F497325

General Info

Members Datasets Scaffolds Average Seq Length
3501 965 3259 319

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002769|Ga0395905_0002769_5452_6540
Length 362
Sequence MAHRRDLVSVAQPRSEAGRVLNHVGIPTIHVLHLKGGTVSKVTFLNFEQPIAELDSKIEELRFVQDDSAVDISEEIDRLSKKSQQLTKDIYAKLTPWQVAQIARHPQRPYTLDYVNEIFTDFHELHGDRNFGDDLSIVGGLARFNGQSCMVIGHQKGRDTKERALRNFGMPRPEGYRKAMRLMKLAEKFNLPIFTFVDTPGAFPGIDAEERGQSEAIGHNLYMMAELKVPIITTIIGEGGSGGALAIAVADTVVMLQYATYSVISPEGCASILWKTAERASDAAEALGLTAHRLKALNLIDKIVNEPLGGAHRDPKQMAVLLKRALADSLRQFHGMKPRELLDARHAKLMSYGKFKEISQPE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
6 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
9 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
10 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
11 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
14 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
15 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
16 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
17 2547132374 Acidovorax radicis N35 Isolate Unclassified
18 2547132512 Azospira oryzae 6a3 Isolate Unclassified
19 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
20 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
21 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
22 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
23 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
24 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
25 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
26 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
27 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
28 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
29 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
30 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
31 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
32 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
33 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
34 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
35 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
36 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
37 2643221556 Massilia sp. Root1485 Isolate Unclassified
38 2643221569 Achromobacter sp. Root565 Isolate Unclassified
39 2643221570 Acidovorax sp. Root568 Isolate Unclassified
40 2643221585 Pelomonas sp. Root662 Isolate Unclassified
41 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
42 2643221594 Achromobacter sp. Root170 Isolate Unclassified
43 2643221596 Acidovorax sp. Root70 Isolate Unclassified
44 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
45 2643221609 Acidovorax sp. Root217 Isolate Unclassified
46 2643221611 Acidovorax sp. Root219 Isolate Unclassified
47 2643221621 Achromobacter sp. Root83 Isolate Unclassified
48 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
49 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
50 2643221638 Duganella sp. Root336D2 Isolate Unclassified
51 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
52 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
53 2643221645 Massilia sp. Root351 Isolate Unclassified
54 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
55 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
56 2643221652 Acidovorax sp. Root402 Isolate Unclassified
57 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
58 2643221656 Pelomonas sp. Root405 Isolate Unclassified
59 2643221658 Variovorax sp. Root411 Isolate Unclassified
60 2643221660 Methylibium sp. Root1272 Isolate Unclassified
61 2643221664 Massilia sp. Root418 Isolate Unclassified
62 2643221672 Variovorax sp. Root434 Isolate Unclassified
63 2643221683 Variovorax sp. Root473 Isolate Unclassified
64 2643221684 Massilia sp. Root133 Isolate Unclassified
65 2643221717 Acidovorax sp. Root267 Isolate Unclassified
66 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
67 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
68 2721755523 Delftia sp. HK171 Isolate Unclassified
69 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
70 2738541277 Variovorax sp. GV051 Isolate Unclassified
71 2738541280 Massilia sp. GV090 Isolate Unclassified
72 2738541283 Pedobacter sp. OK701 Isolate Unclassified
73 2738541284 Pedobacter sp. YR016 Isolate Unclassified
74 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
75 2738541297 Duganella sp. GV083 Isolate Unclassified
76 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
77 2738541300 Massilia sp. GV016 Isolate Unclassified
78 2738541302 Pedobacter sp. CF074 Isolate Unclassified
79 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
80 2738541307 Variovorax sp. GV008 Isolate Unclassified
81 2738541337 Pelomonas sp. BT06 Isolate Unclassified
82 2738541357 Duganella sp. GV053 Isolate Unclassified
83 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
84 2738543003 Duganella sp. GV066 Isolate Unclassified
85 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
86 2738543012 Acidovorax sp. CF301 Isolate Unclassified
87 2738543013 Variovorax sp. BT01 Isolate Unclassified
88 2738543018 Massilia sp. GV045 Isolate Unclassified
89 2738543019 Variovorax sp. GV040 Isolate Unclassified
90 2738543023 Pedobacter sp. OK628 Isolate Unclassified
91 2738543026 Duganella sp. GV089 Isolate Unclassified
92 2738543029 Duganella sp. GV039 Isolate Unclassified
93 2738543030 Massilia sp. GV097 Isolate Unclassified
94 2739367651 Pedobacter sp. OK291 Isolate Unclassified
95 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
96 2739367656 Pedobacter sp. CF523 Isolate Unclassified
97 2739367663 Pedobacter sp. YR510 Isolate Unclassified
98 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
99 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
100 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
101 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
102 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
103 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
104 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
105 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
106 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
107 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
108 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
109 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
110 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
111 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
112 2816332133 Acidovorax radicis 2721A Isolate Unclassified
113 2818991436 Collimonas arenae 515 Isolate Unclassified
114 2818991437 Pedobacter terrae 518 Isolate Unclassified
115 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
116 2818991446 Variovorax sp. 1180 Isolate Unclassified
117 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
118 2818991450 Burkholderia sp. 604 Isolate Unclassified
119 2821131069 Duganella sp. 1224 Isolate Unclassified
120 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
121 2831864461 Roseateles noduli HZ7 Isolate Nodule
122 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
123 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
124 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
125 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
126 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
127 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
128 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
129 2842677519 Variovorax sp. R-72495 Isolate Unclassified
130 2842711865 Duganella sp. R-73148 Isolate Unclassified
131 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
132 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
133 2842733646 Variovorax sp. R-72446 Isolate Unclassified
134 2842747753 Variovorax sp. R-72060 Isolate Unclassified
135 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
136 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
137 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
138 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
139 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
140 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
141 2855730933 Achromobacter sp. HZ28 Isolate Nodule
142 2855767633 Achromobacter sp. HZ34 Isolate Nodule
143 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
144 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
145 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
146 2857553236 Duganella sp. R-74557 Isolate Unclassified
147 2857558681 Duganella sp. R-74565 Isolate Unclassified
148 2857564685 Duganella sp. R-74599 Isolate Unclassified
149 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
150 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
151 2858950400 Achromobacter sp. K91 Isolate Unclassified
152 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
153 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
154 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
155 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
156 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
157 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
158 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
159 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
160 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
161 2885198086 Variovorax sp. 679 Isolate Unclassified
162 2885211737 Variovorax sp. 553 Isolate Unclassified
163 2885266251 Ralstonia sp. SET104 Isolate Nodule
164 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
165 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
166 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
167 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
168 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
169 2899924645 Variovorax sp. 369 Isolate Unclassified
170 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
171 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
172 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
173 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
174 2904424332 Duganella sp. 1411 Isolate Rhizosphere
175 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
176 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
177 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
178 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
179 2904456579 Variovorax sp. 2002 Isolate Unclassified
180 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
181 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
182 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
183 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
184 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
185 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
186 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
187 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
188 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
189 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
190 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
191 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
192 2919476304 Duganella sp. 3397 Isolate Unclassified
193 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
194 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
195 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
196 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
197 2928037797 Variovorax sp. 1126 Isolate Unclassified
198 2928044640 Variovorax sp. 1128 Isolate Unclassified
199 2928051484 Variovorax sp. 1133 Isolate Unclassified
200 2928058823 Ralstonia sp. 1138 Isolate Unclassified
201 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
202 2928070936 Variovorax gossypii 1167 Isolate Unclassified
203 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
204 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
205 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
206 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
207 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
208 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
209 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
210 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
211 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
212 2929520902 Variovorax beijingensis 502 Isolate Unclassified
213 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
214 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
215 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
216 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
217 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
218 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
219 2941479691
220 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
221 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
222 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
223 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
224 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
225 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
226 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
227 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
228 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
229 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
230 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
231 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
232 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
233 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
234 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
235 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
236 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
237 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
238 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
239 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
240 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
241 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
242 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
243 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
244 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
245 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
246 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
247 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
248 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
249 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
250 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
251 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
252 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
253 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
254 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
255 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
256 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
257 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
258 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
259 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
260 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
261 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
263 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
264 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
265 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
266 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
267 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
268 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
269 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
270 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
271 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
272 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
273 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
274 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
275 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
276 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
277 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
278 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
279 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
280 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
281 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
282 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
283 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
284 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
285 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
286 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
287 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
288 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
289 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
290 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
291 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
292 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
293 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
294 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
295 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
296 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
297 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
298 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
299 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
300 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
301 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
302 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
303 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
304 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
305 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
306 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
307 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
308 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
309 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
310 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
311 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
312 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
313 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
314 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
315 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
316 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
317 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
318 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
319 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
320 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
321 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
322 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
323 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
324 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
325 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
326 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
327 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
328 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
329 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
330 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
331 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
332 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
333 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
334 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
335 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
336 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
337 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
338 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
339 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
340 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
341 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
342 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
343 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
344 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
345 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
346 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
347 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
348 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
349 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
350 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
351 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
352 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
353 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
354 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
355 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
356 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
357 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
358 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
359 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
360 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
361 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
362 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
363 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
364 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
365 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
366 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
367 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
368 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
369 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
370 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
371 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
372 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
373 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
374 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
375 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
376 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
377 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
378 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
379 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
380 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
381 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
382 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
383 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
384 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
385 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
386 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
387 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
388 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
389 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
390 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
391 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
392 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
393 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
394 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
395 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
396 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
397 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
398 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
399 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
400 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
401 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
402 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
403 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
404 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
405 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
406 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
407 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
408 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
409 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
410 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
411 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
412 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
413 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
414 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
415 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
416 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
417 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
418 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
419 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
420 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
421 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
422 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
423 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
424 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
425 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
426 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
427 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
428 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
429 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
430 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
431 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
432 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
433 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
434 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
435 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
436 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
437 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
438 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
440 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
441 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
442 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
443 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
444 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
445 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
446 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
448 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
449 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
450 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
451 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
452 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
453 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
454 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
455 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
456 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
459 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
460 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
461 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
462 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
464 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
465 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
466 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
468 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
469 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
470 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
472 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
473 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
474 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
475 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
530 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
532 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
535 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
537 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
538 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
539 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
543 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
544 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
545 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
546 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
547 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
548 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
550 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
551 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
552 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
553 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
554 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
555 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
556 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
