934 77
221 3300005355 Ga0070671_100016626 Ga0070671_1000166262 77
222 3300005355 Ga0070671_100017136 Ga0070671_1000171367 77
223 3300005355 Ga0070671_100141121 Ga0070671_1001411212 77
224 3300005355 Ga0070671_100301446 Ga0070671_1003014462 77
225 3300005356 Ga0070674_100002690 Ga0070674_1000026903 77
226 3300005356 Ga0070674_100492144 Ga0070674_1004921442 77
227 3300005356 Ga0070674_101329529 Ga0070674_1013295291 77
228 3300005364 Ga0070673_100012928 Ga0070673_1000129282 77
229 3300005364 Ga0070673_100027506 Ga0070673_1000275063 77
230 3300005364 Ga0070673_100197629 Ga0070673_1001976292 77
231 3300005364 Ga0070673_100374335 Ga0070673_1003743352 77
232 3300005364 Ga0070673_101568354 Ga0070673_1015683541 77
233 3300005365 Ga0070688_100018458 Ga0070688_1000184584 77
234 3300005365 Ga0070688_100704704 Ga0070688_1007047042 77
235 3300005366 Ga0070659_100004749 Ga0070659_1000047498 77
236 3300005366 Ga0070659_100006775 Ga0070659_1000067754 77
237 3300005366 Ga0070659_100015232 Ga0070659_1000152328 77
238 3300005366 Ga0070659_100024202 Ga0070659_1000242022 77
239 3300005366 Ga0070659_100031820 Ga0070659_1000318203 77
240 3300005366 Ga0070659_100091066 Ga0070659_1000910661 77
241 3300005366 Ga0070659_100200067 Ga0070659_1002000672 77
242 3300005366 Ga0070659_100280233 Ga0070659_1002802332 77
243 3300005366 Ga0070659_100443115 Ga0070659_1004431152 77
244 3300005366 Ga0070659_100491586 Ga0070659_1004915862 77
245 3300005366 Ga0070659_100590646 Ga0070659_1005906462 77
246 3300005366 Ga0070659_100605616 Ga0070659_1006056162 77
247 3300005366 Ga0070659_100898875 Ga0070659_1008988751 77
248 3300005366 Ga0070659_100918330 Ga0070659_1009183301 77
249 3300005367 Ga0070667_100000004 Ga0070667_100000004194 77
250 3300005367 Ga0070667_100000670 Ga0070667_10000067011 77
251 3300005367 Ga0070667_100003740 Ga0070667_1000037402 77
252 3300005367 Ga0070667_100015295 Ga0070667_1000152952 77
253 3300005367 Ga0070667_100030252 Ga0070667_1000302522 77
254 3300005367 Ga0070667_100781941 Ga0070667_1007819412 77
255 3300005367 Ga0070667_101328557 Ga0070667_1013285572 77
256 3300005367 Ga0070667_101947116 Ga0070667_1019471161 77
257 3300005367 Ga0070667_102045563 Ga0070667_1020455632 77
258 3300005435 Ga0070714_100211616 Ga0070714_1002116163 77
259 3300005436 Ga0070713_100075070 Ga0070713_1000750703 77
260 3300005438 Ga0070701_10151952 Ga0070701_101519522 77
261 3300005441 Ga0070700_100014819 Ga0070700_1000148191 77
262 3300005444 Ga0070694_100042064 Ga0070694_1000420643 77
263 3300005455 Ga0070663_100006999 Ga0070663_1000069995 77
264 3300005455 Ga0070663_100109543 Ga0070663_1001095433 77
265 3300005455 Ga0070663_100148341 Ga0070663_1001483412 77
266 3300005455 Ga0070663_100199874 Ga0070663_1001998741 77
267 3300005455 Ga0070663_100229736 Ga0070663_1002297362 77
268 3300005455 Ga0070663_100719668 Ga0070663_1007196682 77
269 3300005456 Ga0070678_100014156 Ga0070678_1000141563 77
270 3300005456 Ga0070678_100558019 Ga0070678_1005580192 77
271 3300005456 Ga0070678_101474492 Ga0070678_1014744921 77
272 3300005456 Ga0070678_101492570 Ga0070678_1014925701 77
273 3300005457 Ga0070662_100000920 Ga0070662_10000092011 77
274 3300005457 Ga0070662_100004489 Ga0070662_1000044899 77
275 3300005457 Ga0070662_100079214 Ga0070662_1000792142 77
276 3300005457 Ga0070662_100163838 Ga0070662_1001638382 77
277 3300005457 Ga0070662_100324658 Ga0070662_1003246582 77
278 3300005457 Ga0070662_100642864 Ga0070662_1006428642 77
279 3300005457 Ga0070662_101363958 Ga0070662_1013639582 77
280 3300005458 Ga0070681_10147455 Ga0070681_101474551 77
281 3300005458 Ga0070681_10254922 Ga0070681_102549223 77
282 3300005458 Ga0070681_10279922 Ga0070681_102799222 77
283 3300005458 Ga0070681_10319699 Ga0070681_103196991 77
284 3300005458 Ga0070681_10580449 Ga0070681_105804492 77
285 3300005458 Ga0070681_11687256 Ga0070681_116872562 77
286 3300005459 Ga0068867_100010850 Ga0068867_1000108503 77
287 3300005459 Ga0068867_100016992 Ga0068867_1000169921 77
288 3300005459 Ga0068867_100064427 Ga0068867_1000644273 77
289 3300005459 Ga0068867_100333851 Ga0068867_1003338512 77
290 3300005466 Ga0070685_10000056 Ga0070685_1000005676 77
291 3300005466 Ga0070685_10257114 Ga0070685_102571142 77
292 3300005467 Ga0070706_101138992 Ga0070706_1011389922 77
293 3300005471 Ga0070698_100651167 Ga0070698_1006511671 77
294 3300005530 Ga0070679_100000025 Ga0070679_10000002582 77
295 3300005530 Ga0070679_100286000 Ga0070679_1002860003 77
296 3300005530 Ga0070679_101098061 Ga0070679_1010980612 77
297 3300005530 Ga0070679_101265391 Ga0070679_1012653912 77
298 3300005530 Ga0070679_101350191 Ga0070679_1013501912 77
299 3300005535 Ga0070684_100374066 Ga0070684_1003740662 77
300 3300005539 Ga0068853_100001390 Ga0068853_1000013902 77
301 3300005539 Ga0068853_100051030 Ga0068853_1000510302 77
302 3300005539 Ga0068853_100061648 Ga0068853_1000616484 77
303 3300005539 Ga0068853_100124244 Ga0068853_1001242442 77
304 3300005539 Ga0068853_100140002 Ga0068853_1001400022 77
305 3300005539 Ga0068853_100152907 Ga0068853_1001529072 77
306 3300005539 Ga0068853_100687346 Ga0068853_1006873462 77
307 3300005539 Ga0068853_100725911 Ga0068853_1007259111 77
308 3300005539 Ga0068853_100885909 Ga0068853_1008859092 77
309 3300005539 Ga0068853_101818484 Ga0068853_1018184842 77
310 3300005539 Ga0068853_101823038 Ga0068853_1018230381 77
311 3300005539 Ga0068853_102144935 Ga0068853_1021449351 77
312 3300005543 Ga0070672_100000788 Ga0070672_10000078811 77
313 3300005543 Ga0070672_100009819 Ga0070672_1000098192 77
314 3300005543 Ga0070672_100012979 Ga0070672_1000129798 77
315 3300005543 Ga0070672_100240067 Ga0070672_1002400672 77
316 3300005543 Ga0070672_101059399 Ga0070672_1010593992 77
317 3300005543 Ga0070672_101887035 Ga0070672_1018870352 77
318 3300005544 Ga0070686_100000002 Ga0070686_10000000291 77
319 3300005545 Ga0070695_100092734 Ga0070695_1000927342 77
320 3300005546 Ga0070696_100015724 Ga0070696_1000157242 77
321 3300005546 Ga0070696_100304529 Ga0070696_1003045292 77
322 3300005547 Ga0070693_100378287 Ga0070693_1003782872 77
323 3300005547 Ga0070693_100504753 Ga0070693_1005047532 77
324 3300005547 Ga0070693_100755648 Ga0070693_1007556481 77
325 3300005548 Ga0070665_100000025 Ga0070665_100000025246 77
326 3300005548 Ga0070665_100112634 Ga0070665_1001126342 77
327 3300005548 Ga0070665_100341200 Ga0070665_1003412002 77
328 3300005548 Ga0070665_101179536 Ga0070665_1011795362 77
329 3300005548 Ga0070665_102084741 Ga0070665_1020847412 77
330 3300005563 Ga0068855_100075313 Ga0068855_1000753135 77
331 3300005563 Ga0068855_100143563 Ga0068855_1001435634 77
332 3300005563 Ga0068855_100269055 Ga0068855_1002690552 77
333 3300005563 Ga0068855_100333642 Ga0068855_1003336422 77
334 3300005563 Ga0068855_100336282 Ga0068855_1003362822 77
335 3300005563 Ga0068855_100413261 Ga0068855_1004132612 77
336 3300005563 Ga0068855_100811825 Ga0068855_1008118251 77
337 3300005563 Ga0068855_101941874 Ga0068855_1019418741 77
338 3300005564 Ga0070664_100113168 Ga0070664_1001131682 77
339 3300005564 Ga0070664_100157066 Ga0070664_1001570662 77
340 3300005564 Ga0070664_100199645 Ga0070664_1001996452 77
341 3300005564 Ga0070664_100304936 Ga0070664_1003049361 77
342 3300005564 Ga0070664_100487380 Ga0070664_1004873802 77
343 3300005564 Ga0070664_100767213 Ga0070664_1007672132 77
344 3300005564 Ga0070664_101304521 Ga0070664_1013045212 77
345 3300005577 Ga0068857_100038993 Ga0068857_1000389932 77
346 3300005577 Ga0068857_100048544 Ga0068857_1000485444 77
347 3300005577 Ga0068857_100079797 Ga0068857_1000797973 77
348 3300005577 Ga0068857_100099439 Ga0068857_1000994393 77
349 3300005577 Ga0068857_100136984 Ga0068857_1001369842 77
350 3300005577 Ga0068857_100174040 Ga0068857_1001740402 77
351 3300005577 Ga0068857_101582845 Ga0068857_1015828452 77
352 3300005577 Ga0068857_102083018 Ga0068857_1020830181 77
353 3300005578 Ga0068854_100040893 Ga0068854_1000408932 77
354 3300005578 Ga0068854_100096461 Ga0068854_1000964613 77
355 3300005578 Ga0068854_100108040 Ga0068854_1001080403 77
356 3300005578 Ga0068854_100251074 Ga0068854_1002510742 77
357 3300005578 Ga0068854_100325905 Ga0068854_1003259053 77
358 3300005578 Ga0068854_100342951 Ga0068854_1003429512 77
359 3300005578 Ga0068854_100577753 Ga0068854_1005777532 77
360 3300005578 Ga0068854_100808307 Ga0068854_1008083071 77
361 3300005578 Ga0068854_101142741 Ga0068854_1011427412 77
362 3300005578 Ga0068854_101266594 Ga0068854_1012665942 77
363 3300005578 Ga0068854_101474579 Ga0068854_1014745792 77
364 3300005578 Ga0068854_101846953 Ga0068854_1018469531 77
365 3300005614 Ga0068856_100007187 Ga0068856_1000071877 77
366 3300005614 Ga0068856_100133225 Ga0068856_1001332253 77
367 3300005614 Ga0068856_100296382 Ga0068856_1002963822 77
368 3300005614 Ga0068856_100400886 Ga0068856_1004008862 77
369 3300005614 Ga0068856_100528688 Ga0068856_1005286882 77
370 3300005614 Ga0068856_101071795 Ga0068856_1010717952 77
371 3300005614 Ga0068856_101604464 Ga0068856_1016044642 77
372 3300005614 Ga0068856_102205352 Ga0068856_1022053521 77
373 3300005615 Ga0070702_100167883 Ga0070702_1001678833 77
374 3300005616 Ga0068852_100021324 Ga0068852_1000213243 77
375 3300005616 Ga0068852_100052642 Ga0068852_1000526422 77
376 3300005616 Ga0068852_100119012 Ga0068852_1001190123 77
377 3300005616 Ga0068852_100164820 Ga0068852_1001648202 77
378 3300005616 Ga0068852_100181684 Ga0068852_1001816842 77
379 3300005616 Ga0068852_100399676 Ga0068852_1003996762 77
380 3300005616 Ga0068852_100497178 Ga0068852_1004971782 77
381 3300005616 Ga0068852_100527756 Ga0068852_1005277561 77
382 3300005617 Ga0068859_100001534 Ga0068859_1000015342 77
383 3300005617 Ga0068859_100001912 Ga0068859_1000019123 77
384 3300005617 Ga0068859_100002233 Ga0068859_10000223311 77
385 3300005617 Ga0068859_100010510 Ga0068859_1000105109 77
386 3300005617 Ga0068859_100040483 Ga0068859_1000404837 77
387 3300005617 Ga0068859_100067943 Ga0068859_1000679432 77
388 3300005617 Ga0068859_100084948 Ga0068859_1000849483 77
389 3300005617 Ga0068859_100110159 Ga0068859_1001101593 77
390 3300005617 Ga0068859_100578136 Ga0068859_1005781362 77
391 3300005617 Ga0068859_101598857 Ga0068859_1015988572 77
392 3300005618 Ga0068864_100000011 Ga0068864_10000001130 77
393 3300005618 Ga0068864_100000017 Ga0068864_100000017114 77
394 3300005618 Ga0068864_100034989 Ga0068864_1000349893 77
395 3300005618 Ga0068864_100053264 Ga0068864_1000532643 77
396 3300005618 Ga0068864_100102808 Ga0068864_1001028083 77
397 3300005618 Ga0068864_100134514 Ga0068864_1001345142 77
398 3300005618 Ga0068864_100643829 Ga0068864_1006438292 77
399 3300005718 Ga0068866_10092560 Ga0068866_100925602 77
400 3300005719 Ga0068861_100000005 Ga0068861_10000000570 77
401 3300005719 Ga0068861_100003486 Ga0068861_1000034868 77
402 3300005719 Ga0068861_100003714 Ga0068861_10000371410 77
403 3300005719 Ga0068861_100238258 Ga0068861_1002382582 77
404 3300005719 Ga0068861_100318828 Ga0068861_1003188282 77
405 3300005719 Ga0068861_100413740 Ga0068861_1004137402 77
406 3300005719 Ga0068861_102691819 Ga0068861_1026918191 77
407 3300005834 Ga0068851_10013293 Ga0068851_100132931 77
408 3300005834 Ga0068851_10021275 Ga0068851_100212753 77
409 3300005834 Ga0068851_10072277 Ga0068851_100722772 77
410 3300005834 Ga0068851_10112552 Ga0068851_101125522 77
411 3300005840 Ga0068870_10188231 Ga0068870_101882312 77
412 3300005840 Ga0068870_10350009 Ga0068870_103500091 77
413 3300005840 Ga0068870_10392705 Ga0068870_103927052 77
414 3300005841 Ga0068863_100000018 Ga0068863_10000001832 77
415 3300005841 Ga0068863_100000030 Ga0068863_100000030136 77
416 3300005841 Ga0068863_100000070 Ga0068863_10000007086 77
417 3300005841 Ga0068863_100000901 Ga0068863_1000009012 77
418 3300005841 Ga0068863_100009881 Ga0068863_10000988112 77
419 3300005841 Ga0068863_101778784 Ga0068863_1017787842 77
420 3300005842 Ga0068858_100000248 Ga0068858_10000024840 77
421 3300005842 Ga0068858_100002601 Ga0068858_1000026018 77
422 3300005842 Ga0068858_100012541 Ga0068858_1000125418 77
423 3300005842 Ga0068858_100058143 Ga0068858_1000581434 77
424 3300005842 Ga0068858_101340271 Ga0068858_1013402712 77
425 3300005843 Ga0068860_100000001 Ga0068860_100000001479 77
426 3300005843 Ga0068860_100000002 Ga0068860_100000002185 77
427 3300005843 Ga0068860_100011736 Ga0068860_1000117366 77
428 3300005843 Ga0068860_100282145 Ga0068860_1002821452 77
429 3300005843 Ga0068860_100323963 Ga0068860_1003239632 77
430 3300005843 Ga0068860_101824518 Ga0068860_1018245181 77
431 3300005844 Ga0068862_100000010 Ga0068862_100000010197 77