557 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
559 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
560 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
561 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
562 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
563 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
564 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
565 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
566 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
567 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
568 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
569 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
570 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
571 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
572 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
573 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
574 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
575 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
576 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
577 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
578 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
579 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
580 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
581 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
582 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
583 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
584 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
585 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
586 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
587 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
588 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
589 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
590 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
591 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
592 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
593 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
594 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
595 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
596 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
597 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
598 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
599 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
600 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
601 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
602 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
603 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
604 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
605 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
606 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
607 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
608 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
609 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
610 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
611 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
612 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
613 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
614 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
615 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
616 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
618 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
619 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
622 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
623 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
624 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
625 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
626 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
627 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
628 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
629 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
630 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
631 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
632 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
633 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
634 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
635 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
636 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
637 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
638 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
639 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
640 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
641 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
642 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
643 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
644 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
645 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
646 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
647 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
648 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
649 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
650 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
651 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
652 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
653 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
654 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
655 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
656 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
657 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
658 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
659 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
660 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
661 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
662 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
663 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
664 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
665 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
666 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
667 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
668 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
669 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
670 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
671 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
672 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
673 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
674 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
675 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
676 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
677 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
678 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
679 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
680 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
681 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
682 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
683 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
684 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
685 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
686 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
687 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
688 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
689 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
690 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
691 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
692 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
693 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
694 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
695 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
696 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
697 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
698 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
699 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
700 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
701 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
702 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
703 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
704 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
705 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
706 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
707 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
708 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
709 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
710 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
711 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
712 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
713 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
714 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
715 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
716 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
717 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
718 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
719 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
720 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
721 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
722 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
723 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
724 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
725 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
726 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
727 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
728 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
729 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
730 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
731 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
732 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
733 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
734 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
735 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
736 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
737 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
738 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
739 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
740 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
741 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
742 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
743 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
744 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
745 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
746 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
747 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
748 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
749 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
750 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
751 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
752 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
753 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
754 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
755 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
756 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
757 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
758 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
759 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
760 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
761 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
762 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
763 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
764 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
765 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
766 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
767 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
768 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
769 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
770 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
771 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
772 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
773 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
774 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
775 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
776 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
777 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
778 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
779 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
780 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
781 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
782 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
783 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
784 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
785 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
786 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
787 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
788 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
789 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
790 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
791 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
792 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
793 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
794 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
795 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
796 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
797 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
798 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
799 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
800 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
801 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
802 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
803 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
804 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
805 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
806 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
807 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
808 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
809 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
810 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
811 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
812 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
813 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
814 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
815 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
816 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
817 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
818 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
819 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
820 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
821 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
822 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
823 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
824 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
825 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
826 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
827 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
828 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
829 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
830 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
831 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
832 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
833 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
834 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
835 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
836 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
837 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
838 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
839 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
840 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
841 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
842 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
843 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
844 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
845 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
846 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
847 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
848 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
849 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
850 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
851 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
852 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
853 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
854 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
855 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
856 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
857 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
858 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
859 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
860 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
861 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
862 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
863 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
864 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
865 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
866 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
867 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
868 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
869 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
870 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
871 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
872 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
873 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
874 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
875 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
876 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
877 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
878 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
879 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
880 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
881 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
882 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
883 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
884 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
885 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
886 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
887 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
888 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
889 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
890 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
891 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
892 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
893 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
894 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
895 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
896 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
897 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
898 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
899 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
900 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
901 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
902 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
903 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
904 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
905 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
906 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
907 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
908 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
909 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
910 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
911 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
912 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
913 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
914 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
915 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
916 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
917 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
918 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
919 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
920 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
921 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
922 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
923 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
924 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
925 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
926 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
927 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
928 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
929 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
930 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
931 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
932 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
933 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
934 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
935 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
936 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
937 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
938 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
939 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
940 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
941 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
942 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
943 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
944 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
945 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
946 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
947 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
948 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
949 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
950 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
951 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
952 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
953 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
954 639633007 Azoarcus olearius BH72 Isolate Unclassified
955 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
956 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
957 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
958 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
959 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
960 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
961 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
962 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
963 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
964 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
965 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.8
Metatranscriptomes 1.29
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.4
Nodule 1.14
Rhizoplane 2.37
Rhizosphere 74.44
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_20252 2162886007 Bacteria 9216
2 SwRhRL2b_contig_3536978 2162886007 Bacteria 1513
3 JGI24741J21665_1000812 3300001915 Bacteria 9388
4 JGI24740J21852_10001296 3300001979 Bacteria 11360
5 JGI24740J21852_10001980 3300001979 Bacteria 9358
6 JGI24740J21852_10007839 3300001979 Bacteria 4309
7 JGI24740J21852_10017042 3300001979 Bacteria 2609
8 JGI24739J22299_10043291 3300001989 Bacteria 1489
9 JGI24737J22298_10064721 3300001990 Bacteria 1097
10 JGI24735J21928_10000801 3300002067 Bacteria 11204
11 JGI24738J21930_10000986 3300002075 Bacteria 8159
12 JGI25155J39150_1000174 3300002704 Bacteria 28283
13 JGI25155J39150_1000640 3300002704 Bacteria 7005
14 JGI25156J39149_1000002 3300002705 Bacteria 343501
15 JGI25156J39149_1000168 3300002705 Bacteria 47907
16 JGI25156J39149_1001483 3300002705 Bacteria 9840
17 JGI25156J39149_1005207 3300002705 Bacteria 3807
18 JGI25156J39149_1007051 3300002705 Bacteria 3004
19 JGI25162J39368_1000083 3300002737 Bacteria 109521
20 JGI25154J39366_1000010 3300002738 Bacteria 297985
21 JGI25154J39366_1000185 3300002738 Bacteria 47907
22 JGI25154J39366_1000245 3300002738 Bacteria 35470
23 JGI25154J39366_1000549 3300002738 Bacteria 18579
24 JGI25154J39366_1000703 3300002738 Bacteria 15281
25 JGI25158J39367_1014853 3300002739 Bacteria 1001
26 JGI25157J39369_1000001 3300002741 Bacteria 363277
27 JGI25157J39369_1000399 3300002741 Bacteria 29865
28 JGI25157J39369_1000429 3300002741 Bacteria 27371
29 JGI25152J39213_1000006 3300002773 Bacteria 158516
30 JGI25152J39213_1000204 3300002773 Bacteria 39867
31 JGI25152J39213_1003414 3300002773 Bacteria 5436
32 JGI25150J39212_1000005 3300002774 Bacteria 311800
33 JGI25150J39212_1002631 3300002774 Bacteria 4408
34 JGI25150J39212_1002688 3300002774 Bacteria 4334
35 JGI25150J39212_1005032 3300002774 Bacteria 2860
36 JGI25159J45721_1000897 3300002987 Bacteria 12953
37 JGI25159J45721_1004328 3300002987 Bacteria 4740
38 JGI25159J45721_1013462 3300002987 Bacteria 1889
39 Ga0006759J45824_1057535 3300003163 Bacteria 1577
40 JGI25151J46595_10000004 3300003187 Bacteria 494006
41 JGI25151J46595_10000277 3300003187 Bacteria 59086
42 JGI25151J46595_10001330 3300003187 Bacteria 17271
43 JGI25151J46595_10007165 3300003187 Bacteria 5495
44 JGI25151J46595_10010351 3300003187 Bacteria 4346
45 JGI25151J46595_10013650 3300003187 Bacteria 3648
46 JGI25151J46595_10020477 3300003187 Bacteria 2788
47 JGI25151J46595_10037267 3300003187 Bacteria 1825
48 JGI25406J46586_10008436 3300003203 Bacteria 4667
49 JGI25165J46597_1000064 3300003214 Bacteria 199878
50 JGI25153J46596_10000004 3300003215 Bacteria 494006
51 JGI25153J46596_10003141 3300003215 Bacteria 9317
52 rootH2_10002127 3300003320 Bacteria 66384
53 rootH1_10032395 3300003323 Bacteria 2171
54 rootH1_10060699 3300003323 Bacteria 6869
55 rootH1_10218092 3300003323 Bacteria 1686
56 JGI25160J50197_1000102 3300003354 Bacteria 82464
57 JGI25160J50197_1000179 3300003354 Bacteria 53666
58 JGI25160J50197_1004592 3300003354 Bacteria 5943
59 JGI25161J50226_1000076 3300003374 Bacteria 84478
60 JGI25161J50226_1002401 3300003374 Bacteria 4824
61 JGI25161J50226_1003041 3300003374 Bacteria 4017
62 Ga0007417J51691_1018019 3300003544 Bacteria 1740
63 Ga0007417J51691_1049231 3300003544 Bacteria 1205
64 Ga0007410J51695_1020662 3300003574 Bacteria 1528
65 Ga0007409J51694_1007615 3300003575 Bacteria 1738
66 Ga0007409J51694_1012812 3300003575 Bacteria 2806
67 Ga0007416J51690_1017424 3300003577 Bacteria 6610
68 Ga0007411J51799_109832 3300003611 Bacteria 1298
69 Ga0032354_1029923 3300003693 Bacteria 2376
70 Ga0055538_1000002 3300003751 Bacteria 999437
71 Ga0055538_1000031 3300003751 Bacteria 199878
72 Ga0055538_1004126 3300003751 Bacteria 1701
73 Ga0055539_1000002 3300003752 Bacteria 999437
74 Ga0055539_1000041 3300003752 Bacteria 199878
75 Ga0055539_1000246 3300003752 Bacteria 34904
76 Ga0055533_1000004 3300003756 Bacteria 999437
77 Ga0055533_1000051 3300003756 Bacteria 199878
78 Ga0055533_1002041 3300003756 Bacteria 4889
79 Ga0055533_1002283 3300003756 Bacteria 4455
80 Ga0055533_1003652 3300003756 Bacteria 3026
81 Ga0055532_1000001 3300003758 Bacteria 1119836
82 Ga0055532_1000002 3300003758 Bacteria 576000
83 Ga0055532_1000029 3300003758 Bacteria 232900
84 Ga0055532_1000050 3300003758 Bacteria 169240
85 Ga0055525_1000002 3300003759 Bacteria 999437
86 Ga0055525_1000011 3300003759 Bacteria 503124
87 Ga0055525_1000046 3300003759 Bacteria 261587
88 Ga0055525_1000047 3300003759 Bacteria 261507
89 Ga0055525_1000061 3300003759 Bacteria 199878
90 Ga0055525_1000378 3300003759 Bacteria 29231
91 Ga0055527_1000002 3300003760 Bacteria 830488
92 Ga0055527_1000383 3300003760 Bacteria 19413
93 Ga0055535_1000001 3300003761 Bacteria 1119836
94 Ga0055535_1000612 3300003761 Bacteria 29305
95 Ga0055535_1003298 3300003761 Bacteria 4668
96 Ga0055542_1000001 3300003762 Bacteria 1119836
97 Ga0055542_1000004 3300003762 Bacteria 553532
98 Ga0055542_1000735 3300003762 Bacteria 25388
99 Ga0055529_1000001 3300003763 Bacteria 826680
100 Ga0055529_1000028 3300003763 Bacteria 287650
101 Ga0055529_1000293 3300003763 Bacteria 58070
102 Ga0055529_1001788 3300003763 Bacteria 5244
103 Ga0055526_1000439 3300003771 Bacteria 33186
104 Ga0055526_1000654 3300003771 Bacteria 26768
105 Ga0055526_1000752 3300003771 Bacteria 24231
106 Ga0055526_1014282 3300003771 Bacteria 3278
107 Ga0055537_1000102 3300003773 Bacteria 63809
108 Ga0055537_1000271 3300003773 Bacteria 37521
109 Ga0055537_1000554 3300003773 Bacteria 21198
110 Ga0055537_1002368 3300003773 Bacteria 6383
111 Ga0055537_1002377 3300003773 Bacteria 6367
112 Ga0055524_1000008 3300003775 Bacteria 297761
113 Ga0055524_1000093 3300003775 Bacteria 111953
114 Ga0055524_1000183 3300003775 Bacteria 70460
115 Ga0055524_1000493 3300003775 Bacteria 30936
116 Ga0055524_1008015 3300003775 Bacteria 4429
117 Ga0055524_1010115 3300003775 Bacteria 3779
118 Ga0055536_1000124 3300003781 Bacteria 66148
119 Ga0055536_1004090 3300003781 Bacteria 7585
120 Ga0055536_1005630 3300003781 Bacteria 6067
121 Ga0055536_1009755 3300003781 Bacteria 3921
122 Ga0055534_1000251 3300003784 Bacteria 37571
123 Ga0055534_1000432 3300003784 Bacteria 25007
124 Ga0055534_1004363 3300003784 Bacteria 4124
125 Ga0055528_1000744 3300003790 Bacteria 22729
126 Ga0055528_1001274 3300003790 Bacteria 15851
127 Ga0055528_1004763 3300003790 Bacteria 6458
128 Ga0055528_1024292 3300003790 Bacteria 1821
129 Ga0055530_10000285 3300003791 Bacteria 46054
130 Ga0055530_10005799 3300003791 Bacteria 5731
131 Ga0055530_10006805 3300003791 Bacteria 4972
132 Ga0055540_1000119 3300003792 Bacteria 82568
133 Ga0055540_1000196 3300003792 Bacteria 58476
134 Ga0055540_1002092 3300003792 Bacteria 10956
135 Ga0055540_1003106 3300003792 Bacteria 8242
136 Ga0055540_1004606 3300003792 Bacteria 6124
137 Ga0055540_1009693 3300003792 Bacteria 3293
138 Ga0055531_10000064 3300003794 Bacteria 117923
139 Ga0055531_10000776 3300003794 Bacteria 26566
140 Ga0055531_10010231 3300003794 Bacteria 4689
141 Ga0055531_10010751 3300003794 Bacteria 4505
142 Ga0055531_10013212 3300003794 Bacteria 3826
143 Ga0055541_1000002 3300003841 Bacteria 896405
144 Ga0055541_1000028 3300003841 Bacteria 199878
145 Ga0055541_1000043 3300003841 Bacteria 161703
146 Ga0055541_1000762 3300003841 Bacteria 8152
147 Ga0055543_1000118 3300004625 Bacteria 66892
148 Ga0055543_1002781 3300004625 Bacteria 5547
149 Ga0055543_1008133 3300004625 Bacteria 2349
150 Ga0065165_1000039 3300005262 Bacteria 208372
151 Ga0065165_1000074 3300005262 Bacteria 164454
152 Ga0065165_1000233 3300005262 Bacteria 96768
153 Ga0065165_1000787 3300005262 Bacteria 42471
154 Ga0065165_1002662 3300005262 Bacteria 14423
155 Ga0065165_1009408 3300005262 Bacteria 4384
156 Ga0065165_1009565 3300005262 Bacteria 4326
157 Ga0065165_1023871 3300005262 Bacteria 2065
158 Ga0065714_10003130 3300005288 Bacteria 9547
159 Ga0065714_10064583 3300005288 Bacteria 32320
160 Ga0065714_10065075 3300005288 Bacteria 13216
161 Ga0065714_10166280 3300005288 Bacteria 1026
162 Ga0065704_10002117 3300005289 Bacteria 6126
163 Ga0065704_10016834 3300005289 Bacteria 1612
164 Ga0065704_10070246 3300005289 Bacteria 48710
165 Ga0065704_10074755 3300005289 Bacteria 6038
166 Ga0065704_10108249 3300005289 Bacteria 2034
167 Ga0065712_10075254 3300005290 Unclassified 3900
168 Ga0065707_10084798 3300005295 Bacteria 6769
169 Ga0065707_10110683 3300005295 Bacteria 2391
170 Ga0070658_10027758 3300005327 Bacteria 4542
171 Ga0070658_10035989 3300005327 Bacteria 3989
172 Ga0070658_10056212 3300005327 Bacteria 3198
173 Ga0070658_10089514 3300005327 Bacteria 2534
174 Ga0070658_10213056 3300005327 Bacteria 1632
175 Ga0070658_10241650 3300005327 Bacteria 1530
176 Ga0070676_10004849 3300005328 Bacteria 7119
177 Ga0070676_10011623 3300005328 Bacteria 4788
178 Ga0070676_10080606 3300005328 Bacteria 1973
179 Ga0070683_100024131 3300005329 Bacteria 5444
180 Ga0070683_100121556 3300005329 Bacteria 2467
181 Ga0070690_100001791 3300005330 Bacteria 11362
182 Ga0070690_100009371 3300005330 Bacteria 5671
183 Ga0070690_100010317 3300005330 Bacteria 5432
184 Ga0070690_100011086 3300005330 Bacteria 5264
185 Ga0070690_100020329 3300005330 Bacteria 4045
186 Ga0070690_100040675 3300005330 Bacteria 2941
187 Ga0070690_100056938 3300005330 Bacteria 2508
188 Ga0070690_100371708 3300005330 Bacteria 1043
189 Ga0070670_100008004 3300005331 Bacteria 8989
190 Ga0070670_100022364 3300005331 Bacteria 5443
191 Ga0070670_100027095 3300005331 Bacteria 4929
192 Ga0070670_100039722 3300005331 Bacteria 4046
193 Ga0070670_100044925 3300005331 Bacteria 3797
194 Ga0070670_100053737 3300005331 Bacteria 3459
195 Ga0070670_100068678 3300005331 Bacteria 3042
196 Ga0070670_100094152 3300005331 Bacteria 2576
197 Ga0070670_100102307 3300005331 Bacteria 2467
198 Ga0070670_100109397 3300005331 Bacteria 2381
199 Ga0070677_10001379 3300005333 Bacteria 7748
200 Ga0068869_100002260 3300005334 Bacteria 11588
201 Ga0068869_100002944 3300005334 Bacteria 10339
202 Ga0068869_100003399 3300005334 Bacteria 9719
203 Ga0068869_100009039 3300005334 Bacteria 6457
204 Ga0068869_100029342 3300005334 Bacteria 3853
205 Ga0068869_100056917 3300005334 Bacteria 2853
206 Ga0068869_100058219 3300005334 Bacteria 2824
207 Ga0068869_100067537 3300005334 Bacteria 2638
208 Ga0068869_100209408 3300005334 Bacteria 1541
209 Ga0070666_10000702 3300005335 Bacteria 20297
210 Ga0070666_10003075 3300005335 Bacteria 10127
211 Ga0070666_10011965 3300005335 Bacteria 5461
212 Ga0070666_10017293 3300005335 Bacteria 4621
213 Ga0070666_10030025 3300005335 Bacteria 3579
214 Ga0070666_10048476 3300005335 Bacteria 2855
215 Ga0070666_10052799 3300005335 Bacteria 2740
216 Ga0070666_10090535 3300005335 Bacteria 2101
217 Ga0070666_10225015 3300005335 Bacteria 1324
218 Ga0070680_100006209 3300005336 Bacteria 9065
219 Ga0070680_100010892 3300005336 Bacteria 7025
220 Ga0070680_100019919 3300005336 Bacteria 5319
221 Ga0070682_100000001 3300005337 Bacteria 569837
222 Ga0070682_100000123 3300005337 Bacteria 68616
223 Ga0070682_100006866 3300005337 Bacteria 6395
224 Ga0070682_100033691 3300005337 Bacteria 3114
225 Ga0070682_100045546 3300005337 Bacteria 2719
226 Ga0068868_100000449 3300005338 Bacteria 27621
227 Ga0068868_100000679 3300005338 Bacteria 22831
228 Ga0068868_100000963 3300005338 Bacteria 19619
229 Ga0068868_100004301 3300005338 Bacteria 9974
230 Ga0068868_100004718 3300005338 Bacteria 9576
231 Ga0068868_100017218 3300005338 Bacteria 5378
232 Ga0068868_100059942 3300005338 Bacteria 3012
233 Ga0068868_100062027 3300005338 Unclassified 2962
234 Ga0068868_100062285 3300005338 Bacteria 2956
235 Ga0068868_100063696 3300005338 Bacteria 2924
236 Ga0070660_100001539 3300005339 Bacteria 15838
237 Ga0070660_100130338 3300005339 Bacteria 2012
238 Ga0070689_100000313 3300005340 Bacteria 28319
239 Ga0070689_100004270 3300005340 Bacteria 9632
240 Ga0070689_100005157 3300005340 Bacteria 8890
241 Ga0070689_100026092 3300005340 Bacteria 4395
242 Ga0070689_100026938 3300005340 Bacteria 4331
243 Ga0070689_100061988 3300005340 Bacteria 2909
244 Ga0070689_100144208 3300005340 Bacteria 1917
245 Ga0070691_10004174 3300005341 Bacteria 6563
246 Ga0070691_10049622 3300005341 Bacteria 2000
247 Ga0070687_100001173 3300005343 Bacteria 9067
248 Ga0070687_100045473 3300005343 Bacteria 2242
249 Ga0070687_100081411 3300005343 Bacteria 1768
250 Ga0070661_100000063 3300005344 Bacteria 85407
251 Ga0070661_100000171 3300005344 Bacteria 53073
252 Ga0070661_100061361 3300005344 Bacteria 2759
253 Ga0070661_100070616 3300005344 Bacteria 2568
254 Ga0070661_100115830 3300005344 Bacteria 2004
255 Ga0070692_10002086 3300005345 Bacteria 7623
256 Ga0070692_10028855 3300005345 Bacteria 2761
257 Ga0070668_100000613 3300005347 Bacteria 23905
258 Ga0070668_100027160 3300005347 Bacteria 4344
259 Ga0070668_100062118 3300005347 Bacteria 2894
260 Ga0070668_100088343 3300005347 Bacteria 2440
261 Ga0070668_100131863 3300005347 Bacteria 2006
262 Ga0070668_100277468 3300005347 Bacteria 1399
263 Ga0070669_100000169 3300005353 Bacteria 57353
264 Ga0070669_100005737 3300005353 Bacteria 8950
265 Ga0070669_100024221 3300005353 Bacteria 4351
266 Ga0070669_100030061 3300005353 Bacteria 3918
267 Ga0070669_100034332 3300005353 Bacteria 3672
268 Ga0070669_100035165 3300005353 Bacteria 3629
269 Ga0070669_100069431 3300005353 Bacteria 2602
270 Ga0070669_100070241 3300005353 Bacteria 2588
271 Ga0070669_100094956 3300005353 Bacteria 2241
272 Ga0070669_100130921 3300005353 Bacteria 1924
273 Ga0070669_100321927 3300005353 Bacteria 1249
274 Ga0070675_100001515 3300005354 Bacteria 17170
275 Ga0070675_100002078 3300005354 Bacteria 14820
276 Ga0070675_100007450 3300005354 Bacteria 8455
277 Ga0070675_100015931 3300005354 Bacteria 5955
278 Ga0070675_100016156 3300005354 Bacteria 5918
279 Ga0070675_100019536 3300005354 Bacteria 5402
280 Ga0070675_100037121 3300005354 Bacteria 3968
281 Ga0070675_100057834 3300005354 Bacteria 3197
282 Ga0070675_100059737 3300005354 Bacteria 3146
283 Ga0070675_100106028 3300005354 Bacteria 2372
284 Ga0070675_100120224 3300005354 Bacteria 2231
285 Ga0070675_100120411 3300005354 Unclassified 2229
286 Ga0070671_100000492 3300005355 Bacteria 27614
287 Ga0070671_100001763 3300005355 Bacteria 16442
288 Ga0070671_100003154 3300005355 Bacteria 12850
289 Ga0070671_100003542 3300005355 Bacteria 12197
290 Ga0070671_100009875 3300005355 Bacteria 7662
291 Ga0070671_100018139 3300005355 Bacteria 5714
292 Ga0070671_100018988 3300005355 Bacteria 5591
293 Ga0070671_100058128 3300005355 Bacteria 3219
294 Ga0070671_100061107 3300005355 Bacteria 3137
295 Ga0070671_100138012 3300005355 Bacteria 2056
296 Ga0070671_100140750 3300005355 Bacteria 2036
297 Ga0070671_100198487 3300005355 Bacteria 1701
298 Ga0070674_100019062 3300005356 Bacteria 4352
299 Ga0070674_100027444 3300005356 Bacteria 3731
300 Ga0070674_100029419 3300005356 Bacteria 3618
301 Ga0070674_100059284 3300005356 Bacteria 2664
302 Ga0070674_100075836 3300005356 Bacteria 2389
303 Ga0070674_100173390 3300005356 Unclassified 1646
304 Ga0070674_100205614 3300005356 Bacteria 1523
305 Ga0070674_100256606 3300005356 Bacteria 1375
306 Ga0070673_100000466 3300005364 Bacteria 21542
307 Ga0070673_100001265 3300005364 Bacteria 14678
308 Ga0070673_100001661 3300005364 Bacteria 13169
309 Ga0070673_100017418 3300005364 Bacteria 5108
310 Ga0070673_100195420 3300005364 Bacteria 1740
311 Ga0070673_100294553 3300005364 Bacteria 1427
312 Ga0070688_100000868 3300005365 Bacteria 15030
313 Ga0070688_100035183 3300005365 Unclassified 3041
314 Ga0070688_100105451 3300005365 Bacteria 1866
315 Ga0070659_100000309 3300005366 Bacteria 37923
316 Ga0070659_100000363 3300005366 Bacteria 34581
317 Ga0070659_100008037 3300005366 Bacteria 7690
318 Ga0070659_100019525 3300005366 Bacteria 5137
319 Ga0070659_100036335 3300005366 Bacteria 3840
320 Ga0070659_100047647 3300005366 Bacteria 3363
321 Ga0070659_100234470 3300005366 Bacteria 1517
322 Ga0070667_100000628 3300005367 Bacteria 34351
323 Ga0070667_100001660 3300005367 Bacteria 19880
324 Ga0070667_100003283 3300005367 Bacteria 13816
325 Ga0070667_100006529 3300005367 Bacteria 9693
326 Ga0070667_100008436 3300005367 Bacteria 8544
327 Ga0070667_100025755 3300005367 Bacteria 4892
328 Ga0070667_100027791 3300005367 Bacteria 4707
329 Ga0070667_100087626 3300005367 Bacteria 2672
330 Ga0070667_100124401 3300005367 Bacteria 2246
331 Ga0070667_100141893 3300005367 Bacteria 2104
332 Ga0070667_100149966 3300005367 Bacteria 2048
333 Ga0070667_100270432 3300005367 Bacteria 1524
334 Ga0070667_100303281 3300005367 Bacteria 1438
335 Ga0070703_10011913 3300005406 Bacteria 2460
336 Ga0070709_10007633 3300005434 Bacteria 5935
337 Ga0070714_100047993 3300005435 Bacteria 3630
338 Ga0070714_100517523 3300005435 Bacteria 1139
339 Ga0070713_100000082 3300005436 Bacteria 59649
340 Ga0070713_100004766 3300005436 Bacteria 9177
341 Ga0070713_100022973 3300005436 Bacteria 4829
342 Ga0070710_10165626 3300005437 Bacteria 1374
343 Ga0070701_10021299 3300005438 Bacteria 3091
344 Ga0070701_10030877 3300005438 Bacteria 2654
345 Ga0070701_10058798 3300005438 Bacteria 2019
346 Ga0070701_10081063 3300005438 Bacteria 1757
347 Ga0070711_100003379 3300005439 Bacteria 9302
348 Ga0070705_100001344 3300005440 Bacteria 13123
349 Ga0070705_100014405 3300005440 Bacteria 4066
350 Ga0070700_100001732 3300005441 Bacteria 10966
351 Ga0070700_100018818 3300005441 Bacteria 3976
352 Ga0070700_100023518 3300005441 Bacteria 3604
353 Ga0070700_100032079 3300005441 Bacteria 3155
354 Ga0070700_100050929 3300005441 Bacteria 2576
355 Ga0070700_100059211 3300005441 Bacteria 2410
356 Ga0070694_100002752 3300005444 Bacteria 10430
357 Ga0070694_100008531 3300005444 Bacteria 6270
358 Ga0070694_100012962 3300005444 Bacteria 5200
359 Ga0070694_100017137 3300005444 Bacteria 4572
360 Ga0070694_100064033 3300005444 Bacteria 2516
361 Ga0070694_100109061 3300005444 Bacteria 1970
362 Ga0070708_100000002 3300005445 Bacteria 195857
363 Ga0070708_100000054 3300005445 Bacteria 76469
364 Ga0070708_100013041 3300005445 Bacteria 6793
365 Ga0070708_100120772 3300005445 Bacteria 2417
366 Ga0070708_100245492 3300005445 Bacteria 1681
367 Ga0070708_100301778 3300005445 Bacteria 1508
368 Ga0070663_100000006 3300005455 Bacteria 208068
369 Ga0070663_100105567 3300005455 Bacteria 2109
370 Ga0070678_100000359 3300005456 Bacteria 21211
371 Ga0070678_100001521 3300005456 Bacteria 12382
372 Ga0070678_100017423 3300005456 Bacteria 4625
373 Ga0070678_100024505 3300005456 Bacteria 4041
374 Ga0070678_100031089 3300005456 Bacteria 3678
375 Ga0070678_100036171 3300005456 Bacteria 3454
376 Ga0070678_100059295 3300005456 Bacteria 2812
377 Ga0070678_100063951 3300005456 Bacteria 2725
378 Ga0070678_100072989 3300005456 Bacteria 2574
379 Ga0070678_100161930 3300005456 Bacteria 1814
380 Ga0070678_100267818 3300005456 Bacteria 1439
381 Ga0070678_100345417 3300005456 Bacteria 1278
382 Ga0070678_100367754 3300005456 Bacteria 1241
383 Ga0070662_100001823 3300005457 Bacteria 13070
384 Ga0070662_100003473 3300005457 Bacteria 9825
385 Ga0070662_100010894 3300005457 Bacteria 5990
386 Ga0070662_100014970 3300005457 Bacteria 5188
387 Ga0070662_100065529 3300005457 Bacteria 2663
388 Ga0070662_100265720 3300005457 Bacteria 1384
389 Ga0070681_10000615 3300005458 Bacteria 29209
390 Ga0070681_10035133 3300005458 Bacteria 5035
391 Ga0070681_10051714 3300005458 Bacteria 4098
392 Ga0070681_10459484 3300005458 Bacteria 1185
393 Ga0068867_100000385 3300005459 Bacteria 29434
394 Ga0068867_100000870 3300005459 Bacteria 20402
395 Ga0068867_100006247 3300005459 Bacteria 8427
396 Ga0068867_100006473 3300005459 Bacteria 8272
397 Ga0068867_100010574 3300005459 Bacteria 6510
398 Ga0068867_100015873 3300005459 Bacteria 5346
399 Ga0068867_100087983 3300005459 Bacteria 2353
400 Ga0068867_100096357 3300005459 Bacteria 2252
401 Ga0068867_100209295 3300005459 Bacteria 1565
402 Ga0068867_100307120 3300005459 Bacteria 1310
403 Ga0068867_100330902 3300005459 Bacteria 1265
404 Ga0070685_10005854 3300005466 Bacteria 6256
405 Ga0070706_100000377 3300005467 Bacteria 53406
406 Ga0070706_100001538 3300005467 Bacteria 24123
407 Ga0070706_100001955 3300005467 Bacteria 21224
408 Ga0070706_100002408 3300005467 Bacteria 18856
409 Ga0070706_100041395 3300005467 Bacteria 4253
410 Ga0070706_100093928 3300005467 Bacteria 2783
411 Ga0070706_100181802 3300005467 Bacteria 1963
412 Ga0070707_100008628 3300005468 Bacteria 9460
413 Ga0070707_100010422 3300005468 Bacteria 8656
414 Ga0070707_100012478 3300005468 Bacteria 7937
415 Ga0070707_100018196 3300005468 Bacteria 6611
416 Ga0070707_100067750 3300005468 Bacteria 3434
417 Ga0070707_100095388 3300005468 Bacteria 2881
418 Ga0070707_100166306 3300005468 Bacteria 2150
419 Ga0070707_100247067 3300005468 Bacteria 1736
420 Ga0070707_100260215 3300005468 Bacteria 1688
421 Ga0070707_100348189 3300005468 Bacteria 1439
422 Ga0070707_100357313 3300005468 Bacteria 1419
423 Ga0070698_100005045 3300005471 Bacteria 14469
424 Ga0070698_100006643 3300005471 Bacteria 12542
425 Ga0070698_100008337 3300005471 Bacteria 11201
426 Ga0070698_100024281 3300005471 Bacteria 6325
427 Ga0070698_100027104 3300005471 Bacteria 5959
428 Ga0070698_100138072 3300005471 Bacteria 2391
429 Ga0070698_100157906 3300005471 Bacteria 2213
430 Ga0070698_100210323 3300005471 Bacteria 1880
431 Ga0070699_100001009 3300005518 Bacteria 26204
432 Ga0070699_100005930 3300005518 Bacteria 10669
433 Ga0070699_100016107 3300005518 Bacteria 6417
434 Ga0070699_100063889 3300005518 Bacteria 3192
435 Ga0070699_100168727 3300005518 Bacteria 1939
436 Ga0070699_100316104 3300005518 Bacteria 1403
437 Ga0070699_100642807 3300005518 Bacteria 968
438 Ga0070679_100014735 3300005530 Bacteria 7513
439 Ga0070679_100018568 3300005530 Bacteria 6750
440 Ga0070679_100131131 3300005530 Bacteria 2488
441 Ga0070684_100027191 3300005535 Bacteria 4826
442 Ga0070697_100000184 3300005536 Bacteria 51536
443 Ga0070697_100001737 3300005536 Bacteria 16644
444 Ga0070697_100002067 3300005536 Bacteria 15378
445 Ga0070697_100059071 3300005536 Bacteria 3122
446 Ga0068853_100010152 3300005539 Bacteria 7609
447 Ga0068853_100018926 3300005539 Bacteria 5703
448 Ga0068853_100027933 3300005539 Bacteria 4744
449 Ga0068853_100029543 3300005539 Bacteria 4622
450 Ga0068853_100137692 3300005539 Bacteria 2190
451 Ga0068853_100382507 3300005539 Bacteria 1314
452 Ga0070672_100000363 3300005543 Bacteria 26119
453 Ga0070672_100002404 3300005543 Bacteria 11852
454 Ga0070672_100003539 3300005543 Bacteria 10122
455 Ga0070672_100003651 3300005543 Bacteria 9995
456 Ga0070672_100007729 3300005543 Bacteria 7324
457 Ga0070672_100019324 3300005543 Bacteria 4943
458 Ga0070672_100035847 3300005543 Bacteria 3773
459 Ga0070672_100040899 3300005543 Unclassified 3560
460 Ga0070672_100041643 3300005543 Bacteria 3532
461 Ga0070672_100047360 3300005543 Bacteria 3336
462 Ga0070672_100058918 3300005543 Bacteria 3020
463 Ga0070672_100114846 3300005543 Bacteria 2198
464 Ga0070672_100117130 3300005543 Bacteria 2177
465 Ga0070672_100157815 3300005543 Bacteria 1880
466 Ga0070672_100176458 3300005543 Bacteria 1779
467 Ga0070686_100004387 3300005544 Bacteria 7778
468 Ga0070686_100016050 3300005544 Bacteria 4351
469 Ga0070686_100020649 3300005544 Bacteria 3900
470 Ga0070686_100044349 3300005544 Bacteria 2795
471 Ga0070686_100059827 3300005544 Bacteria 2456
472 Ga0070686_100061550 3300005544 Bacteria 2426
473 Ga0070695_100001112 3300005545 Bacteria 14731
474 Ga0070695_100003342 3300005545 Bacteria 9370
475 Ga0070695_100016830 3300005545 Bacteria 4430
476 Ga0070695_100018532 3300005545 Bacteria 4228
477 Ga0070695_100069439 3300005545 Bacteria 2303
478 Ga0070695_100142799 3300005545 Bacteria 1662
479 Ga0070696_100000730 3300005546 Bacteria 20979
480 Ga0070696_100002882 3300005546 Bacteria 11438
481 Ga0070696_100004740 3300005546 Bacteria 9091
482 Ga0070696_100008398 3300005546 Bacteria 6909
483 Ga0070696_100025677 3300005546 Bacteria 4006
484 Ga0070696_100192395 3300005546 Bacteria 1519
485 Ga0070696_100206141 3300005546 Bacteria 1470
486 Ga0070693_100000174 3300005547 Bacteria 29811
487 Ga0070693_100014170 3300005547 Bacteria 4078
488 Ga0070693_100113784 3300005547 Bacteria 1669
489 Ga0070693_100127010 3300005547 Bacteria 1589
490 Ga0070665_100001806 3300005548 Bacteria 24259
491 Ga0070665_100003125 3300005548 Bacteria 17834
492 Ga0070665_100003481 3300005548 Bacteria 16772
493 Ga0070665_100009137 3300005548 Bacteria 10044
494 Ga0070665_100037597 3300005548 Bacteria 4867
495 Ga0070665_100041068 3300005548 Bacteria 4649
496 Ga0070665_100048820 3300005548 Bacteria 4248
497 Ga0070665_100050964 3300005548 Bacteria 4153
498 Ga0070665_100051163 3300005548 Bacteria 4143
499 Ga0070665_100246409 3300005548 Bacteria 1787
500 Ga0070665_100374221 3300005548 Bacteria 1431
501 Ga0070704_100001537 3300005549 Bacteria 12455
502 Ga0070704_100129522 3300005549 Bacteria 1953
503 Ga0070704_100256086 3300005549 Bacteria 1440
504 Ga0068855_100000065 3300005563 Bacteria 129307
505 Ga0068855_100011132 3300005563 Bacteria 10860
506 Ga0068855_100018720 3300005563 Bacteria 8326
507 Ga0068855_100022677 3300005563 Bacteria 7522
508 Ga0068855_100042078 3300005563 Bacteria 5413
509 Ga0068855_100064835 3300005563 Bacteria 4260
510 Ga0068855_100076294 3300005563 Bacteria 3891
511 Ga0068855_100110706 3300005563 Bacteria 3152
512 Ga0068855_100122191 3300005563 Bacteria 2980
513 Ga0068855_100269505 3300005563 Bacteria 1893
514 Ga0070664_100000002 3300005564 Bacteria 458815
515 Ga0070664_100003645 3300005564 Bacteria 12405
516 Ga0070664_100003995 3300005564 Bacteria 11857
517 Ga0070664_100035096 3300005564 Bacteria 4209
518 Ga0070664_100038389 3300005564 Bacteria 4030
519 Ga0070664_100047443 3300005564 Bacteria 3628
520 Ga0070664_100097101 3300005564 Bacteria 2558
521 Ga0070664_100138711 3300005564 Bacteria 2140
522 Ga0070664_100271432 3300005564 Bacteria 1528
523 Ga0068857_100227790 3300005577 Bacteria 1704
524 Ga0068857_100251763 3300005577 Bacteria 1619
525 Ga0068857_100326896 3300005577 Bacteria 1417
526 Ga0068854_100001848 3300005578 Bacteria 12898
527 Ga0068854_100003562 3300005578 Bacteria 9736
528 Ga0068854_100014548 3300005578 Bacteria 5191
529 Ga0068854_100018908 3300005578 Bacteria 4633
530 Ga0068854_100029644 3300005578 Bacteria 3789
531 Ga0068856_100000028 3300005614 Bacteria 131498
532 Ga0068856_100004556 3300005614 Bacteria 13773
533 Ga0068856_100016156 3300005614 Bacteria 7218
534 Ga0068856_100128021 3300005614 Bacteria 2543
535 Ga0068856_100130589 3300005614 Bacteria 2517
536 Ga0068856_100247882 3300005614 Bacteria 1796
537 Ga0068856_100251843 3300005614 Bacteria 1781
538 Ga0070702_100000064 3300005615 Bacteria 30037
539 Ga0070702_100006583 3300005615 Bacteria 5509
540 Ga0070702_100012960 3300005615 Bacteria 4198
541 Ga0070702_100281230 3300005615 Bacteria 1143
542 Ga0068852_100032852 3300005616 Bacteria 4301
543 Ga0068852_100034426 3300005616 Bacteria 4214
544 Ga0068852_100043779 3300005616 Bacteria 3798
545 Ga0068852_100048938 3300005616 Bacteria 3614
546 Ga0068852_100090103 3300005616 Bacteria 2742
547 Ga0068852_100101714 3300005616 Bacteria 2596
548 Ga0068852_100164938 3300005616 Unclassified 2072
549 Ga0068852_100377079 3300005616 Bacteria 1391
550 Ga0068859_100000565 3300005617 Bacteria 36813
551 Ga0068859_100001391 3300005617 Bacteria 24558
552 Ga0068859_100001763 3300005617 Bacteria 22021
553 Ga0068859_100003641 3300005617 Bacteria 15704
554 Ga0068859_100010947 3300005617 Bacteria 9129
555 Ga0068859_100013392 3300005617 Bacteria 8224
556 Ga0068859_100026071 3300005617 Bacteria 5865
557 Ga0068859_100043567 3300005617 Bacteria 4511
558 Ga0068859_100044892 3300005617 Bacteria 4440
559 Ga0068859_100049897 3300005617 Bacteria 4204
560 Ga0068859_100054947 3300005617 Bacteria 4006
561 Ga0068859_100059555 3300005617 Bacteria 3847
562 Ga0068859_100066208 3300005617 Bacteria 3648
563 Ga0068859_100069662 3300005617 Bacteria 3552
564 Ga0068859_100086446 3300005617 Bacteria 3182
565 Ga0068859_100106714 3300005617 Bacteria 2860
566 Ga0068859_100138485 3300005617 Bacteria 2507
567 Ga0068859_100256901 3300005617 Bacteria 1838
568 Ga0068859_100261321 3300005617 Bacteria 1823
569 Ga0068859_100314102 3300005617 Bacteria 1661
570 Ga0068859_100496992 3300005617 Bacteria 1315
571 Ga0068864_100000426 3300005618 Bacteria 36452
572 Ga0068864_100000997 3300005618 Bacteria 23676
573 Ga0068864_100006457 3300005618 Bacteria 9606
574 Ga0068864_100008243 3300005618 Bacteria 8595
575 Ga0068864_100010098 3300005618 Bacteria 7796
576 Ga0068864_100015090 3300005618 Bacteria 6422
577 Ga0068864_100019355 3300005618 Bacteria 5691
578 Ga0068864_100024332 3300005618 Bacteria 5094
579 Ga0068864_100029317 3300005618 Bacteria 4659
580 Ga0068864_100040370 3300005618 Bacteria 3993
581 Ga0068864_100058855 3300005618 Bacteria 3322
582 Ga0068864_100061034 3300005618 Bacteria 3265
583 Ga0068864_100118530 3300005618 Bacteria 2364
584 Ga0068864_100148309 3300005618 Bacteria 2122
585 Ga0068864_100175281 3300005618 Unclassified 1957
586 Ga0068866_10000766 3300005718 Bacteria 14492
587 Ga0068866_10002116 3300005718 Bacteria 8258
588 Ga0068866_10034870 3300005718 Unclassified 2454
589 Ga0068866_10126330 3300005718 Bacteria 1448
590 Ga0068861_100002330 3300005719 Bacteria 12335
591 Ga0068861_100004622 3300005719 Bacteria 9240
592 Ga0068861_100006869 3300005719 Bacteria 7771
593 Ga0068861_100011229 3300005719 Bacteria 6217
594 Ga0068861_100015073 3300005719 Bacteria 5440
595 Ga0068861_100034843 3300005719 Bacteria 3725
596 Ga0068861_100035848 3300005719 Bacteria 3677
597 Ga0068861_100051385 3300005719 Bacteria 3129
598 Ga0068861_100066028 3300005719 Bacteria 2788
599 Ga0068861_100193902 3300005719 Bacteria 1701
600 Ga0068851_10003126 3300005834 Bacteria 7338
601 Ga0068851_10015520 3300005834 Bacteria 3630
602 Ga0068851_10021848 3300005834 Bacteria 3110
603 Ga0068870_10017028 3300005840 Bacteria 3488
604 Ga0068870_10024310 3300005840 Bacteria 2997
605 Ga0068870_10068659 3300005840 Bacteria 1926
606 Ga0068870_10077522 3300005840 Unclassified 1828
607 Ga0068863_100002920 3300005841 Bacteria 16928
608 Ga0068863_100005285 3300005841 Bacteria 12748
609 Ga0068863_100005760 3300005841 Bacteria 12160
610 Ga0068863_100006870 3300005841 Bacteria 11153
611 Ga0068863_100006877 3300005841 Bacteria 11144
612 Ga0068863_100010314 3300005841 Bacteria 9079
613 Ga0068863_100015566 3300005841 Bacteria 7308
614 Ga0068863_100036198 3300005841 Bacteria 4701
615 Ga0068863_100037673 3300005841 Bacteria 4602
616 Ga0068863_100041069 3300005841 Bacteria 4397
617 Ga0068863_100042216 3300005841 Bacteria 4333
618 Ga0068863_100062025 3300005841 Bacteria 3535
619 Ga0068863_100064212 3300005841 Bacteria 3472
620 Ga0068863_100069420 3300005841 Bacteria 3332
621 Ga0068863_100083469 3300005841 Bacteria 3027
622 Ga0068863_100086496 3300005841 Bacteria 2970
623 Ga0068863_100099699 3300005841 Bacteria 2760
624 Ga0068863_100310005 3300005841 Bacteria 1532
625 Ga0068863_100337638 3300005841 Bacteria 1465
626 Ga0068858_100001130 3300005842 Bacteria 27612
627 Ga0068858_100001482 3300005842 Bacteria 24159
628 Ga0068858_100002236 3300005842 Bacteria 19552
629 Ga0068858_100005069 3300005842 Bacteria 12918
630 Ga0068858_100005342 3300005842 Bacteria 12606
631 Ga0068858_100008710 3300005842 Bacteria 9743
632 Ga0068858_100015995 3300005842 Bacteria 7046
633 Ga0068858_100016647 3300005842 Bacteria 6904
634 Ga0068858_100017850 3300005842 Bacteria 6644
635 Ga0068858_100035358 3300005842 Bacteria 4634
636 Ga0068858_100044815 3300005842 Bacteria 4099
637 Ga0068858_100054381 3300005842 Bacteria 3702
638 Ga0068858_100057657 3300005842 Bacteria 3589
639 Ga0068858_100120291 3300005842 Unclassified 2455
640 Ga0068858_100134542 3300005842 Bacteria 2319
641 Ga0068858_100135536 3300005842 Bacteria 2310
642 Ga0068858_100138151 3300005842 Bacteria 2287
643 Ga0068860_100003152 3300005843 Bacteria 17043
644 Ga0068860_100003404 3300005843 Bacteria 16347
645 Ga0068860_100006792 3300005843 Bacteria 11469
646 Ga0068860_100012268 3300005843 Bacteria 8444
647 Ga0068860_100013859 3300005843 Bacteria 7905
648 Ga0068860_100014757 3300005843 Bacteria 7640
649 Ga0068860_100015309 3300005843 Bacteria 7491
650 Ga0068860_100023497 3300005843 Bacteria 5957
651 Ga0068860_100048989 3300005843 Bacteria 4026
652 Ga0068860_100049168 3300005843 Bacteria 4018
653 Ga0068860_100069539 3300005843 Bacteria 3346
654 Ga0068860_100122061 3300005843 Bacteria 2495
655 Ga0068860_100149892 3300005843 Bacteria 2245
656 Ga0068860_100184036 3300005843 Bacteria 2020
657 Ga0068860_100336948 3300005843 Bacteria 1482
658 Ga0068862_100004610 3300005844 Bacteria 11617
659 Ga0068862_100005062 3300005844 Bacteria 11092
660 Ga0068862_100006256 3300005844 Bacteria 9909
661 Ga0068862_100008778 3300005844 Bacteria 8371
662 Ga0068862_100016908 3300005844 Bacteria 6071