432 3300005844 Ga0068862_100000011 Ga0068862_100000011204 77
433 3300005844 Ga0068862_100000020 Ga0068862_100000020168 77
434 3300005844 Ga0068862_100000255 Ga0068862_10000025517 77
435 3300005844 Ga0068862_100036790 Ga0068862_1000367904 77
436 3300005844 Ga0068862_100050926 Ga0068862_1000509262 77
437 3300005844 Ga0068862_100069882 Ga0068862_1000698821 77
438 3300005844 Ga0068862_100157758 Ga0068862_1001577583 77
439 3300005844 Ga0068862_100338467 Ga0068862_1003384672 77
440 3300005844 Ga0068862_100343286 Ga0068862_1003432863 77
441 3300005844 Ga0068862_100633598 Ga0068862_1006335982 77
442 3300005844 Ga0068862_100839644 Ga0068862_1008396442 77
443 3300005844 Ga0068862_101448692 Ga0068862_1014486922 77
444 3300005844 Ga0068862_101793863 Ga0068862_1017938631 77
445 3300005844 Ga0068862_102488036 Ga0068862_1024880362 77
446 3300005937 Ga0081455_10000477 Ga0081455_1000047729 77
447 3300005985 Ga0081539_10008339 Ga0081539_100083393 77
448 3300005985 Ga0081539_10034793 Ga0081539_100347934 77
449 3300005985 Ga0081539_10135348 Ga0081539_101353481 77
450 3300006042 Ga0075368_10000012 Ga0075368_100000126 77
451 3300006048 Ga0075363_100271328 Ga0075363_1002713282 77
452 3300006048 Ga0075363_100593850 Ga0075363_1005938502 77
453 3300006058 Ga0075432_10545598 Ga0075432_105455981 77
454 3300006177 Ga0075362_10057504 Ga0075362_100575042 77
455 3300006178 Ga0075367_10077753 Ga0075367_100777531 77
456 3300006195 Ga0075366_10191525 Ga0075366_101915252 77
457 3300006195 Ga0075366_10289984 Ga0075366_102899842 77
458 3300006195 Ga0075366_11053918 Ga0075366_110539181 77
459 3300006237 Ga0097621_100015046 Ga0097621_1000150464 77
460 3300006237 Ga0097621_102298419 Ga0097621_1022984191 77
461 3300006353 Ga0075370_10039836 Ga0075370_100398363 77
462 3300006353 Ga0075370_10181747 Ga0075370_101817471 77
463 3300006353 Ga0075370_10526009 Ga0075370_105260092 77
464 3300006358 Ga0068871_100635875 Ga0068871_1006358752 77
465 3300006358 Ga0068871_101423172 Ga0068871_1014231722 77
466 3300006844 Ga0075428_100162259 Ga0075428_1001622593 77
467 3300006844 Ga0075428_100459352 Ga0075428_1004593522 77
468 3300006846 Ga0075430_100142608 Ga0075430_1001426082 77
469 3300006846 Ga0075430_100152834 Ga0075430_1001528342 77
470 3300006847 Ga0075431_100002601 Ga0075431_1000026011 77
471 3300006871 Ga0075434_100651820 Ga0075434_1006518202 77
472 3300006880 Ga0075429_100168465 Ga0075429_1001684652 77
473 3300006881 Ga0068865_100010982 Ga0068865_1000109823 77
474 3300006931 Ga0097620_100001534 Ga0097620_10000153420 77
475 3300006931 Ga0097620_100001912 Ga0097620_1000019123 77
476 3300006931 Ga0097620_100002233 Ga0097620_10000223311 77
477 3300006931 Ga0097620_100010510 Ga0097620_1000105102 77
478 3300006931 Ga0097620_100040484 Ga0097620_1000404842 77
479 3300006931 Ga0097620_100067944 Ga0097620_1000679442 77
480 3300006931 Ga0097620_100084946 Ga0097620_1000849463 77
481 3300006931 Ga0097620_100110159 Ga0097620_1001101593 77
482 3300006931 Ga0097620_100578220 Ga0097620_1005782202 77
483 3300006931 Ga0097620_101598710 Ga0097620_1015987102 77
484 3300007788 Ga0099795_10535447 Ga0099795_105354472 77
485 3300009011 Ga0105251_10002397 Ga0105251_100023974 77
486 3300009011 Ga0105251_10037097 Ga0105251_100370972 77
487 3300009092 Ga0105250_10267487 Ga0105250_102674872 77
488 3300009092 Ga0105250_10396659 Ga0105250_103966591 77
489 3300009092 Ga0105250_10433087 Ga0105250_104330871 77
490 3300009093 Ga0105240_10007112 Ga0105240_1000711217 77
491 3300009093 Ga0105240_10035093 Ga0105240_100350937 77
492 3300009093 Ga0105240_10044699 Ga0105240_100446993 77
493 3300009093 Ga0105240_10258816 Ga0105240_102588162 77
494 3300009093 Ga0105240_10326080 Ga0105240_103260802 77
495 3300009093 Ga0105240_10368136 Ga0105240_103681362 77
496 3300009093 Ga0105240_10961671 Ga0105240_109616712 77
497 3300009093 Ga0105240_11968366 Ga0105240_119683661 77
498 3300009093 Ga0105240_12596872 Ga0105240_125968721 77
499 3300009094 Ga0111539_10088855 Ga0111539_100888553 77
500 3300009094 Ga0111539_10275559 Ga0111539_102755592 77
501 3300009094 Ga0111539_10823079 Ga0111539_108230792 77
502 3300009094 Ga0111539_11146779 Ga0111539_111467792 77
503 3300009098 Ga0105245_10004049 Ga0105245_100040496 77
504 3300009101 Ga0105247_10034327 Ga0105247_100343272 77
505 3300009101 Ga0105247_10051265 Ga0105247_100512653 77
506 3300009147 Ga0114129_10073524 Ga0114129_100735242 77
507 3300009147 Ga0114129_10316914 Ga0114129_103169143 77
508 3300009147 Ga0114129_11129727 Ga0114129_111297272 77
509 3300009147 Ga0114129_11167469 Ga0114129_111674692 77
510 3300009148 Ga0105243_10214400 Ga0105243_102144002 77
511 3300009148 Ga0105243_10246884 Ga0105243_102468842 77
512 3300009148 Ga0105243_10598297 Ga0105243_105982972 77
513 3300009148 Ga0105243_10670454 Ga0105243_106704542 77
514 3300009148 Ga0105243_12414960 Ga0105243_124149602 77
515 3300009174 Ga0105241_10055904 Ga0105241_100559043 77
516 3300009174 Ga0105241_10298488 Ga0105241_102984882 77
517 3300009174 Ga0105241_10458444 Ga0105241_104584442 77
518 3300009174 Ga0105241_11622954 Ga0105241_116229541 77
519 3300009176 Ga0105242_13018527 Ga0105242_130185272 77
520 3300009177 Ga0105248_10000921 Ga0105248_1000092132 77
521 3300009177 Ga0105248_10001148 Ga0105248_100011489 77
522 3300009177 Ga0105248_10002326 Ga0105248_100023266 77
523 3300009177 Ga0105248_10109542 Ga0105248_101095423 77
524 3300009177 Ga0105248_10126111 Ga0105248_101261113 77
525 3300009177 Ga0105248_10229360 Ga0105248_102293602 77
526 3300009177 Ga0105248_11122103 Ga0105248_111221032 77
527 3300009545 Ga0105237_10003097 Ga0105237_1000309717 77
528 3300009545 Ga0105237_10013689 Ga0105237_100136898 77
529 3300009545 Ga0105237_10142781 Ga0105237_101427812 77
530 3300009545 Ga0105237_10588228 Ga0105237_105882282 77
531 3300009545 Ga0105237_10590424 Ga0105237_105904242 77
532 3300009545 Ga0105237_10698836 Ga0105237_106988362 77
533 3300009551 Ga0105238_10083197 Ga0105238_100831972 77
534 3300009551 Ga0105238_10101457 Ga0105238_101014572 77
535 3300009551 Ga0105238_10199059 Ga0105238_101990592 77
536 3300009551 Ga0105238_10291589 Ga0105238_102915892 77
537 3300009551 Ga0105238_10376200 Ga0105238_103762002 77
538 3300009551 Ga0105238_10719275 Ga0105238_107192752 77
539 3300009551 Ga0105238_10790679 Ga0105238_107906792 77
540 3300009551 Ga0105238_10957419 Ga0105238_109574192 77
541 3300009553 Ga0105249_10000005 Ga0105249_10000005261 77
542 3300009553 Ga0105249_10000489 Ga0105249_1000048921 77
543 3300009553 Ga0105249_10020669 Ga0105249_100206693 77
544 3300009553 Ga0105249_10155669 Ga0105249_101556692 77
545 3300009553 Ga0105249_10155974 Ga0105249_101559742 77
546 3300009553 Ga0105249_10324300 Ga0105249_103243003 77
547 3300009553 Ga0105249_10325643 Ga0105249_103256431 77
548 3300009553 Ga0105249_10985142 Ga0105249_109851422 77
549 3300009553 Ga0105249_11238004 Ga0105249_112380041 77
550 3300009553 Ga0105249_12726551 Ga0105249_127265512 77
551 3300009978 Ga0105148_100107 Ga0105148_10010711 77
552 3300009978 Ga0105148_117298 Ga0105148_1172982 77
553 3300009979 Ga0105032_105966 Ga0105032_1059662 77
554 3300009982 Ga0105147_100777 Ga0105147_1007773 77
555 3300009993 Ga0105028_136136 Ga0105028_1361361 77
556 3300010375 Ga0105239_10000104 Ga0105239_1000010425 77
557 3300010375 Ga0105239_10097588 Ga0105239_100975882 77
558 3300010375 Ga0105239_10736233 Ga0105239_107362332 77
559 3300010375 Ga0105239_11154226 Ga0105239_111542261 77
560 3300010375 Ga0105239_11975720 Ga0105239_119757202 77
561 3300010375 Ga0105239_12129963 Ga0105239_121299632 77
562 3300012495 Ga0157323_1049476 Ga0157323_10494761 77
563 3300012498 Ga0157345_1031392 Ga0157345_10313922 77
564 3300012507 Ga0157342_1005268 Ga0157342_10052682 77
565 3300012510 Ga0157316_1008431 Ga0157316_10084312 77
566 3300012513 Ga0157326_1000620 Ga0157326_10006203 77
567 3300013100 Ga0157373_10003953 Ga0157373_100039537 77
568 3300013100 Ga0157373_10093168 Ga0157373_100931682 77
569 3300013100 Ga0157373_10147691 Ga0157373_101476912 77
570 3300013100 Ga0157373_10224784 Ga0157373_102247842 77
571 3300013100 Ga0157373_10260491 Ga0157373_102604912 77
572 3300013100 Ga0157373_10384666 Ga0157373_103846662 77
573 3300013100 Ga0157373_10406961 Ga0157373_104069612 77
574 3300013100 Ga0157373_10408188 Ga0157373_104081882 77
575 3300013100 Ga0157373_10752409 Ga0157373_107524092 77
576 3300013100 Ga0157373_11223534 Ga0157373_112235342 77
577 3300013102 Ga0157371_10027559 Ga0157371_100275596 77
578 3300013102 Ga0157371_10045505 Ga0157371_100455053 77
579 3300013102 Ga0157371_10126340 Ga0157371_101263402 77
580 3300013102 Ga0157371_10669992 Ga0157371_106699922 77
581 3300013102 Ga0157371_11120168 Ga0157371_111201682 77
582 3300013104 Ga0157370_10002107 Ga0157370_1000210713 77
583 3300013104 Ga0157370_10037341 Ga0157370_100373412 77
584 3300013104 Ga0157370_10395335 Ga0157370_103953352 77
585 3300013104 Ga0157370_10411952 Ga0157370_104119522 77
586 3300013104 Ga0157370_10457591 Ga0157370_104575912 77
587 3300013104 Ga0157370_10563423 Ga0157370_105634231 77
588 3300013104 Ga0157370_10599228 Ga0157370_105992282 77
589 3300013104 Ga0157370_11386059 Ga0157370_113860591 77
590 3300013104 Ga0157370_11979282 Ga0157370_119792821 77
591 3300013104 Ga0157370_12078253 Ga0157370_120782531 77
592 3300013105 Ga0157369_10000833 Ga0157369_100008335 77
593 3300013105 Ga0157369_10002370 Ga0157369_1000237023 77
594 3300013105 Ga0157369_10005676 Ga0157369_1000567616 77
595 3300013105 Ga0157369_10023976 Ga0157369_100239762 77
596 3300013105 Ga0157369_10160855 Ga0157369_101608552 77
597 3300013105 Ga0157369_10261890 Ga0157369_102618901 77
598 3300013105 Ga0157369_10288736 Ga0157369_102887363 77
599 3300013105 Ga0157369_10379018 Ga0157369_103790183 77
600 3300013105 Ga0157369_10560956 Ga0157369_105609561 77
601 3300013105 Ga0157369_10622649 Ga0157369_106226492 77
602 3300013105 Ga0157369_10877771 Ga0157369_108777712 77
603 3300013105 Ga0157369_10934271 Ga0157369_109342712 77
604 3300013105 Ga0157369_11930034 Ga0157369_119300341 77
605 3300013296 Ga0157374_10083974 Ga0157374_100839742 77
606 3300013296 Ga0157374_10184723 Ga0157374_101847233 77
607 3300013296 Ga0157374_11741176 Ga0157374_117411761 77
608 3300013297 Ga0157378_10079970 Ga0157378_100799702 77
609 3300013297 Ga0157378_10277844 Ga0157378_102778442 77
610 3300013297 Ga0157378_10550272 Ga0157378_105502722 77
611 3300013297 Ga0157378_13186711 Ga0157378_131867112 77
612 3300013306 Ga0163162_10080600 Ga0163162_100806002 77
613 3300013306 Ga0163162_10245634 Ga0163162_102456342 77
614 3300013306 Ga0163162_10267966 Ga0163162_102679662 77
615 3300013306 Ga0163162_10604084 Ga0163162_106040842 77
616 3300013306 Ga0163162_10788502 Ga0163162_107885022 77
617 3300013306 Ga0163162_10854465 Ga0163162_108544652 77
618 3300013306 Ga0163162_11038897 Ga0163162_110388972 77
619 3300013306 Ga0163162_11670708 Ga0163162_116707082 77
620 3300013307 Ga0157372_10157109 Ga0157372_101571092 77
621 3300013307 Ga0157372_10637849 Ga0157372_106378492 77
622 3300013307 Ga0157372_10649167 Ga0157372_106491672 77
623 3300013307 Ga0157372_10868332 Ga0157372_108683322 77
624 3300013307 Ga0157372_11089751 Ga0157372_110897512 77
625 3300013308 Ga0157375_10427538 Ga0157375_104275382 77
626 3300013308 Ga0157375_10606942 Ga0157375_106069422 77
627 3300013308 Ga0157375_10737323 Ga0157375_107373232 77
628 3300013308 Ga0157375_12366502 Ga0157375_123665021 77
629 3300013308 Ga0157375_12532656 Ga0157375_125326562 77
630 3300013308 Ga0157375_13045609 Ga0157375_130456091 77
631 3300014325 Ga0163163_10128874 Ga0163163_101288742 77
632 3300014325 Ga0163163_10188131 Ga0163163_101881312 77
633 3300014325 Ga0163163_10991935 Ga0163163_109919352 77
634 3300014326 Ga0157380_10000280 Ga0157380_100002809 77
635 3300014326 Ga0157380_10000287 Ga0157380_1000028720 77
636 3300014326 Ga0157380_10001415 Ga0157380_1000141518 77
637 3300014326 Ga0157380_10003876 Ga0157380_100038763 77
638 3300014326 Ga0157380_10008397 Ga0157380_100083978 77
639 3300014326 Ga0157380_10073817 Ga0157380_100738172 77
640 3300014326 Ga0157380_10103919 Ga0157380_101039193 77
641 3300014326 Ga0157380_10548471 Ga0157380_105484712 77
642 3300014326 Ga0157380_13525983 Ga0157380_135259832 77
643 3300014497 Ga0182008_10788773 Ga0182008_107887732 77
644 3300014745 Ga0157377_10172942 Ga0157377_101729422 77
645 3300014745 Ga0157377_10215324 Ga0157377_102153241 77
646 3300014968 Ga0157379_10160772 Ga0157379_101607722 77
647 3300014968 Ga0157379_10283392 Ga0157379_102833922 77
648 3300015690 Ga0183363_1001 Ga0183363_1001514 77