663 Ga0068862_100021734 3300005844 Bacteria 5367
664 Ga0068862_100026797 3300005844 Bacteria 4847
665 Ga0068862_100035002 3300005844 Bacteria 4251
666 Ga0068862_100040052 3300005844 Bacteria 3982
667 Ga0068862_100062528 3300005844 Bacteria 3202
668 Ga0068862_100101371 3300005844 Bacteria 2518
669 Ga0068862_100370732 3300005844 Bacteria 1333
670 Ga0081455_10000099 3300005937 Bacteria 95044
671 Ga0081539_10000004 3300005985 Bacteria 555600
672 Ga0081539_10000178 3300005985 Bacteria 149201
673 Ga0081539_10009727 3300005985 Bacteria 7959
674 Ga0070717_10000216 3300006028 Bacteria 40022
675 Ga0075365_10000471 3300006038 Bacteria 15189
676 Ga0075365_10002728 3300006038 Bacteria 8801
677 Ga0075368_10008636 3300006042 Bacteria 3637
678 Ga0075368_10015357 3300006042 Bacteria 2840
679 Ga0075368_10015523 3300006042 Bacteria 2828
680 Ga0075363_100005898 3300006048 Bacteria 5515
681 Ga0075363_100009082 3300006048 Bacteria 4666
682 Ga0075363_100047297 3300006048 Bacteria 2284
683 Ga0075363_100058079 3300006048 Bacteria 2077
684 Ga0075363_100069140 3300006048 Bacteria 1915
685 Ga0075364_10017392 3300006051 Bacteria 4491
686 Ga0075364_10019521 3300006051 Bacteria 4255
687 Ga0075364_10020991 3300006051 Bacteria 4113
688 Ga0075364_10025979 3300006051 Bacteria 3732
689 Ga0075364_10030915 3300006051 Bacteria 3439
690 Ga0075364_10053618 3300006051 Bacteria 2636
691 Ga0075364_10076057 3300006051 Bacteria 2215
692 Ga0075364_10095884 3300006051 Bacteria 1972
693 Ga0075364_10169150 3300006051 Bacteria 1477
694 Ga0075364_10182707 3300006051 Bacteria 1420
695 Ga0075364_10213656 3300006051 Bacteria 1308
696 Ga0070715_10105052 3300006163 Bacteria 1324
697 Ga0070716_100012448 3300006173 Bacteria 4313
698 Ga0070712_100005427 3300006175 Bacteria 7893
699 Ga0075362_10000777 3300006177 Bacteria 9503
700 Ga0075362_10004973 3300006177 Bacteria 4820
701 Ga0075362_10039026 3300006177 Bacteria 2086
702 Ga0075362_10039550 3300006177 Bacteria 2074
703 Ga0075362_10039646 3300006177 Bacteria 2071
704 Ga0075367_10003436 3300006178 Bacteria 7553
705 Ga0075367_10010068 3300006178 Bacteria 4957
706 Ga0075367_10025811 3300006178 Bacteria 3325
707 Ga0075367_10063491 3300006178 Bacteria 2208
708 Ga0075367_10178347 3300006178 Bacteria 1324
709 Ga0075369_10002021 3300006186 Bacteria 7149
710 Ga0075366_10000198 3300006195 Bacteria 26513
711 Ga0075366_10004914 3300006195 Bacteria 7210
712 Ga0075366_10008300 3300006195 Bacteria 5769
713 Ga0075366_10008903 3300006195 Bacteria 5592
714 Ga0075366_10009299 3300006195 Bacteria 5488
715 Ga0075366_10014147 3300006195 Bacteria 4554
716 Ga0075366_10015176 3300006195 Bacteria 4411
717 Ga0075366_10034630 3300006195 Bacteria 2975
718 Ga0075366_10039414 3300006195 Bacteria 2793
719 Ga0075366_10087094 3300006195 Bacteria 1869
720 Ga0075366_10089234 3300006195 Bacteria 1846
721 Ga0075366_10137933 3300006195 Bacteria 1473
722 Ga0097621_100000850 3300006237 Bacteria 21530
723 Ga0097621_100002980 3300006237 Bacteria 11626
724 Ga0097621_100003083 3300006237 Bacteria 11429
725 Ga0097621_100010068 3300006237 Bacteria 6896
726 Ga0097621_100015544 3300006237 Bacteria 5730
727 Ga0097621_100017304 3300006237 Bacteria 5471
728 Ga0097621_100028624 3300006237 Bacteria 4392
729 Ga0097621_100142704 3300006237 Bacteria 2048
730 Ga0097621_100336598 3300006237 Bacteria 1339
731 Ga0075370_10007243 3300006353 Bacteria 5643
732 Ga0075370_10007297 3300006353 Bacteria 5627
733 Ga0075370_10007987 3300006353 Bacteria 5424
734 Ga0075370_10009232 3300006353 Bacteria 5111
735 Ga0075370_10011506 3300006353 Bacteria 4652
736 Ga0075370_10017073 3300006353 Bacteria 3917
737 Ga0075370_10057523 3300006353 Bacteria 2210
738 Ga0075370_10093020 3300006353 Bacteria 1740
739 Ga0068871_100000242 3300006358 Bacteria 38319
740 Ga0068871_100000936 3300006358 Bacteria 19492
741 Ga0068871_100007842 3300006358 Bacteria 7649
742 Ga0068871_100008816 3300006358 Bacteria 7265
743 Ga0068871_100011024 3300006358 Bacteria 6624
744 Ga0068871_100025447 3300006358 Bacteria 4605
745 Ga0068871_100130136 3300006358 Bacteria 2133
746 Ga0075428_100003071 3300006844 Bacteria 18219
747 Ga0075428_100004249 3300006844 Bacteria 15770
748 Ga0075428_100009028 3300006844 Bacteria 11063
749 Ga0075428_100010270 3300006844 Bacteria 10392
750 Ga0075428_100022859 3300006844 Bacteria 6918
751 Ga0075428_100035952 3300006844 Bacteria 5459
752 Ga0075428_100135045 3300006844 Bacteria 2683
753 Ga0075428_100203880 3300006844 Bacteria 2137
754 Ga0075430_100001295 3300006846 Bacteria 20186
755 Ga0075430_100018296 3300006846 Bacteria 5965
756 Ga0075430_100019263 3300006846 Bacteria 5800
757 Ga0075430_100026682 3300006846 Bacteria 4913
758 Ga0075431_100004900 3300006847 Bacteria 13179
759 Ga0075431_100010305 3300006847 Bacteria 9390
760 Ga0075431_100034322 3300006847 Bacteria 5227
761 Ga0075431_100045218 3300006847 Bacteria 4539
762 Ga0075431_100492991 3300006847 Bacteria 1217
763 Ga0075433_10003458 3300006852 Bacteria 12192
764 Ga0075433_10013495 3300006852 Bacteria 6644
765 Ga0075433_10085125 3300006852 Bacteria 2791
766 Ga0075434_100009983 3300006871 Bacteria 8886
767 Ga0075434_100053000 3300006871 Bacteria 4031
768 Ga0075434_100176299 3300006871 Bacteria 2158
769 Ga0075434_100280206 3300006871 Bacteria 1687
770 Ga0075434_100312926 3300006871 Bacteria 1591
771 Ga0075434_100455773 3300006871 Bacteria 1300
772 Ga0075429_100000003 3300006880 Bacteria 130377
773 Ga0075429_100005146 3300006880 Bacteria 11248
774 Ga0075429_100010505 3300006880 Bacteria 8007
775 Ga0075429_100012631 3300006880 Bacteria 7324
776 Ga0075429_100083338 3300006880 Bacteria 2787
777 Ga0075429_100146354 3300006880 Bacteria 2068
778 Ga0068865_100000441 3300006881 Bacteria 23086
779 Ga0068865_100009857 3300006881 Bacteria 5936
780 Ga0068865_100009866 3300006881 Bacteria 5931
781 Ga0068865_100026341 3300006881 Bacteria 3833
782 Ga0068865_100080416 3300006881 Bacteria 2337
783 Ga0068865_100162923 3300006881 Bacteria 1703
784 Ga0075436_100000353 3300006914 Bacteria 29366
785 Ga0075436_100058923 3300006914 Bacteria 2652
786 Ga0097620_100000565 3300006931 Bacteria 36813
787 Ga0097620_100001391 3300006931 Bacteria 24558
788 Ga0097620_100001763 3300006931 Bacteria 22021
789 Ga0097620_100003641 3300006931 Bacteria 15704
790 Ga0097620_100010947 3300006931 Bacteria 9129
791 Ga0097620_100013393 3300006931 Bacteria 8224
792 Ga0097620_100026070 3300006931 Bacteria 5865
793 Ga0097620_100043565 3300006931 Bacteria 4511
794 Ga0097620_100044892 3300006931 Bacteria 4440
795 Ga0097620_100049895 3300006931 Bacteria 4204
796 Ga0097620_100054954 3300006931 Bacteria 4006
797 Ga0097620_100059550 3300006931 Bacteria 3847
798 Ga0097620_100066207 3300006931 Bacteria 3648
799 Ga0097620_100069663 3300006931 Bacteria 3552
800 Ga0097620_100086445 3300006931 Bacteria 3182
801 Ga0097620_100106721 3300006931 Bacteria 2860
802 Ga0097620_100138504 3300006931 Bacteria 2507
803 Ga0097620_100256919 3300006931 Bacteria 1838
804 Ga0097620_100261315 3300006931 Bacteria 1823
805 Ga0097620_100314072 3300006931 Bacteria 1661
806 Ga0097620_100496970 3300006931 Bacteria 1315
807 Ga0099823_1000018 3300006944 Bacteria 81972
808 Ga0079104_1000098 3300006946 Bacteria 129064
809 Ga0079104_1000273 3300006946 Bacteria 67267
810 Ga0079104_1005795 3300006946 Bacteria 4835
811 Ga0099826_10000001 3300006948 Bacteria 1155201
812 Ga0099826_10000004 3300006948 Bacteria 802669
813 Ga0099826_10002445 3300006948 Bacteria 11980
814 Ga0099826_10082944 3300006948 Bacteria 1990
815 Ga0075435_100000148 3300007076 Bacteria 39782
816 Ga0075435_100000252 3300007076 Bacteria 33173
817 Ga0075435_100001831 3300007076 Bacteria 13810
818 Ga0075435_100023942 3300007076 Bacteria 4731
819 Ga0075435_100025356 3300007076 Bacteria 4615
820 Ga0075435_100064930 3300007076 Bacteria 2967
821 Ga0075435_100072868 3300007076 Bacteria 2807
822 Ga0075435_100139926 3300007076 Bacteria 2030
823 Ga0075435_100257549 3300007076 Bacteria 1486
824 Ga0099794_10022672 3300007265 Bacteria 2864
825 Ga0099794_10037849 3300007265 Bacteria 2284
826 Ga0099795_10000015 3300007788 Bacteria 64331
827 Ga0105251_10000043 3300009011 Bacteria 113848
828 Ga0105251_10000918 3300009011 Bacteria 26403
829 Ga0105251_10018619 3300009011 Bacteria 3686
830 Ga0105251_10021102 3300009011 Bacteria 3408
831 Ga0105244_10007145 3300009036 Bacteria 7134
832 Ga0105244_10062026 3300009036 Bacteria 1880
833 Ga0105244_10064518 3300009036 Bacteria 1837
834 Ga0105244_10106408 3300009036 Bacteria 1368
835 Ga0105250_10013024 3300009092 Bacteria 3423
836 Ga0105240_10000096 3300009093 Bacteria 179543
837 Ga0105240_10008179 3300009093 Bacteria 14996
838 Ga0105240_10008792 3300009093 Bacteria 14388
839 Ga0105240_10010737 3300009093 Bacteria 12851
840 Ga0105240_10023942 3300009093 Bacteria 8065
841 Ga0105240_10052764 3300009093 Bacteria 5109
842 Ga0105240_10053037 3300009093 Bacteria 5094
843 Ga0105240_10074217 3300009093 Bacteria 4199
844 Ga0105240_10081441 3300009093 Bacteria 3978
845 Ga0105240_10091956 3300009093 Bacteria 3705
846 Ga0105240_10203758 3300009093 Bacteria 2317
847 Ga0111539_10000052 3300009094 Bacteria 116307
848 Ga0111539_10000470 3300009094 Bacteria 50795
849 Ga0111539_10014421 3300009094 Bacteria 9863
850 Ga0111539_10018072 3300009094 Bacteria 8734
851 Ga0111539_10038524 3300009094 Bacteria 5766
852 Ga0111539_10073751 3300009094 Bacteria 4023
853 Ga0111539_10198485 3300009094 Bacteria 2340
854 Ga0105245_10002747 3300009098 Bacteria 15826
855 Ga0105245_10006429 3300009098 Bacteria 10343
856 Ga0105245_10007522 3300009098 Bacteria 9546
857 Ga0105245_10009132 3300009098 Bacteria 8645
858 Ga0105245_10019755 3300009098 Bacteria 5904
859 Ga0105245_10099688 3300009098 Bacteria 2686
860 Ga0105245_10107967 3300009098 Bacteria 2584
861 Ga0105245_10187032 3300009098 Bacteria 1982
862 Ga0105247_10000212 3300009101 Bacteria 56393
863 Ga0105247_10009631 3300009101 Bacteria 5863
864 Ga0105247_10048202 3300009101 Bacteria 2616
865 Ga0105247_10068377 3300009101 Bacteria 2215
866 Ga0114129_10000467 3300009147 Bacteria 48450
867 Ga0114129_10001804 3300009147 Bacteria 29175
868 Ga0114129_10003608 3300009147 Bacteria 21765
869 Ga0114129_10007207 3300009147 Bacteria 15824
870 Ga0114129_10020824 3300009147 Bacteria 9315
871 Ga0114129_10031057 3300009147 Bacteria 7555
872 Ga0114129_10101165 3300009147 Bacteria 3988
873 Ga0114129_10382172 3300009147 Bacteria 1859
874 Ga0114129_10537975 3300009147 Bacteria 1521
875 Ga0114129_10931635 3300009147 Bacteria 1099
876 Ga0105243_10002368 3300009148 Bacteria 15774
877 Ga0105243_10003839 3300009148 Bacteria 12008
878 Ga0105243_10005490 3300009148 Bacteria 9887
879 Ga0105243_10011531 3300009148 Bacteria 6687
880 Ga0105243_10014474 3300009148 Bacteria 5969
881 Ga0105243_10024906 3300009148 Bacteria 4568
882 Ga0105243_10042763 3300009148 Bacteria 3548
883 Ga0105243_10044826 3300009148 Bacteria 3472
884 Ga0105243_10064073 3300009148 Bacteria 2948
885 Ga0105243_10070538 3300009148 Bacteria 2822
886 Ga0105243_10078193 3300009148 Bacteria 2693
887 Ga0105243_10084779 3300009148 Bacteria 2596
888 Ga0105243_10110846 3300009148 Bacteria 2296
889 Ga0105243_10161357 3300009148 Bacteria 1933
890 Ga0105243_10206421 3300009148 Bacteria 1727
891 Ga0105243_10605769 3300009148 Bacteria 1055
892 Ga0105241_10002990 3300009174 Bacteria 12621
893 Ga0105241_10003014 3300009174 Bacteria 12593
894 Ga0105241_10012933 3300009174 Bacteria 6121
895 Ga0105241_10041835 3300009174 Bacteria 3463
896 Ga0105241_10092787 3300009174 Bacteria 2385
897 Ga0105241_10249704 3300009174 Unclassified 1503
898 Ga0105242_10000524 3300009176 Bacteria 30157
899 Ga0105242_10005056 3300009176 Bacteria 10185
900 Ga0105242_10011906 3300009176 Bacteria 6694
901 Ga0105242_10016812 3300009176 Bacteria 5694
902 Ga0105242_10037191 3300009176 Bacteria 3909
903 Ga0105242_10045644 3300009176 Bacteria 3552
904 Ga0105248_10000595 3300009177 Bacteria 41224
905 Ga0105248_10000927 3300009177 Bacteria 32633
906 Ga0105248_10005028 3300009177 Bacteria 14602
907 Ga0105248_10007054 3300009177 Bacteria 12310
908 Ga0105248_10041492 3300009177 Bacteria 5159
909 Ga0105248_10048842 3300009177 Bacteria 4746
910 Ga0105248_10108391 3300009177 Bacteria 3132
911 Ga0105248_10118105 3300009177 Bacteria 2991
912 Ga0105248_10272700 3300009177 Bacteria 1905
913 Ga0105248_10304381 3300009177 Unclassified 1795
914 Ga0105237_10000674 3300009545 Bacteria 47165
915 Ga0105237_10001570 3300009545 Bacteria 29798
916 Ga0105237_10007879 3300009545 Bacteria 11612
917 Ga0105237_10011825 3300009545 Bacteria 9231
918 Ga0105237_10087341 3300009545 Bacteria 3108
919 Ga0105237_10095980 3300009545 Bacteria 2955
920 Ga0105238_10001892 3300009551 Bacteria 21002
921 Ga0105238_10008614 3300009551 Bacteria 10207
922 Ga0105238_10020517 3300009551 Bacteria 6728
923 Ga0105238_10021998 3300009551 Bacteria 6497
924 Ga0105238_10057203 3300009551 Bacteria 3911
925 Ga0105238_10151933 3300009551 Bacteria 2290
926 Ga0105238_10169630 3300009551 Bacteria 2158
927 Ga0105238_10179307 3300009551 Bacteria 2095
928 Ga0105249_10004718 3300009553 Bacteria 11767
929 Ga0105249_10006781 3300009553 Bacteria 9978
930 Ga0105249_10016770 3300009553 Bacteria 6500
931 Ga0105249_10032626 3300009553 Bacteria 4711
932 Ga0105249_10046464 3300009553 Bacteria 3951
933 Ga0105249_10048283 3300009553 Bacteria 3881
934 Ga0105249_10257385 3300009553 Bacteria 1733
935 Ga0105249_10262672 3300009553 Bacteria 1716
936 Ga0105249_10317539 3300009553 Bacteria 1568
937 Ga0099796_10000044 3300010159 Bacteria 24507
938 Ga0105239_10004457 3300010375 Bacteria 16738
939 Ga0105239_10038964 3300010375 Bacteria 5206
940 Ga0105239_10046410 3300010375 Bacteria 4760
941 Ga0105239_10059647 3300010375 Bacteria 4188
942 Ga0105239_10068572 3300010375 Bacteria 3898
943 Ga0105239_10091442 3300010375 Bacteria 3358
944 Ga0105239_10166919 3300010375 Bacteria 2462
945 Ga0105239_10299804 3300010375 Bacteria 1810
946 Ga0105239_10608295 3300010375 Bacteria 1247
947 Ga0105246_10005346 3300011119 Bacteria 7816
948 Ga0105246_10066681 3300011119 Bacteria 2521
949 Ga0105246_10084236 3300011119 Bacteria 2274
950 Ga0105246_10169645 3300011119 Bacteria 1670
951 Ga0105246_10219537 3300011119 Bacteria 1489
952 Ga0157319_1000033 3300012497 Bacteria 45200
953 Ga0157373_10001474 3300013100 Bacteria 17936
954 Ga0157373_10004784 3300013100 Bacteria 10191
955 Ga0157373_10005713 3300013100 Bacteria 9322
956 Ga0157373_10050747 3300013100 Bacteria 2954
957 Ga0157371_10000026 3300013102 Bacteria 274703
958 Ga0157371_10000123 3300013102 Bacteria 118119
959 Ga0157371_10001949 3300013102 Bacteria 20527
960 Ga0157371_10002243 3300013102 Bacteria 18663
961 Ga0157371_10109351 3300013102 Bacteria 1962
962 Ga0157370_10000013 3300013104 Bacteria 198861
963 Ga0157370_10006046 3300013104 Bacteria 13444
964 Ga0157370_10014396 3300013104 Bacteria 8087
965 Ga0157370_10016957 3300013104 Bacteria 7363
966 Ga0157370_10294492 3300013104 Bacteria 1499
967 Ga0157369_10000169 3300013105 Bacteria 91977
968 Ga0157369_10000787 3300013105 Bacteria 40692
969 Ga0157369_10194310 3300013105 Bacteria 2131
970 Ga0157369_10221456 3300013105 Bacteria 1981
971 Ga0157369_10224981 3300013105 Bacteria 1963
972 Ga0157369_10256842 3300013105 Bacteria 1823
973 Ga0157374_10003025 3300013296 Bacteria 14090
974 Ga0157374_10003398 3300013296 Bacteria 13384
975 Ga0157374_10006790 3300013296 Bacteria 9729
976 Ga0157374_10021757 3300013296 Bacteria 5711
977 Ga0157374_10053996 3300013296 Bacteria 3747
978 Ga0157374_10072657 3300013296 Bacteria 3246
979 Ga0157374_10079933 3300013296 Bacteria 3099
980 Ga0157374_10432543 3300013296 Bacteria 1316
981 Ga0157378_10002315 3300013297 Bacteria 16942
982 Ga0157378_10009990 3300013297 Bacteria 8276
983 Ga0157378_10033548 3300013297 Bacteria 4539
984 Ga0157378_10049082 3300013297 Bacteria 3755
985 Ga0157378_10055858 3300013297 Bacteria 3518
986 Ga0157378_10084924 3300013297 Bacteria 2867
987 Ga0157378_10107508 3300013297 Bacteria 2553
988 Ga0157378_10229358 3300013297 Bacteria 1769
989 Ga0157378_10249596 3300013297 Bacteria 1698
990 Ga0157378_10727011 3300013297 Bacteria 1014
991 Ga0163162_10000349 3300013306 Bacteria 42017
992 Ga0163162_10001767 3300013306 Bacteria 20260
993 Ga0163162_10006232 3300013306 Bacteria 11562
994 Ga0163162_10007570 3300013306 Bacteria 10576
995 Ga0163162_10007605 3300013306 Bacteria 10550
996 Ga0163162_10009639 3300013306 Bacteria 9393
997 Ga0163162_10022923 3300013306 Bacteria 6157
998 Ga0163162_10052780 3300013306 Bacteria 4084
999 Ga0163162_10079786 3300013306 Bacteria 3339
1000 Ga0163162_10094796 3300013306 Bacteria 3071
1001 Ga0163162_10343373 3300013306 Bacteria 1625
1002 Ga0163162_10405388 3300013306 Bacteria 1496
1003 Ga0157372_10000067 3300013307 Bacteria 111621
1004 Ga0157372_10025485 3300013307 Bacteria 6431
1005 Ga0157372_10080129 3300013307 Bacteria 3693
1006 Ga0157372_10280586 3300013307 Bacteria 1937
1007 Ga0157375_10000001 3300013308 Bacteria 696576
1008 Ga0157375_10001878 3300013308 Bacteria 18062
1009 Ga0157375_10004775 3300013308 Bacteria 11779
1010 Ga0157375_10008888 3300013308 Bacteria 8791
1011 Ga0157375_10011061 3300013308 Bacteria 7958
1012 Ga0157375_10029172 3300013308 Bacteria 5184
1013 Ga0157375_10035914 3300013308 Bacteria 4735
1014 Ga0157375_10038677 3300013308 Bacteria 4582
1015 Ga0157375_10054372 3300013308 Bacteria 3943
1016 Ga0157375_10054724 3300013308 Bacteria 3931
1017 Ga0157375_10062436 3300013308 Bacteria 3702
1018 Ga0157375_10149180 3300013308 Bacteria 2472
1019 Ga0157375_10176793 3300013308 Unclassified 2284
1020 Ga0157375_10216155 3300013308 Bacteria 2075
1021 Ga0157375_10633514 3300013308 Bacteria 1226
1022 Ga0163163_10001234 3300014325 Bacteria 21623
1023 Ga0163163_10004742 3300014325 Bacteria 11654
1024 Ga0163163_10006531 3300014325 Bacteria 10210
1025 Ga0163163_10028741 3300014325 Bacteria 5343
1026 Ga0163163_10040350 3300014325 Bacteria 4558
1027 Ga0163163_10064678 3300014325 Bacteria 3629
1028 Ga0163163_10138534 3300014325 Bacteria 2475
1029 Ga0163163_10144214 3300014325 Unclassified 2424
1030 Ga0163163_10181035 3300014325 Bacteria 2155
1031 Ga0163163_10544782 3300014325 Bacteria 1223
1032 Ga0157380_10007072 3300014326 Bacteria 7946
1033 Ga0157380_10007203 3300014326 Bacteria 7881
1034 Ga0157380_10017365 3300014326 Bacteria 5325
1035 Ga0157380_10034873 3300014326 Bacteria 3883
1036 Ga0157380_10131977 3300014326 Bacteria 2132
1037 Ga0157380_10159598 3300014326 Bacteria 1958
1038 Ga0182008_10000002 3300014497 Bacteria 480216
1039 Ga0182008_10000228 3300014497 Bacteria 43946
1040 Ga0182008_10000840 3300014497 Bacteria 21424
1041 Ga0182008_10001327 3300014497 Bacteria 16867
1042 Ga0182008_10004335 3300014497 Bacteria 8302
1043 Ga0182008_10007071 3300014497 Bacteria 6219
1044 Ga0182008_10013248 3300014497 Bacteria 4335
1045 Ga0182008_10036384 3300014497 Bacteria 2463
1046 Ga0182008_10073362 3300014497 Bacteria 1684
1047 Ga0182008_10150984 3300014497 Bacteria 1165
1048 Ga0157377_10000024 3300014745 Bacteria 142391
1049 Ga0157377_10000223 3300014745 Bacteria 29679
1050 Ga0157377_10001521 3300014745 Bacteria 10064
1051 Ga0157377_10023436 3300014745 Bacteria 3271
1052 Ga0157379_10000672 3300014968 Bacteria 27765
1053 Ga0157379_10002563 3300014968 Bacteria 15248
1054 Ga0157379_10003249 3300014968 Bacteria 13775
1055 Ga0157379_10005542 3300014968 Bacteria 10846
1056 Ga0157379_10014368 3300014968 Bacteria 6947
1057 Ga0157379_10018408 3300014968 Bacteria 6158
1058 Ga0157379_10041219 3300014968 Bacteria 4122
1059 Ga0157379_10045458 3300014968 Bacteria 3919
1060 Ga0157379_10052262 3300014968 Bacteria 3650
1061 Ga0157379_10105787 3300014968 Bacteria 2526
1062 Ga0157379_10143395 3300014968 Bacteria 2154
1063 Ga0157379_10159105 3300014968 Bacteria 2038
1064 Ga0157379_10263052 3300014968 Bacteria 1568
1065 Ga0157376_10000400 3300014969 Bacteria 28297
1066 Ga0157376_10000673 3300014969 Bacteria 22084
1067 Ga0157376_10002756 3300014969 Bacteria 12000
1068 Ga0157376_10005428 3300014969 Bacteria 8913
1069 Ga0157376_10008822 3300014969 Bacteria 7295
1070 Ga0157376_10021214 3300014969 Bacteria 5044
1071 Ga0157376_10042273 3300014969 Bacteria 3736
1072 Ga0157376_10045309 3300014969 Bacteria 3620
1073 Ga0157376_10099496 3300014969 Bacteria 2537
1074 Ga0182006_1000142 3300015261 Bacteria 76916
1075 Ga0182006_1000151 3300015261 Bacteria 74303
1076 Ga0182006_1001297 3300015261 Bacteria 15416
1077 Ga0182006_1002298 3300015261 Bacteria 10536
1078 Ga0182006_1002522 3300015261 Bacteria 9945
1079 Ga0182006_1006685 3300015261 Bacteria 5333
1080 Ga0182006_1008920 3300015261 Bacteria 4524
1081 Ga0182006_1028407 3300015261 Bacteria 2274
1082 Ga0182006_1029238 3300015261 Bacteria 2234
1083 Ga0182006_1047912 3300015261 Bacteria 1654
1084 Ga0182007_10000016 3300015262 Bacteria 202375
1085 Ga0182007_10000905 3300015262 Bacteria 16411
1086 Ga0182007_10000920 3300015262 Bacteria 16274
1087 Ga0182007_10001887 3300015262 Bacteria 10932
1088 Ga0182007_10005205 3300015262 Bacteria 5748
1089 Ga0182007_10007647 3300015262 Bacteria 4505
1090 Ga0182007_10015205 3300015262 Bacteria 2877
1091 Ga0182005_1000013 3300015265 Bacteria 396391
1092 Ga0182005_1000090 3300015265 Bacteria 68199
1093 Ga0182005_1000136 3300015265 Bacteria 52225
1094 Ga0183362_10001 3300015683 Bacteria 2046624
1095 Ga0183361_10006 3300016635 Bacteria 368532
1096 Ga0163161_10000281 3300017792 Bacteria 44484
1097 Ga0163161_10000768 3300017792 Bacteria 25285
1098 Ga0163161_10003820 3300017792 Bacteria 10565
1099 Ga0163161_10013852 3300017792 Bacteria 5616
1100 Ga0163161_10015827 3300017792 Bacteria 5260
1101 Ga0163161_10031424 3300017792 Bacteria 3783
1102 Ga0163161_10032283 3300017792 Bacteria 3737
1103 Ga0163161_10042366 3300017792 Bacteria 3274
1104 Ga0163161_10045325 3300017792 Bacteria 3171
1105 Ga0163161_10130946 3300017792 Bacteria 1892
1106 Ga0163161_10141728 3300017792 Unclassified 1820
1107 Ga0163161_10149879 3300017792 Bacteria 1772
1108 Ga0163161_10159841 3300017792 Bacteria 1718
1109 Ga0163161_10168224 3300017792 Bacteria 1675
1110 Ga0163161_10193260 3300017792 Bacteria 1565
1111 Ga0163161_10348054 3300017792 Bacteria 1177
1112 Ga0163161_10364956 3300017792 Bacteria 1151
1113 Ga0206349_1733961 3300020075 Bacteria 1656
1114 Ga0206355_1008944 3300020076 Bacteria 1528
1115 Ga0206351_10549872 3300020077 Bacteria 5798
1116 Ga0206350_10951374 3300020080 Bacteria 1916
1117 Ga0154015_1218115 3300020610 Bacteria 21766
1118 Ga0213873_10000002 3300021358 Bacteria 1164195
1119 Ga0213872_10000020 3300021361 Bacteria 159607
1120 Ga0213872_10000048 3300021361 Bacteria 109712
1121 Ga0213872_10000710 3300021361 Bacteria 25046
1122 Ga0213872_10011372 3300021361 Bacteria 4209
1123 Ga0213872_10021918 3300021361 Bacteria 2941
1124 Ga0213872_10022499 3300021361 Bacteria 2903
1125 Ga0213872_10123187 3300021361 Bacteria 1145
1126 Ga0213876_10000001 3300021384 Bacteria 1186326
1127 Ga0209435_100001 3300025206 Bacteria 1424171
1128 Ga0209435_100029 3300025206 Bacteria 176358
1129 Ga0209435_100195 3300025206 Bacteria 17815
1130 Ga0209436_101070 3300025208 Bacteria 10325
1131 Ga0209436_106584 3300025208 Bacteria 2528
1132 Ga0209784_100002 3300025224 Bacteria 1753105
1133 Ga0209784_100003 3300025224 Bacteria 1379451
1134 Ga0209784_100039 3300025224 Bacteria 232021
1135 Ga0209784_100347 3300025224 Bacteria 22666
1136 Ga0209566_100002 3300025225 Bacteria 2614868
1137 Ga0209566_100003 3300025225 Bacteria 1753105
1138 Ga0209566_100023 3300025225 Bacteria 396571
1139 Ga0209566_100402 3300025225 Bacteria 34394
1140 Ga0209566_102320 3300025225 Bacteria 3641
1141 Ga0209674_100004 3300025226 Bacteria 1753105
1142 Ga0209674_100005 3300025226 Bacteria 1708125
1143 Ga0209674_100008 3300025226 Bacteria 1076909
1144 Ga0209674_100040 3300025226 Bacteria 396571
1145 Ga0209674_100161 3300025226 Bacteria 87684
1146 Ga0209674_100179 3300025226 Bacteria 77366
1147 Ga0209672_100001 3300025228 Bacteria 2828210
1148 Ga0209672_100052 3300025228 Bacteria 231179
1149 Ga0209672_100468 3300025228 Bacteria 22756
1150 Ga0209672_102021 3300025228 Bacteria 5590
1151 Ga0209147_100001 3300025229 Bacteria 2384371
1152 Ga0209147_100002 3300025229 Bacteria 2158988
1153 Ga0209147_100004 3300025229 Bacteria 1371850
1154 Ga0209147_102593 3300025229 Bacteria 4290
1155 Ga0209563_100003 3300025230 Bacteria 1932942
1156 Ga0209563_100004 3300025230 Bacteria 1814108
1157 Ga0209563_100005 3300025230 Bacteria 1774893
1158 Ga0209563_100006 3300025230 Bacteria 1753105
1159 Ga0209563_100072 3300025230 Bacteria 232021
1160 Ga0209563_102766 3300025230 Bacteria 3844
1161 Ga0207427_100492 3300025231 Bacteria 21112
1162 Ga0207427_100670 3300025231 Bacteria 16420
1163 Ga0209437_100053 3300025233 Bacteria 375580
1164 Ga0209437_100097 3300025233 Bacteria 232021
1165 Ga0209258_100001 3300025242 Bacteria 2384269
1166 Ga0209258_100002 3300025242 Bacteria 2158988
1167 Ga0209258_100022 3300025242 Bacteria 553584
1168 Ga0209258_100463 3300025242 Bacteria 44224
1169 Ga0207425_1000001 3300025245 Bacteria 2525432
1170 Ga0207425_1000008 3300025245 Bacteria 618024
1171 Ga0207425_1000033 3300025245 Bacteria 245540
1172 Ga0207425_1000485 3300025245 Bacteria 25015
1173 Ga0207425_1000611 3300025245 Bacteria 20596
1174 Ga0207425_1004173 3300025245 Bacteria 4398
1175 Ga0207425_1013535 3300025245 Bacteria 1882
1176 Ga0209646_1000001 3300025246 Bacteria 3092932
1177 Ga0209646_1000007 3300025246 Bacteria 670994
1178 Ga0209646_1000022 3300025246 Bacteria 446621
1179 Ga0209646_1000073 3300025246 Bacteria 224301
1180 Ga0209646_1000109 3300025246 Bacteria 158348
1181 Ga0209026_1000001 3300025250 Bacteria 1228671
1182 Ga0209026_1000124 3300025250 Bacteria 125673
1183 Ga0209026_1003015 3300025250 Bacteria 5811
1184 Ga0209026_1005159 3300025250 Bacteria 3593
1185 Ga0209026_1006104 3300025250 Bacteria 3049
1186 Ga0209677_100003 3300025253 Bacteria 1753105
1187 Ga0209677_100009 3300025253 Bacteria 749530
1188 Ga0209677_100041 3300025253 Bacteria 232021
1189 Ga0209677_101812 3300025253 Bacteria 8748
1190 Ga0209148_1000003 3300025254 Bacteria 2384288
1191 Ga0209148_1000021 3300025254 Bacteria 714645
1192 Ga0209148_1000034 3300025254 Bacteria 553584
1193 Ga0209148_1000352 3300025254 Bacteria 59377
1194 Ga0209759_1000001 3300025256 Bacteria 2799452
1195 Ga0209759_1000030 3300025256 Bacteria 285649
1196 Ga0209759_1000108 3300025256 Bacteria 146393
1197 Ga0209759_1000260 3300025256 Bacteria 76538
1198 Ga0209759_1000706 3300025256 Bacteria 29792
1199 Ga0209759_1006866 3300025256 Bacteria 3762
1200 Ga0209129_1000003 3300025258 Bacteria 903689
1201 Ga0209129_1000023 3300025258 Bacteria 420646
1202 Ga0209129_1000040 3300025258 Bacteria 313043
1203 Ga0209129_1000089 3300025258 Bacteria 177344
1204 Ga0209129_1001305 3300025258 Bacteria 14172
1205 Ga0209129_1008566 3300025258 Bacteria 2828
1206 Ga0209233_1000016 3300025261 Bacteria 907830
1207 Ga0209233_1000122 3300025261 Bacteria 232021
1208 Ga0209565_1000003 3300025263 Bacteria 1099648
1209 Ga0209565_1000040 3300025263 Bacteria 266543
1210 Ga0209565_1000161 3300025263 Bacteria 90019
1211 Ga0209565_1000304 3300025263 Bacteria 46114
1212 Ga0209565_1000391 3300025263 Bacteria 37106
1213 Ga0209565_1000623 3300025263 Bacteria 23359
1214 Ga0209565_1001269 3300025263 Bacteria 11721
1215 Ga0209565_1001295 3300025263 Bacteria 11589
1216 Ga0209565_1002330 3300025263 Bacteria 6953
1217 Ga0209565_1004058 3300025263 Bacteria 4564
1218 Ga0209455_1000001 3300025272 Bacteria 2384278
1219 Ga0209455_1000021 3300025272 Bacteria 699993
1220 Ga0209455_1000044 3300025272 Bacteria 410787
1221 Ga0209455_1000747 3300025272 Bacteria 18592
1222 Ga0209673_1000017 3300025273 Bacteria 492994
1223 Ga0209673_1000265 3300025273 Bacteria 98501
1224 Ga0209673_1000353 3300025273 Bacteria 83670
1225 Ga0209673_1000391 3300025273 Bacteria 78867
1226 Ga0209673_1001216 3300025273 Bacteria 27312
1227 Ga0209673_1007288 3300025273 Bacteria 5134
1228 Ga0209673_1011801 3300025273 Bacteria 3573
1229 Ga0209673_1012753 3300025273 Bacteria 3363
1230 Ga0209673_1028818 3300025273 Bacteria 1780
1231 Ga0209673_1040680 3300025273 Bacteria 1328
1232 Ga0209130_1000041 3300025284 Bacteria 261078
1233 Ga0209130_1000113 3300025284 Bacteria 130804
1234 Ga0209130_1000177 3300025284 Bacteria 90450
1235 Ga0209130_1000359 3300025284 Bacteria 52040
1236 Ga0209130_1002256 3300025284 Bacteria 9959
1237 Ga0209130_1002618 3300025284 Bacteria 8678
1238 Ga0209130_1018780 3300025284 Bacteria 1617
1239 Ga0209130_1019829 3300025284 Bacteria 1551
1240 Ga0209130_1024631 3300025284 Bacteria 1311
1241 Ga0209675_1000024 3300025291 Bacteria 312615
1242 Ga0209675_1000119 3300025291 Bacteria 110218
1243 Ga0209675_1000127 3300025291 Bacteria 104257
1244 Ga0209675_1000128 3300025291 Bacteria 103111
1245 Ga0209675_1000223 3300025291 Bacteria 58166
1246 Ga0209675_1000767 3300025291 Bacteria 21553
1247 Ga0209675_1000928 3300025291 Bacteria 18690
1248 Ga0209675_1001446 3300025291 Bacteria 13716
1249 Ga0209675_1002670 3300025291 Bacteria 8992
1250 Ga0209675_1003378 3300025291 Bacteria 7614
1251 Ga0209675_1003815 3300025291 Bacteria 6953
1252 Ga0209675_1004265 3300025291 Bacteria 6435
1253 Ga0209675_1013772 3300025291 Bacteria 2506
1254 Ga0209676_1000005 3300025292 Bacteria 1076001
1255 Ga0209676_1000014 3300025292 Bacteria 793514
1256 Ga0209676_1000054 3300025292 Bacteria 365890
1257 Ga0209676_1000106 3300025292 Bacteria 222576
1258 Ga0209676_1000437 3300025292 Bacteria 71544
1259 Ga0209676_1000785 3300025292 Bacteria 42175
1260 Ga0209676_1004645 3300025292 Bacteria 7548
1261 Ga0209676_1006138 3300025292 Bacteria 6025
1262 Ga0209676_1048778 3300025292 Bacteria 1128
1263 Ga0209025_1000003 3300025294 Bacteria 1366495
1264 Ga0209025_1000020 3300025294 Bacteria 618024
1265 Ga0209025_1000232 3300025294 Bacteria 130663
1266 Ga0209025_1000246 3300025294 Bacteria 127684
1267 Ga0209025_1000484 3300025294 Bacteria 76831
1268 Ga0209025_1000717 3300025294 Bacteria 56308
1269 Ga0209025_1001132 3300025294 Bacteria 38158
1270 Ga0209025_1001868 3300025294 Bacteria 24674
1271 Ga0209025_1002474 3300025294 Bacteria 19432
1272 Ga0209025_1003667 3300025294 Bacteria 14198
1273 Ga0209025_1007211 3300025294 Bacteria 8374
1274 Ga0209025_1015075 3300025294 Bacteria 4691
1275 Ga0209025_1015776 3300025294 Bacteria 4520
1276 Ga0209025_1017930 3300025294 Bacteria 4053
1277 Ga0209025_1024218 3300025294 Bacteria 3141
1278 Ga0209025_1068211 3300025294 Bacteria 1279
1279 Ga0209564_1000002 3300025295 Bacteria 1636803
1280 Ga0209564_1000007 3300025295 Bacteria 1028582
1281 Ga0209564_1000016 3300025295 Bacteria 613131
1282 Ga0209564_1000051 3300025295 Bacteria 357748
1283 Ga0209564_1000053 3300025295 Bacteria 351452
1284 Ga0209564_1000095 3300025295 Bacteria 237896
1285 Ga0209564_1000958 3300025295 Bacteria 36698
1286 Ga0209564_1001012 3300025295 Bacteria 34912
1287 Ga0209564_1001115 3300025295 Bacteria 31628
1288 Ga0209564_1001995 3300025295 Bacteria 17861
1289 Ga0209564_1003647 3300025295 Bacteria 10205
1290 Ga0209564_1004537 3300025295 Bacteria 8435
1291 Ga0209564_1005444 3300025295 Bacteria 7275
1292 Ga0209564_1009277 3300025295 Bacteria 4710
1293 Ga0209564_1009307 3300025295 Bacteria 4695
1294 Ga0209758_1000022 3300025297 Bacteria 618024
1295 Ga0209758_1000041 3300025297 Bacteria 410328
1296 Ga0209758_1000064 3300025297 Bacteria 311812
1297 Ga0209758_1000243 3300025297 Bacteria 113193
1298 Ga0209758_1001105 3300025297 Bacteria 34833
1299 Ga0209758_1004040 3300025297 Bacteria 12648
1300 Ga0209758_1004584 3300025297 Bacteria 11386
1301 Ga0209758_1010869 3300025297 Bacteria 5369
1302 Ga0209758_1011446 3300025297 Bacteria 5138
1303 Ga0209758_1025967 3300025297 Bacteria 2553
1304 Ga0209050_1000007 3300025298 Bacteria 1187891
1305 Ga0209050_1000011 3300025298 Bacteria 914037
1306 Ga0209050_1000066 3300025298 Bacteria 305458
1307 Ga0209050_1000138 3300025298 Bacteria 173923
1308 Ga0209050_1000456 3300025298 Bacteria 73296
1309 Ga0209050_1000471 3300025298 Bacteria 71466
1310 Ga0209050_1000478 3300025298 Bacteria 70631
1311 Ga0209050_1000723 3300025298 Bacteria 48329
1312 Ga0209050_1001271 3300025298 Bacteria 28989
1313 Ga0209050_1002074 3300025298 Bacteria 18412
1314 Ga0209050_1004989 3300025298 Bacteria 8634
1315 Ga0209050_1007739 3300025298 Bacteria 5928
1316 Ga0209050_1012069 3300025298 Bacteria 4011
1317 Ga0209256_1000003 3300025299 Bacteria 1661127
1318 Ga0209256_1000005 3300025299 Bacteria 1315082
1319 Ga0209256_1000024 3300025299 Bacteria 448909
1320 Ga0209256_1000078 3300025299 Bacteria 225992
1321 Ga0209256_1000115 3300025299 Bacteria 173607
1322 Ga0209256_1000210 3300025299 Bacteria 110217
1323 Ga0209256_1000291 3300025299 Bacteria 88153
1324 Ga0209256_1000689 3300025299 Bacteria 45269
1325 Ga0209256_1000895 3300025299 Bacteria 36698
1326 Ga0209256_1001323 3300025299 Bacteria 26472
1327 Ga0209256_1001589 3300025299 Bacteria 22234
1328 Ga0209256_1011754 3300025299 Bacteria 3452
1329 Ga0209256_1012348 3300025299 Bacteria 3288
1330 Ga0209256_1012450 3300025299 Bacteria 3257
1331 Ga0207426_1000001 3300025302 Bacteria 1341301
1332 Ga0207426_1000031 3300025302 Bacteria 460699
1333 Ga0207426_1000125 3300025302 Bacteria 217504
1334 Ga0207426_1000197 3300025302 Bacteria 146366
1335 Ga0207426_1000980 3300025302 Bacteria 28158
1336 Ga0207426_1002951 3300025302 Bacteria 9989
1337 Ga0207426_1017971 3300025302 Bacteria 2502
1338 Ga0209051_1000009 3300025303 Bacteria 706778
1339 Ga0209051_1000044 3300025303 Bacteria 305458
1340 Ga0209051_1000063 3300025303 Bacteria 249739
1341 Ga0209051_1000115 3300025303 Bacteria 152010
1342 Ga0209051_1000312 3300025303 Bacteria 75251
1343 Ga0209051_1000398 3300025303 Bacteria 60408
1344 Ga0209051_1002044 3300025303 Bacteria 15331
1345 Ga0209051_1003195 3300025303 Bacteria 10941
1346 Ga0209051_1012681 3300025303 Bacteria 4060
1347 Ga0209051_1022442 3300025303 Bacteria 2656
1348 Ga0209051_1023867 3300025303 Bacteria 2532
1349 Ga0209257_1000003 3300025304 Bacteria 1702593
1350 Ga0209257_1000011 3300025304 Bacteria 1112630
1351 Ga0209257_1000032 3300025304 Bacteria 680354
1352 Ga0209257_1000055 3300025304 Bacteria 415534
1353 Ga0209257_1000082 3300025304 Bacteria 305458
1354 Ga0209257_1000118 3300025304 Bacteria 225963
1355 Ga0209257_1000669 3300025304 Bacteria 53655
1356 Ga0209257_1000978 3300025304 Bacteria 38851
1357 Ga0209257_1004114 3300025304 Bacteria 11619
1358 Ga0209257_1005323 3300025304 Bacteria 9123
1359 Ga0209257_1006936 3300025304 Bacteria 7072
1360 Ga0209257_1011253 3300025304 Bacteria 4340
1361 Ga0209257_1014294 3300025304 Bacteria 3422
1362 Ga0209257_1036598 3300025304 Bacteria 1506
1363 Ga0207697_10003849 3300025315 Bacteria 7323
1364 Ga0207697_10007431 3300025315 Bacteria 4887
1365 Ga0207697_10015744 3300025315 Bacteria 3121
1366 Ga0207655_1005400 3300025728 Bacteria 8701
1367 Ga0207655_1051290 3300025728 Bacteria 1669
1368 Ga0207655_1058170 3300025728 Bacteria 1513
1369 Ga0207713_1000240 3300025735 Bacteria 73219
1370 Ga0207713_1006774 3300025735 Bacteria 6914
1371 Ga0207653_10033421 3300025885 Bacteria 1669
1372 Ga0207682_10000737 3300025893 Bacteria 15157
1373 Ga0207682_10014412 3300025893 Bacteria 3079
1374 Ga0207682_10024091 3300025893 Bacteria 2408
1375 Ga0207692_10013114 3300025898 Bacteria 3586
1376 Ga0207642_10000664 3300025899 Bacteria 10569
1377 Ga0207642_10002098 3300025899 Bacteria 6164
1378 Ga0207642_10016178 3300025899 Bacteria 2803
1379 Ga0207642_10050593 3300025899 Unclassified 1875
1380 Ga0207710_10012665 3300025900 Bacteria 3549
1381 Ga0207710_10036351 3300025900 Bacteria 2170
1382 Ga0207710_10037443 3300025900 Bacteria 2142
1383 Ga0207688_10025869 3300025901 Bacteria 3226
1384 Ga0207680_10002464 3300025903 Bacteria 8637
1385 Ga0207680_10003213 3300025903 Bacteria 7688
1386 Ga0207680_10025319 3300025903 Bacteria 3272
1387 Ga0207680_10074549 3300025903 Bacteria 2113
1388 Ga0207680_10075665 3300025903 Bacteria 2100
1389 Ga0207680_10203532 3300025903 Unclassified 1350
1390 Ga0207647_10002696 3300025904 Bacteria 13406
1391 Ga0207647_10080847 3300025904 Bacteria 1948
1392 Ga0207645_10001462 3300025907 Bacteria 19304
1393 Ga0207645_10003353 3300025907 Bacteria 12211
1394 Ga0207645_10023200 3300025907 Bacteria 4033
1395 Ga0207645_10063638 3300025907 Bacteria 2357
1396 Ga0207645_10148320 3300025907 Bacteria 1530
1397 Ga0207643_10005854 3300025908 Bacteria 6568
1398 Ga0207643_10015982 3300025908 Bacteria 4088
1399 Ga0207643_10033279 3300025908 Bacteria 2883
1400 Ga0207643_10041127 3300025908 Bacteria 2604
1401 Ga0207643_10079088 3300025908 Bacteria 1903
1402 Ga0207643_10079836 3300025908 Bacteria 1894
1403 Ga0207643_10104879 3300025908 Bacteria 1661
1404 Ga0207705_10030015 3300025909 Bacteria 3878
1405 Ga0207705_10285307 3300025909 Bacteria 1264
1406 Ga0207684_10000399 3300025910 Bacteria 57986
1407 Ga0207684_10001184 3300025910 Bacteria 29184
1408 Ga0207684_10018838 3300025910 Bacteria 5905
1409 Ga0207684_10021690 3300025910 Bacteria 5483
1410 Ga0207684_10025275 3300025910 Bacteria 5061
1411 Ga0207684_10054572 3300025910 Bacteria 3390
1412 Ga0207684_10061439 3300025910 Bacteria 3190
1413 Ga0207684_10151111 3300025910 Bacteria 1998
1414 Ga0207654_10008831 3300025911 Bacteria 5112
1415 Ga0207654_10022032 3300025911 Bacteria 3394
1416 Ga0207654_10026881 3300025911 Bacteria 3122
1417 Ga0207654_10089231 3300025911 Bacteria 1875
1418 Ga0207654_10089301 3300025911 Bacteria 1875
1419 Ga0207707_10001577 3300025912 Bacteria 21004
1420 Ga0207707_10021721 3300025912 Bacteria 5610
1421 Ga0207707_10195481 3300025912 Bacteria 1764
1422 Ga0207707_10230975 3300025912 Bacteria 1609
1423 Ga0207695_10000475 3300025913 Bacteria 86957
1424 Ga0207695_10000887 3300025913 Bacteria 54367
1425 Ga0207695_10004636 3300025913 Bacteria 18634
1426 Ga0207695_10006974 3300025913 Bacteria 14503
1427 Ga0207695_10012264 3300025913 Bacteria 10297
1428 Ga0207695_10018487 3300025913 Bacteria 8056
1429 Ga0207695_10025935 3300025913 Bacteria 6549
1430 Ga0207695_10027990 3300025913 Bacteria 6264
1431 Ga0207695_10098917 3300025913 Bacteria 2916
1432 Ga0207695_10142611 3300025913 Bacteria 2342
1433 Ga0207671_10005383 3300025914 Bacteria 11821
1434 Ga0207671_10010561 3300025914 Bacteria 7603
1435 Ga0207671_10014008 3300025914 Bacteria 6361
1436 Ga0207671_10070790 3300025914 Bacteria 2601
1437 Ga0207671_10086548 3300025914 Bacteria 2356
1438 Ga0207693_10000712 3300025915 Bacteria 29935
1439 Ga0207663_10011997 3300025916 Bacteria 4672
1440 Ga0207660_10012024 3300025917 Bacteria 5654
1441 Ga0207660_10067585 3300025917 Bacteria 2589
1442 Ga0207660_10235904 3300025917 Bacteria 1440
1443 Ga0207660_10341116 3300025917 Bacteria 1199
1444 Ga0207662_10000112 3300025918 Bacteria 38862
1445 Ga0207662_10006173 3300025918 Bacteria 6450
1446 Ga0207662_10028669 3300025918 Bacteria 3221
1447 Ga0207662_10050417 3300025918 Bacteria 2473
1448 Ga0207657_10002340 3300025919 Bacteria 20552
1449 Ga0207657_10006936 3300025919 Bacteria 11673
1450 Ga0207657_10025011 3300025919 Bacteria 5516
1451 Ga0207657_10049823 3300025919 Bacteria 3647
1452 Ga0207657_10056303 3300025919 Bacteria 3393
1453 Ga0207657_10105845 3300025919 Bacteria 2328
1454 Ga0207649_10000118 3300025920 Bacteria 67180
1455 Ga0207649_10002632 3300025920 Bacteria 9962
1456 Ga0207649_10020789 3300025920 Bacteria 3768
1457 Ga0207649_10021054 3300025920 Bacteria 3748
1458 Ga0207649_10027972 3300025920 Bacteria 3315
1459 Ga0207652_10007084 3300025921 Bacteria 9035
1460 Ga0207652_10030770 3300025921 Bacteria 4498
1461 Ga0207652_10130965 3300025921 Bacteria 2237
1462 Ga0207652_10228995 3300025921 Bacteria 1675
1463 Ga0207646_10001337 3300025922 Bacteria 30623
1464 Ga0207646_10006170 3300025922 Bacteria 12459
1465 Ga0207646_10039206 3300025922 Bacteria 4263
1466 Ga0207646_10044820 3300025922 Bacteria 3970
1467 Ga0207646_10045783 3300025922 Bacteria 3926
1468 Ga0207646_10150481 3300025922 Bacteria 2099
1469 Ga0207646_10205580 3300025922 Bacteria 1778
1470 Ga0207646_10237664 3300025922 Bacteria 1646
1471 Ga0207646_10278692 3300025922 Bacteria 1511
1472 Ga0207646_10296675 3300025922 Bacteria 1460
1473 Ga0207681_10000648 3300025923 Bacteria 23129
1474 Ga0207681_10002682 3300025923 Bacteria 11272
1475 Ga0207681_10008178 3300025923 Bacteria 6396
1476 Ga0207681_10017797 3300025923 Bacteria 4468
1477 Ga0207681_10026751 3300025923 Bacteria 3724
1478 Ga0207681_10113440 3300025923 Bacteria 1976
1479 Ga0207681_10119741 3300025923 Bacteria 1929
1480 Ga0207694_10041783 3300025924 Bacteria 3534
1481 Ga0207694_10114749 3300025924 Bacteria 2145
1482 Ga0207694_10149210 3300025924 Bacteria 1883
1483 Ga0207694_10172408 3300025924 Bacteria 1752
1484 Ga0207650_10020385 3300025925 Bacteria 4674
1485 Ga0207650_10028511 3300025925 Bacteria 4004
1486 Ga0207650_10035201 3300025925 Bacteria 3634
1487 Ga0207650_10058613 3300025925 Bacteria 2867
1488 Ga0207650_10064656 3300025925 Bacteria 2739
1489 Ga0207650_10142528 3300025925 Bacteria 1885
1490 Ga0207650_10163730 3300025925 Bacteria 1764
1491 Ga0207650_10282128 3300025925 Bacteria 1353
1492 Ga0207650_10349373 3300025925 Bacteria 1216
1493 Ga0207659_10001002 3300025926 Bacteria 16791
1494 Ga0207659_10003004 3300025926 Bacteria 10055
1495 Ga0207659_10009755 3300025926 Bacteria 6005
1496 Ga0207659_10040958 3300025926 Bacteria 3242
1497 Ga0207659_10048422 3300025926 Bacteria 3011
1498 Ga0207659_10051999 3300025926 Unclassified 2916
1499 Ga0207659_10066323 3300025926 Bacteria 2619
1500 Ga0207659_10067923 3300025926 Bacteria 2591
1501 Ga0207659_10081233 3300025926 Bacteria 2396
1502 Ga0207659_10116581 3300025926 Bacteria 2039
1503 Ga0207659_10249258 3300025926 Bacteria 1440
1504 Ga0207687_10001571 3300025927 Bacteria 15704
1505 Ga0207687_10002009 3300025927 Bacteria 13968
1506 Ga0207687_10003156 3300025927 Bacteria 11181
1507 Ga0207687_10004822 3300025927 Bacteria 8969
1508 Ga0207687_10016111 3300025927 Bacteria 4907
1509 Ga0207687_10021764 3300025927 Bacteria 4261
1510 Ga0207687_10022649 3300025927 Bacteria 4183
1511 Ga0207700_10021278 3300025928 Bacteria 4425
1512 Ga0207700_10057989 3300025928 Bacteria 2923
1513 Ga0207700_10448862 3300025928 Bacteria 1136
1514 Ga0207664_10003701 3300025929 Bacteria 10251
1515 Ga0207664_10024518 3300025929 Bacteria 4534
1516 Ga0207644_10002473 3300025931 Bacteria 11910
1517 Ga0207644_10005832 3300025931 Bacteria 8022
1518 Ga0207644_10011075 3300025931 Bacteria 5957
1519 Ga0207644_10022031 3300025931 Bacteria 4347
1520 Ga0207644_10079559 3300025931 Bacteria 2418
1521 Ga0207644_10103707 3300025931 Bacteria 2140
1522 Ga0207644_10159119 3300025931 Unclassified 1754
1523 Ga0207690_10000455 3300025932 Bacteria 26357
1524 Ga0207690_10001749 3300025932 Bacteria 13339
1525 Ga0207690_10005166 3300025932 Bacteria 7704
1526 Ga0207690_10028465 3300025932 Bacteria 3542
1527 Ga0207690_10142398 3300025932 Bacteria 1768
1528 Ga0207690_10161968 3300025932 Bacteria 1669
1529 Ga0207690_10185645 3300025932 Bacteria 1569
1530 Ga0207706_10000246 3300025933 Bacteria 59254
1531 Ga0207706_10004842 3300025933 Bacteria 12605
1532 Ga0207706_10014421 3300025933 Bacteria 7163
1533 Ga0207706_10014903 3300025933 Bacteria 7039
1534 Ga0207706_10016942 3300025933 Bacteria 6573
1535 Ga0207706_10021145 3300025933 Bacteria 5846
1536 Ga0207706_10023955 3300025933 Bacteria 5477
1537 Ga0207706_10169417 3300025933 Bacteria 1919
1538 Ga0207706_10262266 3300025933 Bacteria 1508
1539 Ga0207706_10334841 3300025933 Bacteria 1317
1540 Ga0207706_10434144 3300025933 Bacteria 1137
1541 Ga0207686_10002320 3300025934 Bacteria 10418
1542 Ga0207686_10007513 3300025934 Bacteria 5866
1543 Ga0207686_10043759 3300025934 Bacteria 2745
1544 Ga0207686_10164502 3300025934 Unclassified 1558
1545 Ga0207686_10178822 3300025934 Bacteria 1503
1546 Ga0207709_10000105 3300025935 Bacteria 130495
1547 Ga0207709_10000295 3300025935 Bacteria 55888
1548 Ga0207709_10002341 3300025935 Bacteria 11961
1549 Ga0207709_10002911 3300025935 Bacteria 10448
1550 Ga0207709_10007537 3300025935 Bacteria 6048
1551 Ga0207709_10012876 3300025935 Bacteria 4612
1552 Ga0207709_10038267 3300025935 Bacteria 2855
1553 Ga0207709_10072844 3300025935 Bacteria 2186
1554 Ga0207709_10126953 3300025935 Unclassified 1732
1555 Ga0207709_10379467 3300025935 Bacteria 1075
1556 Ga0207670_10000755 3300025936 Bacteria 17002
1557 Ga0207670_10003955 3300025936 Bacteria 7917
1558 Ga0207670_10027399 3300025936 Bacteria 3602
1559 Ga0207670_10075558 3300025936 Bacteria 2342
1560 Ga0207670_10089072 3300025936 Bacteria 2178
1561 Ga0207670_10180485 3300025936 Bacteria 1590
1562 Ga0207670_10228247 3300025936 Bacteria 1429
1563 Ga0207669_10002931 3300025937 Bacteria 7327
1564 Ga0207669_10021824 3300025937 Bacteria 3388
1565 Ga0207669_10057697 3300025937 Bacteria 2365
1566 Ga0207669_10116169 3300025937 Bacteria 1805
1567 Ga0207669_10238384 3300025937 Bacteria 1347
1568 Ga0207704_10001087 3300025938 Bacteria 12065
1569 Ga0207704_10001120 3300025938 Bacteria 11919
1570 Ga0207704_10001549 3300025938 Bacteria 10308
1571 Ga0207704_10005088 3300025938 Bacteria 6049
1572 Ga0207704_10008648 3300025938 Bacteria 4879
1573 Ga0207704_10017993 3300025938 Bacteria 3678
1574 Ga0207704_10045390 3300025938 Bacteria 2611
1575 Ga0207704_10076352 3300025938 Bacteria 2146
1576 Ga0207704_10106379 3300025938 Bacteria 1884
1577 Ga0207704_10124952 3300025938 Bacteria 1769
1578 Ga0207665_10006550 3300025939 Bacteria 7721
1579 Ga0207665_10023227 3300025939 Bacteria 4085
1580 Ga0207665_10162827 3300025939 Bacteria 1606
1581 Ga0207691_10000073 3300025940 Bacteria 83553
1582 Ga0207691_10000250 3300025940 Bacteria 53186
1583 Ga0207691_10000269 3300025940 Bacteria 51350
1584 Ga0207691_10000906 3300025940 Bacteria 29417
1585 Ga0207691_10001701 3300025940 Bacteria 21735
1586 Ga0207691_10003494 3300025940 Bacteria 15290
1587 Ga0207691_10030260 3300025940 Bacteria 5060
1588 Ga0207691_10032543 3300025940 Bacteria 4861
1589 Ga0207691_10050111 3300025940 Bacteria 3824
1590 Ga0207691_10061798 3300025940 Bacteria 3402
1591 Ga0207691_10066047 3300025940 Bacteria 3273
1592 Ga0207691_10067104 3300025940 Bacteria 3244
1593 Ga0207691_10074819 3300025940 Bacteria 3054
1594 Ga0207691_10090545 3300025940 Bacteria 2742
1595 Ga0207691_10098896 3300025940 Bacteria 2606
1596 Ga0207691_10110437 3300025940 Bacteria 2446
1597 Ga0207691_10128172 3300025940 Bacteria 2243
1598 Ga0207691_10248809 3300025940 Bacteria 1535
1599 Ga0207711_10001751 3300025941 Bacteria 19911
1600 Ga0207711_10004442 3300025941 Bacteria 11957
1601 Ga0207711_10030749 3300025941 Bacteria 4529
1602 Ga0207711_10067021 3300025941 Bacteria 3106
1603 Ga0207711_10098106 3300025941 Bacteria 2588
1604 Ga0207711_10099715 3300025941 Bacteria 2568
1605 Ga0207711_10167300 3300025941 Bacteria 1993
1606 Ga0207711_10212454 3300025941 Unclassified 1767
1607 Ga0207711_10266588 3300025941 Bacteria 1575
1608 Ga0207711_10373936 3300025941 Bacteria 1322
1609 Ga0207689_10003090 3300025942 Bacteria 15318
1610 Ga0207689_10003706 3300025942 Bacteria 13935
1611 Ga0207689_10004261 3300025942 Bacteria 13010
1612 Ga0207689_10005913 3300025942 Bacteria 10834
1613 Ga0207689_10006788 3300025942 Bacteria 10073
1614 Ga0207689_10014604 3300025942 Bacteria 6675
1615 Ga0207689_10015537 3300025942 Bacteria 6448
1616 Ga0207689_10019263 3300025942 Bacteria 5753
1617 Ga0207689_10032521 3300025942 Bacteria 4339
1618 Ga0207689_10033553 3300025942 Bacteria 4265
1619 Ga0207689_10038198 3300025942 Bacteria 3978
1620 Ga0207689_10048209 3300025942 Bacteria 3514
1621 Ga0207689_10053306 3300025942 Bacteria 3332
1622 Ga0207689_10055845 3300025942 Bacteria 3249
1623 Ga0207689_10156661 3300025942 Bacteria 1877
1624 Ga0207689_10169745 3300025942 Bacteria 1798
1625 Ga0207689_10339176 3300025942 Bacteria 1248
1626 Ga0207661_10132783 3300025944 Bacteria 2135
1627 Ga0207661_10137465 3300025944 Bacteria 2100
1628 Ga0207661_10459505 3300025944 Bacteria 1160
1629 Ga0207679_10000001 3300025945 Bacteria 777444
1630 Ga0207679_10000991 3300025945 Bacteria 18231
1631 Ga0207679_10021714 3300025945 Bacteria 4357
1632 Ga0207679_10041047 3300025945 Bacteria 3316
1633 Ga0207679_10131746 3300025945 Bacteria 2007
1634 Ga0207679_10188604 3300025945 Bacteria 1712
1635 Ga0207679_10201073 3300025945 Bacteria 1664
1636 Ga0207679_10235897 3300025945 Bacteria 1547
1637 Ga0207679_10295732 3300025945 Bacteria 1393
1638 Ga0207667_10000025 3300025949 Bacteria 350159
1639 Ga0207667_10002421 3300025949 Bacteria 23380
1640 Ga0207667_10013866 3300025949 Bacteria 9207
1641 Ga0207667_10021269 3300025949 Bacteria 7191
1642 Ga0207667_10022096 3300025949 Bacteria 7037
1643 Ga0207667_10064691 3300025949 Bacteria 3817
1644 Ga0207667_10108675 3300025949 Bacteria 2861
1645 Ga0207667_10248788 3300025949 Bacteria 1818
1646 Ga0207667_10440228 3300025949 Bacteria 1325
1647 Ga0207651_10002729 3300025960 Bacteria 8472
1648 Ga0207651_10006970 3300025960 Bacteria 5981
1649 Ga0207651_10011844 3300025960 Bacteria 4900
1650 Ga0207651_10021408 3300025960 Bacteria 3930
1651 Ga0207651_10038591 3300025960 Bacteria 3141
1652 Ga0207651_10256701 3300025960 Bacteria 1433
1653 Ga0207712_10006042 3300025961 Bacteria 7638
1654 Ga0207712_10010385 3300025961 Bacteria 5911
1655 Ga0207712_10010669 3300025961 Bacteria 5835
1656 Ga0207712_10010887 3300025961 Bacteria 5789
1657 Ga0207712_10022078 3300025961 Bacteria 4187
1658 Ga0207712_10102362 3300025961 Bacteria 2132
1659 Ga0207712_10106442 3300025961 Bacteria 2095
1660 Ga0207712_10238531 3300025961 Bacteria 1463
1661 Ga0207668_10001922 3300025972 Bacteria 12168
1662 Ga0207668_10003817 3300025972 Bacteria 8881
1663 Ga0207668_10004960 3300025972 Bacteria 7829
1664 Ga0207668_10006870 3300025972 Bacteria 6751
1665 Ga0207668_10016955 3300025972 Bacteria 4558
1666 Ga0207668_10045399 3300025972 Bacteria 2996
1667 Ga0207668_10052639 3300025972 Bacteria 2817
1668 Ga0207668_10065074 3300025972 Bacteria 2579
1669 Ga0207668_10128274 3300025972 Bacteria 1933
1670 Ga0207640_10000183 3300025981 Bacteria 44817
1671 Ga0207640_10007344 3300025981 Bacteria 6083
1672 Ga0207640_10011961 3300025981 Bacteria 4929
1673 Ga0207640_10033131 3300025981 Bacteria 3211
1674 Ga0207640_10052379 3300025981 Bacteria 2658
1675 Ga0207640_10185819 3300025981 Bacteria 1562
1676 Ga0207658_10001054 3300025986 Bacteria 22355
1677 Ga0207658_10006425 3300025986 Bacteria 8024
1678 Ga0207658_10008330 3300025986 Bacteria 7060
1679 Ga0207658_10011808 3300025986 Bacteria 5950
1680 Ga0207658_10037313 3300025986 Bacteria 3490
1681 Ga0207658_10056948 3300025986 Bacteria 2903
1682 Ga0207658_10170023 3300025986 Bacteria 1795
1683 Ga0207658_10191192 3300025986 Bacteria 1701
1684 Ga0207658_10231561 3300025986 Bacteria 1560
1685 Ga0207658_10296998 3300025986 Bacteria 1390
1686 Ga0207677_10000405 3300026023 Bacteria 29760
1687 Ga0207677_10005852 3300026023 Bacteria 6692
1688 Ga0207677_10013070 3300026023 Bacteria 4797
1689 Ga0207677_10025253 3300026023 Bacteria 3703
1690 Ga0207677_10105943 3300026023 Bacteria 2081
1691 Ga0207703_10000046 3300026035 Bacteria 154474
1692 Ga0207703_10000470 3300026035 Bacteria 42191
1693 Ga0207703_10000663 3300026035 Bacteria 34425
1694 Ga0207703_10001035 3300026035 Bacteria 26657
1695 Ga0207703_10001406 3300026035 Bacteria 21938
1696 Ga0207703_10003924 3300026035 Bacteria 12353
1697 Ga0207703_10020161 3300026035 Bacteria 5212
1698 Ga0207703_10036725 3300026035 Bacteria 3901
1699 Ga0207703_10042632 3300026035 Bacteria 3640
1700 Ga0207703_10089142 3300026035 Bacteria 2590
1701 Ga0207703_10104433 3300026035 Unclassified 2407
1702 Ga0207703_10123660 3300026035 Bacteria 2224
1703 Ga0207703_10138870 3300026035 Bacteria 2107
1704 Ga0207639_10000051 3300026041 Bacteria 113927
1705 Ga0207639_10002193 3300026041 Bacteria 13149
1706 Ga0207639_10010774 3300026041 Bacteria 6336
1707 Ga0207639_10067819 3300026041 Bacteria 2777
1708 Ga0207639_10102374 3300026041 Bacteria 2318
1709 Ga0207639_10114522 3300026041 Bacteria 2204
1710 Ga0207639_10224561 3300026041 Bacteria 1624
1711 Ga0207639_10443788 3300026041 Bacteria 1177
1712 Ga0207678_10000001 3300026067 Bacteria 433184
1713 Ga0207678_10006696 3300026067 Bacteria 10218
1714 Ga0207678_10010449 3300026067 Bacteria 8150
1715 Ga0207678_10138183 3300026067 Bacteria 2079
1716 Ga0207708_10000133 3300026075 Bacteria 58317
1717 Ga0207708_10001613 3300026075 Bacteria 16809
1718 Ga0207708_10007845 3300026075 Bacteria 7907
1719 Ga0207708_10013226 3300026075 Bacteria 6161
1720 Ga0207708_10053681 3300026075 Bacteria 3071
1721 Ga0207708_10068492 3300026075 Bacteria 2717
1722 Ga0207708_10115599 3300026075 Bacteria 2087
1723 Ga0207708_10185012 3300026075 Bacteria 1655
1724 Ga0207702_10000009 3300026078 Bacteria 305906
1725 Ga0207702_10037703 3300026078 Bacteria 4047
1726 Ga0207702_10150973 3300026078 Bacteria 2113
1727 Ga0207702_10210517 3300026078 Bacteria 1807
1728 Ga0207702_10401430 3300026078 Bacteria 1322
1729 Ga0207641_10002216 3300026088 Bacteria 18233
1730 Ga0207641_10002267 3300026088 Bacteria 17934
1731 Ga0207641_10002373 3300026088 Bacteria 17380
1732 Ga0207641_10058576 3300026088 Bacteria 3278
1733 Ga0207641_10063018 3300026088 Bacteria 3166
1734 Ga0207641_10097285 3300026088 Bacteria 2587
1735 Ga0207641_10107074 3300026088 Bacteria 2472
1736 Ga0207641_10124482 3300026088 Bacteria 2306
1737 Ga0207641_10172654 3300026088 Bacteria 1974
1738 Ga0207641_10228716 3300026088 Bacteria 1727
1739 Ga0207641_10272169 3300026088 Unclassified 1589
1740 Ga0207641_10278932 3300026088 Bacteria 1571
1741 Ga0207648_10000205 3300026089 Bacteria 62995
1742 Ga0207648_10000556 3300026089 Bacteria 41762
1743 Ga0207648_10001151 3300026089 Bacteria 29631
1744 Ga0207648_10008185 3300026089 Bacteria 10165
1745 Ga0207648_10013654 3300026089 Bacteria 7540
1746 Ga0207648_10014371 3300026089 Bacteria 7318
1747 Ga0207648_10018070 3300026089 Bacteria 6387
1748 Ga0207648_10022904 3300026089 Bacteria 5603
1749 Ga0207648_10437307 3300026089 Bacteria 1189
1750 Ga0207676_10000013 3300026095 Bacteria 343067
1751 Ga0207676_10000116 3300026095 Bacteria 71614
1752 Ga0207676_10003146 3300026095 Bacteria 11784
1753 Ga0207676_10010013 3300026095 Bacteria 6746
1754 Ga0207676_10011955 3300026095 Bacteria 6212
1755 Ga0207676_10013940 3300026095 Bacteria 5770
1756 Ga0207676_10028978 3300026095 Bacteria 4141
1757 Ga0207676_10037037 3300026095 Bacteria 3714
1758 Ga0207676_10079099 3300026095 Bacteria 2665
1759 Ga0207676_10183474 3300026095 Unclassified 1834
1760 Ga0207676_10258070 3300026095 Bacteria 1572
1761 Ga0207676_10312829 3300026095 Bacteria 1438
1762 Ga0207676_10408598 3300026095 Bacteria 1270
1763 Ga0207674_10011128 3300026116 Bacteria 10118
1764 Ga0207674_10027192 3300026116 Bacteria 6057
1765 Ga0207674_10052624 3300026116 Bacteria 4152
1766 Ga0207674_10072755 3300026116 Bacteria 3452
1767 Ga0207674_10144782 3300026116 Bacteria 2335
1768 Ga0207674_10149467 3300026116 Bacteria 2293
1769 Ga0207674_10285298 3300026116 Bacteria 1599
1770 Ga0207674_10423870 3300026116 Bacteria 1286
1771 Ga0207674_10467163 3300026116 Bacteria 1219
1772 Ga0207675_100000353 3300026118 Bacteria 43874
1773 Ga0207675_100001125 3300026118 Bacteria 26534
1774 Ga0207675_100001686 3300026118 Bacteria 22114
1775 Ga0207675_100003888 3300026118 Bacteria 14518
1776 Ga0207675_100005669 3300026118 Bacteria 11952
1777 Ga0207675_100009842 3300026118 Bacteria 8944
1778 Ga0207675_100011445 3300026118 Bacteria 8299
1779 Ga0207675_100026512 3300026118 Bacteria 5395
1780 Ga0207675_100028833 3300026118 Bacteria 5171
1781 Ga0207675_100036321 3300026118 Bacteria 4597
1782 Ga0207675_100037019 3300026118 Bacteria 4552
1783 Ga0207675_100055265 3300026118 Bacteria 3704
1784 Ga0207675_100062299 3300026118 Bacteria 3483
1785 Ga0207675_100063606 3300026118 Bacteria 3447
1786 Ga0207675_100070454 3300026118 Bacteria 3268
1787 Ga0207675_100077970 3300026118 Bacteria 3104
1788 Ga0207675_100153929 3300026118 Bacteria 2190
1789 Ga0207683_10000125 3300026121 Bacteria 62664
1790 Ga0207683_10000135 3300026121 Bacteria 61049
1791 Ga0207683_10001991 3300026121 Bacteria 18082
1792 Ga0207683_10009629 3300026121 Bacteria 8234
1793 Ga0207683_10016645 3300026121 Bacteria 6257
1794 Ga0207683_10016646 3300026121 Bacteria 6257
1795 Ga0207683_10022573 3300026121 Bacteria 5403
1796 Ga0207683_10024010 3300026121 Bacteria 5247
1797 Ga0207683_10047187 3300026121 Bacteria 3772
1798 Ga0207683_10074560 3300026121 Bacteria 3002
1799 Ga0207683_10079983 3300026121 Bacteria 2899
1800 Ga0207683_10145430 3300026121 Bacteria 2137
1801 Ga0207683_10476319 3300026121 Bacteria 1152
1802 Ga0207698_10068668 3300026142 Bacteria 2799
1803 Ga0207698_10084835 3300026142 Bacteria 2569
1804 Ga0207698_10100474 3300026142 Bacteria 2396
1805 Ga0207698_10169356 3300026142 Bacteria 1921
1806 Ga0207698_10178323 3300026142 Bacteria 1879
1807 Ga0207698_10196567 3300026142 Bacteria 1802