649 3300017792 Ga0163161_10002791 Ga0163161_100027914 77
650 3300017792 Ga0163161_10051052 Ga0163161_100510521 77
651 3300017792 Ga0163161_10451042 Ga0163161_104510422 77
652 3300017792 Ga0163161_10677483 Ga0163161_106774832 77
653 3300017792 Ga0163161_11000349 Ga0163161_110003491 77
654 3300017792 Ga0163161_11504673 Ga0163161_115046731 77
655 3300020069 Ga0197907_10371562 Ga0197907_103715622 77
656 3300020069 Ga0197907_10636746 Ga0197907_106367462 77
657 3300020069 Ga0197907_11433208 Ga0197907_114332081 77
658 3300020069 Ga0197907_11463038 Ga0197907_114630381 77
659 3300020070 Ga0206356_10232349 Ga0206356_102323492 77
660 3300020070 Ga0206356_11392980 Ga0206356_113929801 77
661 3300020075 Ga0206349_1471077 Ga0206349_14710771 77
662 3300020075 Ga0206349_1612579 Ga0206349_16125791 77
663 3300020075 Ga0206349_1633633 Ga0206349_16336331 77
664 3300020076 Ga0206355_1042636 Ga0206355_10426362 77
665 3300020076 Ga0206355_1322866 Ga0206355_13228661 77
666 3300020076 Ga0206355_1569335 Ga0206355_15693352 77
667 3300020077 Ga0206351_10176166 Ga0206351_101761661 77
668 3300020080 Ga0206350_10216588 Ga0206350_102165881 77
669 3300020080 Ga0206350_10528454 Ga0206350_105284541 77
670 3300020081 Ga0206354_10799011 Ga0206354_107990112 77
671 3300020081 Ga0206354_10900097 Ga0206354_109000972 77
672 3300020081 Ga0206354_10916235 Ga0206354_109162352 77
673 3300020081 Ga0206354_11251771 Ga0206354_112517711 77
674 3300020081 Ga0206354_11323271 Ga0206354_113232711 77
675 3300020082 Ga0206353_10888205 Ga0206353_108882051 77
676 3300020082 Ga0206353_11643594 Ga0206353_116435941 77
677 3300020082 Ga0206353_11883278 Ga0206353_118832781 77
678 3300021358 Ga0213873_10000009 Ga0213873_10000009127 77
679 3300021358 Ga0213873_10325015 Ga0213873_103250151 77
680 3300021361 Ga0213872_10071737 Ga0213872_100717372 77
681 3300021361 Ga0213872_10188882 Ga0213872_101888822 77
682 3300021377 Ga0213874_10246781 Ga0213874_102467812 77
683 3300021384 Ga0213876_10000004 Ga0213876_10000004190 77
684 3300021384 Ga0213876_10004806 Ga0213876_100048065 77
685 3300021384 Ga0213876_10012151 Ga0213876_100121515 77
686 3300021384 Ga0213876_10105760 Ga0213876_101057602 77
687 3300021384 Ga0213876_10302052 Ga0213876_103020522 77
688 3300021388 Ga0213875_10000394 Ga0213875_1000039435 77
689 3300021388 Ga0213875_10268652 Ga0213875_102686522 77
690 3300021441 Ga0213871_10011291 Ga0213871_100112913 77
691 3300022467 Ga0224712_10198930 Ga0224712_101989302 77
692 3300022467 Ga0224712_10351621 Ga0224712_103516211 77
693 3300022467 Ga0224712_10652851 Ga0224712_106528511 77
694 3300025223 Ga0207672_1001090 Ga0207672_10010902 77
695 3300025223 Ga0207672_1005545 Ga0207672_10055451 77
696 3300025229 Ga0209147_105068 Ga0209147_1050683 77
697 3300025231 Ga0207427_119234 Ga0207427_1192342 77
698 3300025233 Ga0209437_113268 Ga0209437_1132682 77
699 3300025250 Ga0209026_1048449 Ga0209026_10484491 77
700 3300025261 Ga0209233_1000066 Ga0209233_10000663 77
701 3300025271 Ga0207666_1040503 Ga0207666_10405031 77
702 3300025271 Ga0207666_1043211 Ga0207666_10432112 77
703 3300025272 Ga0209455_1037683 Ga0209455_10376832 77
704 3300025290 Ga0207673_1034985 Ga0207673_10349851 77
705 3300025291 Ga0209675_1000833 Ga0209675_10008335 77
706 3300025292 Ga0209676_1000070 Ga0209676_10000709 77
707 3300025292 Ga0209676_1000236 Ga0209676_100023676 77
708 3300025292 Ga0209676_1000296 Ga0209676_100029682 77
709 3300025292 Ga0209676_1050598 Ga0209676_10505982 77
710 3300025294 Ga0209025_1016016 Ga0209025_10160165 77
711 3300025294 Ga0209025_1047301 Ga0209025_10473012 77
712 3300025298 Ga0209050_1000132 Ga0209050_1000132153 77
713 3300025298 Ga0209050_1037474 Ga0209050_10374742 77
714 3300025304 Ga0209257_1000250 Ga0209257_1000250126 77
715 3300025304 Ga0209257_1000517 Ga0209257_100051743 77
716 3300025304 Ga0209257_1002076 Ga0209257_100207621 77
717 3300025304 Ga0209257_1026973 Ga0209257_10269732 77
718 3300025315 Ga0207697_10001194 Ga0207697_100011943 77
719 3300025315 Ga0207697_10029183 Ga0207697_100291832 77
720 3300025315 Ga0207697_10165297 Ga0207697_101652972 77
721 3300025315 Ga0207697_10243643 Ga0207697_102436432 77
722 3300025321 Ga0207656_10089641 Ga0207656_100896412 77
723 3300025321 Ga0207656_10157092 Ga0207656_101570922 77
724 3300025321 Ga0207656_10165581 Ga0207656_101655812 77
725 3300025321 Ga0207656_10166623 Ga0207656_101666232 77
726 3300025711 Ga0207696_1143538 Ga0207696_11435381 77
727 3300025735 Ga0207713_1002993 Ga0207713_100299315 77
728 3300025735 Ga0207713_1041068 Ga0207713_10410682 77
729 3300025893 Ga0207682_10001410 Ga0207682_100014104 77
730 3300025893 Ga0207682_10090862 Ga0207682_100908622 77
731 3300025893 Ga0207682_10114856 Ga0207682_101148562 77
732 3300025900 Ga0207710_10029536 Ga0207710_100295362 77
733 3300025900 Ga0207710_10095048 Ga0207710_100950482 77
734 3300025901 Ga0207688_10022901 Ga0207688_100229013 77
735 3300025901 Ga0207688_10035051 Ga0207688_100350512 77
736 3300025901 Ga0207688_10290983 Ga0207688_102909832 77
737 3300025903 Ga0207680_10000004 Ga0207680_10000004389 77
738 3300025903 Ga0207680_10267408 Ga0207680_102674082 77
739 3300025903 Ga0207680_10634105 Ga0207680_106341052 77
740 3300025904 Ga0207647_10000376 Ga0207647_1000037634 77
741 3300025904 Ga0207647_10069037 Ga0207647_100690371 77
742 3300025904 Ga0207647_10085390 Ga0207647_100853902 77
743 3300025904 Ga0207647_10419225 Ga0207647_104192251 77
744 3300025904 Ga0207647_10589405 Ga0207647_105894051 77
745 3300025906 Ga0207699_11124315 Ga0207699_111243152 77
746 3300025907 Ga0207645_10003349 Ga0207645_100033492 77
747 3300025907 Ga0207645_10007869 Ga0207645_100078692 77
748 3300025907 Ga0207645_10056219 Ga0207645_100562192 77
749 3300025907 Ga0207645_10315192 Ga0207645_103151922 77
750 3300025908 Ga0207643_10123878 Ga0207643_101238782 77
751 3300025908 Ga0207643_10313556 Ga0207643_103135562 77
752 3300025909 Ga0207705_10000002 Ga0207705_100000021570 77
753 3300025909 Ga0207705_10002599 Ga0207705_1000259914 77
754 3300025909 Ga0207705_10043461 Ga0207705_100434612 77
755 3300025909 Ga0207705_10452377 Ga0207705_104523772 77
756 3300025909 Ga0207705_10463279 Ga0207705_104632792 77
757 3300025909 Ga0207705_10926773 Ga0207705_109267731 77
758 3300025910 Ga0207684_11207438 Ga0207684_112074382 77
759 3300025911 Ga0207654_10002603 Ga0207654_100026033 77
760 3300025911 Ga0207654_10032763 Ga0207654_100327633 77
761 3300025911 Ga0207654_10875114 Ga0207654_108751142 77
762 3300025911 Ga0207654_10941192 Ga0207654_109411922 77
763 3300025912 Ga0207707_10206991 Ga0207707_102069913 77
764 3300025912 Ga0207707_10276059 Ga0207707_102760592 77
765 3300025912 Ga0207707_10376581 Ga0207707_103765812 77
766 3300025912 Ga0207707_10439424 Ga0207707_104394242 77
767 3300025912 Ga0207707_11049544 Ga0207707_110495442 77
768 3300025913 Ga0207695_10012776 Ga0207695_100127767 77
769 3300025913 Ga0207695_10015462 Ga0207695_100154624 77
770 3300025913 Ga0207695_10017424 Ga0207695_1001742412 77
771 3300025913 Ga0207695_10058321 Ga0207695_100583212 77
772 3300025913 Ga0207695_10095536 Ga0207695_100955362 77
773 3300025913 Ga0207695_10499395 Ga0207695_104993952 77
774 3300025913 Ga0207695_10636433 Ga0207695_106364332 77
775 3300025913 Ga0207695_10912089 Ga0207695_109120892 77
776 3300025914 Ga0207671_10001907 Ga0207671_100019073 77
777 3300025914 Ga0207671_10027831 Ga0207671_100278313 77
778 3300025914 Ga0207671_10035937 Ga0207671_100359373 77
779 3300025914 Ga0207671_10259591 Ga0207671_102595912 77
780 3300025914 Ga0207671_11064615 Ga0207671_110646152 77
781 3300025917 Ga0207660_10000730 Ga0207660_1000073010 77
782 3300025917 Ga0207660_10454896 Ga0207660_104548962 77
783 3300025917 Ga0207660_10505044 Ga0207660_105050442 77
784 3300025918 Ga0207662_10097273 Ga0207662_100972732 77
785 3300025918 Ga0207662_11208081 Ga0207662_112080812 77
786 3300025919 Ga0207657_10000763 Ga0207657_1000076318 77
787 3300025919 Ga0207657_10003354 Ga0207657_100033547 77
788 3300025919 Ga0207657_10011736 Ga0207657_100117369 77
789 3300025919 Ga0207657_10029902 Ga0207657_100299023 77
790 3300025919 Ga0207657_10033116 Ga0207657_100331162 77
791 3300025919 Ga0207657_10378106 Ga0207657_103781062 77
792 3300025920 Ga0207649_10000536 Ga0207649_1000053614 77
793 3300025920 Ga0207649_10160061 Ga0207649_101600611 77
794 3300025920 Ga0207649_10184895 Ga0207649_101848952 77
795 3300025920 Ga0207649_10485630 Ga0207649_104856302 77
796 3300025920 Ga0207649_10608622 Ga0207649_106086222 77
797 3300025920 Ga0207649_11245497 Ga0207649_112454972 77
798 3300025921 Ga0207652_10000042 Ga0207652_1000004281 77
799 3300025921 Ga0207652_10041079 Ga0207652_100410793 77
800 3300025921 Ga0207652_10395581 Ga0207652_103955812 77
801 3300025921 Ga0207652_10561506 Ga0207652_105615062 77
802 3300025921 Ga0207652_10901012 Ga0207652_109010122 77
803 3300025923 Ga0207681_10000001 Ga0207681_10000001627 77
804 3300025923 Ga0207681_10000130 Ga0207681_1000013067 77
805 3300025923 Ga0207681_10001009 Ga0207681_100010097 77
806 3300025923 Ga0207681_10021225 Ga0207681_100212252 77
807 3300025923 Ga0207681_10059518 Ga0207681_100595182 77
808 3300025923 Ga0207681_10146486 Ga0207681_101464862 77
809 3300025923 Ga0207681_10182921 Ga0207681_101829212 77
810 3300025923 Ga0207681_10249388 Ga0207681_102493883 77
811 3300025923 Ga0207681_10391942 Ga0207681_103919422 77
812 3300025923 Ga0207681_10510291 Ga0207681_105102912 77
813 3300025923 Ga0207681_10532161 Ga0207681_105321612 77
814 3300025923 Ga0207681_10623207 Ga0207681_106232072 77
815 3300025923 Ga0207681_10698801 Ga0207681_106988012 77
816 3300025924 Ga0207694_10003700 Ga0207694_100037004 77
817 3300025924 Ga0207694_10037001 Ga0207694_100370013 77
818 3300025924 Ga0207694_10061168 Ga0207694_100611683 77
819 3300025924 Ga0207694_10062325 Ga0207694_100623252 77
820 3300025924 Ga0207694_10125700 Ga0207694_101257002 77
821 3300025924 Ga0207694_10215878 Ga0207694_102158782 77
822 3300025924 Ga0207694_10223696 Ga0207694_102236962 77
823 3300025924 Ga0207694_10400438 Ga0207694_104004382 77
824 3300025924 Ga0207694_10612031 Ga0207694_106120312 77
825 3300025924 Ga0207694_10798891 Ga0207694_107988911 77
826 3300025924 Ga0207694_10895931 Ga0207694_108959312 77
827 3300025924 Ga0207694_11622580 Ga0207694_116225802 77
828 3300025925 Ga0207650_10000018 Ga0207650_1000001833 77
829 3300025925 Ga0207650_10000196 Ga0207650_1000019610 77
830 3300025925 Ga0207650_10002118 Ga0207650_100021185 77
831 3300025925 Ga0207650_10005659 Ga0207650_100056592 77
832 3300025925 Ga0207650_10022534 Ga0207650_100225345 77
833 3300025925 Ga0207650_10028323 Ga0207650_100283233 77
834 3300025925 Ga0207650_10067278 Ga0207650_100672783 77
835 3300025925 Ga0207650_10076428 Ga0207650_100764282 77
836 3300025925 Ga0207650_10101939 Ga0207650_101019392 77
837 3300025925 Ga0207650_10429505 Ga0207650_104295051 77
838 3300025925 Ga0207650_11130728 Ga0207650_111307282 77
839 3300025926 Ga0207659_10003573 Ga0207659_100035733 77
840 3300025926 Ga0207659_10276532 Ga0207659_102765322 77
841 3300025926 Ga0207659_10621112 Ga0207659_106211121 77
842 3300025926 Ga0207659_10766559 Ga0207659_107665592 77
843 3300025927 Ga0207687_10004338 Ga0207687_1000433814 77
844 3300025928 Ga0207700_10038154 Ga0207700_100381543 77
845 3300025928 Ga0207700_10196533 Ga0207700_101965332 77
846 3300025929 Ga0207664_10023835 Ga0207664_100238353 77
847 3300025929 Ga0207664_10066816 Ga0207664_100668163 77
848 3300025931 Ga0207644_10000029 Ga0207644_1000002924 77
849 3300025931 Ga0207644_10000096 Ga0207644_1000009653 77
850 3300025931 Ga0207644_10001859 Ga0207644_1000185913 77
851 3300025931 Ga0207644_10084083 Ga0207644_100840832 77
852 3300025931 Ga0207644_10550954 Ga0207644_105509542 77
853 3300025932 Ga0207690_10003860 Ga0207690_1000386012 77
854 3300025932 Ga0207690_10022506 Ga0207690_100225064 77
855 3300025932 Ga0207690_10174914 Ga0207690_101749142 77
856 3300025932 Ga0207690_10178970 Ga0207690_101789703 77
857 3300025932 Ga0207690_10184819 Ga0207690_101848192 77
858 3300025932 Ga0207690_10246785 Ga0207690_102467852 77
859 3300025932 Ga0207690_10485371 Ga0207690_104853712 77
860 3300025932 Ga0207690_10941878 Ga0207690_109418781 77
861 3300025932 Ga0207690_11053117 Ga0207690_110531171 77
862 3300025932 Ga0207690_11221328 Ga0207690_112213282 77
863 3300025933 Ga0207706_10000401 Ga0207706_100004017 77
864 3300025933 Ga0207706_10005540 Ga0207706_100055405 77
865 3300025933 Ga0207706_10030894 Ga0207706_100308947 77
866 3300025933 Ga0207706_10101549 Ga0207706_101015493 77
867 3300025933 Ga0207706_10162322 Ga0207706_101623222 77
868 3300025933 Ga0207706_10463068 Ga0207706_104630682 77
869 3300025933 Ga0207706_10679394 Ga0207706_106793942 77
870 3300025933 Ga0207706_10760624 Ga0207706_107606242 77
871 3300025933 Ga0207706_11436647 Ga0207706_114366471 77
872 3300025935 Ga0207709_10444855 Ga0207709_104448552 77
873 3300025936 Ga0207670_10034886 Ga0207670_100348862 77
874 3300025936 Ga0207670_10550434 Ga0207670_105504342 77
875 3300025937 Ga0207669_10018828 Ga0207669_100188283 77
876 3300025937 Ga0207669_10535697 Ga0207669_105356971 77
877 3300025937 Ga0207669_11886905 Ga0207669_118869052 77
878 3300025938 Ga0207704_10099860 Ga0207704_100998602 77
879 3300025938 Ga0207704_10468528 Ga0207704_104685282 77
880 3300025940 Ga0207691_10005155 Ga0207691_1000515511 77
881 3300025940 Ga0207691_10007278 Ga0207691_1000727810 77
882 3300025940 Ga0207691_10184786 Ga0207691_101847862 77
883 3300025940 Ga0207691_10206199 Ga0207691_102061992 77
884 3300025940 Ga0207691_11054826 Ga0207691_110548262 77
885 3300025941 Ga0207711_10000031 Ga0207711_10000031198 77
886 3300025941 Ga0207711_10004033 Ga0207711_1000403312 77
887 3300025941 Ga0207711_10010695 Ga0207711_100106951 77
888 3300025941 Ga0207711_10059741 Ga0207711_100597413 77
889 3300025941 Ga0207711_11155258 Ga0207711_111552582 77
890 3300025942 Ga0207689_10094296 Ga0207689_100942963 77
891 3300025942 Ga0207689_10199886 Ga0207689_101998862 77
892 3300025942 Ga0207689_10843300 Ga0207689_108433001 77
893 3300025944 Ga0207661_10128194 Ga0207661_101281943 77
894 3300025944 Ga0207661_10705128 Ga0207661_107051282 77
895 3300025944 Ga0207661_11235048 Ga0207661_112350482 77
896 3300025945 Ga0207679_10339968 Ga0207679_103399683 77
897 3300025945 Ga0207679_10447129 Ga0207679_104471291 77
898 3300025945 Ga0207679_10742477 Ga0207679_107424772 77
899 3300025945 Ga0207679_11450824 Ga0207679_114508242 77
900 3300025945 Ga0207679_11629854 Ga0207679_116298541 77
901 3300025945 Ga0207679_11759717 Ga0207679_117597172 77
902 3300025945 Ga0207679_11761720 Ga0207679_117617201 77
903 3300025949 Ga0207667_10036815 Ga0207667_100368153 77
904 3300025949 Ga0207667_10085889 Ga0207667_100858892 77
905 3300025949 Ga0207667_10096186 Ga0207667_100961862 77
906 3300025949 Ga0207667_10134292 Ga0207667_101342921 77
907 3300025949 Ga0207667_10357577 Ga0207667_103575771 77
908 3300025949 Ga0207667_10434364 Ga0207667_104343642 77
909 3300025949 Ga0207667_10643427 Ga0207667_106434272 77
910 3300025949 Ga0207667_11330468 Ga0207667_113304682 77
911 3300025949 Ga0207667_11358599 Ga0207667_113585991 77
912 3300025960 Ga0207651_10001720 Ga0207651_100017203 77
913 3300025960 Ga0207651_10038906 Ga0207651_100389065 77
914 3300025960 Ga0207651_10386437 Ga0207651_103864372 77
915 3300025960 Ga0207651_10914535 Ga0207651_109145352 77
916 3300025961 Ga0207712_10000001 Ga0207712_10000001263 77
917 3300025961 Ga0207712_10000550 Ga0207712_1000055017 77
918 3300025961 Ga0207712_10015962 Ga0207712_100159623 77
919 3300025961 Ga0207712_10211097 Ga0207712_102110971 77
920 3300025961 Ga0207712_10235082 Ga0207712_102350821 77
921 3300025961 Ga0207712_10315862 Ga0207712_103158622 77
922 3300025961 Ga0207712_10351104 Ga0207712_103511041 77
923 3300025961 Ga0207712_10381660 Ga0207712_103816602 77
924 3300025961 Ga0207712_11277930 Ga0207712_112779301 77
925 3300025972 Ga0207668_10000008 Ga0207668_10000008108 77
926 3300025972 Ga0207668_10000021 Ga0207668_1000002138 77
927 3300025972 Ga0207668_10000624 Ga0207668_1000062410 77
928 3300025972 Ga0207668_10002999 Ga0207668_1000299911 77
929 3300025972 Ga0207668_10004145 Ga0207668_100041451 77
930 3300025972 Ga0207668_10062560 Ga0207668_100625603 77
931 3300025972 Ga0207668_10080343 Ga0207668_100803433 77
932 3300025972 Ga0207668_10082031 Ga0207668_100820312 77
933 3300025972 Ga0207668_10087733 Ga0207668_100877331 77
934 3300025972 Ga0207668_10190011 Ga0207668_101900113 77
935 3300025972 Ga0207668_10316001 Ga0207668_103160012 77
936 3300025972 Ga0207668_10356715 Ga0207668_103567152 77
937 3300025972 Ga0207668_10906976 Ga0207668_109069762 77
938 3300025972 Ga0207668_11041062 Ga0207668_110410622 77
939 3300025972 Ga0207668_11138021 Ga0207668_111380212 77
940 3300025972 Ga0207668_11275072 Ga0207668_112750722 77
941 3300025981 Ga0207640_10000560 Ga0207640_1000056023 77
942 3300025981 Ga0207640_10014052 Ga0207640_100140523 77
943 3300025981 Ga0207640_10031495 Ga0207640_100314954 77
944 3300025981 Ga0207640_10083055 Ga0207640_100830552 77
945 3300025981 Ga0207640_10140789 Ga0207640_101407892 77
946 3300025981 Ga0207640_10174590 Ga0207640_101745903 77
947 3300025981 Ga0207640_10199803 Ga0207640_101998032 77
948 3300025981 Ga0207640_10203333 Ga0207640_102033332 77
949 3300025981 Ga0207640_11002240 Ga0207640_110022401 77
950 3300025981 Ga0207640_11662959 Ga0207640_116629591 77
951 3300025981 Ga0207640_11785253 Ga0207640_117852531 77
952 3300025986 Ga0207658_10000002 Ga0207658_10000002487 77
953 3300025986 Ga0207658_10001041 Ga0207658_100010414 77
954 3300025986 Ga0207658_10003252 Ga0207658_1000325213 77
955 3300025986 Ga0207658_10003274 Ga0207658_100032744 77
956 3300025986 Ga0207658_10013577 Ga0207658_100135774 77
957 3300025986 Ga0207658_10023418 Ga0207658_100234183 77
958 3300025986 Ga0207658_10219927 Ga0207658_102199272 77
959 3300025986 Ga0207658_10535682 Ga0207658_105356822 77
960 3300025986 Ga0207658_11510205 Ga0207658_115102052 77
961 3300026035 Ga0207703_10000564 Ga0207703_1000056411 77
962 3300026035 Ga0207703_10000572 Ga0207703_100005727 77
963 3300026035 Ga0207703_10005970 Ga0207703_100059709 77
964 3300026035 Ga0207703_10162538 Ga0207703_101625382 77
965 3300026035 Ga0207703_10709461 Ga0207703_107094612 77
966 3300026041 Ga0207639_10003713 Ga0207639_1000371312 77
967 3300026041 Ga0207639_10006054 Ga0207639_100060542 77
968 3300026041 Ga0207639_10043787 Ga0207639_100437872 77
969 3300026041 Ga0207639_10074549 Ga0207639_100745493 77
970 3300026041 Ga0207639_10313533 Ga0207639_103135332 77
971 3300026041 Ga0207639_10531088 Ga0207639_105310882 77
972 3300026041 Ga0207639_10538214 Ga0207639_105382143 77
973 3300026041 Ga0207639_11486241 Ga0207639_114862412 77
974 3300026067 Ga0207678_10003288 Ga0207678_1000328813 77
975 3300026067 Ga0207678_10024245 Ga0207678_100242453 77
976 3300026067 Ga0207678_10082416 Ga0207678_100824162 77
977 3300026067 Ga0207678_10460838 Ga0207678_104608382 77
978 3300026067 Ga0207678_10462484 Ga0207678_104624842 77
979 3300026067 Ga0207678_10642136 Ga0207678_106421362 77
980 3300026067 Ga0207678_10801633 Ga0207678_108016332 77
981 3300026067 Ga0207678_11096053 Ga0207678_110960532 77
982 3300026075 Ga0207708_10090171 Ga0207708_100901713 77
983 3300026078 Ga0207702_10003840 Ga0207702_1000384012 77
984 3300026078 Ga0207702_10005198 Ga0207702_100051986 77
985 3300026078 Ga0207702_10039424 Ga0207702_100394242 77
986 3300026078 Ga0207702_10045584 Ga0207702_100455842 77
987 3300026078 Ga0207702_11709218 Ga0207702_117092181 77
988 3300026088 Ga0207641_10000001 Ga0207641_10000001147 77
989 3300026088 Ga0207641_10000002 Ga0207641_10000002289 77
990 3300026088 Ga0207641_10000033 Ga0207641_10000033195 77
991 3300026088 Ga0207641_10000339 Ga0207641_1000033915 77
992 3300026088 Ga0207641_10001579 Ga0207641_100015794 77
993 3300026088 Ga0207641_10015149 Ga0207641_100151492 77
994 3300026088 Ga0207641_11073703 Ga0207641_110737032 77
995 3300026088 Ga0207641_12068434 Ga0207641_120684341 77
996 3300026089 Ga0207648_10001456 Ga0207648_1000145619 77
997 3300026089 Ga0207648_10014544 Ga0207648_100145443 77
998 3300026089 Ga0207648_10036654 Ga0207648_100366541 77
999 3300026089 Ga0207648_12262152 Ga0207648_122621522 77
1000 3300026095 Ga0207676_10000004 Ga0207676_10000004426 77
1001 3300026095 Ga0207676_10000005 Ga0207676_10000005519 77
1002 3300026095 Ga0207676_10002304 Ga0207676_1000230410 77
1003 3300026095 Ga0207676_10005071 Ga0207676_100050713 77
1004 3300026095 Ga0207676_10052804 Ga0207676_100528043 77
1005 3300026095 Ga0207676_10722984 Ga0207676_107229842 77
1006 3300026116 Ga0207674_10005417 Ga0207674_100054176 77
1007 3300026116 Ga0207674_10014991 Ga0207674_100149917 77
1008 3300026116 Ga0207674_10022369 Ga0207674_100223692 77
1009 3300026116 Ga0207674_10024479 Ga0207674_100244794 77
1010 3300026116 Ga0207674_10030327 Ga0207674_100303276 77
1011 3300026116 Ga0207674_10201680 Ga0207674_102016803 77
1012 3300026116 Ga0207674_10355806 Ga0207674_103558061 77
1013 3300026116 Ga0207674_10545106 Ga0207674_105451061 77
1014 3300026116 Ga0207674_11680794 Ga0207674_116807941 77
1015 3300026118 Ga0207675_100000020 Ga0207675_10000002090 77
1016 3300026118 Ga0207675_100000119 Ga0207675_10000011945 77
1017 3300026118 Ga0207675_100003055 Ga0207675_10000305511 77
1018 3300026118 Ga0207675_100004282 Ga0207675_1000042825 77
1019 3300026118 Ga0207675_100708945 Ga0207675_1007089452 77
1020 3300026118 Ga0207675_101115614 Ga0207675_1011156142 77
1021 3300026118 Ga0207675_101408004 Ga0207675_1014080042 77
1022 3300026121 Ga0207683_10007786 Ga0207683_1000778610 77
1023 3300026121 Ga0207683_10321678 Ga0207683_103216782 77
1024 3300026121 Ga0207683_11156329 Ga0207683_111563291 77
1025 3300026142 Ga0207698_10003570 Ga0207698_1000357012 77
1026 3300026142 Ga0207698_10009383 Ga0207698_100093838 77
1027 3300026142 Ga0207698_10055488 Ga0207698_100554881 77
1028 3300026142 Ga0207698_10077791 Ga0207698_100777912 77
1029 3300026142 Ga0207698_10113585 Ga0207698_101135851 77
1030 3300026142 Ga0207698_10118457 Ga0207698_101184573 77
1031 3300026142 Ga0207698_10134761 Ga0207698_101347612 77
1032 3300026142 Ga0207698_10281234 Ga0207698_102812342 77
1033 3300026142 Ga0207698_10399368 Ga0207698_103993682 77
1034 3300026142 Ga0207698_10767939 Ga0207698_107679392 77
1035 3300026142 Ga0207698_10972598 Ga0207698_109725981 77
1036 3300026142 Ga0207698_11122319 Ga0207698_111223191 77
1037 3300027252 Ga0209973_1058083 Ga0209973_10580831 77
1038 3300027364 Ga0209967_1027913 Ga0209967_10279131 77
1039 3300027424 Ga0209984_1062255 Ga0209984_10622552 77
1040 3300027462 Ga0210000_1018670 Ga0210000_10186702 77
1041 3300027552 Ga0209982_1038949 Ga0209982_10389492 77
1042 3300027614 Ga0209970_1010809 Ga0209970_10108092 77
1043 3300027614 Ga0209970_1104397 Ga0209970_11043972 77
1044 3300027617 Ga0210002_1033102 Ga0210002_10331021 77
1045 3300027665 Ga0209983_1025530 Ga0209983_10255303 77
1046 3300027665 Ga0209983_1075880 Ga0209983_10758802 77
1047 3300027717 Ga0209998_10023105 Ga0209998_100231051 77
1048 3300027866 Ga0209813_10000035 Ga0209813_100000357 77
1049 3300027876 Ga0209974_10022979 Ga0209974_100229792 77
1050 3300027876 Ga0209974_10032661 Ga0209974_100326612 77
1051 3300027876 Ga0209974_10041640 Ga0209974_100416402 77
1052 3300027876 Ga0209974_10302553 Ga0209974_103025531 77
1053 3300027876 Ga0209974_10380993 Ga0209974_103809931 77
1054 3300027907 Ga0207428_10111455 Ga0207428_101114552 77
1055 3300027907 Ga0207428_10185644 Ga0207428_101856443 77
1056 3300027907 Ga0207428_10985896 Ga0207428_109858961 77
1057 3300028379 Ga0268266_10000028 Ga0268266_10000028142 77
1058 3300028379 Ga0268266_10039582 Ga0268266_100395823 77
1059 3300028379 Ga0268266_10192573 Ga0268266_101925733 77
1060 3300028379 Ga0268266_10445783 Ga0268266_104457832 77
1061 3300028380 Ga0268265_10000002 Ga0268265_10000002644 77
1062 3300028380 Ga0268265_10000003 Ga0268265_10000003701 77
1063 3300028380 Ga0268265_10000524 Ga0268265_1000052413 77
1064 3300028380 Ga0268265_10006450 Ga0268265_100064506 77
1065 3300028380 Ga0268265_10010863 Ga0268265_100108634 77
1066 3300028380 Ga0268265_10012136 Ga0268265_100121367 77
1067 3300028380 Ga0268265_10057726 Ga0268265_100577263 77
1068 3300028380 Ga0268265_10178086 Ga0268265_101780863 77
1069 3300028380 Ga0268265_10235511 Ga0268265_102355112 77
1070 3300028380 Ga0268265_11325652 Ga0268265_113256522 77
1071 3300028380 Ga0268265_12100627 Ga0268265_121006272 77
1072 3300028380 Ga0268265_12231601 Ga0268265_122316012 77
1073 3300028381 Ga0268264_10000001 Ga0268264_10000001812 77
1074 3300028381 Ga0268264_10000006 Ga0268264_10000006389 77
1075 3300028381 Ga0268264_10005384 Ga0268264_100053846 77
1076 3300028381 Ga0268264_10007580 Ga0268264_1000758014 77
1077 3300028800 Ga0265338_10011755 Ga0265338_1001175510 77
1078 3300028800 Ga0265338_10543080 Ga0265338_105430802 77
1079 3300030742 Ga0316183_1215396 Ga0316183_12153961 77
1080 3300030745 Ga0316182_1197276 Ga0316182_11972762 77
1081 3300030745 Ga0316182_1271905 Ga0316182_12719052 77
1082 3300030760 Ga0265762_1029412 Ga0265762_10294122 77
1083 3300030882 Ga0265764_113426 Ga0265764_1134261 77