1808 Ga0207698_10330817 3300026142 Bacteria 1431
1809 Ga0209281_1000002 3300027111 Bacteria 1924012
1810 Ga0209281_1000416 3300027111 Bacteria 64290
1811 Ga0209281_1004749 3300027111 Bacteria 3970
1812 Ga0209281_1007844 3300027111 Bacteria 2643
1813 Ga0209973_1000926 3300027252 Bacteria 2399
1814 Ga0209371_1003542 3300027312 Bacteria 7504
1815 Ga0209996_1001989 3300027395 Bacteria 2518
1816 Ga0210000_1003736 3300027462 Bacteria 2200
1817 Ga0209995_1012032 3300027471 Bacteria 1409
1818 Ga0209179_1000010 3300027512 Bacteria 68867
1819 Ga0209999_1002271 3300027543 Bacteria 3379
1820 Ga0209983_1003473 3300027665 Bacteria 3365
1821 Ga0209983_1003490 3300027665 Bacteria 3358
1822 Ga0209282_1000001 3300027666 Bacteria 2450367
1823 Ga0209282_1000027 3300027666 Bacteria 159842
1824 Ga0209282_1000310 3300027666 Bacteria 24189
1825 Ga0209971_1000257 3300027682 Bacteria 15025
1826 Ga0209971_1007600 3300027682 Bacteria 2573
1827 Ga0209966_1000659 3300027695 Bacteria 7679
1828 Ga0209966_1004582 3300027695 Bacteria 2347
1829 Ga0209998_10016385 3300027717 Bacteria 1560
1830 Ga0209974_10000749 3300027876 Bacteria 11101
1831 Ga0209974_10001866 3300027876 Bacteria 7693
1832 Ga0209974_10012954 3300027876 Bacteria 2783
1833 Ga0209974_10013503 3300027876 Bacteria 2721
1834 Ga0209974_10033058 3300027876 Unclassified 1716
1835 Ga0207428_10000003 3300027907 Bacteria 799783
1836 Ga0207428_10000429 3300027907 Bacteria 51824
1837 Ga0207428_10003904 3300027907 Bacteria 14298
1838 Ga0207428_10005651 3300027907 Bacteria 11623
1839 Ga0207428_10060518 3300027907 Bacteria 3000
1840 Ga0207428_10132368 3300027907 Bacteria 1907
1841 Ga0268266_10004460 3300028379 Bacteria 13385
1842 Ga0268266_10005315 3300028379 Bacteria 12066
1843 Ga0268266_10009087 3300028379 Bacteria 8776
1844 Ga0268266_10024895 3300028379 Bacteria 5092
1845 Ga0268266_10038899 3300028379 Bacteria 4050
1846 Ga0268266_10064441 3300028379 Bacteria 3166
1847 Ga0268266_10081005 3300028379 Bacteria 2829
1848 Ga0268266_10082673 3300028379 Bacteria 2802
1849 Ga0268266_10117709 3300028379 Bacteria 2361
1850 Ga0268266_10232207 3300028379 Bacteria 1699
1851 Ga0268265_10001008 3300028380 Bacteria 25465
1852 Ga0268265_10002600 3300028380 Bacteria 13451
1853 Ga0268265_10004134 3300028380 Bacteria 10190
1854 Ga0268265_10006044 3300028380 Bacteria 8229
1855 Ga0268265_10023410 3300028380 Bacteria 4353
1856 Ga0268265_10025075 3300028380 Bacteria 4227
1857 Ga0268265_10051179 3300028380 Bacteria 3116
1858 Ga0268265_10110936 3300028380 Bacteria 2239
1859 Ga0268265_10135553 3300028380 Bacteria 2053
1860 Ga0268265_10278370 3300028380 Bacteria 1496
1861 Ga0268264_10001218 3300028381 Bacteria 24739
1862 Ga0268264_10002397 3300028381 Bacteria 16512
1863 Ga0268264_10009538 3300028381 Bacteria 8039
1864 Ga0268264_10013500 3300028381 Bacteria 6726
1865 Ga0268264_10014456 3300028381 Bacteria 6487
1866 Ga0268264_10018814 3300028381 Bacteria 5648
1867 Ga0268264_10028514 3300028381 Bacteria 4567
1868 Ga0268264_10050866 3300028381 Bacteria 3452
1869 Ga0268264_10056158 3300028381 Bacteria 3291
1870 Ga0268264_10104946 3300028381 Bacteria 2464
1871 Ga0268264_10260017 3300028381 Bacteria 1616
1872 Ga0268264_10260427 3300028381 Bacteria 1615
1873 Ga0268264_10335315 3300028381 Bacteria 1435
1874 Ga0265334_10000338 3300028573 Bacteria 25032
1875 Ga0265318_10000616 3300028577 Bacteria 24650
1876 Ga0307517_10002492 3300028786 Bacteria 29429
1877 Ga0307517_10048416 3300028786 Bacteria 4374
1878 Ga0307515_10000006 3300028794 Bacteria 725810
1879 Ga0307515_10000028 3300028794 Bacteria 368467
1880 Ga0307515_10000043 3300028794 Bacteria 304612
1881 Ga0307515_10000416 3300028794 Bacteria 102535
1882 Ga0307515_10000459 3300028794 Bacteria 97482
1883 Ga0307515_10007444 3300028794 Bacteria 21641
1884 Ga0307515_10018602 3300028794 Bacteria 12554
1885 Ga0307515_10060251 3300028794 Bacteria 5419
1886 Ga0307515_10088806 3300028794 Bacteria 3901
1887 Ga0307515_10112059 3300028794 Bacteria 3176
1888 Ga0307515_10121446 3300028794 Bacteria 2955
1889 Ga0307515_10157823 3300028794 Bacteria 2331
1890 Ga0307515_10162675 3300028794 Bacteria 2267
1891 Ga0265338_10003965 3300028800 Bacteria 20391
1892 Ga0265338_10016757 3300028800 Bacteria 7941
1893 Ga0268256_1003237 3300030500 Bacteria 7505
1894 Ga0307511_10000040 3300030521 Bacteria 102640
1895 Ga0307511_10002142 3300030521 Bacteria 20730
1896 Ga0307512_10118482 3300030522 Bacteria 1712
1897 Ga0316177_1126523 3300030731 Bacteria 5729
1898 Ga0316177_1154063 3300030731 Bacteria 2407
1899 Ga0316176_1155407 3300030732 Bacteria 2396
1900 Ga0314311_1127732 3300030733 Bacteria 7424
1901 Ga0316179_1066869 3300030734 Bacteria 2287
1902 Ga0316178_1038519 3300030735 Bacteria 3088
1903 Ga0316180_1083909 3300030736 Bacteria 2496
1904 Ga0316183_1003610 3300030742 Bacteria 136078
1905 Ga0316183_1066219 3300030742 Bacteria 2292
1906 Ga0316181_1002569 3300030744 Bacteria 2429
1907 Ga0316181_1008908 3300030744 Bacteria 28157
1908 Ga0316182_1003039 3300030745 Bacteria 3233
1909 Ga0316182_1192275 3300030745 Bacteria 1050
1910 Ga0265330_10000062 3300031235 Bacteria 95409
1911 Ga0265330_10001287 3300031235 Bacteria 14675
1912 Ga0265332_10000001 3300031238 Bacteria 863783
1913 Ga0265332_10000013 3300031238 Bacteria 250095
1914 Ga0265332_10018991 3300031238 Bacteria 3034
1915 Ga0265328_10002630 3300031239 Bacteria 8021
1916 Ga0265328_10007254 3300031239 Bacteria 4634
1917 Ga0265328_10024605 3300031239 Unclassified 2273
1918 Ga0265320_10004288 3300031240 Bacteria 9374
1919 Ga0265320_10016068 3300031240 Bacteria 4206
1920 Ga0265320_10129856 3300031240 Bacteria 1145
1921 Ga0265325_10002547 3300031241 Bacteria 12259
1922 Ga0265325_10013088 3300031241 Bacteria 4728
1923 Ga0265325_10054134 3300031241 Bacteria 2055
1924 Ga0265329_10009075 3300031242 Bacteria 3731
1925 Ga0265340_10012493 3300031247 Bacteria 4483
1926 Ga0265340_10031095 3300031247 Bacteria 2672
1927 Ga0265339_10020126 3300031249 Bacteria 3903
1928 Ga0265331_10011463 3300031250 Bacteria 4853
1929 Ga0265327_10000731 3300031251 Bacteria 51292
1930 Ga0265327_10002253 3300031251 Bacteria 20836
1931 Ga0265327_10003664 3300031251 Bacteria 14412
1932 Ga0265327_10041840 3300031251 Bacteria 2465
1933 Ga0265327_10062478 3300031251 Bacteria 1895
1934 Ga0265327_10082527 3300031251 Bacteria 1584
1935 Ga0265316_10002079 3300031344 Bacteria 21039
1936 Ga0265316_10022484 3300031344 Bacteria 5314
1937 Ga0307513_10000012 3300031456 Bacteria 328865
1938 Ga0307513_10000021 3300031456 Bacteria 228078
1939 Ga0307513_10005429 3300031456 Bacteria 16849
1940 Ga0307513_10015370 3300031456 Bacteria 9278
1941 Ga0307513_10049223 3300031456 Bacteria 4567
1942 Ga0307513_10288532 3300031456 Bacteria 1414
1943 Ga0307509_10000599 3300031507 Bacteria 61465
1944 Ga0307509_10033058 3300031507 Bacteria 5695
1945 Ga0307509_10050936 3300031507 Bacteria 4431
1946 Ga0307509_10067465 3300031507 Bacteria 3747
1947 Ga0307509_10154467 3300031507 Bacteria 2204
1948 Ga0307408_100000056 3300031548 Bacteria 140709
1949 Ga0307408_100000095 3300031548 Bacteria 97142
1950 Ga0307408_100000864 3300031548 Bacteria 23794
1951 Ga0307408_100042051 3300031548 Bacteria 3243
1952 Ga0307408_100065306 3300031548 Bacteria 2668
1953 Ga0307408_100080697 3300031548 Bacteria 2430
1954 Ga0307408_100085494 3300031548 Bacteria 2368
1955 Ga0307408_100093488 3300031548 Bacteria 2275
1956 Ga0307408_100128215 3300031548 Bacteria 1976
1957 Ga0307408_100422813 3300031548 Bacteria 1149
1958 Ga0307408_100504621 3300031548 Bacteria 1059
1959 Ga0265313_10001678 3300031595 Bacteria 20464
1960 Ga0307508_10000047 3300031616 Bacteria 137805
1961 Ga0307508_10000204 3300031616 Bacteria 71518
1962 Ga0307508_10000388 3300031616 Bacteria 52836
1963 Ga0307514_10000979 3300031649 Bacteria 42521
1964 Ga0307514_10024596 3300031649 Bacteria 4872
1965 Ga0316575_10000044 3300031665 Bacteria 31116
1966 Ga0316575_10002587 3300031665 Bacteria 6093
1967 Ga0316575_10005476 3300031665 Bacteria 4530
1968 Ga0316575_10024170 3300031665 Bacteria 2350
1969 Ga0316575_10070129 3300031665 Bacteria 1407
1970 Ga0316579_10001389 3300031691 Bacteria 8769
1971 Ga0316579_10006085 3300031691 Bacteria 4903
1972 Ga0316579_10012506 3300031691 Bacteria 3633
1973 Ga0265314_10000145 3300031711 Bacteria 106541
1974 Ga0265314_10004359 3300031711 Bacteria 13176
1975 Ga0265314_10009622 3300031711 Bacteria 8140
1976 Ga0265314_10080078 3300031711 Bacteria 2158
1977 Ga0265342_10004299 3300031712 Bacteria 11283
1978 Ga0316576_10002059 3300031727 Bacteria 11283
1979 Ga0316576_10009558 3300031727 Bacteria 6263
1980 Ga0316576_10063753 3300031727 Bacteria 2705
1981 Ga0316576_10089934 3300031727 Bacteria 2286
1982 Ga0316578_10000034 3300031728 Bacteria 28193
1983 Ga0316578_10001360 3300031728 Bacteria 9848
1984 Ga0316578_10005109 3300031728 Bacteria 6318
1985 Ga0316578_10017829 3300031728 Bacteria 3874
1986 Ga0316578_10019102 3300031728 Bacteria 3767
1987 Ga0316578_10161969 3300031728 Bacteria 1348
1988 Ga0307516_10001121 3300031730 Bacteria 37343
1989 Ga0307516_10008157 3300031730 Bacteria 11896
1990 Ga0307516_10215889 3300031730 Bacteria 1630
1991 Ga0307405_10000025 3300031731 Bacteria 123095
1992 Ga0307405_10027693 3300031731 Bacteria 3290
1993 Ga0307405_10052528 3300031731 Bacteria 2534
1994 Ga0307405_10095709 3300031731 Bacteria 1978
1995 Ga0307405_10141032 3300031731 Bacteria 1680
1996 Ga0316577_10000159 3300031733 Bacteria 21180
1997 Ga0316577_10001223 3300031733 Bacteria 11948
1998 Ga0307413_10173756 3300031824 Bacteria 1528
1999 Ga0307410_10019465 3300031852 Bacteria 4130
2000 Ga0307410_10070483 3300031852 Bacteria 2422
2001 Ga0307410_10237070 3300031852 Bacteria 1412
2002 Ga0307406_10005421 3300031901 Bacteria 6979
2003 Ga0307407_10000016 3300031903 Bacteria 141499
2004 Ga0307407_10015089 3300031903 Bacteria 3805
2005 Ga0307412_10000085 3300031911 Bacteria 88692
2006 Ga0307412_10000517 3300031911 Bacteria 23043
2007 Ga0307412_10001984 3300031911 Bacteria 11335
2008 Ga0307412_10012336 3300031911 Bacteria 4978
2009 Ga0307412_10014387 3300031911 Bacteria 4664
2010 Ga0307412_10147393 3300031911 Bacteria 1732
2011 Ga0307412_10343752 3300031911 Bacteria 1195
2012 Ga0307409_100002755 3300031995 Bacteria 9286
2013 Ga0307409_100041625 3300031995 Bacteria 3433
2014 Ga0307409_100059769 3300031995 Bacteria 2968
2015 Ga0307409_100083307 3300031995 Bacteria 2593
2016 Ga0307416_100000036 3300032002 Bacteria 141505
2017 Ga0307416_100005127 3300032002 Bacteria 8001
2018 Ga0307416_100016370 3300032002 Bacteria 5152
2019 Ga0307416_100080095 3300032002 Bacteria 2755
2020 Ga0307416_100141507 3300032002 Bacteria 2187
2021 Ga0307416_100252506 3300032002 Bacteria 1717
2022 Ga0307416_100257802 3300032002 Bacteria 1702
2023 Ga0307416_100321278 3300032002 Bacteria 1550
2024 Ga0307416_100473154 3300032002 Bacteria 1311
2025 Ga0307414_10010495 3300032004 Bacteria 5379
2026 Ga0307414_10018294 3300032004 Bacteria 4310
2027 Ga0307411_10001214 3300032005 Bacteria 10218
2028 Ga0307411_10037583 3300032005 Bacteria 3045
2029 Ga0307411_10042556 3300032005 Bacteria 2899
2030 Ga0307411_10068675 3300032005 Bacteria 2390
2031 Ga0307411_10306949 3300032005 Bacteria 1275
2032 Ga0307415_100169715 3300032126 Bacteria 1700
2033 Ga0316583_10003885 3300032133 Bacteria 5309
2034 Ga0316583_10006085 3300032133 Bacteria 4338
2035 Ga0316583_10024058 3300032133 Bacteria 2175
2036 Ga0316583_10050272 3300032133 Bacteria 1467
2037 Ga0316585_10000072 3300032137 Bacteria 16903
2038 Ga0316580_10000248 3300032139 Bacteria 11491
2039 Ga0316580_10042784 3300032139 Bacteria 1398
2040 Ga0316593_10018906 3300032168 Bacteria 2123
2041 Ga0316593_10078378 3300032168 Bacteria 1150
2042 Ga0307507_10068312 3300033179 Bacteria 3243
2043 Ga0307510_10006844 3300033180 Bacteria 13597
2044 Ga0307510_10115844 3300033180 Bacteria 2403
2045 Ga0307510_10161503 3300033180 Bacteria 1836
2046 Ga0307510_10207985 3300033180 Bacteria 1483
2047 Ga0316592_1031204 3300033524 Bacteria 1160
2048 Ga0316588_1028303 3300033528 Bacteria 1306
2049 Ga0373926_0005073 3300035083 Bacteria 4324
2050 Ga0373926_0006370 3300035083 Bacteria 3920
2051 Ga0373929_0034119 3300035085 Bacteria 1102
2052 Ga0373934_0007124 3300035086 Bacteria 4149
2053 Ga0373934_0010704 3300035086 Bacteria 3444
2054 Ga0373934_0063607 3300035086 Bacteria 1472
2055 Ga0373934_0089983 3300035086 Bacteria 1237
2056 Ga0373944_0008624 3300035089 Bacteria 2753
2057 Ga0373944_0010603 3300035089 Bacteria 2513
2058 Ga0373949_0013208 3300035090 Bacteria 1829
2059 Ga0373923_0030791 3300035111 Bacteria 2160
2060 Ga0373932_0000024 3300035112 Bacteria 45717
2061 Ga0373932_0004674 3300035112 Bacteria 3232
2062 Ga0373932_0040408 3300035112 Bacteria 1343
2063 Ga0373936_0009320 3300035113 Bacteria 3698
2064 Ga0373936_0040856 3300035113 Bacteria 1859
2065 Ga0373936_0053080 3300035113 Bacteria 1643
2066 Ga0373939_0000029 3300035114 Bacteria 52306
2067 Ga0373939_0004613 3300035114 Bacteria 3264
2068 Ga0373939_0039174 3300035114 Bacteria 1417
2069 Ga0373939_0047628 3300035114 Bacteria 1317
2070 Ga0373941_0056695 3300035115 Bacteria 1263
2071 Ga0373945_0021438 3300035116 Bacteria 2220
2072 Ga0373954_0000511 3300035118 Bacteria 14523
2073 Ga0373954_0000664 3300035118 Bacteria 13179
2074 Ga0373954_0041456 3300035118 Bacteria 2146
2075 Ga0373956_0092453 3300035119 Bacteria 1396
2076 Ga0373960_0009118 3300035121 Bacteria 2396
2077 Ga0373943_0022637 3300035170 Bacteria 2915
2078 Ga0373943_0058921 3300035170 Bacteria 1913
2079 Ga0373946_0012724 3300035171 Bacteria 3153
2080 Ga0373946_0103301 3300035171 Bacteria 1280
2081 Ga0373955_0007065 3300035172 Bacteria 5143
2082 Ga0373955_0100024 3300035172 Bacteria 1663
2083 Ga0373942_0012448 3300035207 Bacteria 2032
2084 Ga0373942_0036693 3300035207 Bacteria 1321
2085 Ga0373961_0003551 3300035241 Bacteria 3842
2086 Ga0373962_0015395 3300035242 Bacteria 1960
2087 Ga0373962_0045809 3300035242 Bacteria 1246
2088 Ga0316574_0000640 3300035398 Bacteria 14674
2089 Ga0316574_0005234 3300035398 Bacteria 6901
2090 Ga0316574_0054690 3300035398 Bacteria 2493
2091 Ga0316574_0086539 3300035398 Bacteria 1994
2092 Ga0316574_0110230 3300035398 Bacteria 1764
2093 Ga0373924_0013797 3300035410 Bacteria 3041
2094 Ga0373931_0000407 3300035691 Bacteria 17625
2095 Ga0373931_0002605 3300035691 Bacteria 8035
2096 Ga0373931_0010350 3300035691 Bacteria 4482
2097 Ga0373931_0052079 3300035691 Bacteria 2181
2098 Ga0373931_0076777 3300035691 Bacteria 1836
2099 Ga0373935_0032053 3300035692 Bacteria 3264
2100 Ga0373935_0210887 3300035692 Bacteria 1346
2101 Ga0373927_0030979 3300035695 Bacteria 3489
2102 Ga0373927_0077595 3300035695 Bacteria 2152
2103 Ga0373933_0005238 3300035724 Bacteria 7074
2104 Ga0373933_0063753 3300035724 Bacteria 2228
2105 Ga0373947_0005778 3300035725 Bacteria 7216
2106 Ga0373947_0009748 3300035725 Bacteria 5512
2107 Ga0373947_0186625 3300035725 Bacteria 1352
2108 Ga0373937_0002310 3300036401 Bacteria 15920
2109 Ga0373937_0002644 3300036401 Bacteria 14929
2110 Ga0373937_0005522 3300036401 Bacteria 10840
2111 Ga0373937_0099932 3300036401 Bacteria 2691
2112 Ga0373937_0103339 3300036401 Bacteria 2646
2113 Ga0373937_0122319 3300036401 Bacteria 2426
2114 Ga0373937_0173376 3300036401 Bacteria 2024
2115 Ga0316582_0004956 3300036647 Bacteria 6803
2116 Ga0316584_0000500 3300036712 Bacteria 20703
2117 Ga0316584_0008519 3300036712 Bacteria 7067
2118 Ga0316584_0010407 3300036712 Bacteria 6497
2119 Ga0316584_0101518 3300036712 Bacteria 2154
2120 Ga0373925_0003379 3300037068 Bacteria 12375
2121 Ga0373925_0005260 3300037068 Bacteria 9662
2122 Ga0373925_0012205 3300037068 Bacteria 6218
2123 Ga0373925_0040562 3300037068 Bacteria 3447
2124 Ga0373925_0055995 3300037068 Bacteria 2953
2125 Ga0373925_0087690 3300037068 Bacteria 2375
2126 Ga0373925_0217629 3300037068 Bacteria 1523
2127 Ga0395899_0000163 3300037312 Bacteria 102351
2128 Ga0395899_0001301 3300037312 Bacteria 21545
2129 Ga0395899_0001859 3300037312 Bacteria 17459
2130 Ga0395899_0009873 3300037312 Bacteria 7320
2131 Ga0395899_0041558 3300037312 Bacteria 3435
2132 Ga0395899_0073339 3300037312 Bacteria 2503
2133 Ga0395899_0074957 3300037312 Bacteria 2471
2134 Ga0395899_0091118 3300037312 Bacteria 2209
2135 Ga0395900_0000133 3300037418 Bacteria 124692
2136 Ga0395900_0002123 3300037418 Bacteria 22178
2137 Ga0395900_0007411 3300037418 Bacteria 11337
2138 Ga0395900_0010794 3300037418 Bacteria 9345
2139 Ga0395900_0011264 3300037418 Bacteria 9146
2140 Ga0395900_0030463 3300037418 Bacteria 5540
2141 Ga0395900_0032373 3300037418 Bacteria 5377
2142 Ga0395900_0033794 3300037418 Bacteria 5263
2143 Ga0395900_0040252 3300037418 Bacteria 4816
2144 Ga0395900_0059504 3300037418 Bacteria 3933
2145 Ga0395900_0063495 3300037418 Bacteria 3796
2146 Ga0395900_0107797 3300037418 Bacteria 2862
2147 Ga0395900_0128714 3300037418 Bacteria 2595
2148 Ga0395900_0304281 3300037418 Bacteria 1579
2149 Ga0395898_0003944 3300037466 Bacteria 16366
2150 Ga0395898_0007603 3300037466 Bacteria 11507
2151 Ga0395898_0024863 3300037466 Bacteria 6038
2152 Ga0395898_0049040 3300037466 Bacteria 4139
2153 Ga0395898_0076721 3300037466 Bacteria 3226
2154 Ga0395898_0078013 3300037466 Bacteria 3196
2155 Ga0395905_0000249 3300037471 Bacteria 80584
2156 Ga0395905_0000459 3300037471 Bacteria 57003
2157 Ga0395905_0002454 3300037471 Bacteria 20536
2158 Ga0395905_0002769 3300037471 Bacteria 19207
2159 Ga0395905_0002774 3300037471 Bacteria 19194
2160 Ga0395905_0003414 3300037471 Bacteria 16995
2161 Ga0395905_0004459 3300037471 Bacteria 14535
2162 Ga0395905_0006573 3300037471 Bacteria 11681
2163 Ga0395905_0011520 3300037471 Bacteria 8543
2164 Ga0395905_0012066 3300037471 Bacteria 8327
2165 Ga0395905_0069206 3300037471 Bacteria 3305
2166 Ga0395905_0092710 3300037471 Bacteria 2833
2167 Ga0395905_0093479 3300037471 Bacteria 2820
2168 Ga0395905_0097148 3300037471 Bacteria 2765
2169 Ga0395905_0144462 3300037471 Bacteria 2238
2170 Ga0395905_0149641 3300037471 Bacteria 2196
2171 Ga0395905_0176738 3300037471 Bacteria 2004
2172 Ga0395905_0179211 3300037471 Bacteria 1989
2173 Ga0395905_0284640 3300037471 Bacteria 1540
2174 Ga0395905_0373398 3300037471 Bacteria 1319
2175 Ga0316581_0019722 3300037588 Bacteria 1969
2176 Ga0395901_0000097 3300038443 Bacteria 118528
2177 Ga0395901_0001818 3300038443 Bacteria 22045
2178 Ga0395901_0003510 3300038443 Bacteria 15795
2179 Ga0395901_0014164 3300038443 Bacteria 8120
2180 Ga0395901_0043096 3300038443 Bacteria 4681
2181 Ga0395901_0091963 3300038443 Bacteria 3175
2182 Ga0395901_0189258 3300038443 Bacteria 2158
2183 Ga0395901_0264060 3300038443 Bacteria 1791
2184 Ga0395901_0403822 3300038443 Bacteria 1403
2185 Ga0395901_0505709 3300038443 Bacteria 1229
2186 Ga0400484_14929 3300038725 Bacteria 3157
2187 Ga0400490_03747 3300038726 Bacteria 9903
2188 Ga0400490_09917 3300038726 Bacteria 3459
2189 Ga0400490_46903 3300038726 Bacteria 6492
2190 Ga0400485_13276 3300038735 Bacteria 5960
2191 Ga0400488_07133 3300038741 Bacteria 1413
2192 Ga0400488_29469 3300038741 Bacteria 1940
2193 Ga0400486_00114 3300038742 Bacteria 11672
2194 Ga0400483_048159 3300039062 Bacteria 2078
2195 Ga0400483_127586 3300039062 Bacteria 26735
2196 Ga0400483_189073 3300039062 Bacteria 1447
2197 Ga0400483_289455 3300039062 Bacteria 2561
2198 Ga0400489_12713 3300039093 Bacteria 13861
2199 Ga0400489_95529 3300039093 Bacteria 1419
2200 Ga0436365_0404975 3300039437 Bacteria 180420
2201 Ga0436361_0146317 3300039447 Bacteria 92155
2202 Ga0436361_0173123 3300039447 Bacteria 12524
2203 Ga0436361_0281261 3300039447 Bacteria 1141
2204 Ga0436361_0296829 3300039447 Bacteria 16250
2205 Ga0436361_0441147 3300039447 Bacteria 2099
2206 Ga0436361_0661766 3300039447 Bacteria 37529
2207 Ga0436361_0734651 3300039447 Bacteria 3204
2208 Ga0436361_0756923 3300039447 Bacteria 5967
2209 Ga0436361_0890508 3300039447 Bacteria 3090
2210 Ga0436361_0946536 3300039447 Bacteria 2846
2211 Ga0436361_0969208 3300039447 Bacteria 5646
2212 Ga0436361_1083165 3300039447 Bacteria 3553
2213 Ga0436361_1096778 3300039447 Bacteria 1838
2214 Ga0436361_1167030 3300039447 Bacteria 25768
2215 Ga0436362_0660519 3300039453 Bacteria 832172
2216 Ga0439453_0004089 3300041408 Bacteria 2148
2217 Ga0439465_0023617 3300041413 Bacteria 1935
2218 Ga0451791_0481874 3300041451 Bacteria 1546
2219 Ga0451793_1161440 3300041452 Bacteria 1261
2220 Ga0451849_0605010 3300041505 Bacteria 1292
2221 Ga0451851_0519729 3300041507 Bacteria 1533
2222 Ga0451843_0571383 3300041509 Bacteria 1182
2223 Ga0439431_0003184 3300041997 Bacteria 3609
2224 Ga0439433_0011201 3300041999 Bacteria 1962
2225 Ga0439441_003375 3300042001 Bacteria 2351
2226 Ga0439443_006665 3300042003 Bacteria 1586
2227 Ga0439449_0001807 3300042007 Bacteria 8416
2228 Ga0439449_0008496 3300042007 Bacteria 3901
2229 Ga0439452_001623 3300042010 Bacteria 8879
2230 Ga0439462_0005201 3300042015 Bacteria 3199
2231 Ga0450911_000104 3300042115 Bacteria 34662
2232 Ga0450923_003900 3300042125 Bacteria 2298
2233 Ga0450888_001051 3300042126 Bacteria 2610
2234 Ga0450890_003073 3300042127 Bacteria 2237
2235 Ga0450892_002332 3300042130 Bacteria 1626
2236 Ga0450896_014734 3300042133 Bacteria 1117
2237 Ga0439446_0001571 3300042156 Bacteria 5247
2238 Ga0439434_0002090 3300042435 Bacteria 5777
2239 Ga0439435_0038494 3300042436 Bacteria 1329
2240 Ga0439459_0001175 3300042438 Bacteria 3808
2241 Ga0439460_0000057 3300042461 Bacteria 16332
2242 Ga0450918_000335 3300042531 Bacteria 10515
2243 Ga0450918_000642 3300042531 Bacteria 7483
2244 Ga0450893_0009149 3300042532 Bacteria 1617
2245 Ga0451577_0000095 3300042876 Bacteria 196116
2246 Ga0451577_0000674 3300042876 Bacteria 53771
2247 Ga0451577_0003463 3300042876 Bacteria 17556
2248 Ga0451577_0007678 3300042876 Bacteria 10580
2249 Ga0451577_0011955 3300042876 Bacteria 8179
2250 Ga0451577_0021208 3300042876 Bacteria 5948
2251 Ga0451577_0022629 3300042876 Bacteria 5739
2252 Ga0451577_0040840 3300042876 Bacteria 4165
2253 Ga0451577_0054789 3300042876 Bacteria 3559
2254 Ga0451577_0059759 3300042876 Bacteria 3398
2255 Ga0451577_0068518 3300042876 Bacteria 3164
2256 Ga0451577_0072030 3300042876 Bacteria 3082
2257 Ga0451577_0170400 3300042876 Bacteria 1962
2258 Ga0451577_0200401 3300042876 Bacteria 1802
2259 Ga0466969_0038812 3300044656 Bacteria 2394
2260 Ga0466972_0000041 3300044658 Bacteria 132242
2261 Ga0466972_0002562 3300044658 Bacteria 8999
2262 Ga0466972_0034246 3300044658 Bacteria 2489
2263 Ga0466972_0044311 3300044658 Bacteria 2158
2264 Ga0466972_0065985 3300044658 Bacteria 1730
2265 Ga0466977_0003177 3300044666 Bacteria 7862
2266 Ga0453683_0027171 3300044673 Bacteria 3632
2267 Ga0453683_0184879 3300044673 Bacteria 1322
2268 Ga0453683_0207373 3300044673 Bacteria 1245
2269 Ga0466965_0000352 3300044683 Bacteria 15560
2270 Ga0466965_0009694 3300044683 Bacteria 4476
2271 Ga0466965_0114424 3300044683 Bacteria 1389
2272 Ga0466965_0121561 3300044683 Bacteria 1349
2273 Ga0466966_0012989 3300044684 Bacteria 5514
2274 Ga0466966_0015864 3300044684 Bacteria 4979
2275 Ga0466966_0020803 3300044684 Bacteria 4313
2276 Ga0466966_0046312 3300044684 Bacteria 2777
2277 Ga0466966_0091085 3300044684 Bacteria 1893
2278 Ga0466961_0005511 3300044693 Bacteria 7984
2279 Ga0466961_0020504 3300044693 Bacteria 4254
2280 Ga0466963_0010367 3300044694 Bacteria 5639
2281 Ga0466963_0026888 3300044694 Bacteria 3681
2282 Ga0466964_0001842 3300044706 Bacteria 7378
2283 Ga0466964_0002193 3300044706 Bacteria 6911
2284 Ga0453684_0000005 3300044712 Bacteria 1431632
2285 Ga0453684_0000069 3300044712 Bacteria 456439
2286 Ga0453684_0000090 3300044712 Bacteria 391614
2287 Ga0453684_0000126 3300044712 Bacteria 336395
2288 Ga0453684_0000292 3300044712 Bacteria 213050
2289 Ga0453684_0001096 3300044712 Bacteria 85305
2290 Ga0453684_0001963 3300044712 Bacteria 52889
2291 Ga0453684_0002457 3300044712 Bacteria 44934
2292 Ga0453684_0005726 3300044712 Bacteria 24318
2293 Ga0453684_0031613 3300044712 Bacteria 7434
2294 Ga0453684_0045729 3300044712 Bacteria 5833
2295 Ga0453684_0066551 3300044712 Bacteria 4587
2296 Ga0453684_0077064 3300044712 Bacteria 4182
2297 Ga0453684_0156086 3300044712 Bacteria 2706
2298 Ga0453684_0285066 3300044712 Bacteria 1882
2299 Ga0453684_0320134 3300044712 Bacteria 1757
2300 Ga0453684_0326064 3300044712 Bacteria 1737
2301 Ga0453684_0337331 3300044712 Bacteria 1703
2302 Ga0453684_0425567 3300044712 Bacteria 1482
2303 Ga0466971_0004933 3300044719 Bacteria 5770
2304 Ga0466968_0018845 3300044735 Bacteria 2771
2305 Ga0466970_0003655 3300044765 Bacteria 7504
2306 Ga0466970_0005441 3300044765 Bacteria 6318
2307 Ga0466970_0069726 3300044765 Bacteria 1890
2308 Ga0466957_0000007 3300044842 Bacteria 84513
2309 Ga0466957_0010652 3300044842 Bacteria 5284
2310 Ga0466959_0011860 3300045049 Bacteria 6276
2311 Ga0466959_0019625 3300045049 Bacteria 4971
2312 Ga0466959_0105782 3300045049 Bacteria 2012
2313 Ga0451576_0000490 3300045051 Bacteria 87626
2314 Ga0451576_0001091 3300045051 Bacteria 49592
2315 Ga0451576_0002387 3300045051 Bacteria 28262
2316 Ga0451576_0005477 3300045051 Bacteria 15899
2317 Ga0451576_0014782 3300045051 Bacteria 8676
2318 Ga0451576_0017345 3300045051 Bacteria 7919
2319 Ga0451576_0022121 3300045051 Bacteria 6898
2320 Ga0451576_0095994 3300045051 Bacteria 3083
2321 Ga0451576_0096897 3300045051 Bacteria 3068
2322 Ga0451576_0100244 3300045051 Bacteria 3012
2323 Ga0451576_0139481 3300045051 Bacteria 2529
2324 Ga0451576_0144562 3300045051 Bacteria 2480
2325 Ga0451576_0165298 3300045051 Bacteria 2309
2326 Ga0451576_0218664 3300045051 Bacteria 1989
2327 Ga0451576_0260055 3300045051 Bacteria 1814
2328 Ga0451576_0463260 3300045051 Bacteria 1331
2329 Ga0451576_0607205 3300045051 Bacteria 1150
2330 Ga0466958_0018132 3300045836 Bacteria 4079
2331 Ga0466967_0027465 3300045976 Bacteria 4735
2332 Ga0466967_0458257 3300045976 Bacteria 1247
2333 Ga0495617_000009 3300046452 Bacteria 312936
2334 Ga0495617_000021 3300046452 Bacteria 215885
2335 Ga0495617_001664 3300046452 Bacteria 9551
2336 Ga0495627_000008 3300046453 Bacteria 572150
2337 Ga0495627_000119 3300046453 Bacteria 99048
2338 Ga0495592_0000656 3300046454 Bacteria 24042
2339 Ga0495592_0004884 3300046454 Bacteria 9866
2340 Ga0495592_0005047 3300046454 Bacteria 9712
2341 Ga0495603_0023574 3300046455 Bacteria 3722
2342 Ga0495603_0065433 3300046455 Bacteria 2142
2343 Ga0495603_0102975 3300046455 Bacteria 1666
2344 Ga0495603_0122247 3300046455 Bacteria 1517
2345 Ga0495603_0235325 3300046455 Bacteria 1055
2346 Ga0495590_0000010 3300046457 Bacteria 317890
2347 Ga0495590_0000253 3300046457 Bacteria 29076
2348 Ga0495590_0001564 3300046457 Bacteria 9805
2349 Ga0495590_0002391 3300046457 Bacteria 7775
2350 Ga0495590_0004432 3300046457 Bacteria 5667
2351 Ga0495590_0016892 3300046457 Bacteria 2633
2352 Ga0495591_000043 3300046458 Bacteria 148885
2353 Ga0495591_001067 3300046458 Bacteria 18415
2354 Ga0495629_0000005 3300046459 Bacteria 404868
2355 Ga0495629_0001122 3300046459 Bacteria 21224
2356 Ga0495629_0001555 3300046459 Bacteria 18025
2357 Ga0495629_0005595 3300046459 Bacteria 9382
2358 Ga0495629_0011926 3300046459 Bacteria 6302
2359 Ga0495629_0031532 3300046459 Bacteria 3752
2360 Ga0495641_0023762 3300046461 Bacteria 3038
2361 Ga0495641_0029948 3300046461 Bacteria 2617
2362 Ga0495651_0000273 3300046462 Bacteria 40134
2363 Ga0495651_0014567 3300046462 Bacteria 6079
2364 Ga0495651_0081100 3300046462 Bacteria 2450
2365 Ga0495653_0000010 3300046463 Bacteria 274131
2366 Ga0495653_0001206 3300046463 Bacteria 20018
2367 Ga0495653_0017032 3300046463 Bacteria 5911
2368 Ga0495653_0068371 3300046463 Bacteria 2665
2369 Ga0495653_0069892 3300046463 Bacteria 2628
2370 Ga0495653_0078498 3300046463 Bacteria 2448
2371 Ga0495650_0000051 3300046471 Bacteria 318297
2372 Ga0495650_0000081 3300046471 Bacteria 240957
2373 Ga0495650_0000194 3300046471 Bacteria 131682
2374 Ga0495650_0000213 3300046471 Bacteria 123910
2375 Ga0495650_0000495 3300046471 Bacteria 59867
2376 Ga0495650_0006594 3300046471 Bacteria 7211
2377 Ga0495650_0007975 3300046471 Bacteria 6267
2378 Ga0495650_0021336 3300046471 Bacteria 3134
2379 Ga0495580_0000111 3300046472 Bacteria 55138
2380 Ga0495580_0003364 3300046472 Bacteria 13666
2381 Ga0495580_0013334 3300046472 Bacteria 6278
2382 Ga0495580_0048268 3300046472 Bacteria 3015
2383 Ga0495580_0058594 3300046472 Bacteria 2708
2384 Ga0495580_0070877 3300046472 Bacteria 2435