1084 3300030963 Ga0265768_117228 Ga0265768_1172281 77
1085 3300031250 Ga0265331_10012351 Ga0265331_100123514 77
1086 3300031344 Ga0265316_10135723 Ga0265316_101357232 77
1087 3300031456 Ga0307513_10562316 Ga0307513_105623162 77
1088 3300031548 Ga0307408_100016833 Ga0307408_1000168332 77
1089 3300031548 Ga0307408_100053905 Ga0307408_1000539052 77
1090 3300031548 Ga0307408_100065510 Ga0307408_1000655103 77
1091 3300031548 Ga0307408_100074863 Ga0307408_1000748633 77
1092 3300031548 Ga0307408_100085330 Ga0307408_1000853301 77
1093 3300031548 Ga0307408_100088017 Ga0307408_1000880173 77
1094 3300031548 Ga0307408_100102881 Ga0307408_1001028812 77
1095 3300031548 Ga0307408_100110730 Ga0307408_1001107302 77
1096 3300031548 Ga0307408_100196118 Ga0307408_1001961182 77
1097 3300031548 Ga0307408_100215463 Ga0307408_1002154632 77
1098 3300031548 Ga0307408_100216422 Ga0307408_1002164221 77
1099 3300031548 Ga0307408_100222919 Ga0307408_1002229193 77
1100 3300031548 Ga0307408_100290812 Ga0307408_1002908122 77
1101 3300031548 Ga0307408_100453784 Ga0307408_1004537842 77
1102 3300031548 Ga0307408_100607454 Ga0307408_1006074542 77
1103 3300031548 Ga0307408_100632948 Ga0307408_1006329482 77
1104 3300031548 Ga0307408_100881694 Ga0307408_1008816942 77
1105 3300031548 Ga0307408_100973782 Ga0307408_1009737822 77
1106 3300031548 Ga0307408_102002464 Ga0307408_1020024642 77
1107 3300031616 Ga0307508_10007262 Ga0307508_100072629 77
1108 3300031665 Ga0316575_10555492 Ga0316575_105554921 77
1109 3300031727 Ga0316576_10215189 Ga0316576_102151893 77
1110 3300031731 Ga0307405_10000836 Ga0307405_100008367 77
1111 3300031731 Ga0307405_10007251 Ga0307405_100072513 77
1112 3300031731 Ga0307405_10030541 Ga0307405_100305412 77
1113 3300031731 Ga0307405_10104357 Ga0307405_101043572 77
1114 3300031731 Ga0307405_10181360 Ga0307405_101813603 77
1115 3300031731 Ga0307405_10209585 Ga0307405_102095852 77
1116 3300031731 Ga0307405_10228251 Ga0307405_102282512 77
1117 3300031731 Ga0307405_10268331 Ga0307405_102683312 77
1118 3300031731 Ga0307405_10287764 Ga0307405_102877642 77
1119 3300031731 Ga0307405_10357047 Ga0307405_103570471 77
1120 3300031731 Ga0307405_10363716 Ga0307405_103637161 77
1121 3300031731 Ga0307405_10472303 Ga0307405_104723032 77
1122 3300031731 Ga0307405_10546535 Ga0307405_105465352 77
1123 3300031731 Ga0307405_10559912 Ga0307405_105599122 77
1124 3300031731 Ga0307405_10721799 Ga0307405_107217991 77
1125 3300031731 Ga0307405_10776358 Ga0307405_107763582 77
1126 3300031731 Ga0307405_11047534 Ga0307405_110475342 77
1127 3300031731 Ga0307405_11177529 Ga0307405_111775291 77
1128 3300031733 Ga0316577_10661546 Ga0316577_106615462 77
1129 3300031824 Ga0307413_10004092 Ga0307413_100040923 77
1130 3300031824 Ga0307413_10007986 Ga0307413_100079863 77
1131 3300031824 Ga0307413_10016308 Ga0307413_100163082 77
1132 3300031824 Ga0307413_10022312 Ga0307413_100223123 77
1133 3300031824 Ga0307413_10028267 Ga0307413_100282672 77
1134 3300031824 Ga0307413_10043841 Ga0307413_100438412 77
1135 3300031824 Ga0307413_10054417 Ga0307413_100544172 77
1136 3300031824 Ga0307413_10067270 Ga0307413_100672703 77
1137 3300031824 Ga0307413_10067955 Ga0307413_100679553 77
1138 3300031824 Ga0307413_10073499 Ga0307413_100734992 77
1139 3300031824 Ga0307413_10102822 Ga0307413_101028222 77
1140 3300031824 Ga0307413_10309016 Ga0307413_103090162 77
1141 3300031824 Ga0307413_10314035 Ga0307413_103140352 77
1142 3300031824 Ga0307413_10325735 Ga0307413_103257352 77
1143 3300031824 Ga0307413_10393473 Ga0307413_103934732 77
1144 3300031824 Ga0307413_10571520 Ga0307413_105715202 77
1145 3300031824 Ga0307413_10680180 Ga0307413_106801801 77
1146 3300031824 Ga0307413_10689220 Ga0307413_106892202 77
1147 3300031852 Ga0307410_10004200 Ga0307410_100042003 77
1148 3300031852 Ga0307410_10013509 Ga0307410_100135094 77
1149 3300031852 Ga0307410_10017442 Ga0307410_100174423 77
1150 3300031852 Ga0307410_10022803 Ga0307410_100228033 77
1151 3300031852 Ga0307410_10026784 Ga0307410_100267843 77
1152 3300031852 Ga0307410_10052189 Ga0307410_100521894 77
1153 3300031852 Ga0307410_10097012 Ga0307410_100970123 77
1154 3300031852 Ga0307410_10145359 Ga0307410_101453591 77
1155 3300031852 Ga0307410_10160589 Ga0307410_101605892 77
1156 3300031852 Ga0307410_10176673 Ga0307410_101766733 77
1157 3300031852 Ga0307410_10178160 Ga0307410_101781603 77
1158 3300031852 Ga0307410_10230238 Ga0307410_102302382 77
1159 3300031852 Ga0307410_10232731 Ga0307410_102327312 77
1160 3300031852 Ga0307410_10266737 Ga0307410_102667372 77
1161 3300031852 Ga0307410_10513675 Ga0307410_105136752 77
1162 3300031852 Ga0307410_11422098 Ga0307410_114220982 77
1163 3300031852 Ga0307410_11581458 Ga0307410_115814582 77
1164 3300031852 Ga0307410_11880338 Ga0307410_118803381 77
1165 3300031901 Ga0307406_10002316 Ga0307406_100023166 77
1166 3300031901 Ga0307406_10029352 Ga0307406_100293522 77
1167 3300031901 Ga0307406_10044981 Ga0307406_100449813 77
1168 3300031901 Ga0307406_10063519 Ga0307406_100635193 77
1169 3300031901 Ga0307406_10082890 Ga0307406_100828903 77
1170 3300031901 Ga0307406_10110661 Ga0307406_101106613 77
1171 3300031901 Ga0307406_10110905 Ga0307406_101109052 77
1172 3300031901 Ga0307406_10118490 Ga0307406_101184902 77
1173 3300031901 Ga0307406_10189468 Ga0307406_101894681 77
1174 3300031901 Ga0307406_10194998 Ga0307406_101949983 77
1175 3300031901 Ga0307406_10251002 Ga0307406_102510022 77
1176 3300031901 Ga0307406_10291493 Ga0307406_102914932 77
1177 3300031901 Ga0307406_10456672 Ga0307406_104566722 77
1178 3300031901 Ga0307406_10682901 Ga0307406_106829011 77
1179 3300031901 Ga0307406_10833860 Ga0307406_108338602 77
1180 3300031903 Ga0307407_10001288 Ga0307407_100012883 77
1181 3300031903 Ga0307407_10010206 Ga0307407_100102062 77
1182 3300031903 Ga0307407_10013593 Ga0307407_100135933 77
1183 3300031903 Ga0307407_10017136 Ga0307407_100171366 77
1184 3300031903 Ga0307407_10023847 Ga0307407_100238473 77
1185 3300031903 Ga0307407_10041166 Ga0307407_100411663 77
1186 3300031903 Ga0307407_10054398 Ga0307407_100543981 77
1187 3300031903 Ga0307407_10099952 Ga0307407_100999523 77
1188 3300031903 Ga0307407_10121095 Ga0307407_101210952 77
1189 3300031903 Ga0307407_10124814 Ga0307407_101248142 77
1190 3300031903 Ga0307407_10340621 Ga0307407_103406212 77
1191 3300031903 Ga0307407_10361126 Ga0307407_103611262 77
1192 3300031903 Ga0307407_10725638 Ga0307407_107256381 77
1193 3300031903 Ga0307407_10855696 Ga0307407_108556961 77
1194 3300031903 Ga0307407_10951155 Ga0307407_109511552 77
1195 3300031911 Ga0307412_10002969 Ga0307412_100029694 77
1196 3300031911 Ga0307412_10010772 Ga0307412_100107723 77
1197 3300031911 Ga0307412_10011266 Ga0307412_100112664 77
1198 3300031911 Ga0307412_10016186 Ga0307412_100161862 77
1199 3300031911 Ga0307412_10018552 Ga0307412_100185524 77
1200 3300031911 Ga0307412_10053068 Ga0307412_100530681 77
1201 3300031911 Ga0307412_10055034 Ga0307412_100550343 77
1202 3300031911 Ga0307412_10099710 Ga0307412_100997103 77
1203 3300031911 Ga0307412_10166430 Ga0307412_101664302 77
1204 3300031911 Ga0307412_10194928 Ga0307412_101949282 77
1205 3300031911 Ga0307412_10216595 Ga0307412_102165952 77
1206 3300031911 Ga0307412_10219663 Ga0307412_102196632 77
1207 3300031911 Ga0307412_10275773 Ga0307412_102757732 77
1208 3300031911 Ga0307412_10313203 Ga0307412_103132032 77
1209 3300031911 Ga0307412_10369629 Ga0307412_103696292 77
1210 3300031911 Ga0307412_10468344 Ga0307412_104683442 77
1211 3300031911 Ga0307412_10539900 Ga0307412_105399001 77
1212 3300031911 Ga0307412_10765969 Ga0307412_107659692 77
1213 3300031911 Ga0307412_10772969 Ga0307412_107729692 77
1214 3300031911 Ga0307412_10813936 Ga0307412_108139362 77
1215 3300031911 Ga0307412_11018619 Ga0307412_110186192 77
1216 3300031911 Ga0307412_11052856 Ga0307412_110528562 77
1217 3300031911 Ga0307412_11098731 Ga0307412_110987311 77
1218 3300031911 Ga0307412_11391942 Ga0307412_113919421 77
1219 3300031911 Ga0307412_11552718 Ga0307412_115527182 77
1220 3300031911 Ga0307412_12114205 Ga0307412_121142051 77
1221 3300031911 Ga0307412_12156228 Ga0307412_121562281 77
1222 3300031995 Ga0307409_100007579 Ga0307409_1000075797 77
1223 3300031995 Ga0307409_100028571 Ga0307409_1000285714 77
1224 3300031995 Ga0307409_100039825 Ga0307409_1000398252 77
1225 3300031995 Ga0307409_100046658 Ga0307409_1000466584 77
1226 3300031995 Ga0307409_100055447 Ga0307409_1000554472 77
1227 3300031995 Ga0307409_100063561 Ga0307409_1000635614 77
1228 3300031995 Ga0307409_100081330 Ga0307409_1000813303 77
1229 3300031995 Ga0307409_100105950 Ga0307409_1001059503 77
1230 3300031995 Ga0307409_100142175 Ga0307409_1001421752 77
1231 3300031995 Ga0307409_100155841 Ga0307409_1001558412 77
1232 3300031995 Ga0307409_100223512 Ga0307409_1002235122 77
1233 3300031995 Ga0307409_100231658 Ga0307409_1002316583 77
1234 3300031995 Ga0307409_100266485 Ga0307409_1002664852 77
1235 3300031995 Ga0307409_100284359 Ga0307409_1002843592 77
1236 3300031995 Ga0307409_100392190 Ga0307409_1003921902 77
1237 3300031995 Ga0307409_100478103 Ga0307409_1004781032 77
1238 3300031995 Ga0307409_100497348 Ga0307409_1004973482 77
1239 3300031995 Ga0307409_100546700 Ga0307409_1005467001 77
1240 3300031995 Ga0307409_100614039 Ga0307409_1006140392 77
1241 3300031995 Ga0307409_100812011 Ga0307409_1008120112 77
1242 3300031995 Ga0307409_100881312 Ga0307409_1008813123 77
1243 3300031995 Ga0307409_101229969 Ga0307409_1012299691 77
1244 3300031995 Ga0307409_101953492 Ga0307409_1019534921 77
1245 3300031995 Ga0307409_102508441 Ga0307409_1025084411 77
1246 3300032002 Ga0307416_100006179 Ga0307416_1000061792 77
1247 3300032002 Ga0307416_100012349 Ga0307416_1000123493 77
1248 3300032002 Ga0307416_100016125 Ga0307416_1000161253 77
1249 3300032002 Ga0307416_100066042 Ga0307416_1000660422 77
1250 3300032002 Ga0307416_100083655 Ga0307416_1000836552 77
1251 3300032002 Ga0307416_100180123 Ga0307416_1001801232 77
1252 3300032002 Ga0307416_100183290 Ga0307416_1001832903 77
1253 3300032002 Ga0307416_100517850 Ga0307416_1005178502 77
1254 3300032002 Ga0307416_100676047 Ga0307416_1006760472 77
1255 3300032002 Ga0307416_100746471 Ga0307416_1007464712 77
1256 3300032002 Ga0307416_100822753 Ga0307416_1008227532 77
1257 3300032002 Ga0307416_100990204 Ga0307416_1009902042 77
1258 3300032002 Ga0307416_101017113 Ga0307416_1010171132 77
1259 3300032002 Ga0307416_101163670 Ga0307416_1011636701 77
1260 3300032002 Ga0307416_101208719 Ga0307416_1012087191 77
1261 3300032002 Ga0307416_101589215 Ga0307416_1015892151 77
1262 3300032002 Ga0307416_102245799 Ga0307416_1022457991 77
1263 3300032002 Ga0307416_102300467 Ga0307416_1023004672 77
1264 3300032002 Ga0307416_103543880 Ga0307416_1035438801 77
1265 3300032004 Ga0307414_10000422 Ga0307414_100004222 77
1266 3300032004 Ga0307414_10001282 Ga0307414_100012823 77
1267 3300032004 Ga0307414_10010861 Ga0307414_100108614 77
1268 3300032004 Ga0307414_10018635 Ga0307414_100186353 77
1269 3300032004 Ga0307414_10020449 Ga0307414_100204492 77
1270 3300032004 Ga0307414_10037704 Ga0307414_100377043 77
1271 3300032004 Ga0307414_10038761 Ga0307414_100387613 77
1272 3300032004 Ga0307414_10045170 Ga0307414_100451703 77
1273 3300032004 Ga0307414_10051971 Ga0307414_100519714 77
1274 3300032004 Ga0307414_10053687 Ga0307414_100536873 77
1275 3300032004 Ga0307414_10072381 Ga0307414_100723812 77
1276 3300032004 Ga0307414_10083368 Ga0307414_100833682 77
1277 3300032004 Ga0307414_10112156 Ga0307414_101121562 77
1278 3300032004 Ga0307414_10113810 Ga0307414_101138103 77
1279 3300032004 Ga0307414_10271559 Ga0307414_102715593 77
1280 3300032004 Ga0307414_10285744 Ga0307414_102857442 77
1281 3300032004 Ga0307414_10359404 Ga0307414_103594042 77
1282 3300032004 Ga0307414_10393245 Ga0307414_103932452 77
1283 3300032004 Ga0307414_10572274 Ga0307414_105722742 77
1284 3300032004 Ga0307414_10653563 Ga0307414_106535632 77
1285 3300032004 Ga0307414_10707972 Ga0307414_107079722 77
1286 3300032004 Ga0307414_10820595 Ga0307414_108205951 77
1287 3300032004 Ga0307414_10859544 Ga0307414_108595442 77
1288 3300032004 Ga0307414_10913306 Ga0307414_109133061 77
1289 3300032004 Ga0307414_10967831 Ga0307414_109678311 77
1290 3300032004 Ga0307414_10997577 Ga0307414_109975772 77
1291 3300032004 Ga0307414_11071942 Ga0307414_110719422 77
1292 3300032004 Ga0307414_11210774 Ga0307414_112107742 77
1293 3300032004 Ga0307414_12055516 Ga0307414_120555162 77
1294 3300032004 Ga0307414_12312080 Ga0307414_123120801 77
1295 3300032005 Ga0307411_10001661 Ga0307411_1000166110 77
1296 3300032005 Ga0307411_10004359 Ga0307411_100043593 77
1297 3300032005 Ga0307411_10004416 Ga0307411_100044164 77
1298 3300032005 Ga0307411_10005780 Ga0307411_100057805 77
1299 3300032005 Ga0307411_10017903 Ga0307411_100179033 77
1300 3300032005 Ga0307411_10028117 Ga0307411_100281175 77
1301 3300032005 Ga0307411_10033079 Ga0307411_100330794 77
1302 3300032005 Ga0307411_10036999 Ga0307411_100369992 77
1303 3300032005 Ga0307411_10037289 Ga0307411_100372892 77
1304 3300032005 Ga0307411_10051590 Ga0307411_100515903 77
1305 3300032005 Ga0307411_10058766 Ga0307411_100587663 77
1306 3300032005 Ga0307411_10136957 Ga0307411_101369572 77
1307 3300032005 Ga0307411_10186754 Ga0307411_101867542 77
1308 3300032005 Ga0307411_10203022 Ga0307411_102030222 77
1309 3300032005 Ga0307411_10228924 Ga0307411_102289242 77
1310 3300032005 Ga0307411_10265226 Ga0307411_102652261 77
1311 3300032005 Ga0307411_10288711 Ga0307411_102887112 77
1312 3300032005 Ga0307411_10291459 Ga0307411_102914593 77
1313 3300032005 Ga0307411_10322159 Ga0307411_103221592 77
1314 3300032005 Ga0307411_10360371 Ga0307411_103603712 77
1315 3300032005 Ga0307411_10449318 Ga0307411_104493182 77
1316 3300032005 Ga0307411_10465174 Ga0307411_104651743 77
1317 3300032005 Ga0307411_10509165 Ga0307411_105091652 77
1318 3300032005 Ga0307411_10695047 Ga0307411_106950472 77
1319 3300032005 Ga0307411_10934485 Ga0307411_109344852 77
1320 3300032005 Ga0307411_10980632 Ga0307411_109806322 77
1321 3300032005 Ga0307411_11076779 Ga0307411_110767791 77
1322 3300032005 Ga0307411_11161975 Ga0307411_111619752 77
1323 3300032005 Ga0307411_11808938 Ga0307411_118089381 77
1324 3300032126 Ga0307415_100002260 Ga0307415_1000022604 77
1325 3300032126 Ga0307415_100013706 Ga0307415_1000137064 77
1326 3300032126 Ga0307415_100019428 Ga0307415_1000194285 77
1327 3300032126 Ga0307415_100137356 Ga0307415_1001373562 77
1328 3300032126 Ga0307415_100165568 Ga0307415_1001655682 77
1329 3300032126 Ga0307415_100176156 Ga0307415_1001761562 77
1330 3300032126 Ga0307415_100226222 Ga0307415_1002262222 77
1331 3300032126 Ga0307415_100250608 Ga0307415_1002506082 77
1332 3300032126 Ga0307415_100309870 Ga0307415_1003098702 77
1333 3300032126 Ga0307415_100325471 Ga0307415_1003254712 77
1334 3300032126 Ga0307415_100419873 Ga0307415_1004198732 77
1335 3300032126 Ga0307415_100668171 Ga0307415_1006681712 77
1336 3300032126 Ga0307415_100686730 Ga0307415_1006867302 77
1337 3300032126 Ga0307415_101256626 Ga0307415_1012566261 77
1338 3300032126 Ga0307415_101641406 Ga0307415_1016414062 77
1339 3300032126 Ga0307415_101792021 Ga0307415_1017920211 77
1340 3300032126 Ga0307415_102570286 Ga0307415_1025702861 77
1341 3300033180 Ga0307510_10134724 Ga0307510_101347241 77
1342 3300033528 Ga0316588_1211960 Ga0316588_12119602 77
1343 3300033529 Ga0316587_1029651 Ga0316587_10296512 77
1344 3300033541 Ga0316596_1019259 Ga0316596_10192591 77
1345 3300033541 Ga0316596_1242168 Ga0316596_12421682 77
1346 3300034957 Ga0373938_0188906 Ga0373938_0188906_29_262 77
1347 3300035086 Ga0373934_0272395 Ga0373934_0272395_260_499 77
1348 3300035115 Ga0373941_0520568 Ga0373941_0520568_154_387 77
1349 3300035121 Ga0373960_0132424 Ga0373960_0132424_226_462 77
1350 3300035170 Ga0373943_0080466 Ga0373943_0080466_772_1008 77
1351 3300035172 Ga0373955_0494243 Ga0373955_0494243_338_574 77
1352 3300035724 Ga0373933_0327233 Ga0373933_0327233_272_508 77
1353 3300036457 Ga0265778_059191 Ga0265778_059191_132_368 77
1354 3300036647 Ga0316582_0642652 Ga0316582_0642652_481_720 77
1355 3300037312 Ga0395899_0028010 Ga0395899_0028010_1411_1647 77
1356 3300037312 Ga0395899_0077235 Ga0395899_0077235_1079_1315 77
1357 3300037312 Ga0395899_0112751 Ga0395899_0112751_1528_1764 77
1358 3300037312 Ga0395899_0122307 Ga0395899_0122307_473_709 77
1359 3300037312 Ga0395899_0159313 Ga0395899_0159313_860_1096 77
1360 3300037312 Ga0395899_0183129 Ga0395899_0183129_169_405 77
1361 3300037312 Ga0395899_0346568 Ga0395899_0346568_494_730 77
1362 3300037418 Ga0395900_0001420 Ga0395900_0001420_11976_12212 77
1363 3300037418 Ga0395900_0002862 Ga0395900_0002862_664_900 77
1364 3300037418 Ga0395900_0061087 Ga0395900_0061087_994_1230 77
1365 3300037418 Ga0395900_0072352 Ga0395900_0072352_1603_1839 77
1366 3300037418 Ga0395900_0077414 Ga0395900_0077414_2283_2519 77
1367 3300037418 Ga0395900_0194991 Ga0395900_0194991_1317_1553 77
1368 3300037418 Ga0395900_0400653 Ga0395900_0400653_329_565 77
1369 3300037418 Ga0395900_0675815 Ga0395900_0675815_165_401 77
1370 3300037418 Ga0395900_1561879 Ga0395900_1561879_190_426 77
1371 3300037466 Ga0395898_0008799 Ga0395898_0008799_1515_1751 77
1372 3300037466 Ga0395898_0137711 Ga0395898_0137711_739_975 77
1373 3300037466 Ga0395898_0163595 Ga0395898_0163595_496_732 77
1374 3300037466 Ga0395898_0165772 Ga0395898_0165772_1127_1363 77
1375 3300037466 Ga0395898_0506140 Ga0395898_0506140_896_1132 77
1376 3300037466 Ga0395898_1383781 Ga0395898_1383781_131_367 77
1377 3300037466 Ga0395898_1405540 Ga0395898_1405540_221_457 77
1378 3300037471 Ga0395905_0000264 Ga0395905_0000264_65013_65249 77
1379 3300037471 Ga0395905_0041060 Ga0395905_0041060_3609_3845 77
1380 3300037471 Ga0395905_0069236 Ga0395905_0069236_2373_2609 77
1381 3300037471 Ga0395905_0386684 Ga0395905_0386684_441_677 77
1382 3300037471 Ga0395905_0750159 Ga0395905_0750159_422_658 77
1383 3300037471 Ga0395905_0956564 Ga0395905_0956564_32_265 77
1384 3300037471 Ga0395905_1061799 Ga0395905_1061799_329_562 77
1385 3300037471 Ga0395905_1236922 Ga0395905_1236922_17_253 77
1386 3300037853 Ga0436364_0159976 Ga0436364_0159976_119_355 77
1387 3300037853 Ga0436364_0246018 Ga0436364_0246018_121_357 77
1388 3300037853 Ga0436364_0427266 Ga0436364_0427266_10_249 77
1389 3300037853 Ga0436364_0494432 Ga0436364_0494432_528_764 77
1390 3300037853 Ga0436364_1063999 Ga0436364_1063999_223_459 77
1391 3300037853 Ga0436364_1203033 Ga0436364_1203033_535_771 77
1392 3300037853 Ga0436364_1265123 Ga0436364_1265123_1610_1846 77
1393 3300037853 Ga0436364_1537497 Ga0436364_1537497_3866_4105 77
1394 3300038443 Ga0395901_0002684 Ga0395901_0002684_1651_1887 77
1395 3300038443 Ga0395901_0030373 Ga0395901_0030373_1461_1697 77
1396 3300038443 Ga0395901_0035019 Ga0395901_0035019_3661_3897 77
1397 3300038443 Ga0395901_0070988 Ga0395901_0070988_354_590 77
1398 3300038443 Ga0395901_0091926 Ga0395901_0091926_374_610 77
1399 3300038443 Ga0395901_0259573 Ga0395901_0259573_197_433 77
1400 3300038443 Ga0395901_0365845 Ga0395901_0365845_51_287 77
1401 3300038443 Ga0395901_0711934 Ga0395901_0711934_500_736 77
1402 3300038443 Ga0395901_0828195 Ga0395901_0828195_19_255 77
1403 3300038443 Ga0395901_1909207 Ga0395901_1909207_112_348 77
1404 3300038705 Ga0237819_00792 Ga0237819_00792_7592_7828 77
1405 3300039145 Ga0237816_03508 Ga0237816_03508_538_774 77
1406 3300039437 Ga0436365_0137032 Ga0436365_0137032_10646_10882 77
1407 3300039437 Ga0436365_0192103 Ga0436365_0192103_35459_35695 77
1408 3300039437 Ga0436365_0389735 Ga0436365_0389735_161_397 77
1409 3300039437 Ga0436365_0516245 Ga0436365_0516245_83_319 77
1410 3300039437 Ga0436365_0630238 Ga0436365_0630238_391_630 77
1411 3300039437 Ga0436365_0676110 Ga0436365_0676110_620_853 77
1412 3300039437 Ga0436365_1132339 Ga0436365_1132339_869_1105 77
1413 3300039437 Ga0436365_1667566 Ga0436365_1667566_620_856 77
1414 3300039438 Ga0436360_0671368 Ga0436360_0671368_444_686 77
1415 3300039438 Ga0436360_1089737 Ga0436360_1089737_2833_3075 77
1416 3300039438 Ga0436360_1104798 Ga0436360_1104798_536_775 77
1417 3300039447 Ga0436361_0766879 Ga0436361_0766879_6532_6765 77
1418 3300039450 Ga0436363_0222229 Ga0436363_0222229_220_456 77
1419 3300039450 Ga0436363_1287325 Ga0436363_1287325_262_498 77
1420 3300039450 Ga0436363_1457002 Ga0436363_1457002_487_723 77
1421 3300039453 Ga0436362_0321149 Ga0436362_0321149_78_314 77
1422 3300039453 Ga0436362_1073687 Ga0436362_1073687_3140_3376 77
1423 3300039453 Ga0436362_1230371 Ga0436362_1230371_77_313 77
1424 3300041404 Ga0439436_0159180 Ga0439436_0159180_257_493 77
1425 3300041405 Ga0439438_045215 Ga0439438_045215_250_486 77
1426 3300041407 Ga0439447_079162 Ga0439447_079162_91_327 77
1427 3300041408 Ga0439453_0057474 Ga0439453_0057474_258_500 77
1428 3300041411 Ga0439466_0202426 Ga0439466_0202426_290_526 77
1429 3300041451 Ga0451791_0488539 Ga0451791_0488539_282_518 77
1430 3300041451 Ga0451791_1720350 Ga0451791_1720350_53_286 77
1431 3300041452 Ga0451793_0066913 Ga0451793_0066913_279_515 77
1432 3300041452 Ga0451793_0534558 Ga0451793_0534558_305_541 77
1433 3300041452 Ga0451793_1104239 Ga0451793_1104239_85_321 77
1434 3300041453 Ga0451797_0487713 Ga0451797_0487713_219_455 77
1435 3300041459 Ga0451800_0039576 Ga0451800_0039576_190_426 77
1436 3300041460 Ga0451802_0221331 Ga0451802_0221331_46_282 77
1437 3300041460 Ga0451802_0380036 Ga0451802_0380036_205_441 77
1438 3300041461 Ga0451805_036337 Ga0451805_036337_174_410 77
1439 3300041461 Ga0451805_076480 Ga0451805_076480_152_388 77
1440 3300041462 Ga0451806_016836 Ga0451806_016836_441_683 77
1441 3300041486 Ga0451807_0963126 Ga0451807_0963126_130_366 77
1442 3300041491 Ga0451833_0069387 Ga0451833_0069387_273_509 77
1443 3300041492 Ga0451835_0820366 Ga0451835_0820366_195_434 77
1444 3300041505 Ga0451849_0914951 Ga0451849_0914951_103_339 77
1445 3300041509 Ga0451843_0531416 Ga0451843_0531416_101_340 77
1446 3300041509 Ga0451843_0612048 Ga0451843_0612048_325_579 77
1447 3300041509 Ga0451843_1776115 Ga0451843_1776115_527_763 77
1448 3300041511 Ga0451855_0821017 Ga0451855_0821017_27_263 77
1449 3300041999 Ga0439433_0107977 Ga0439433_0107977_89_325 77
1450 3300042001 Ga0439441_043326 Ga0439441_043326_550_789 77
1451 3300042002 Ga0439442_042059 Ga0439442_042059_244_480 77
1452 3300042004 Ga0439445_0007676 Ga0439445_0007676_1537_1773 77
1453 3300042004 Ga0439445_0016648 Ga0439445_0016648_397_633 77
1454 3300042004 Ga0439445_0043387 Ga0439445_0043387_112_348 77
1455 3300042006 Ga0439432_036385 Ga0439432_036385_866_1102 77
1456 3300042006 Ga0439432_131238 Ga0439432_131238_246_482 77
1457 3300042007 Ga0439449_0100281 Ga0439449_0100281_356_592 77
1458 3300042007 Ga0439449_0323686 Ga0439449_0323686_132_368 77
1459 3300042008 Ga0439450_151619 Ga0439450_151619_216_452 77
1460 3300042010 Ga0439452_109393 Ga0439452_109393_306_542 77
1461 3300042118 Ga0450914_003199 Ga0450914_003199_400_636 77
1462 3300042118 Ga0450914_003983 Ga0450914_003983_488_724 77
1463 3300042120 Ga0450917_000634 Ga0450917_000634_928_1164 77
1464 3300042122 Ga0450920_019806 Ga0450920_019806_129_365 77
1465 3300042126 Ga0450888_074543 Ga0450888_074543_264_497 77
1466 3300042134 Ga0450898_094401 Ga0450898_094401_186_422 77
1467 3300042139 Ga0450904_035417 Ga0450904_035417_33_269 77
1468 3300042142 Ga0450905_001347 Ga0450905_001347_2489_2725 77
1469 3300042144 Ga0450889_000126 Ga0450889_000126_4403_4639 77
1470 3300042144 Ga0450889_026471 Ga0450889_026471_279_515 77
1471 3300042147 Ga0450910_095518 Ga0450910_095518_61_297 77
1472 3300042156 Ga0439446_0257212 Ga0439446_0257212_43_279 77
1473 3300042435 Ga0439434_0061241 Ga0439434_0061241_837_1073 77
1474 3300042435 Ga0439434_0087471 Ga0439434_0087471_287_523 77
1475 3300042439 Ga0439464_0299183 Ga0439464_0299183_150_389 77
1476 3300042530 Ga0450916_028010 Ga0450916_028010_366_602 77
1477 3300042876 Ga0451577_0241428 Ga0451577_0241428_738_974 77
1478 3300044656 Ga0466969_0126901 Ga0466969_0126901_336_572 77
1479 3300044659 Ga0466973_0346498 Ga0466973_0346498_565_801 77
1480 3300044683 Ga0466965_0206501 Ga0466965_0206501_386_622 77
1481 3300044684 Ga0466966_0000007 Ga0466966_0000007_89293_89529 77
1482 3300044684 Ga0466966_0041208 Ga0466966_0041208_208_444 77
1483 3300044684 Ga0466966_0075625 Ga0466966_0075625_384_620 77
1484 3300044693 Ga0466961_0272641 Ga0466961_0272641_705_941 77
1485 3300044693 Ga0466961_0384416 Ga0466961_0384416_328_564 77
1486 3300044693 Ga0466961_0431252 Ga0466961_0431252_531_767 77
1487 3300044694 Ga0466963_0016472 Ga0466963_0016472_298_534 77
1488 3300044694 Ga0466963_0261753 Ga0466963_0261753_766_1002 77
1489 3300044694 Ga0466963_0644989 Ga0466963_0644989_392_628 77
1490 3300044694 Ga0466963_1219995 Ga0466963_1219995_102_338 77
1491 3300044706 Ga0466964_0106341 Ga0466964_0106341_713_949 77
1492 3300044712 Ga0453684_0244512 Ga0453684_0244512_1119_1355 77
1493 3300044712 Ga0453684_2417312 Ga0453684_2417312_163_399 77
1494 3300044719 Ga0466971_0111738 Ga0466971_0111738_547_783 77
1495 3300044719 Ga0466971_0280582 Ga0466971_0280582_15_251 77
1496 3300044735 Ga0466968_0188107 Ga0466968_0188107_442_678 77