2385 Ga0495580_0112193 3300046472 Bacteria 1893
2386 Ga0495582_0007041 3300046473 Bacteria 6253
2387 Ga0495582_0009205 3300046473 Bacteria 5446
2388 Ga0495582_0149895 3300046473 Bacteria 1324
2389 Ga0495605_0000024 3300046474 Bacteria 236016
2390 Ga0495605_0000181 3300046474 Bacteria 78127
2391 Ga0495605_0000728 3300046474 Bacteria 24222
2392 Ga0495605_0002346 3300046474 Bacteria 11780
2393 Ga0495605_0009123 3300046474 Bacteria 5579
2394 Ga0495605_0040843 3300046474 Bacteria 2313
2395 Ga0495605_0048924 3300046474 Bacteria 2067
2396 Ga0495639_0000190 3300046475 Bacteria 32311
2397 Ga0495639_0003921 3300046475 Bacteria 6392
2398 Ga0495639_0019210 3300046475 Bacteria 2981
2399 Ga0495662_0015959 3300046476 Bacteria 3644
2400 Ga0495664_0001630 3300046477 Bacteria 11926
2401 Ga0495664_0020070 3300046477 Bacteria 3850
2402 Ga0495664_0054960 3300046477 Bacteria 2368
2403 Ga0495584_0000062 3300046491 Bacteria 77864
2404 Ga0495584_0004512 3300046491 Bacteria 7475
2405 Ga0495584_0007351 3300046491 Bacteria 5744
2406 Ga0495584_0037057 3300046491 Bacteria 2463
2407 Ga0495585_0000275 3300046492 Bacteria 51464
2408 Ga0495585_0000796 3300046492 Bacteria 27578
2409 Ga0495585_0014464 3300046492 Bacteria 4597
2410 Ga0495585_0048510 3300046492 Bacteria 2360
2411 Ga0495594_0007010 3300046499 Bacteria 5793
2412 Ga0495594_0108438 3300046499 Bacteria 1565
2413 Ga0495594_0126787 3300046499 Bacteria 1444
2414 Ga0495596_0001969 3300046500 Bacteria 11330
2415 Ga0495596_0002616 3300046500 Bacteria 9545
2416 Ga0495596_0002916 3300046500 Bacteria 8893
2417 Ga0495596_0004316 3300046500 Bacteria 6959
2418 Ga0495596_0014151 3300046500 Bacteria 3365
2419 Ga0495596_0036601 3300046500 Bacteria 1943
2420 Ga0495596_0045878 3300046500 Bacteria 1717
2421 Ga0495607_0002337 3300046501 Bacteria 15522
2422 Ga0495607_0005632 3300046501 Bacteria 8928
2423 Ga0495607_0017979 3300046501 Bacteria 4518
2424 Ga0495583_0000006 3300046506 Bacteria 436893
2425 Ga0495583_0000045 3300046506 Bacteria 220503
2426 Ga0495583_0001184 3300046506 Bacteria 28099
2427 Ga0495583_0001186 3300046506 Bacteria 28072
2428 Ga0495583_0006961 3300046506 Bacteria 7244
2429 Ga0495606_0000014 3300046507 Bacteria 289347
2430 Ga0495606_0000034 3300046507 Bacteria 247705
2431 Ga0495606_0000111 3300046507 Bacteria 138144
2432 Ga0495606_0002129 3300046507 Bacteria 23946
2433 Ga0495606_0003632 3300046507 Bacteria 16194
2434 Ga0495606_0007000 3300046507 Bacteria 10237
2435 Ga0495606_0008283 3300046507 Bacteria 9069
2436 Ga0495606_0013398 3300046507 Bacteria 6477
2437 Ga0495606_0018077 3300046507 Bacteria 5301
2438 Ga0495606_0038736 3300046507 Bacteria 3221
2439 Ga0495606_0039803 3300046507 Bacteria 3162
2440 Ga0495608_0009972 3300046511 Bacteria 6631
2441 Ga0495608_0010013 3300046511 Bacteria 6614
2442 Ga0495608_0013655 3300046511 Bacteria 5635
2443 Ga0495608_0056949 3300046511 Bacteria 2580
2444 Ga0495610_0000010 3300046512 Bacteria 538821
2445 Ga0495610_0000039 3300046512 Bacteria 166799
2446 Ga0495610_0000103 3300046512 Bacteria 98502
2447 Ga0495610_0000809 3300046512 Bacteria 29337
2448 Ga0495610_0001322 3300046512 Bacteria 21997
2449 Ga0495610_0002487 3300046512 Bacteria 15418
2450 Ga0495610_0003388 3300046512 Bacteria 12454
2451 Ga0495610_0016627 3300046512 Bacteria 4225
2452 Ga0495610_0027901 3300046512 Bacteria 2993
2453 Ga0495616_0002264 3300046513 Bacteria 12873
2454 Ga0495616_0003155 3300046513 Bacteria 10642
2455 Ga0495616_0005227 3300046513 Bacteria 8019
2456 Ga0495616_0006622 3300046513 Bacteria 6997
2457 Ga0495616_0015058 3300046513 Bacteria 4304
2458 Ga0495616_0032035 3300046513 Bacteria 2749
2459 Ga0495618_0013126 3300046514 Bacteria 5038
2460 Ga0495618_0018749 3300046514 Bacteria 4251
2461 Ga0495618_0019154 3300046514 Bacteria 4208
2462 Ga0495618_0024550 3300046514 Bacteria 3734
2463 Ga0495620_0006244 3300046515 Bacteria 6561
2464 Ga0495620_0052750 3300046515 Bacteria 1725
2465 Ga0495628_0000218 3300046516 Bacteria 50142
2466 Ga0495628_0019472 3300046516 Bacteria 5610
2467 Ga0495628_0041838 3300046516 Bacteria 3656
2468 Ga0495628_0074301 3300046516 Bacteria 2648
2469 Ga0495628_0106809 3300046516 Bacteria 2156
2470 Ga0495630_0028523 3300046517 Bacteria 4147
2471 Ga0495630_0042493 3300046517 Bacteria 3395
2472 Ga0495630_0061102 3300046517 Bacteria 2829
2473 Ga0495630_0106572 3300046517 Bacteria 2123
2474 Ga0495631_0005890 3300046518 Bacteria 6388
2475 Ga0495631_0005928 3300046518 Bacteria 6358
2476 Ga0495631_0009824 3300046518 Bacteria 4763
2477 Ga0495631_0013828 3300046518 Bacteria 3908
2478 Ga0495631_0020256 3300046518 Bacteria 3109
2479 Ga0495632_0000035 3300046519 Bacteria 162574
2480 Ga0495632_0000073 3300046519 Bacteria 104293
2481 Ga0495632_0000161 3300046519 Bacteria 69567
2482 Ga0495632_0008045 3300046519 Bacteria 6537
2483 Ga0495632_0008849 3300046519 Bacteria 6123
2484 Ga0495632_0042229 3300046519 Bacteria 2286
2485 Ga0495632_0159568 3300046519 Bacteria 1039
2486 Ga0495637_0000009 3300046520 Bacteria 402028
2487 Ga0495637_0003958 3300046520 Bacteria 7748
2488 Ga0495637_0010473 3300046520 Bacteria 4481
2489 Ga0495643_0000171 3300046522 Bacteria 103167
2490 Ga0495643_0000299 3300046522 Bacteria 69119
2491 Ga0495643_0000856 3300046522 Bacteria 32746
2492 Ga0495643_0016276 3300046522 Bacteria 4371
2493 Ga0495643_0019763 3300046522 Bacteria 3894
2494 Ga0495643_0024502 3300046522 Bacteria 3423
2495 Ga0495643_0035096 3300046522 Bacteria 2762
2496 Ga0495643_0133827 3300046522 Bacteria 1242
2497 Ga0495644_0016601 3300046523 Bacteria 2818
2498 Ga0495644_0021387 3300046523 Bacteria 2468
2499 Ga0495644_0023675 3300046523 Bacteria 2337
2500 Ga0495644_0033176 3300046523 Bacteria 1950
2501 Ga0495648_0000110 3300046524 Bacteria 101280
2502 Ga0495648_0000475 3300046524 Bacteria 43147
2503 Ga0495648_0000659 3300046524 Bacteria 36898
2504 Ga0495648_0014650 3300046524 Bacteria 5727
2505 Ga0495648_0039181 3300046524 Bacteria 3018
2506 Ga0495648_0115321 3300046524 Bacteria 1453
2507 Ga0495666_0001245 3300046526 Bacteria 12326
2508 Ga0495666_0003154 3300046526 Bacteria 8294
2509 Ga0495666_0007051 3300046526 Bacteria 5647
2510 Ga0495666_0012819 3300046526 Bacteria 4179
2511 Ga0495666_0019753 3300046526 Bacteria 3340
2512 Ga0495666_0019792 3300046526 Bacteria 3337
2513 Ga0495666_0035367 3300046526 Bacteria 2435
2514 Ga0495642_0000125 3300046528 Bacteria 43793
2515 Ga0495642_0000257 3300046528 Bacteria 29844
2516 Ga0495642_0009095 3300046528 Bacteria 3802
2517 Ga0495642_0070860 3300046528 Bacteria 1458
2518 Ga0495652_0027469 3300046529 Bacteria 5013
2519 Ga0495652_0041947 3300046529 Bacteria 3946
2520 Ga0495652_0127813 3300046529 Bacteria 2016
2521 Ga0495652_0147434 3300046529 Bacteria 1842
2522 Ga0495652_0151364 3300046529 Bacteria 1812
2523 Ga0495652_0261084 3300046529 Bacteria 1278
2524 Ga0495654_0000002 3300046530 Bacteria 1021205
2525 Ga0495665_0007297 3300046531 Bacteria 5969
2526 Ga0495665_0009812 3300046531 Bacteria 5183
2527 Ga0495665_0024365 3300046531 Bacteria 3250
2528 Ga0495665_0025100 3300046531 Bacteria 3203
2529 Ga0495665_0095442 3300046531 Bacteria 1561
2530 Ga0495665_0104461 3300046531 Bacteria 1486
2531 Ga0495640_0002796 3300046533 Bacteria 14038
2532 Ga0495640_0048207 3300046533 Bacteria 2945
2533 Ga0495586_0000131 3300046535 Bacteria 46603
2534 Ga0495586_0000700 3300046535 Bacteria 19011
2535 Ga0495586_0001753 3300046535 Bacteria 11850
2536 Ga0495586_0001843 3300046535 Bacteria 11544
2537 Ga0495586_0014021 3300046535 Bacteria 4255
2538 Ga0495586_0124872 3300046535 Bacteria 1439
2539 Ga0495587_0022001 3300046536 Bacteria 3929
2540 Ga0495587_0029851 3300046536 Bacteria 3308
2541 Ga0495587_0127294 3300046536 Bacteria 1457
2542 Ga0495598_0058623 3300046537 Bacteria 1181
2543 Ga0495609_0000030 3300046538 Bacteria 215885
2544 Ga0495609_0000604 3300046538 Bacteria 28136
2545 Ga0495609_0002888 3300046538 Bacteria 10250
2546 Ga0495609_0003421 3300046538 Bacteria 9097
2547 Ga0495609_0005242 3300046538 Bacteria 6894
2548 Ga0495609_0006242 3300046538 Bacteria 6118
2549 Ga0495609_0035035 3300046538 Bacteria 2273
2550 Ga0495609_0049638 3300046538 Bacteria 1872
2551 Ga0495621_0000296 3300046539 Bacteria 11950
2552 Ga0495597_0000071 3300046542 Bacteria 88148
2553 Ga0495597_0000324 3300046542 Bacteria 43211
2554 Ga0495597_0000769 3300046542 Bacteria 25353
2555 Ga0495597_0001261 3300046542 Bacteria 18704
2556 Ga0495597_0010865 3300046542 Bacteria 4431
2557 Ga0495597_0119417 3300046542 Bacteria 1100
2558 Ga0495645_0007321 3300046543 Bacteria 7675
2559 Ga0495645_0062660 3300046543 Bacteria 2693
2560 Ga0495645_0106476 3300046543 Bacteria 1988
2561 Ga0495645_0107293 3300046543 Bacteria 1980
2562 Ga0495645_0117467 3300046543 Bacteria 1876
2563 Ga0495622_0000012 3300046557 Bacteria 189011
2564 Ga0495622_0000384 3300046557 Bacteria 30402
2565 Ga0495622_0010884 3300046557 Bacteria 4196
2566 Ga0495622_0023124 3300046557 Bacteria 2897
2567 Ga0495622_0031961 3300046557 Bacteria 2458
2568 Ga0495622_0099965 3300046557 Bacteria 1330
2569 Ga0495633_0000124 3300046558 Bacteria 104617
2570 Ga0495633_0019527 3300046558 Bacteria 3427
2571 Ga0495633_0040410 3300046558 Bacteria 2222
2572 Ga0495667_0001556 3300046559 Bacteria 15231
2573 Ga0495667_0107461 3300046559 Bacteria 1803
2574 Ga0495656_0000514 3300046615 Bacteria 12644
2575 Ga0495656_0072828 3300046615 Bacteria 1530
2576 Ga0495668_0000038 3300046616 Bacteria 232122
2577 Ga0495668_0000071 3300046616 Bacteria 168801
2578 Ga0495668_0001401 3300046616 Bacteria 23472
2579 Ga0495668_0001962 3300046616 Bacteria 18142
2580 Ga0495668_0028279 3300046616 Bacteria 3171
2581 Ga0495668_0048214 3300046616 Bacteria 2363
2582 Ga0495634_0003011 3300046642 Bacteria 13716
2583 Ga0495634_0008971 3300046642 Bacteria 7403
2584 Ga0495634_0019668 3300046642 Bacteria 4795
2585 Ga0495611_0000631 3300046648 Bacteria 20289
2586 Ga0495611_0008179 3300046648 Bacteria 4436
2587 Ga0495611_0013165 3300046648 Bacteria 3518
2588 Ga0495625_0000591 3300046660 Bacteria 52756
2589 Ga0495625_0002026 3300046660 Bacteria 22822
2590 Ga0495625_0004448 3300046660 Bacteria 13248
2591 Ga0495625_0031215 3300046660 Bacteria 3965
2592 Ga0495625_0048907 3300046660 Bacteria 3041
2593 Ga0495625_0075196 3300046660 Bacteria 2364
2594 Ga0495625_0115707 3300046660 Bacteria 1830
2595 Ga0495625_0184733 3300046660 Bacteria 1384
2596 Ga0495635_0001560 3300046663 Bacteria 15374
2597 Ga0495635_0005083 3300046663 Bacteria 9145
2598 Ga0495635_0020749 3300046663 Bacteria 4577
2599 Ga0495635_0081050 3300046663 Bacteria 2221
2600 Ga0495659_0067574 3300046664 Bacteria 1333
2601 Ga0495659_0080610 3300046664 Bacteria 1235
2602 Ga0495661_0001856 3300046665 Bacteria 16872
2603 Ga0495661_0002670 3300046665 Bacteria 13646
2604 Ga0495661_0006672 3300046665 Bacteria 8100
2605 Ga0495661_0014830 3300046665 Bacteria 5212
2606 Ga0495661_0036989 3300046665 Bacteria 3050
2607 Ga0495661_0041799 3300046665 Bacteria 2832
2608 Ga0495661_0049902 3300046665 Bacteria 2535
2609 Ga0495661_0083941 3300046665 Bacteria 1829
2610 Ga0495661_0086591 3300046665 Bacteria 1792
2611 Ga0495588_0000062 3300046674 Bacteria 253674
2612 Ga0495588_0004211 3300046674 Bacteria 6346
2613 Ga0495588_0013634 3300046674 Bacteria 3874
2614 Ga0495588_0028336 3300046674 Bacteria 2802
2615 Ga0495588_0032627 3300046674 Bacteria 2625
2616 Ga0495588_0063601 3300046674 Bacteria 1913
2617 Ga0495588_0075438 3300046674 Bacteria 1756
2618 Ga0495657_0229588 3300046675 Bacteria 1123
2619 Ga0495599_0017717 3300046678 Bacteria 4431
2620 Ga0495599_0056256 3300046678 Bacteria 2462
2621 Ga0495599_0072766 3300046678 Bacteria 2145
2622 Ga0495623_0015754 3300046679 Bacteria 4885
2623 Ga0495623_0028982 3300046679 Bacteria 3563
2624 Ga0495623_0037516 3300046679 Bacteria 3100
2625 Ga0495646_0049962 3300046680 Bacteria 2536
2626 Ga0495646_0079511 3300046680 Bacteria 1914
2627 Ga0495647_0000547 3300046681 Bacteria 11044
2628 Ga0495647_0005874 3300046681 Bacteria 4039
2629 Ga0495647_0033098 3300046681 Bacteria 1930
2630 Ga0495647_0085994 3300046681 Bacteria 1282
2631 Ga0495658_0003785 3300046683 Bacteria 7489
2632 Ga0495658_0054498 3300046683 Bacteria 2275
2633 Ga0495658_0070020 3300046683 Bacteria 2034
2634 Ga0495669_0000035 3300046684 Bacteria 96159
2635 Ga0495669_0005776 3300046684 Bacteria 5159
2636 Ga0495669_0076282 3300046684 Bacteria 1534
2637 Ga0495613_0015729 3300046689 Bacteria 5631
2638 Ga0495613_0077604 3300046689 Bacteria 2416
2639 Ga0495613_0082304 3300046689 Bacteria 2338
2640 Ga0495624_0004640 3300046690 Bacteria 10008
2641 Ga0495624_0008526 3300046690 Bacteria 7140
2642 Ga0495624_0019396 3300046690 Bacteria 4540
2643 Ga0495624_0032633 3300046690 Bacteria 3376
2644 Ga0495624_0042322 3300046690 Bacteria 2910
2645 Ga0495624_0048959 3300046690 Bacteria 2681
2646 Ga0495624_0095750 3300046690 Bacteria 1829
2647 Ga0495624_0105787 3300046690 Bacteria 1731
2648 Ga0495670_0036879 3300046691 Bacteria 2436
2649 Ga0495670_0078915 3300046691 Bacteria 1675
2650 Ga0495670_0092271 3300046691 Bacteria 1551
2651 Ga0495671_0000002 3300046692 Bacteria 1136189
2652 Ga0495671_0001207 3300046692 Bacteria 17694
2653 Ga0495671_0001549 3300046692 Bacteria 15283
2654 Ga0495671_0002436 3300046692 Bacteria 11750
2655 Ga0495671_0004296 3300046692 Bacteria 8561
2656 Ga0495671_0008259 3300046692 Bacteria 5868
2657 Ga0495671_0018768 3300046692 Bacteria 3666
2658 Ga0495649_0000014 3300046694 Bacteria 287408
2659 Ga0495649_0000028 3300046694 Bacteria 163229
2660 Ga0495649_0005369 3300046694 Bacteria 8164
2661 Ga0495649_0007581 3300046694 Bacteria 6598
2662 Ga0495649_0022647 3300046694 Bacteria 3515
2663 Ga0495589_0000021 3300046794 Bacteria 197941
2664 Ga0495589_0016505 3300046794 Bacteria 3796
2665 Ga0495589_0017549 3300046794 Bacteria 3672
2666 Ga0495589_0084408 3300046794 Bacteria 1543
2667 Ga0495600_0001172 3300046809 Bacteria 14307
2668 Ga0495600_0006356 3300046809 Bacteria 7188
2669 Ga0495600_0007477 3300046809 Bacteria 6688
2670 Ga0495600_0012320 3300046809 Bacteria 5345
2671 Ga0495600_0037042 3300046809 Bacteria 3170
2672 Ga0495660_0000077 3300046810 Bacteria 105543
2673 Ga0495660_0001496 3300046810 Bacteria 15805
2674 Ga0495660_0025317 3300046810 Bacteria 3371
2675 Ga0495660_0027196 3300046810 Bacteria 3237
2676 Ga0495660_0074684 3300046810 Bacteria 1790
2677 Ga0495581_0037073 3300047315 Bacteria 2821
2678 Ga0495581_0041545 3300047315 Bacteria 2661
2679 Ga0495581_0043641 3300047315 Bacteria 2593
2680 Ga0495604_0005207 3300047317 Bacteria 10304
2681 Ga0495604_0008096 3300047317 Bacteria 8326
2682 Ga0495604_0036357 3300047317 Bacteria 3882
2683 Ga0495604_0049532 3300047317 Bacteria 3263
2684 Ga0495636_0005697 3300047318 Bacteria 4885
2685 Ga0495636_0006488 3300047318 Bacteria 4596
2686 Ga0495636_0029847 3300047318 Bacteria 2227
2687 Ga0495674_0074170 3300047319 Bacteria 2931
2688 Ga0495674_0171598 3300047319 Bacteria 1809
2689 Ga0495674_0237369 3300047319 Bacteria 1503
2690 Ga0495674_0296630 3300047319 Bacteria 1321
2691 Ga0495672_0000055 3300047320 Bacteria 229428
2692 Ga0495672_0000116 3300047320 Bacteria 127119
2693 Ga0495672_0000191 3300047320 Bacteria 88319
2694 Ga0495672_0000344 3300047320 Bacteria 59479
2695 Ga0495672_0000367 3300047320 Bacteria 57098
2696 Ga0495672_0003998 3300047320 Bacteria 12327
2697 Ga0495672_0009131 3300047320 Bacteria 7226
2698 Ga0495676_0000017 3300047321 Bacteria 181815
2699 Ga0495676_0150528 3300047321 Bacteria 1657
2700 Ga0495676_0170058 3300047321 Bacteria 1534
2701 Ga0495680_0000809 3300047322 Bacteria 34944
2702 Ga0495680_0001614 3300047322 Bacteria 23981
2703 Ga0495680_0002481 3300047322 Bacteria 18867
2704 Ga0495680_0008190 3300047322 Bacteria 9530
2705 Ga0495680_0045496 3300047322 Bacteria 3465
2706 Ga0495680_0070192 3300047322 Bacteria 2671
2707 Ga0495680_0076236 3300047322 Bacteria 2543
2708 Ga0495683_0000243 3300047323 Bacteria 48918
2709 Ga0495683_0006420 3300047323 Bacteria 6428
2710 Ga0495683_0014520 3300047323 Bacteria 4104
2711 Ga0495683_0017929 3300047323 Bacteria 3665
2712 Ga0495683_0018880 3300047323 Bacteria 3559
2713 Ga0495683_0026823 3300047323 Bacteria 2948
2714 Ga0495687_000012 3300047443 Bacteria 391586
2715 Ga0495687_000036 3300047443 Bacteria 255427
2716 Ga0495687_000065 3300047443 Bacteria 162721
2717 Ga0495687_000086 3300047443 Bacteria 143855
2718 Ga0495687_000360 3300047443 Bacteria 57082
2719 Ga0495687_001035 3300047443 Bacteria 27615
2720 Ga0495687_001403 3300047443 Bacteria 22225
2721 Ga0495687_002326 3300047443 Bacteria 15460
2722 Ga0495687_005307 3300047443 Bacteria 8261
2723 Ga0495687_006557 3300047443 Bacteria 7100
2724 Ga0495687_009745 3300047443 Bacteria 5338
2725 Ga0495687_012748 3300047443 Bacteria 4427
2726 Ga0495687_013128 3300047443 Bacteria 4338
2727 Ga0495687_034578 3300047443 Bacteria 2282
2728 Ga0495675_0001986 3300047444 Bacteria 12215
2729 Ga0495675_0014781 3300047444 Bacteria 4935
2730 Ga0495675_0020266 3300047444 Bacteria 4227
2731 Ga0495675_0024677 3300047444 Bacteria 3834
2732 Ga0495675_0082614 3300047444 Bacteria 2022
2733 Ga0495677_0000450 3300047445 Bacteria 17523
2734 Ga0495677_0014309 3300047445 Bacteria 2889
2735 Ga0495677_0034031 3300047445 Bacteria 1858
2736 Ga0495679_000393 3300047446 Bacteria 33113
2737 Ga0495679_008067 3300047446 Bacteria 4318
2738 Ga0495679_018443 3300047446 Bacteria 2476
2739 Ga0495679_029832 3300047446 Bacteria 1775
2740 Ga0495685_000093 3300047447 Bacteria 32265
2741 Ga0495685_012652 3300047447 Bacteria 2859
2742 Ga0495685_028021 3300047447 Bacteria 1937
2743 Ga0495673_0000005 3300047469 Bacteria 943364
2744 Ga0495673_0000026 3300047469 Bacteria 476378
2745 Ga0495673_0000028 3300047469 Bacteria 473418
2746 Ga0495673_0005343 3300047469 Bacteria 7788
2747 Ga0495681_0000016 3300047470 Bacteria 181322
2748 Ga0495681_0000140 3300047470 Bacteria 60661
2749 Ga0495681_0029210 3300047470 Bacteria 2825
2750 Ga0495684_0031921 3300047471 Bacteria 4043
2751 Ga0495686_0008158 3300047472 Bacteria 7735
2752 Ga0495686_0016926 3300047472 Bacteria 4926
2753 Ga0495593_0005044 3300047673 Bacteria 7811
2754 Ga0495593_0050898 3300047673 Bacteria 2193
2755 Ga0495593_0052812 3300047673 Bacteria 2146
2756 Ga0495602_0051288 3300048088 Bacteria 3675
2757 Ga0495602_0073991 3300048088 Bacteria 2897
2758 Ga0495602_0104097 3300048088 Bacteria 2322
2759 Ga0495602_0140357 3300048088 Bacteria 1913
2760 Ga0495602_0216035 3300048088 Bacteria 1451
2761 Ga0495614_0016490 3300048089 Bacteria 3215
2762 Ga0495614_0017413 3300048089 Bacteria 3121
2763 Ga0495614_0046312 3300048089 Bacteria 1864
2764 Ga0495614_0048324 3300048089 Bacteria 1824
2765 Ga0495626_0000017 3300048091 Bacteria 231648
2766 Ga0495626_0001186 3300048091 Bacteria 21623
2767 Ga0495626_0006968 3300048091 Bacteria 6360
2768 Ga0495626_0017721 3300048091 Bacteria 3591
2769 Ga0495626_0019185 3300048091 Bacteria 3421
2770 Ga0495626_0047449 3300048091 Bacteria 1996
2771 Ga0496100_0065127 3300048903 Bacteria 2413
2772 Ga0496100_0106589 3300048903 Bacteria 1940
2773 Ga0496100_0264101 3300048903 Bacteria 1277
2774 Ga0496101_0034375 3300048904 Bacteria 3580
2775 Ga0496101_0055467 3300048904 Bacteria 2862
2776 Ga0496101_0058215 3300048904 Bacteria 2797
2777 Ga0496101_0075566 3300048904 Bacteria 2480
2778 Ga0496101_0075886 3300048904 Bacteria 2475
2779 Ga0496101_0170998 3300048904 Bacteria 1670
2780 Ga0496101_0251750 3300048904 Bacteria 1376
2781 Ga0496102_0000158 3300048905 Bacteria 91822
2782 Ga0496102_0000631 3300048905 Bacteria 35824
2783 Ga0496102_0002317 3300048905 Bacteria 16256
2784 Ga0496102_0005979 3300048905 Bacteria 10366
2785 Ga0496102_0007177 3300048905 Bacteria 9513
2786 Ga0496102_0017182 3300048905 Bacteria 6335
2787 Ga0496102_0026934 3300048905 Bacteria 5132
2788 Ga0496102_0048359 3300048905 Bacteria 3867
2789 Ga0496102_0100033 3300048905 Bacteria 2692
2790 Ga0496103_0001266 3300048906 Bacteria 17242
2791 Ga0496103_0013287 3300048906 Bacteria 4880
2792 Ga0496103_0063848 3300048906 Bacteria 2294
2793 Ga0496103_0185938 3300048906 Bacteria 1335
2794 Ga0496104_0023100 3300048907 Bacteria 5716
2795 Ga0496104_0083311 3300048907 Bacteria 3050
2796 Ga0496104_0133192 3300048907 Bacteria 2388
2797 Ga0496105_0011012 3300048908 Bacteria 7128
2798 Ga0496105_0027773 3300048908 Bacteria 4625
2799 Ga0496105_0144541 3300048908 Bacteria 1956
2800 Ga0496106_0014044 3300048909 Bacteria 5919
2801 Ga0496106_0045198 3300048909 Bacteria 3308
2802 Ga0496106_0281449 3300048909 Bacteria 1333
2803 Ga0496106_0289664 3300048909 Bacteria 1313
2804 Ga0496107_0009678 3300048910 Bacteria 6681
2805 Ga0496107_0052676 3300048910 Bacteria 2935
2806 Ga0496107_0092610 3300048910 Bacteria 2210
2807 Ga0496108_0058208 3300048911 Bacteria 3247
2808 Ga0496108_0058546 3300048911 Bacteria 3239
2809 Ga0496108_0072308 3300048911 Bacteria 2911
2810 Ga0496108_0085441 3300048911 Bacteria 2678
2811 Ga0496108_0088391 3300048911 Bacteria 2633
2812 Ga0496108_0183745 3300048911 Bacteria 1811
2813 Ga0496108_0242070 3300048911 Bacteria 1569
2814 Ga0496109_0013548 3300048912 Bacteria 7079
2815 Ga0496109_0047779 3300048912 Bacteria 3892
2816 Ga0496109_0058772 3300048912 Bacteria 3512
2817 Ga0496109_0241515 3300048912 Bacteria 1700
2818 Ga0496109_0255946 3300048912 Bacteria 1649
2819 Ga0496109_0307276 3300048912 Bacteria 1496
2820 Ga0496110_0026087 3300048913 Bacteria 4996
2821 Ga0496110_0033052 3300048913 Bacteria 4472
2822 Ga0496110_0076977 3300048913 Bacteria 2967
2823 Ga0496110_0093526 3300048913 Bacteria 2691
2824 Ga0496110_0159930 3300048913 Bacteria 2041
2825 Ga0496110_0200922 3300048913 Bacteria 1811
2826 Ga0496112_0001019 3300048915 Bacteria 20575
2827 Ga0496112_0005630 3300048915 Bacteria 10869
2828 Ga0496112_0007712 3300048915 Bacteria 9574
2829 Ga0496112_0044166 3300048915 Bacteria 4366
2830 Ga0496112_0221475 3300048915 Bacteria 1848
2831 Ga0496112_0250665 3300048915 Bacteria 1722
2832 Ga0496112_0256883 3300048915 Bacteria 1697
2833 Ga0496112_0285943 3300048915 Bacteria 1595
2834 Ga0496114_0012980 3300048917 Bacteria 6676
2835 Ga0496114_0030090 3300048917 Bacteria 4465
2836 Ga0496114_0035569 3300048917 Bacteria 4113
2837 Ga0496114_0060896 3300048917 Bacteria 3156
2838 Ga0496114_0065647 3300048917 Bacteria 3041
2839 Ga0496114_0199917 3300048917 Bacteria 1750
2840 Ga0496115_0011962 3300048918 Bacteria 6519
2841 Ga0496115_0023078 3300048918 Bacteria 4827
2842 Ga0496115_0050116 3300048918 Bacteria 3344
2843 Ga0496115_0142818 3300048918 Bacteria 1975
2844 Ga0496116_0000019 3300048919 Bacteria 533227
2845 Ga0496116_0002800 3300048919 Bacteria 17915
2846 Ga0496116_0031243 3300048919 Bacteria 3816
2847 Ga0496116_0052390 3300048919 Bacteria 2704
2848 Ga0496117_0000045 3300048920 Bacteria 301047
2849 Ga0496117_0003524 3300048920 Bacteria 18117
2850 Ga0496117_0004688 3300048920 Bacteria 14850
2851 Ga0496117_0122973 3300048920 Bacteria 1590
2852 Ga0496118_0000041 3300048921 Bacteria 301047
2853 Ga0496118_0001182 3300048921 Bacteria 40316
2854 Ga0496118_0009784 3300048921 Bacteria 9611
2855 Ga0496118_0010497 3300048921 Bacteria 9168
2856 Ga0496118_0016304 3300048921 Bacteria 6822
2857 Ga0496118_0064093 3300048921 Bacteria 2699
2858 Ga0496118_0064786 3300048921 Bacteria 2679
2859 Ga0496118_0069796 3300048921 Bacteria 2542
2860 Ga0496119_0012099 3300048922 Bacteria 7049
2861 Ga0496119_0032080 3300048922 Bacteria 3507
2862 Ga0496119_0086290 3300048922 Bacteria 1794
2863 Ga0496120_0012814 3300048923 Bacteria 5681
2864 Ga0496121_0000018 3300048924 Bacteria 542045
2865 Ga0496121_0000371 3300048924 Bacteria 92354
2866 Ga0496121_0001404 3300048924 Bacteria 40784
2867 Ga0496121_0002658 3300048924 Bacteria 26800
2868 Ga0496121_0006478 3300048924 Bacteria 14510
2869 Ga0496121_0006612 3300048924 Bacteria 14299
2870 Ga0496121_0011373 3300048924 Bacteria 9893
2871 Ga0496121_0014040 3300048924 Bacteria 8549
2872 Ga0496121_0018896 3300048924 Bacteria 6917
2873 Ga0496121_0030272 3300048924 Bacteria 4974
2874 Ga0496121_0036545 3300048924 Bacteria 4376
2875 Ga0496121_0053901 3300048924 Bacteria 3365
2876 Ga0496121_0054706 3300048924 Bacteria 3332
2877 Ga0496121_0092584 3300048924 Bacteria 2356
2878 Ga0496122_0000029 3300048925 Bacteria 336396
2879 Ga0496122_0000452 3300048925 Bacteria 85514
2880 Ga0496122_0000472 3300048925 Bacteria 83803
2881 Ga0496122_0001764 3300048925 Bacteria 33192
2882 Ga0496122_0029842 3300048925 Bacteria 4586
2883 Ga0496122_0038955 3300048925 Bacteria 3797
2884 Ga0496122_0049391 3300048925 Bacteria 3223
2885 Ga0496123_0000314 3300048926 Bacteria 92927
2886 Ga0496123_0000361 3300048926 Bacteria 85609
2887 Ga0496123_0000531 3300048926 Bacteria 65624
2888 Ga0496123_0029319 3300048926 Bacteria 4054
2889 Ga0496123_0039550 3300048926 Bacteria 3297
2890 Ga0496124_0000024 3300048927 Bacteria 414291
2891 Ga0496124_0019170 3300048927 Bacteria 6381
2892 Ga0496124_0020600 3300048927 Bacteria 6088
2893 Ga0496124_0062060 3300048927 Bacteria 3129
2894 Ga0496124_0112898 3300048927 Bacteria 2184
2895 Ga0496124_0156094 3300048927 Bacteria 1784
2896 Ga0496124_0296487 3300048927 Bacteria 1170
2897 Ga0496125_0000244 3300048928 Bacteria 111663
2898 Ga0496125_0000621 3300048928 Bacteria 59634
2899 Ga0496125_0001476 3300048928 Bacteria 33987
2900 Ga0496125_0002948 3300048928 Bacteria 21405
2901 Ga0496125_0009804 3300048928 Bacteria 9761
2902 Ga0496125_0010345 3300048928 Bacteria 9437
2903 Ga0496125_0042420 3300048928 Bacteria 3875
2904 Ga0496126_0002625 3300048929 Bacteria 23910
2905 Ga0496126_0009820 3300048929 Bacteria 10132
2906 Ga0496126_0014290 3300048929 Bacteria 8031
2907 Ga0496126_0039369 3300048929 Bacteria 4387
2908 Ga0496126_0047837 3300048929 Bacteria 3914
2909 Ga0496126_0112348 3300048929 Bacteria 2372
2910 Ga0496126_0119065 3300048929 Bacteria 2292
2911 Ga0501308_000070 3300049128 Bacteria 4323
2912 Ga0501309_005253 3300049129 Bacteria 1537
2913 Ga0495678_000006 3300049459 Bacteria 463690
2914 Ga0495678_000025 3300049459 Bacteria 227891
2915 Ga0495678_000041 3300049459 Bacteria 185715
2916 Ga0495678_000103 3300049459 Bacteria 103891
2917 Ga0495678_006359 3300049459 Bacteria 6298
2918 Ga0495678_018449 3300049459 Bacteria 3136
2919 Ga0495682_0000822 3300049460 Bacteria 19491
2920 Ga0495682_0054612 3300049460 Bacteria 1449
2921 Ga0501299_007651 3300049522 Bacteria 1732
2922 Ga0501031_0008786 3300049568 Bacteria 6570
2923 Ga0501031_0014904 3300049568 Bacteria 5051
2924 Ga0501031_0027229 3300049568 Bacteria 3728
2925 Ga0501031_0045755 3300049568 Bacteria 2855
2926 Ga0501032_0005202 3300049569 Bacteria 9686
2927 Ga0501032_0059634 3300049569 Bacteria 2561
2928 Ga0501033_0003205 3300049570 Bacteria 13541
2929 Ga0501033_0010587 3300049570 Bacteria 7071
2930 Ga0501033_0035348 3300049570 Bacteria 3746
2931 Ga0501034_0000379 3300049571 Bacteria 75837
2932 Ga0501034_0151733 3300049571 Bacteria 2292
2933 Ga0501034_0203588 3300049571 Bacteria 1936
2934 Ga0501036_0000101 3300049572 Bacteria 53813
2935 Ga0501036_0001842 3300049572 Bacteria 16449
2936 Ga0501036_0046990 3300049572 Bacteria 3655
2937 Ga0501036_0265984 3300049572 Bacteria 1436
2938 Ga0501037_0002756 3300049573 Bacteria 12710
2939 Ga0501037_0010675 3300049573 Bacteria 6750
2940 Ga0501037_0019239 3300049573 Bacteria 5033
2941 Ga0501037_0045331 3300049573 Bacteria 3228
2942 Ga0501038_0000828 3300049574 Bacteria 27543
2943 Ga0501038_0006845 3300049574 Bacteria 10531
2944 Ga0501038_0007423 3300049574 Bacteria 10115
2945 Ga0501038_0060857 3300049574 Bacteria 3231
2946 Ga0501039_0000117 3300049575 Bacteria 54402
2947 Ga0501039_0002674 3300049575 Bacteria 13295
2948 Ga0501039_0006011 3300049575 Bacteria 9208
2949 Ga0501039_0082325 3300049575 Bacteria 2506
2950 Ga0501039_0083988 3300049575 Bacteria 2480
2951 Ga0501040_0001365 3300049576 Bacteria 15415
2952 Ga0501040_0009800 3300049576 Bacteria 6253
2953 Ga0501040_0033745 3300049576 Bacteria 3469
2954 Ga0501041_0000892 3300049577 Bacteria 16157
2955 Ga0501041_0000991 3300049577 Bacteria 15517
2956 Ga0501041_0016391 3300049577 Bacteria 4404
2957 Ga0501041_0062356 3300049577 Bacteria 2282
2958 Ga0501041_0093134 3300049577 Bacteria 1861
2959 Ga0501041_0107539 3300049577 Bacteria 1729
2960 Ga0501041_0135803 3300049577 Bacteria 1532
2961 Ga0501042_0001081 3300049578 Bacteria 15620
2962 Ga0501042_0005173 3300049578 Bacteria 8384
2963 Ga0501042_0018221 3300049578 Bacteria 4859
2964 Ga0501043_0000010 3300049579 Bacteria 206374
2965 Ga0501043_0003611 3300049579 Bacteria 12707
2966 Ga0501043_0019175 3300049579 Bacteria 5370