1497 3300044765 Ga0466970_0063304 Ga0466970_0063304_1156_1392 77
1498 3300044765 Ga0466970_0158964 Ga0466970_0158964_34_270 77
1499 3300044765 Ga0466970_0267722 Ga0466970_0267722_585_821 77
1500 3300044842 Ga0466957_0004838 Ga0466957_0004838_966_1202 77
1501 3300044842 Ga0466957_0170624 Ga0466957_0170624_815_1051 77
1502 3300044842 Ga0466957_0230365 Ga0466957_0230365_434_670 77
1503 3300044842 Ga0466957_0344396 Ga0466957_0344396_22_258 77
1504 3300044901 Ga0466960_0140949 Ga0466960_0140949_711_947 77
1505 3300045049 Ga0466959_0008366 Ga0466959_0008366_7004_7240 77
1506 3300045049 Ga0466959_0164340 Ga0466959_0164340_1172_1408 77
1507 3300045049 Ga0466959_1212424 Ga0466959_1212424_104_340 77
1508 3300045836 Ga0466958_0000625 Ga0466958_0000625_4226_4462 77
1509 3300045976 Ga0466967_0020455 Ga0466967_0020455_796_1032 77
1510 3300045976 Ga0466967_0204045 Ga0466967_0204045_348_584 77
1511 3300045976 Ga0466967_0928692 Ga0466967_0928692_396_632 77
1512 3300045976 Ga0466967_2257636 Ga0466967_2257636_73_309 77
1513 3300046452 Ga0495617_089336 Ga0495617_089336_513_746 77
1514 3300046453 Ga0495627_064470 Ga0495627_064470_256_489 77
1515 3300046460 Ga0495638_0000344 Ga0495638_0000344_47757_47993 77
1516 3300046460 Ga0495638_0064577 Ga0495638_0064577_474_710 77
1517 3300046460 Ga0495638_0129180 Ga0495638_0129180_117_350 77
1518 3300046460 Ga0495638_0193423 Ga0495638_0193423_44_277 77
1519 3300046491 Ga0495584_0033167 Ga0495584_0033167_258_491 77
1520 3300046491 Ga0495584_0416537 Ga0495584_0416537_50_286 77
1521 3300046492 Ga0495585_0062407 Ga0495585_0062407_13_249 77
1522 3300046492 Ga0495585_0071988 Ga0495585_0071988_582_818 77
1523 3300046500 Ga0495596_0053326 Ga0495596_0053326_1101_1337 77
1524 3300046501 Ga0495607_0268600 Ga0495607_0268600_367_603 77
1525 3300046501 Ga0495607_0482850 Ga0495607_0482850_93_329 77
1526 3300046507 Ga0495606_0160172 Ga0495606_0160172_764_1000 77
1527 3300046512 Ga0495610_0000072 Ga0495610_0000072_9510_9743 77
1528 3300046512 Ga0495610_0020051 Ga0495610_0020051_2818_3051 77
1529 3300046515 Ga0495620_0197666 Ga0495620_0197666_394_630 77
1530 3300046515 Ga0495620_0269934 Ga0495620_0269934_221_457 77
1531 3300046516 Ga0495628_1211733 Ga0495628_1211733_152_388 77
1532 3300046518 Ga0495631_0162284 Ga0495631_0162284_697_930 77
1533 3300046518 Ga0495631_0207680 Ga0495631_0207680_135_371 77
1534 3300046519 Ga0495632_0000007 Ga0495632_0000007_14591_14824 77
1535 3300046519 Ga0495632_0108991 Ga0495632_0108991_466_699 77
1536 3300046519 Ga0495632_0343771 Ga0495632_0343771_337_570 77
1537 3300046520 Ga0495637_0000971 Ga0495637_0000971_17214_17447 77
1538 3300046520 Ga0495637_0050727 Ga0495637_0050727_526_759 77
1539 3300046522 Ga0495643_0000005 Ga0495643_0000005_150938_151171 77
1540 3300046522 Ga0495643_0113143 Ga0495643_0113143_270_506 77
1541 3300046522 Ga0495643_0188561 Ga0495643_0188561_374_610 77
1542 3300046524 Ga0495648_0019030 Ga0495648_0019030_91_327 77
1543 3300046524 Ga0495648_0053126 Ga0495648_0053126_990_1226 77
1544 3300046524 Ga0495648_0055981 Ga0495648_0055981_714_947 77
1545 3300046524 Ga0495648_0439633 Ga0495648_0439633_82_315 77
1546 3300046525 Ga0495663_0000005 Ga0495663_0000005_13611_13844 77
1547 3300046525 Ga0495663_0005839 Ga0495663_0005839_2983_3219 77
1548 3300046525 Ga0495663_0006586 Ga0495663_0006586_1214_1450 77
1549 3300046525 Ga0495663_0059004 Ga0495663_0059004_837_1070 77
1550 3300046525 Ga0495663_0098439 Ga0495663_0098439_669_905 77
1551 3300046525 Ga0495663_0176093 Ga0495663_0176093_447_683 77
1552 3300046528 Ga0495642_0042851 Ga0495642_0042851_1430_1666 77
1553 3300046528 Ga0495642_0137171 Ga0495642_0137171_649_885 77
1554 3300046530 Ga0495654_0001737 Ga0495654_0001737_11777_12013 77
1555 3300046530 Ga0495654_0163607 Ga0495654_0163607_610_843 77
1556 3300046537 Ga0495598_0102127 Ga0495598_0102127_51_287 77
1557 3300046539 Ga0495621_0264348 Ga0495621_0264348_231_467 77
1558 3300046542 Ga0495597_0114772 Ga0495597_0114772_538_771 77
1559 3300046542 Ga0495597_0162965 Ga0495597_0162965_339_572 77
1560 3300046557 Ga0495622_0069143 Ga0495622_0069143_356_589 77
1561 3300046558 Ga0495633_0000550 Ga0495633_0000550_1521_1754 77
1562 3300046558 Ga0495633_0096849 Ga0495633_0096849_405_638 77
1563 3300046558 Ga0495633_0123148 Ga0495633_0123148_432_665 77
1564 3300046558 Ga0495633_0248338 Ga0495633_0248338_526_759 77
1565 3300046616 Ga0495668_0000079 Ga0495668_0000079_152778_153014 77
1566 3300046616 Ga0495668_0008515 Ga0495668_0008515_5654_5890 77
1567 3300046616 Ga0495668_0011125 Ga0495668_0011125_2608_2844 77
1568 3300046616 Ga0495668_0071990 Ga0495668_0071990_223_456 77
1569 3300046616 Ga0495668_0191300 Ga0495668_0191300_94_330 77
1570 3300046616 Ga0495668_0435840 Ga0495668_0435840_436_672 77
1571 3300046660 Ga0495625_0000064 Ga0495625_0000064_153830_154066 77
1572 3300046660 Ga0495625_0095108 Ga0495625_0095108_1539_1772 77
1573 3300046660 Ga0495625_0243212 Ga0495625_0243212_158_391 77
1574 3300046660 Ga0495625_0433525 Ga0495625_0433525_338_574 77
1575 3300046660 Ga0495625_0459653 Ga0495625_0459653_165_398 77
1576 3300046660 Ga0495625_0531490 Ga0495625_0531490_338_571 77
1577 3300046664 Ga0495659_0174299 Ga0495659_0174299_374_610 77
1578 3300046664 Ga0495659_0335889 Ga0495659_0335889_323_559 77
1579 3300046684 Ga0495669_0111155 Ga0495669_0111155_50_286 77
1580 3300046684 Ga0495669_0131739 Ga0495669_0131739_32_268 77
1581 3300046691 Ga0495670_0196887 Ga0495670_0196887_637_873 77
1582 3300046691 Ga0495670_0459375 Ga0495670_0459375_178_414 77
1583 3300046691 Ga0495670_0462756 Ga0495670_0462756_61_297 77
1584 3300046691 Ga0495670_0784023 Ga0495670_0784023_169_405 77
1585 3300046691 Ga0495670_0805191 Ga0495670_0805191_199_432 77
1586 3300046692 Ga0495671_0000007 Ga0495671_0000007_150938_151171 77
1587 3300046692 Ga0495671_0029410 Ga0495671_0029410_2149_2385 77
1588 3300046794 Ga0495589_0058439 Ga0495589_0058439_961_1197 77
1589 3300047318 Ga0495636_0119069 Ga0495636_0119069_214_450 77
1590 3300047320 Ga0495672_0242256 Ga0495672_0242256_332_565 77
1591 3300047445 Ga0495677_0043186 Ga0495677_0043186_1369_1605 77
1592 3300047446 Ga0495679_073810 Ga0495679_073810_273_509 77
1593 3300047447 Ga0495685_072741 Ga0495685_072741_241_477 77
1594 3300047469 Ga0495673_0075622 Ga0495673_0075622_770_1006 77
1595 3300047470 Ga0495681_0000043 Ga0495681_0000043_18541_18774 77
1596 3300047470 Ga0495681_0002043 Ga0495681_0002043_12994_13227 77
1597 3300047470 Ga0495681_0100780 Ga0495681_0100780_595_831 77
1598 3300047472 Ga0495686_0000060 Ga0495686_0000060_19803_20039 77
1599 3300047472 Ga0495686_0015162 Ga0495686_0015162_1195_1431 77
1600 3300047472 Ga0495686_0034080 Ga0495686_0034080_158_391 77
1601 3300047472 Ga0495686_0052135 Ga0495686_0052135_1954_2187 77
1602 3300047472 Ga0495686_0062563 Ga0495686_0062563_745_981 77
1603 3300047472 Ga0495686_0254925 Ga0495686_0254925_183_419 77
1604 3300048089 Ga0495614_0457879 Ga0495614_0457879_147_386 77
1605 3300048090 Ga0495615_0243375 Ga0495615_0243375_218_454 77
1606 3300048090 Ga0495615_0260026 Ga0495615_0260026_111_347 77
1607 3300048091 Ga0495626_0156483 Ga0495626_0156483_418_654 77
1608 3300048904 Ga0496101_0262625 Ga0496101_0262625_866_1102 77
1609 3300048905 Ga0496102_0108686 Ga0496102_0108686_1430_1666 77
1610 3300048905 Ga0496102_0534542 Ga0496102_0534542_469_705 77
1611 3300048905 Ga0496102_0645633 Ga0496102_0645633_57_293 77
1612 3300048906 Ga0496103_0000643 Ga0496103_0000643_7893_8129 77
1613 3300048906 Ga0496103_0055995 Ga0496103_0055995_833_1069 77
1614 3300048906 Ga0496103_0093529 Ga0496103_0093529_1177_1413 77
1615 3300048907 Ga0496104_0065671 Ga0496104_0065671_2239_2475 77
1616 3300048908 Ga0496105_0277070 Ga0496105_0277070_718_954 77
1617 3300048910 Ga0496107_0054481 Ga0496107_0054481_314_550 77
1618 3300048911 Ga0496108_0001779 Ga0496108_0001779_3068_3301 77
1619 3300048911 Ga0496108_0378522 Ga0496108_0378522_334_570 77
1620 3300048911 Ga0496108_0684040 Ga0496108_0684040_486_719 77
1621 3300048911 Ga0496108_0781638 Ga0496108_0781638_429_665 77
1622 3300048911 Ga0496108_0893976 Ga0496108_0893976_213_449 77
1623 3300048911 Ga0496108_1378091 Ga0496108_1378091_108_344 77
1624 3300048912 Ga0496109_0005285 Ga0496109_0005285_8813_9046 77
1625 3300048912 Ga0496109_0427489 Ga0496109_0427489_331_567 77
1626 3300048912 Ga0496109_0942644 Ga0496109_0942644_502_738 77
1627 3300048912 Ga0496109_0949216 Ga0496109_0949216_23_256 77
1628 3300048912 Ga0496109_0958490 Ga0496109_0958490_429_665 77
1629 3300048913 Ga0496110_0017508 Ga0496110_0017508_2225_2458 77
1630 3300048913 Ga0496110_0171671 Ga0496110_0171671_576_809 77
1631 3300048913 Ga0496110_0187573 Ga0496110_0187573_1151_1387 77
1632 3300048913 Ga0496110_1295115 Ga0496110_1295115_81_317 77
1633 3300048914 Ga0496111_0081045 Ga0496111_0081045_1960_2196 77
1634 3300048914 Ga0496111_0098941 Ga0496111_0098941_1364_1597 77
1635 3300048914 Ga0496111_0560943 Ga0496111_0560943_90_323 77
1636 3300048914 Ga0496111_0597108 Ga0496111_0597108_395_631 77
1637 3300048915 Ga0496112_0828155 Ga0496112_0828155_526_759 77
1638 3300048916 Ga0496113_0040449 Ga0496113_0040449_1187_1420 77
1639 3300048916 Ga0496113_0923147 Ga0496113_0923147_224_460 77
1640 3300048919 Ga0496116_0011628 Ga0496116_0011628_5436_5672 77
1641 3300048919 Ga0496116_0092735 Ga0496116_0092735_971_1204 77
1642 3300048920 Ga0496117_0005240 Ga0496117_0005240_5942_6178 77
1643 3300048920 Ga0496117_0009671 Ga0496117_0009671_37_270 77
1644 3300048920 Ga0496117_0010121 Ga0496117_0010121_684_920 77
1645 3300048920 Ga0496117_0011933 Ga0496117_0011933_3685_3921 77
1646 3300048920 Ga0496117_0078040 Ga0496117_0078040_980_1216 77
1647 3300048921 Ga0496118_0001107 Ga0496118_0001107_28971_29207 77
1648 3300048921 Ga0496118_0001361 Ga0496118_0001361_12366_12602 77
1649 3300048921 Ga0496118_0020836 Ga0496118_0020836_2278_2514 77
1650 3300048921 Ga0496118_0025899 Ga0496118_0025899_494_727 77
1651 3300048921 Ga0496118_0362924 Ga0496118_0362924_430_663 77
1652 3300048922 Ga0496119_0002497 Ga0496119_0002497_16216_16455 77
1653 3300048922 Ga0496119_0105087 Ga0496119_0105087_268_504 77
1654 3300048922 Ga0496119_0112028 Ga0496119_0112028_560_796 77
1655 3300048923 Ga0496120_0188010 Ga0496120_0188010_750_986 77
1656 3300048923 Ga0496120_0206344 Ga0496120_0206344_646_885 77
1657 3300048924 Ga0496121_0000072 Ga0496121_0000072_16059_16295 77
1658 3300048924 Ga0496121_0000349 Ga0496121_0000349_18951_19184 77
1659 3300048924 Ga0496121_0006869 Ga0496121_0006869_60_296 77
1660 3300048924 Ga0496121_0052513 Ga0496121_0052513_2764_2997 77
1661 3300048924 Ga0496121_0089973 Ga0496121_0089973_295_531 77
1662 3300048924 Ga0496121_0244505 Ga0496121_0244505_325_561 77
1663 3300048924 Ga0496121_0338717 Ga0496121_0338717_316_552 77
1664 3300048925 Ga0496122_0000504 Ga0496122_0000504_57908_58141 77
1665 3300048925 Ga0496122_0001301 Ga0496122_0001301_204_440 77
1666 3300048925 Ga0496122_0079829 Ga0496122_0079829_1303_1536 77
1667 3300048925 Ga0496122_0148093 Ga0496122_0148093_392_628 77
1668 3300048925 Ga0496122_0179271 Ga0496122_0179271_395_628 77
1669 3300048925 Ga0496122_0459787 Ga0496122_0459787_59_295 77
1670 3300048926 Ga0496123_0000111 Ga0496123_0000111_141684_141917 77
1671 3300048926 Ga0496123_0001067 Ga0496123_0001067_3128_3364 77
1672 3300048926 Ga0496123_0006586 Ga0496123_0006586_4642_4875 77
1673 3300048926 Ga0496123_0098951 Ga0496123_0098951_1286_1522 77
1674 3300048926 Ga0496123_0172775 Ga0496123_0172775_495_731 77
1675 3300048926 Ga0496123_0228279 Ga0496123_0228279_276_512 77
1676 3300048927 Ga0496124_0005100 Ga0496124_0005100_10077_10313 77
1677 3300048927 Ga0496124_0015198 Ga0496124_0015198_1518_1751 77
1678 3300048927 Ga0496124_0075292 Ga0496124_0075292_30_263 77
1679 3300048927 Ga0496124_0095988 Ga0496124_0095988_829_1065 77
1680 3300048927 Ga0496124_0102418 Ga0496124_0102418_1515_1748 77
1681 3300048927 Ga0496124_0220954 Ga0496124_0220954_628_864 77
1682 3300048927 Ga0496124_0279949 Ga0496124_0279949_506_739 77
1683 3300048927 Ga0496124_0976915 Ga0496124_0976915_249_485 77
1684 3300048928 Ga0496125_0015192 Ga0496125_0015192_6663_6896 77
1685 3300048928 Ga0496125_0019677 Ga0496125_0019677_5032_5265 77
1686 3300048928 Ga0496125_0042848 Ga0496125_0042848_3266_3499 77
1687 3300048928 Ga0496125_0075884 Ga0496125_0075884_174_407 77
1688 3300048928 Ga0496125_0098367 Ga0496125_0098367_1569_1802 77
1689 3300048928 Ga0496125_0293037 Ga0496125_0293037_83_319 77
1690 3300048928 Ga0496125_0549372 Ga0496125_0549372_44_280 77
1691 3300048928 Ga0496125_0592038 Ga0496125_0592038_26_262 77
1692 3300048929 Ga0496126_0038024 Ga0496126_0038024_3678_3911 77
1693 3300048929 Ga0496126_0060278 Ga0496126_0060278_1001_1237 77
1694 3300048929 Ga0496126_0257576 Ga0496126_0257576_1204_1437 77
1695 3300048929 Ga0496126_0881411 Ga0496126_0881411_259_495 77
1696 3300048929 Ga0496126_0894607 Ga0496126_0894607_354_590 77
1697 3300048929 Ga0496126_0978172 Ga0496126_0978172_369_605 77
1698 3300048929 Ga0496126_1148676 Ga0496126_1148676_300_536 77
1699 3300048929 Ga0496126_1305338 Ga0496126_1305338_64_297 77
1700 3300049162 Ga0501307_030519 Ga0501307_030519_405_641 77
1701 3300049459 Ga0495678_108227 Ga0495678_108227_123_359 77
1702 3300049519 Ga0501296_028526 Ga0501296_028526_54_290 77
1703 3300049520 Ga0501297_007607 Ga0501297_007607_777_1010 77
1704 3300049530 Ga0501314_050622 Ga0501314_050622_96_329 77
1705 3300049531 Ga0501315_078810 Ga0501315_078810_256_489 77
1706 3300049532 Ga0501316_063150 Ga0501316_063150_210_446 77
1707 3300049532 Ga0501316_064475 Ga0501316_064475_105_341 77
1708 3300049539 Ga0501323_085355 Ga0501323_085355_250_486 77
1709 3300049541 Ga0501325_054035 Ga0501325_054035_83_319 77
1710 3300049545 Ga0501329_11307 Ga0501329_11307_52_288 77
1711 3300049551 Ga0501335_001328 Ga0501335_001328_747_980 77
1712 3300049568 Ga0501031_0046396 Ga0501031_0046396_894_1130 77
1713 3300049568 Ga0501031_0495590 Ga0501031_0495590_485_721 77
1714 3300049568 Ga0501031_0834112 Ga0501031_0834112_120_356 77
1715 3300049569 Ga0501032_0022036 Ga0501032_0022036_1164_1400 77
1716 3300049569 Ga0501032_0026782 Ga0501032_0026782_384_620 77
1717 3300049569 Ga0501032_0359666 Ga0501032_0359666_14_247 77
1718 3300049569 Ga0501032_0639612 Ga0501032_0639612_129_365 77
1719 3300049570 Ga0501033_0093854 Ga0501033_0093854_91_327 77
1720 3300049570 Ga0501033_0097255 Ga0501033_0097255_705_941 77
1721 3300049571 Ga0501034_0113919 Ga0501034_0113919_2189_2425 77
1722 3300049571 Ga0501034_0254566 Ga0501034_0254566_226_462 77
1723 3300049572 Ga0501036_1217750 Ga0501036_1217750_185_421 77
1724 3300049572 Ga0501036_1303379 Ga0501036_1303379_102_338 77
1725 3300049573 Ga0501037_0107974 Ga0501037_0107974_1221_1457 77
1726 3300049574 Ga0501038_0031543 Ga0501038_0031543_512_748 77
1727 3300049574 Ga0501038_0984568 Ga0501038_0984568_183_419 77
1728 3300049574 Ga0501038_1147500 Ga0501038_1147500_32_268 77
1729 3300049574 Ga0501038_1244585 Ga0501038_1244585_255_491 77
1730 3300049575 Ga0501039_0103982 Ga0501039_0103982_1556_1792 77
1731 3300049575 Ga0501039_1572663 Ga0501039_1572663_231_464 77
1732 3300049577 Ga0501041_0892512 Ga0501041_0892512_97_333 77
1733 3300049579 Ga0501043_0025985 Ga0501043_0025985_1210_1446 77
1734 3300049579 Ga0501043_0047711 Ga0501043_0047711_2506_2742 77
1735 3300049579 Ga0501043_0202331 Ga0501043_0202331_1003_1239 77
1736 3300049580 Ga0501046_0702251 Ga0501046_0702251_174_410 77
1737 3300049580 Ga0501046_1141951 Ga0501046_1141951_87_323 77
1738 3300049581 Ga0501047_0002184 Ga0501047_0002184_18098_18334 77
1739 3300049581 Ga0501047_0284352 Ga0501047_0284352_560_796 77
1740 3300049581 Ga0501047_0719899 Ga0501047_0719899_142_378 77
1741 3300049582 Ga0501048_0463682 Ga0501048_0463682_588_824 77
1742 3300049582 Ga0501048_0942093 Ga0501048_0942093_77_313 77
1743 3300049584 Ga0501068_0617291 Ga0501068_0617291_230_466 77
1744 3300049587 Ga0501071_0221180 Ga0501071_0221180_536_772 77
1745 3300049587 Ga0501071_1344473 Ga0501071_1344473_233_466 77
1746 3300049588 Ga0501072_0693336 Ga0501072_0693336_92_328 77
1747 3300049589 Ga0501073_0221301 Ga0501073_0221301_823_1056 77
1748 3300049592 Ga0501076_0786603 Ga0501076_0786603_325_558 77
1749 3300049593 Ga0501077_0959298 Ga0501077_0959298_45_278 77
1750 3300049651 Ga0501201_017900 Ga0501201_017900_318_554 77
1751 3300049652 Ga0501202_076526 Ga0501202_076526_226_462 77
1752 3300049661 Ga0501217_003366 Ga0501217_003366_17_253 77
1753 3300049663 Ga0501223_000012 Ga0501223_000012_70979_71212 77
1754 3300049669 Ga0501235_003056 Ga0501235_003056_2230_2463 77
1755 3300049670 Ga0501236_030806 Ga0501236_030806_95_328 77
1756 3300049672 Ga0501239_017061 Ga0501239_017061_434_670 77
1757 3300049677 Ga0501247_041314 Ga0501247_041314_401_637 77
1758 3300049679 Ga0501249_000081 Ga0501249_000081_3456_3692 77
1759 3300049679 Ga0501249_106212 Ga0501249_106212_170_406 77
1760 3300049680 Ga0501250_108908 Ga0501250_108908_216_452 77
1761 3300049681 Ga0501251_011865 Ga0501251_011865_785_1021 77
1762 3300049683 Ga0501253_054649 Ga0501253_054649_494_730 77
1763 3300049685 Ga0501256_010588 Ga0501256_010588_121_354 77
1764 3300049685 Ga0501256_022412 Ga0501256_022412_416_652 77
1765 3300049686 Ga0501257_042240 Ga0501257_042240_709_945 77
1766 3300049688 Ga0501259_209920 Ga0501259_209920_172_408 77
1767 3300049704 Ga0501221_091303 Ga0501221_091303_132_368 77
1768 3300049705 Ga0501225_0000500 Ga0501225_0000500_5737_5970 77
1769 3300049705 Ga0501225_0002430 Ga0501225_0002430_4113_4346 77
1770 3300049705 Ga0501225_0306185 Ga0501225_0306185_230_466 77
1771 3300049707 Ga0501234_002192 Ga0501234_002192_28_264 77
1772 3300049708 Ga0501245_107247 Ga0501245_107247_209_445 77
1773 3300049742 Ga0501080_0677811 Ga0501080_0677811_666_899 77
1774 3300049742 Ga0501080_1759949 Ga0501080_1759949_51_287 77
1775 3300049761 Ga0501264_003192 Ga0501264_003192_184_417 77
1776 3300049764 Ga0501267_018110 Ga0501267_018110_293_529 77
1777 3300049765 Ga0501268_025217 Ga0501268_025217_170_406 77
1778 3300049765 Ga0501268_030694 Ga0501268_030694_119_355 77
1779 3300049765 Ga0501268_105821 Ga0501268_105821_293_529 77
1780 3300049765 Ga0501268_180703 Ga0501268_180703_239_475 77
1781 3300049767 Ga0501270_061237 Ga0501270_061237_347_583 77
1782 3300049770 Ga0501273_089049 Ga0501273_089049_143_379 77
1783 3300049822 Ga0501035_0025892 Ga0501035_0025892_3293_3529 77
1784 3300049822 Ga0501035_0220204 Ga0501035_0220204_884_1120 77
1785 3300049822 Ga0501035_1493566 Ga0501035_1493566_87_326 77
1786 3300049823 Ga0501044_0009404 Ga0501044_0009404_8919_9155 77
1787 3300049823 Ga0501044_0708869 Ga0501044_0708869_129_365 77
1788 3300049851 Ga0501212_057866 Ga0501212_057866_400_636 77
1789 3300050489 nmdc:mga03683_137644_c1 nmdc:mga03683_137644_c1_295_528 77
1790 3300050490 nmdc:mga03n38_65880_c1 nmdc:mga03n38_65880_c1_666_899 77
1791 3300050492 nmdc:mga0yw44_1032226_c1 nmdc:mga0yw44_1032226_c1_242_478 77
1792 3300050493 nmdc:mga0k408_443972_c1 nmdc:mga0k408_443972_c1_316_552 77
1793 3300050493 nmdc:mga0k408_921332_c1 nmdc:mga0k408_921332_c1_63_296 77
1794 3300050494 nmdc:mga06z11_30_c1 nmdc:mga06z11_30_c1_7027_7260 77
1795 3300050494 nmdc:mga06z11_630531_c1 nmdc:mga06z11_630531_c1_210_446 77
1796 3300050495 nmdc:mga04h51_93_c1 nmdc:mga04h51_93_c1_6987_7220 77
1797 3300050496 nmdc:mga07m45_132908_c1 nmdc:mga07m45_132908_c1_797_1030 77
1798 3300050496 nmdc:mga07m45_383246_c1 nmdc:mga07m45_383246_c1_34_267 77
1799 3300050507 nmdc:mga05p37_105778_c1 nmdc:mga05p37_105778_c1_2606_2839 77
1800 3300050507 nmdc:mga05p37_1448994_c1 nmdc:mga05p37_1448994_c1_139_375 77
1801 3300050507 nmdc:mga05p37_466271_c1 nmdc:mga05p37_466271_c1_512_748 77
1802 3300050508 nmdc:mga09592_356660_c1 nmdc:mga09592_356660_c1_24_260 77
1803 3300050509 nmdc:mga0qj67_1086296_c1 nmdc:mga0qj67_1086296_c1_352_588 77
1804 3300050509 nmdc:mga0qj67_147987_c1 nmdc:mga0qj67_147987_c1_1343_1579 77
1805 3300050509 nmdc:mga0qj67_300384_c1 nmdc:mga0qj67_300384_c1_751_987 77
1806 3300050510 nmdc:mga06r32_1302965_c1 nmdc:mga06r32_1302965_c1_83_319 77
1807 3300050510 nmdc:mga06r32_5128_c1 nmdc:mga06r32_5128_c1_10541_10777 77
1808 3300050511 nmdc:mga08y16_259973_c1 nmdc:mga08y16_259973_c1_659_895 77
1809 3300050512 nmdc:mga0n895_1117221_c1 nmdc:mga0n895_1117221_c1_26_262 77
1810 3300053087 Ga0500643_000166 Ga0500643_000166_46962_47198 77
1811 3300053087 Ga0500643_004300 Ga0500643_004300_29_265 77
1812 3300053087 Ga0500643_007289 Ga0500643_007289_113_346 77
1813 3300053087 Ga0500643_013345 Ga0500643_013345_72_308 77
1814 3300053087 Ga0500643_019505 Ga0500643_019505_1148_1381 77
1815 3300053087 Ga0500643_081747 Ga0500643_081747_460_696 77
1816 3300053087 Ga0500643_128577 Ga0500643_128577_157_393 77
1817 3300053088 Ga0500644_0328279 Ga0500644_0328279_314_547 77
1818 3300053096 Ga0500641_0041486 Ga0500641_0041486_881_1117 77
1819 3300053098 Ga0500650_0096894 Ga0500650_0096894_719_952 77
1820 3300053104 Ga0500556_0000136 Ga0500556_0000136_22252_22485 77
1821 3300053105 Ga0500557_065418 Ga0500557_065418_417_650 77
1822 3300053108 Ga0500562_049677 Ga0500562_049677_221_460 77
1823 3300053116 Ga0500592_001051 Ga0500592_001051_2362_2598 77
1824 3300053116 Ga0500592_004853 Ga0500592_004853_1724_1960 77
1825 3300053118 Ga0500594_0002435 Ga0500594_0002435_498_731 77
1826 3300053118 Ga0500594_0070406 Ga0500594_0070406_665_901 77
1827 3300053119 Ga0500595_169366 Ga0500595_169366_224_460 77
1828 3300053120 Ga0500597_048749 Ga0500597_048749_1227_1463 77
1829 3300053122 Ga0500608_033939 Ga0500608_033939_1513_1746 77
1830 3300053130 Ga0500642_0000003 Ga0500642_0000003_288928_289161 77
1831 3300053133 Ga0500655_010685 Ga0500655_010685_784_1026 77
1832 3300053134 Ga0500658_0004244 Ga0500658_0004244_4508_4744 77
1833 3300053134 Ga0500658_0071407 Ga0500658_0071407_292_525 77
1834 3300053134 Ga0500658_0074626 Ga0500658_0074626_555_791 77
1835 3300053136 Ga0500559_0146737 Ga0500559_0146737_491_727 77
1836 3300053136 Ga0500559_0558062 Ga0500559_0558062_250_483 77
1837 3300053139 Ga0500568_0002097 Ga0500568_0002097_976_1212 77
1838 3300053139 Ga0500568_0025764 Ga0500568_0025764_1437_1670 77
1839 3300053139 Ga0500568_0138671 Ga0500568_0138671_361_597 77
1840 3300053139 Ga0500568_0318989 Ga0500568_0318989_151_387 77
1841 3300053140 Ga0500573_0084974 Ga0500573_0084974_684_920 77
1842 3300053140 Ga0500573_0417937 Ga0500573_0417937_35_271 77
1843 3300053150 Ga0500603_296304 Ga0500603_296304_167_400 77
1844 3300053151 Ga0500604_0009664 Ga0500604_0009664_1077_1313 77
1845 3300053151 Ga0500604_0061600 Ga0500604_0061600_507_743 77
1846 3300053151 Ga0500604_0145179 Ga0500604_0145179_92_328 77
1847 3300053153 Ga0500616_0008998 Ga0500616_0008998_362_598 77
1848 3300053153 Ga0500616_0035993 Ga0500616_0035993_962_1198 77
1849 3300053153 Ga0500616_0236250 Ga0500616_0236250_384_620 77
1850 3300053156 Ga0500622_0171960 Ga0500622_0171960_370_603 77
1851 3300053157 Ga0500624_000001 Ga0500624_000001_192539_192775 77
1852 3300053157 Ga0500624_000009 Ga0500624_000009_49221_49454 77
1853 3300053158 Ga0500627_0000012 Ga0500627_0000012_93246_93482 77
1854 3300053158 Ga0500627_0000164 Ga0500627_0000164_11198_11434 77
1855 3300053158 Ga0500627_0206961 Ga0500627_0206961_620_856 77
1856 3300053178 Ga0500637_0000010 Ga0500637_0000010_57060_57296 77
1857 3300053730 Ga0500645_000962 Ga0500645_000962_646_879 77
1858 3300053730 Ga0500645_025530 Ga0500645_025530_1327_1563 77
1859 3300053730 Ga0500645_117617 Ga0500645_117617_249_488 77
1860 3300054114 Ga0501084_1377102 Ga0501084_1377102_178_414 77
1861 3300059421 Ga0590071_054107 Ga0590071_054107_534_770 77
1862 3300059421 Ga0590071_073645 Ga0590071_073645_401_637 77
1863 3300059424 Ga0590075_084551 Ga0590075_084551_217_453 77
1864 3300059426 Ga0590077_048986 Ga0590077_048986_563_799 77
1865 3300059510 Ga0587090_082715 Ga0587090_082715_104_340 77
1866 3300059624 Ga0587109_195984 Ga0587109_195984_72_308 77
1867 3300060346 Ga0587111_0191919 Ga0587111_0191919_274_510 77
1868 3300061719 Ga0466962_0019709 Ga0466962_0019709_231_467 77
1869 3300061719 Ga0466962_0089286 Ga0466962_0089286_313_549 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

21

88

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qnw-assembly1.cif.gz_A toxoplasma gondii apicoplast-targeted acyl carrier protein 0.9862 5 76
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.9849 2 73
1f80-assembly1.cif.gz_E holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.9837 2 74
6lvu-assembly2.cif.gz_B crystal structure of apo acyl carrier protein from thermotoga maritima 0.9797 3 77
6n3p-assembly1.cif.gz_G crosslinked acpp=fabz complex from e. coli type ii fas 0.978 5 73
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9961 4 75 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9851 4 77 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9849 2 73 1.10.1200.10
1f80E00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9837 2 74 1.10.1200.10
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9762 1 75 1.10.1200.10

Feature Viewer

pLDDT pTM Quality
90.98 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map