2967 Ga0501043_0410583 3300049579 Bacteria 1022
2968 Ga0501046_0000097 3300049580 Bacteria 93650
2969 Ga0501046_0000705 3300049580 Bacteria 32282
2970 Ga0501046_0004458 3300049580 Bacteria 12702
2971 Ga0501046_0005527 3300049580 Bacteria 11288
2972 Ga0501046_0029371 3300049580 Bacteria 4469
2973 Ga0501046_0120908 3300049580 Bacteria 1992
2974 Ga0501047_0000026 3300049581 Bacteria 225296
2975 Ga0501047_0003174 3300049581 Bacteria 15578
2976 Ga0501047_0012421 3300049581 Bacteria 8061
2977 Ga0501047_0045467 3300049581 Bacteria 4246
2978 Ga0501047_0066881 3300049581 Bacteria 3464
2979 Ga0501047_0072459 3300049581 Bacteria 3316
2980 Ga0501048_0000707 3300049582 Bacteria 24361
2981 Ga0501048_0000742 3300049582 Bacteria 23883
2982 Ga0501048_0043514 3300049582 Bacteria 3214
2983 Ga0501068_0004998 3300049584 Bacteria 7220
2984 Ga0501068_0005644 3300049584 Bacteria 6854
2985 Ga0501069_0008846 3300049585 Bacteria 5306
2986 Ga0501069_0038265 3300049585 Bacteria 2648
2987 Ga0501070_0011990 3300049586 Bacteria 7315
2988 Ga0501070_0023977 3300049586 Bacteria 5115
2989 Ga0501071_0000133 3300049587 Bacteria 30216
2990 Ga0501071_0000230 3300049587 Bacteria 25516
2991 Ga0501071_0010254 3300049587 Bacteria 6272
2992 Ga0501071_0285246 3300049587 Bacteria 1250
2993 Ga0501072_0000598 3300049588 Bacteria 26005
2994 Ga0501072_0002292 3300049588 Bacteria 14325
2995 Ga0501072_0002364 3300049588 Bacteria 14151
2996 Ga0501072_0010770 3300049588 Bacteria 6969
2997 Ga0501072_0041117 3300049588 Bacteria 3630
2998 Ga0501072_0053398 3300049588 Bacteria 3182
2999 Ga0501072_0289604 3300049588 Bacteria 1302
3000 Ga0501073_0052792 3300049589 Bacteria 2846
3001 Ga0501073_0226735 3300049589 Bacteria 1291
3002 Ga0501074_0005430 3300049590 Bacteria 9167
3003 Ga0501074_0013231 3300049590 Bacteria 5999
3004 Ga0501074_0026229 3300049590 Bacteria 4225
3005 Ga0501074_0044481 3300049590 Bacteria 3214
3006 Ga0501074_0064341 3300049590 Bacteria 2641
3007 Ga0501074_0072698 3300049590 Bacteria 2470
3008 Ga0501075_0000036 3300049591 Bacteria 55260
3009 Ga0501075_0000499 3300049591 Bacteria 23531
3010 Ga0501075_0009426 3300049591 Bacteria 6828
3011 Ga0501075_0010258 3300049591 Bacteria 6580
3012 Ga0501075_0013892 3300049591 Bacteria 5759
3013 Ga0501075_0021081 3300049591 Bacteria 4749
3014 Ga0501075_0057419 3300049591 Bacteria 2930
3015 Ga0501075_0091123 3300049591 Bacteria 2314
3016 Ga0501075_0091149 3300049591 Bacteria 2313
3017 Ga0501075_0213671 3300049591 Bacteria 1471
3018 Ga0501075_0298654 3300049591 Bacteria 1227
3019 Ga0501076_0000220 3300049592 Bacteria 34479
3020 Ga0501076_0000743 3300049592 Bacteria 21101
3021 Ga0501076_0008599 3300049592 Bacteria 7488
3022 Ga0501076_0052762 3300049592 Bacteria 3221
3023 Ga0501076_0080252 3300049592 Bacteria 2619
3024 Ga0501076_0267043 3300049592 Bacteria 1401
3025 Ga0501077_0002144 3300049593 Bacteria 11914
3026 Ga0501077_0003707 3300049593 Bacteria 9192
3027 Ga0501077_0010183 3300049593 Bacteria 5854
3028 Ga0501077_0043933 3300049593 Bacteria 2839
3029 Ga0501077_0060671 3300049593 Bacteria 2400
3030 Ga0501198_000030 3300049649 Bacteria 59540
3031 Ga0501209_001369 3300049656 Bacteria 3419
3032 Ga0501222_000047 3300049662 Bacteria 44574
3033 Ga0501222_001490 3300049662 Bacteria 3277
3034 Ga0501235_005191 3300049669 Bacteria 2831
3035 Ga0501221_004223 3300049704 Bacteria 2381
3036 Ga0501225_0027038 3300049705 Bacteria 1579
3037 Ga0501229_000756 3300049706 Bacteria 3649
3038 Ga0501079_0000225 3300049741 Bacteria 33701
3039 Ga0501079_0001209 3300049741 Bacteria 18083
3040 Ga0501079_0004140 3300049741 Bacteria 10739
3041 Ga0501079_0051491 3300049741 Bacteria 3179
3042 Ga0501079_0058524 3300049741 Bacteria 2973
3043 Ga0501079_0318584 3300049741 Bacteria 1217
3044 Ga0501080_0012425 3300049742 Bacteria 7806
3045 Ga0501080_0066993 3300049742 Bacteria 3340
3046 Ga0501080_0074462 3300049742 Bacteria 3158
3047 Ga0501080_0261472 3300049742 Bacteria 1577
3048 Ga0501080_0280872 3300049742 Bacteria 1514
3049 Ga0501081_0000074 3300049743 Bacteria 39073
3050 Ga0501081_0000819 3300049743 Bacteria 18368
3051 Ga0501081_0001159 3300049743 Bacteria 15958
3052 Ga0501081_0016016 3300049743 Bacteria 4951
3053 Ga0501081_0039468 3300049743 Bacteria 3230
3054 Ga0501081_0060896 3300049743 Bacteria 2616
3055 Ga0501081_0102334 3300049743 Bacteria 2026
3056 Ga0501083_0051673 3300049744 Bacteria 2764
3057 Ga0501262_001482 3300049759 Bacteria 2638
3058 Ga0501272_006528 3300049769 Bacteria 1247
3059 Ga0501280_000868 3300049776 Bacteria 6514
3060 Ga0501282_003508 3300049778 Bacteria 1691
3061 Ga0501035_0008798 3300049822 Bacteria 9403
3062 Ga0501035_0017550 3300049822 Bacteria 6604
3063 Ga0501035_0021663 3300049822 Bacteria 5910
3064 Ga0501035_0058367 3300049822 Bacteria 3439
3065 Ga0501035_0084946 3300049822 Bacteria 2791
3066 Ga0501044_0000102 3300049823 Bacteria 106408
3067 Ga0501044_0001266 3300049823 Bacteria 29863
3068 Ga0501044_0012539 3300049823 Bacteria 9181
3069 Ga0501044_0016719 3300049823 Bacteria 7875
3070 Ga0501044_0060261 3300049823 Bacteria 3886
3071 Ga0501044_0265035 3300049823 Bacteria 1656
3072 Ga0501045_0000207 3300049824 Bacteria 33746
3073 Ga0501045_0001533 3300049824 Bacteria 15394
3074 Ga0501045_0014942 3300049824 Bacteria 5508
3075 Ga0501045_0020362 3300049824 Bacteria 4738
3076 Ga0501045_0052494 3300049824 Bacteria 2977
3077 Ga0501045_0116607 3300049824 Bacteria 1982
3078 Ga0501045_0169155 3300049824 Bacteria 1628
3079 nmdc:mga03683_12249_c1 3300050489 Bacteria 3128
3080 nmdc:mga03683_15884_c1 3300050489 Bacteria 2819
3081 nmdc:mga03683_2391_c1 3300050489 Bacteria 5820
3082 nmdc:mga03n38_16173_c1 3300050490 Bacteria 2898
3083 nmdc:mga03n38_19578_c1 3300050490 Bacteria 2692
3084 nmdc:mga03n38_25725_c1 3300050490 Bacteria 2422
3085 nmdc:mga03n38_36749_c1 3300050490 Bacteria 2108
3086 nmdc:mga00v17_12911_c1 3300050491 Bacteria 4623
3087 nmdc:mga00v17_13047_c1 3300050491 Bacteria 4603
3088 nmdc:mga00v17_178689_c1 3300050491 Bacteria 1369
3089 nmdc:mga00v17_18408_c1 3300050491 Bacteria 3967
3090 nmdc:mga00v17_488_c1 3300050491 Bacteria 22242
3091 nmdc:mga0yw44_5873_c1 3300050492 Bacteria 5864
3092 nmdc:mga0yw44_8514_c1 3300050492 Bacteria 5118
3093 nmdc:mga0k408_23253_c1 3300050493 Bacteria 3495
3094 nmdc:mga0k408_232_c3 3300050493 Bacteria 13067
3095 nmdc:mga0k408_25827_c1 3300050493 Bacteria 3328
3096 nmdc:mga0k408_28029_c1 3300050493 Bacteria 3201
3097 nmdc:mga0k408_357_c1 3300050493 Bacteria 25142
3098 nmdc:mga0k408_35_c1 3300050493 Bacteria 25383
3099 nmdc:mga0k408_40041_c1 3300050493 Bacteria 2695
3100 nmdc:mga0k408_75560_c1 3300050493 Bacteria 1969
3101 nmdc:mga0k408_9569_c1 3300050493 Bacteria 5229
3102 nmdc:mga06z11_1160_c1 3300050494 Bacteria 9638
3103 nmdc:mga07m45_11917_c1 3300050496 Bacteria 4581
3104 nmdc:mga07m45_12754_c1 3300050496 Bacteria 4444
3105 nmdc:mga07m45_13610_c1 3300050496 Bacteria 4321
3106 nmdc:mga07m45_15768_c1 3300050496 Bacteria 4038
3107 nmdc:mga07m45_17986_c1 3300050496 Bacteria 3806
3108 nmdc:mga07m45_18166_c1 3300050496 Bacteria 3790
3109 nmdc:mga07m45_22527_c1 3300050496 Bacteria 3440
3110 nmdc:mga07m45_38596_c1 3300050496 Bacteria 2665
3111 nmdc:mga07m45_5320_c1 3300050496 Bacteria 6400
3112 nmdc:mga07m45_622_c1 3300050496 Bacteria 15069
3113 nmdc:mga07m45_66453_c1 3300050496 Bacteria 2049
3114 nmdc:mga07m45_746_c1 3300050496 Bacteria 13911
3115 nmdc:mga07m45_7532_c1 3300050496 Bacteria 5568
3116 nmdc:mga07m45_84_c1 3300050496 Bacteria 35438
3117 nmdc:mga05p37_112055_c1 3300050507 Bacteria 3355
3118 nmdc:mga05p37_128361_c1 3300050507 Bacteria 3113
3119 nmdc:mga05p37_26966_c1 3300050507 Bacteria 6990
3120 nmdc:mga05p37_288723_c1 3300050507 Bacteria 1953
3121 nmdc:mga05p37_40379_c1 3300050507 Bacteria 5730
3122 nmdc:mga05p37_5534_c1 3300050507 Bacteria 14836
3123 nmdc:mga05p37_976_c1 3300050507 Bacteria 32490
3124 nmdc:mga09592_15280_c1 3300050508 Bacteria 6270
3125 nmdc:mga09592_2360_c1 3300050508 Bacteria 15225
3126 nmdc:mga09592_330105_c1 3300050508 Bacteria 1321
3127 nmdc:mga09592_347287_c1 3300050508 Bacteria 1284
3128 nmdc:mga09592_355_c1 3300050508 Bacteria 33629
3129 nmdc:mga09592_97619_c1 3300050508 Bacteria 2514
3130 nmdc:mga0qj67_21538_c1 3300050509 Bacteria 4945
3131 nmdc:mga0qj67_49054_c1 3300050509 Bacteria 3337
3132 nmdc:mga06r32_210229_c1 3300050510 Bacteria 1933
3133 nmdc:mga06r32_2480_c1 3300050510 Bacteria 16511
3134 nmdc:mga06r32_321665_c1 3300050510 Bacteria 1532
3135 nmdc:mga06r32_345400_c1 3300050510 Bacteria 1473
3136 nmdc:mga06r32_42448_c1 3300050510 Bacteria 4324
3137 nmdc:mga08y16_126727_c1 3300050511 Bacteria 2655
3138 nmdc:mga08y16_14108_c1 3300050511 Bacteria 8412
3139 nmdc:mga08y16_26970_c1 3300050511 Bacteria 6055
3140 nmdc:mga08y16_2934_c1 3300050511 Bacteria 17562
3141 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
3142 nmdc:mga08y16_6044_c1 3300050511 Bacteria 12688
3143 nmdc:mga08y16_6783_c1 3300050511 Bacteria 12013
3144 nmdc:mga08y16_693511_c1 3300050511 Bacteria 1019
3145 nmdc:mga0n895_109231_c1 3300050512 Bacteria 2781
3146 nmdc:mga0n895_159920_c1 3300050512 Bacteria 2284
3147 nmdc:mga0n895_20303_c1 3300050512 Bacteria 6193
3148 nmdc:mga0n895_250187_c1 3300050512 Bacteria 1799
3149 nmdc:mga0n895_77214_c1 3300050512 Bacteria 3312
3150 nmdc:mga0n895_7965_c1 3300050512 Bacteria 9138
3151 nmdc:mga0rr50_10523_c1 3300050513 Bacteria 5875
3152 nmdc:mga0rr50_145798_c1 3300050513 Bacteria 1909
3153 nmdc:mga0rr50_16290_c1 3300050513 Bacteria 4932
3154 nmdc:mga0rr50_280891_c1 3300050513 Bacteria 1389
3155 nmdc:mga0rr50_29350_c1 3300050513 Bacteria 3878
3156 nmdc:mga0rr50_37_c1 3300050513 Bacteria 87211
3157 nmdc:mga0rr50_62726_c1 3300050513 Bacteria 2805
3158 nmdc:mga0rr50_8812_c1 3300050513 Bacteria 6296
3159 nmdc:mga08x19_12070_c1 3300050514 Bacteria 5198
3160 nmdc:mga08x19_144_c1 3300050514 Bacteria 61986
3161 nmdc:mga08x19_2253_c1 3300050514 Bacteria 11759
3162 nmdc:mga08x19_4045_c1 3300050514 Bacteria 8712
3163 nmdc:mga08x19_67759_c1 3300050514 Bacteria 2322
3164 nmdc:mga08x19_76895_c1 3300050514 Bacteria 2185
3165 nmdc:mga0a205_11976_c1 3300050515 Bacteria 8011
3166 nmdc:mga0a205_17810_c1 3300050515 Bacteria 6667
3167 nmdc:mga0a205_245008_c1 3300050515 Bacteria 1673
3168 nmdc:mga0a205_308371_c1 3300050515 Bacteria 1455
3169 nmdc:mga0a205_5666_c1 3300050515 Bacteria 11253
3170 Ga0495601_0018551 3300053077 Bacteria 4236
3171 Ga0495601_0275922 3300053077 Bacteria 1096
3172 Ga0495612_0013153 3300053078 Bacteria 3333
3173 Ga0500610_0153907 3300053079 Bacteria 1149
3174 Ga0495655_0035845 3300053083 Bacteria 1237
3175 Ga0495619_0059270 3300053085 Bacteria 2543
3176 Ga0500578_0000013 3300053086 Bacteria 185921
3177 Ga0500643_015502 3300053087 Bacteria 2610
3178 Ga0500646_0000131 3300053090 Bacteria 21436
3179 Ga0500646_0040544 3300053090 Bacteria 1310
3180 Ga0500651_0000078 3300053093 Bacteria 62741
3181 Ga0500651_0024815 3300053093 Bacteria 3759
3182 Ga0500651_0041150 3300053093 Bacteria 2912
3183 Ga0500556_0000152 3300053104 Bacteria 57878
3184 Ga0500556_0026669 3300053104 Bacteria 1922
3185 Ga0500591_054743 3300053115 Bacteria 1859
3186 Ga0500593_000220 3300053117 Bacteria 23613
3187 Ga0500593_018103 3300053117 Bacteria 3066
3188 Ga0500607_010153 3300053121 Bacteria 5623
3189 Ga0500607_016715 3300053121 Bacteria 4199
3190 Ga0500617_021479 3300053124 Bacteria 2840
3191 Ga0500618_000173 3300053125 Bacteria 53346
3192 Ga0500618_008389 3300053125 Bacteria 2886
3193 Ga0500618_033500 3300053125 Bacteria 1198
3194 Ga0500642_0005561 3300053130 Bacteria 4076
3195 Ga0500652_000843 3300053131 Bacteria 10140
3196 Ga0500658_0031456 3300053134 Bacteria 2075
3197 Ga0500658_0086971 3300053134 Bacteria 1345
3198 Ga0500559_0000908 3300053136 Bacteria 18870
3199 Ga0500559_0008211 3300053136 Bacteria 4590
3200 Ga0500568_0001384 3300053139 Bacteria 15707
3201 Ga0500568_0002112 3300053139 Bacteria 12003
3202 Ga0500568_0009348 3300053139 Bacteria 4664
3203 Ga0500568_0037456 3300053139 Bacteria 1967
3204 Ga0500574_000499 3300053141 Bacteria 5009
3205 Ga0500590_117920 3300053148 Bacteria 1248
3206 Ga0500600_0008786 3300053149 Bacteria 6092
3207 Ga0500604_0002636 3300053151 Bacteria 4882
3208 Ga0500616_0000032 3300053153 Bacteria 403673
3209 Ga0500616_0032165 3300053153 Bacteria 2868
3210 Ga0500619_000274 3300053154 Bacteria 10625
3211 Ga0500622_0000054 3300053156 Bacteria 144175
3212 Ga0500622_0000733 3300053156 Bacteria 28666
3213 Ga0500622_0005865 3300053156 Bacteria 7263
3214 Ga0500634_0045808 3300053161 Bacteria 2365
3215 Ga0500636_0000870 3300053177 Bacteria 16194
3216 Ga0500637_0001302 3300053178 Bacteria 10488
3217 Ga0500625_008812 3300053729 Bacteria 4478
3218 Ga0500656_002142 3300053732 Bacteria 1770
3219 Ga0501084_0001080 3300054114 Bacteria 21231
3220 Ga0501084_0002769 3300054114 Bacteria 14160
3221 Ga0501084_0005516 3300054114 Bacteria 10386
3222 Ga0501084_0029297 3300054114 Bacteria 4605
3223 Ga0501084_0248911 3300054114 Bacteria 1500
3224 Ga0587084_002207 3300059477 Bacteria 1984
3225 Ga0587084_004030 3300059477 Bacteria 1657
3226 Ga0587073_0017582 3300059492 Bacteria 1323
3227 Ga0587077_003642 3300059493 Bacteria 1956
3228 Ga0587082_010558 3300059504 Bacteria 1335
3229 Ga0587086_006549 3300059507 Bacteria 1304
3230 Ga0587088_004681 3300059508 Bacteria 1751
3231 Ga0587088_008020 3300059508 Bacteria 1481
3232 Ga0587090_001225 3300059510 Bacteria 2539
3233 Ga0587090_014355 3300059510 Bacteria 1157
3234 Ga0587091_007031 3300059511 Bacteria 1607
3235 Ga0587106_010144 3300059605 Bacteria 1214
3236 Ga0587062_005483 3300059639 Bacteria 1404
3237 Ga0587067_001390 3300059640 Bacteria 2602
3238 Ga0587068_000151 3300059641 Bacteria 4986
3239 Ga0587068_001384 3300059641 Bacteria 2702
3240 Ga0587068_022319 3300059641 Bacteria 1048
3241 Ga0587072_000324 3300059643 Bacteria 4534
3242 Ga0587072_012647 3300059643 Bacteria 1397
3243 Ga0587072_027859 3300059643 Bacteria 1040
3244 Ga0587076_004411 3300059645 Bacteria 1756
3245 Ga0587076_009932 3300059645 Bacteria 1363
3246 Ga0587105_001386 3300059651 Bacteria 1251
3247 Ga0587071_019357 3300060344 Bacteria 1231
3248 Ga0587111_0002268 3300060346 Bacteria 2529
3249 Ga0501082_0001398 3300060353 Bacteria 21254
3250 Ga0501082_0007385 3300060353 Bacteria 9485
3251 Ga0501082_0034853 3300060353 Bacteria 4338
3252 Ga0501082_0070651 3300060353 Bacteria 3006
3253 Ga0501082_0100185 3300060353 Bacteria 2506
3254 Ga0466962_0014036 3300061719 Bacteria 3858
3255 Ga0466962_0076489 3300061719 Bacteria 1599
3256 Ga0530510_0000390 3300061734 Bacteria 28529
3257 Ga0530510_0005181 3300061734 Bacteria 8997
3258 Ga0530510_0047064 3300061734 Bacteria 3116
3259 Ga0530510_0068914 3300061734 Bacteria 2567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10080606 Ga0070676_100806062 244
2 3300005564 Ga0070664_100271432 Ga0070664_1002714322 244
3 3300005340 Ga0070689_100144208 Ga0070689_1001442082 245
4 3300005353 Ga0070669_100130921 Ga0070669_1001309212 245
5 3300005354 Ga0070675_100059737 Ga0070675_1000597372 245
6 3300005438 Ga0070701_10081063 Ga0070701_100810632 245
7 3300005441 Ga0070700_100032079 Ga0070700_1000320792 245
8 3300005457 Ga0070662_100265720 Ga0070662_1002657202 245
9 3300005543 Ga0070672_100041643 Ga0070672_1000416432 245
10 3300005548 Ga0070665_100051163 Ga0070665_1000511633 245
11 3300005618 Ga0068864_100024332 Ga0068864_1000243323 245
12 3300005719 Ga0068861_100035848 Ga0068861_1000358482 245
13 3300005840 Ga0068870_10024310 Ga0068870_100243102 245
14 3300005843 Ga0068860_100069539 Ga0068860_1000695392 245
15 3300006881 Ga0068865_100080416 Ga0068865_1000804162 245
16 3300009094 Ga0111539_10073751 Ga0111539_100737512 245
17 3300013308 Ga0157375_10035914 Ga0157375_100359142 245
18 3300017792 Ga0163161_10130946 Ga0163161_101309461 245
19 3300025315 Ga0207697_10015744 Ga0207697_100157442 245
20 3300025907 Ga0207645_10003353 Ga0207645_100033538 245
21 3300025908 Ga0207643_10041127 Ga0207643_100411272 245
22 3300025926 Ga0207659_10249258 Ga0207659_102492582 245
23 3300025932 Ga0207690_10185645 Ga0207690_101856452 245
24 3300025933 Ga0207706_10014903 Ga0207706_100149032 245
25 3300025936 Ga0207670_10180485 Ga0207670_101804851 245
26 3300025938 Ga0207704_10076352 Ga0207704_100763522 245
27 3300025940 Ga0207691_10030260 Ga0207691_100302603 245
28 3300025945 Ga0207679_10235897 Ga0207679_102358972 245
29 3300026075 Ga0207708_10013226 Ga0207708_100132263 245
30 3300026089 Ga0207648_10022904 Ga0207648_100229043 245
31 3300026118 Ga0207675_100028833 Ga0207675_1000288333 245
32 3300028379 Ga0268266_10117709 Ga0268266_101177092 245
33 3300050511 nmdc:mga08y16_126727_c1 nmdc:mga08y16_126727_c1_958_1968 245
34 3300009147 Ga0114129_10003608 Ga0114129_100036088 258
35 3300050507 nmdc:mga05p37_40379_c1 nmdc:mga05p37_40379_c1_1602_2564 258
36 3300005354 Ga0070675_100019536 Ga0070675_1000195363 264
37 3300005355 Ga0070671_100018988 Ga0070671_1000189882 264
38 3300005456 Ga0070678_100345417 Ga0070678_1003454172 264
39 3300005617 Ga0068859_100106714 Ga0068859_1001067142 264
40 3300005618 Ga0068864_100010098 Ga0068864_1000100983 264
41 3300005841 Ga0068863_100064212 Ga0068863_1000642122 264
42 3300006237 Ga0097621_100336598 Ga0097621_1003365981 264
43 3300006931 Ga0097620_100106721 Ga0097620_1001067212 264
44 3300013308 Ga0157375_10054372 Ga0157375_100543722 264
45 3300014325 Ga0163163_10040350 Ga0163163_100403503 264
46 3300025926 Ga0207659_10040958 Ga0207659_100409582 264
47 3300026121 Ga0207683_10016646 Ga0207683_100166465 264
48 3300005564 Ga0070664_100003995 Ga0070664_1000039952 265
49 3300005985 Ga0081539_10000178 Ga0081539_10000178113 265
50 3300005618 Ga0068864_100118530 Ga0068864_1001185302 267
51 3300007076 Ga0075435_100139926 Ga0075435_1001399262 267
52 3300009147 Ga0114129_10001804 Ga0114129_1000180417 267
53 3300027471 Ga0209995_1012032 Ga0209995_10120321 267
54 3300027543 Ga0209999_1002271 Ga0209999_10022712 267
55 3300050512 nmdc:mga0n895_77214_c1 nmdc:mga0n895_77214_c1_542_1345 267
56 3300005345 Ga0070692_10002086 Ga0070692_100020862 269
57 3300005353 Ga0070669_100035165 Ga0070669_1000351652 269
58 3300005366 Ga0070659_100234470 Ga0070659_1002344702 269
59 3300005444 Ga0070694_100017137 Ga0070694_1000171372 269
60 3300005543 Ga0070672_100058918 Ga0070672_1000589182 269
61 3300005549 Ga0070704_100129522 Ga0070704_1001295222 269
62 3300005563 Ga0068855_100076294 Ga0068855_1000762942 269
63 3300005617 Ga0068859_100086446 Ga0068859_1000864462 269
64 3300005719 Ga0068861_100034843 Ga0068861_1000348432 269
65 3300005841 Ga0068863_100086496 Ga0068863_1000864962 269
66 3300005843 Ga0068860_100006792 Ga0068860_1000067922 269
67 3300005844 Ga0068862_100040052 Ga0068862_1000400522 269
68 3300006931 Ga0097620_100086445 Ga0097620_1000864452 269
69 3300009553 Ga0105249_10016770 Ga0105249_100167702 269
70 3300013306 Ga0163162_10094796 Ga0163162_100947962 269
71 3300014326 Ga0157380_10131977 Ga0157380_101319771 269
72 3300014968 Ga0157379_10143395 Ga0157379_101433952 269
73 3300025924 Ga0207694_10172408 Ga0207694_101724082 269
74 3300025932 Ga0207690_10161968 Ga0207690_101619682 269
75 3300025940 Ga0207691_10128172 Ga0207691_101281722 269
76 3300025949 Ga0207667_10108675 Ga0207667_101086752 269
77 3300025961 Ga0207712_10010669 Ga0207712_100106694 269
78 3300026088 Ga0207641_10063018 Ga0207641_100630182 269
79 3300026118 Ga0207675_100036321 Ga0207675_1000363212 269
80 3300028379 Ga0268266_10082673 Ga0268266_100826734 269
81 3300028380 Ga0268265_10051179 Ga0268265_100511792 269
82 3300028381 Ga0268264_10260427 Ga0268264_102604272 269
83 3300042876 Ga0451577_0068518 Ga0451577_0068518_2087_3049 269
84 3300048905 Ga0496102_0048359 Ga0496102_0048359_820_1782 269
85 3300048909 Ga0496106_0045198 Ga0496106_0045198_1307_2269 269
86 3300005347 Ga0070668_100088343 Ga0070668_1000883432 270
87 3300005353 Ga0070669_100034332 Ga0070669_1000343323 270
88 3300005356 Ga0070674_100027444 Ga0070674_1000274443 270
89 3300005459 Ga0068867_100006247 Ga0068867_1000062478 270
90 3300005844 Ga0068862_100026797 Ga0068862_1000267974 270
91 3300006195 Ga0075366_10008300 Ga0075366_100083003 270
92 3300006881 Ga0068865_100009866 Ga0068865_1000098662 270
93 3300009101 Ga0105247_10048202 Ga0105247_100482022 270
94 3300009553 Ga0105249_10048283 Ga0105249_100482832 270
95 3300014968 Ga0157379_10045458 Ga0157379_100454584 270
96 3300025923 Ga0207681_10026751 Ga0207681_100267514 270
97 3300025938 Ga0207704_10001549 Ga0207704_100015495 270
98 3300025961 Ga0207712_10010385 Ga0207712_100103853 270
99 3300026116 Ga0207674_10285298 Ga0207674_102852982 270
100 3300026118 Ga0207675_100003888 Ga0207675_10000388814 270
101 3300028380 Ga0268265_10001008 Ga0268265_1000100810 270
102 3300032005 Ga0307411_10068675 Ga0307411_100686753 270
103 3300045976 Ga0466967_0027465 Ga0466967_0027465_920_1888 270
104 3300050493 nmdc:mga0k408_232_c3 nmdc:mga0k408_232_c3_10166_11131 270
105 3300050511 nmdc:mga08y16_26970_c1 nmdc:mga08y16_26970_c1_338_1306 270
106 iso_pu_bacteria 2904541872 2904548451 270
107 iso_pu_bacteria 2929160207 2929163849 270
108 3300003320 rootH2_10002127 rootH2_1000212724 272
109 3300031665 Ga0316575_10002587 Ga0316575_100025872 272
110 3300035086 Ga0373934_0089983 Ga0373934_0089983_235_1203 272
111 3300045051 Ga0451576_0463260 Ga0451576_0463260_435_1313 272
112 3300049592 Ga0501076_0080252 Ga0501076_0080252_1515_2477 272
113 3300049741 Ga0501079_0318584 Ga0501079_0318584_156_1118 272
114 3300053115 Ga0500591_054743 Ga0500591_054743_557_1522 272
115 3300060353 Ga0501082_0100185 Ga0501082_0100185_828_1790 272
116 3300005444 Ga0070694_100012962 Ga0070694_1000129623 273
117 3300027665 Ga0209983_1003490 Ga0209983_10034901 273
118 3300027682 Ga0209971_1000257 Ga0209971_10002578 273
119 3300027717 Ga0209998_10016385 Ga0209998_100163852 273
120 3300027876 Ga0209974_10001866 Ga0209974_100018662 273
121 3300035111 Ga0373923_0030791 Ga0373923_0030791_626_1585 273
122 3300035113 Ga0373936_0040856 Ga0373936_0040856_467_1426 273
123 3300035725 Ga0373947_0009748 Ga0373947_0009748_681_1640 273
124 3300037068 Ga0373925_0040562 Ga0373925_0040562_1768_2727 273
125 3300042156 Ga0439446_0001571 Ga0439446_0001571_3360_4328 273
126 3300042435 Ga0439434_0002090 Ga0439434_0002090_1842_2810 273
127 3300042436 Ga0439435_0038494 Ga0439435_0038494_184_1152 273
128 3300045051 Ga0451576_0000490 Ga0451576_0000490_53103_54071 273
129 3300005435 Ga0070714_100047993 Ga0070714_1000479934 274
130 3300005518 Ga0070699_100168727 Ga0070699_1001687272 274
131 3300005536 Ga0070697_100001737 Ga0070697_10000173712 274
132 3300005545 Ga0070695_100003342 Ga0070695_1000033426 274
133 3300005545 Ga0070695_100016830 Ga0070695_1000168304 274
134 3300005545 Ga0070695_100142799 Ga0070695_1001427992 274
135 3300006846 Ga0075430_100001295 Ga0075430_10000129511 274
136 3300006847 Ga0075431_100004900 Ga0075431_1000049006 274
137 3300006871 Ga0075434_100280206 Ga0075434_1002802062 274
138 3300007076 Ga0075435_100025356 Ga0075435_1000253562 274
139 3300025929 Ga0207664_10024518 Ga0207664_100245186 274
140 3300025939 Ga0207665_10162827 Ga0207665_101628272 274
141 3300032002 Ga0307416_100257802 Ga0307416_1002578022 274
142 3300049588 Ga0501072_0002364 Ga0501072_0002364_3458_4423 274
143 3300049591 Ga0501075_0091149 Ga0501075_0091149_339_1304 274
144 3300049593 Ga0501077_0003707 Ga0501077_0003707_6397_7362 274
145 3300049741 Ga0501079_0058524 Ga0501079_0058524_1950_2915 274
146 3300049742 Ga0501080_0280872 Ga0501080_0280872_99_1064 274
147 3300049743 Ga0501081_0016016 Ga0501081_0016016_1221_2186 274
148 3300050509 nmdc:mga0qj67_21538_c1 nmdc:mga0qj67_21538_c1_621_1583 274
149 3300050510 nmdc:mga06r32_345400_c1 nmdc:mga06r32_345400_c1_63_1025 274
150 3300050513 nmdc:mga0rr50_29350_c1 nmdc:mga0rr50_29350_c1_2311_3279 274
151 3300050514 nmdc:mga08x19_12070_c1 nmdc:mga08x19_12070_c1_2435_3403 274
152 3300050514 nmdc:mga08x19_67759_c1 nmdc:mga08x19_67759_c1_823_1791 274
153 3300054114 Ga0501084_0005516 Ga0501084_0005516_7492_8457 274
154 3300060353 Ga0501082_0070651 Ga0501082_0070651_1444_2409 274
155 3300005356 Ga0070674_100205614 Ga0070674_1002056141 275
156 3300005445 Ga0070708_100301778 Ga0070708_1003017782 275
157 3300005457 Ga0070662_100001823 Ga0070662_1000018238 275
158 3300005617 Ga0068859_100069662 Ga0068859_1000696622 275
159 3300006931 Ga0097620_100069663 Ga0097620_1000696634 275
160 3300007076 Ga0075435_100023942 Ga0075435_1000239424 275
161 3300009093 Ga0105240_10052764 Ga0105240_100527642 275
162 3300009174 Ga0105241_10002990 Ga0105241_100029904 275
163 3300010375 Ga0105239_10166919 Ga0105239_101669192 275
164 3300013102 Ga0157371_10109351 Ga0157371_101093513 275
165 3300013105 Ga0157369_10256842 Ga0157369_102568423 275
166 3300013296 Ga0157374_10021757 Ga0157374_100217572 275
167 3300013307 Ga0157372_10025485 Ga0157372_100254855 275
168 3300025904 Ga0207647_10002696 Ga0207647_100026965 275
169 3300025911 Ga0207654_10008831 Ga0207654_100088314 275
170 3300025913 Ga0207695_10012264 Ga0207695_100122648 275
171 3300025932 Ga0207690_10028465 Ga0207690_100284653 275
172 3300025933 Ga0207706_10000246 Ga0207706_100002468 275
173 3300032002 Ga0307416_100016370 Ga0307416_1000163703 275
174 3300050513 nmdc:mga0rr50_62726_c1 nmdc:mga0rr50_62726_c1_227_1180 275
175 3300005841 Ga0068863_100337638 Ga0068863_1003376381 276
176 3300005842 Ga0068858_100017850 Ga0068858_1000178504 276
177 3300026088 Ga0207641_10124482 Ga0207641_101244822 276
178 3300032133 Ga0316583_10050272 Ga0316583_100502722 276
179 3300035085 Ga0373929_0034119 Ga0373929_0034119_69_1037 276
180 3300035090 Ga0373949_0013208 Ga0373949_0013208_628_1596 276
181 3300035112 Ga0373932_0004674 Ga0373932_0004674_507_1475 276
182 3300035116 Ga0373945_0021438 Ga0373945_0021438_155_1117 276
183 3300035170 Ga0373943_0022637 Ga0373943_0022637_421_1383 276
184 3300035171 Ga0373946_0012724 Ga0373946_0012724_1005_1967 276
185 3300035242 Ga0373962_0045809 Ga0373962_0045809_18_986 276
186 3300035691 Ga0373931_0052079 Ga0373931_0052079_204_1172 276
187 3300037068 Ga0373925_0012205 Ga0373925_0012205_4376_5338 276
188 3300041505 Ga0451849_0605010 Ga0451849_0605010_223_1176 276
189 3300042876 Ga0451577_0003463 Ga0451577_0003463_887_1819 276
190 3300042876 Ga0451577_0011955 Ga0451577_0011955_3039_4001 276
191 3300042876 Ga0451577_0040840 Ga0451577_0040840_2029_2982 276
192 3300044712 Ga0453684_0031613 Ga0453684_0031613_2177_3109 276
193 3300044712 Ga0453684_0045729 Ga0453684_0045729_312_1274 276
194 3300045051 Ga0451576_0139481 Ga0451576_0139481_558_1490 276
195 3300046455 Ga0495603_0102975 Ga0495603_0102975_404_1366 276
196 3300046459 Ga0495629_0000005 Ga0495629_0000005_127089_128051 276
197 3300046473 Ga0495582_0149895 Ga0495582_0149895_62_1024 276
198 3300046475 Ga0495639_0000190 Ga0495639_0000190_21658_22620 276
199 3300046526 Ga0495666_0001245 Ga0495666_0001245_9813_10775 276
200 3300046535 Ga0495586_0000131 Ga0495586_0000131_44357_45319 276
201 3300046535 Ga0495586_0014021 Ga0495586_0014021_2033_3001 276
202 3300046557 Ga0495622_0031961 Ga0495622_0031961_588_1550 276
203 3300046663 Ga0495635_0005083 Ga0495635_0005083_7366_8328 276
204 3300046683 Ga0495658_0070020 Ga0495658_0070020_945_1907 276
205 3300046689 Ga0495613_0082304 Ga0495613_0082304_350_1312 276
206 3300046809 Ga0495600_0037042 Ga0495600_0037042_1187_2149 276
207 3300047315 Ga0495581_0037073 Ga0495581_0037073_321_1283 276
208 3300047322 Ga0495680_0000809 Ga0495680_0000809_10688_11650 276
209 3300047471 Ga0495684_0031921 Ga0495684_0031921_873_1835 276
210 3300053085 Ga0495619_0059270 Ga0495619_0059270_124_1086 276
211 3300006914 Ga0075436_100000353 Ga0075436_10000035324 277
212 3300035112 Ga0373932_0000024 Ga0373932_0000024_40297_41241 277
213 3300044673 Ga0453683_0207373 Ga0453683_0207373_158_1096 277
214 3300049568 Ga0501031_0008786 Ga0501031_0008786_2181_3149 277
215 3300049570 Ga0501033_0003205 Ga0501033_0003205_4351_5319 277
216 3300049572 Ga0501036_0000101 Ga0501036_0000101_11964_12932 277
217 3300049573 Ga0501037_0019239 Ga0501037_0019239_4025_4993 277
218 3300049574 Ga0501038_0007423 Ga0501038_0007423_1905_2873 277
219 3300049575 Ga0501039_0000117 Ga0501039_0000117_53036_54004 277
220 3300049576 Ga0501040_0001365 Ga0501040_0001365_6606_7574 277
221 3300049577 Ga0501041_0000991 Ga0501041_0000991_7042_8010 277
222 3300049578 Ga0501042_0001081 Ga0501042_0001081_10378_11346 277
223 3300049580 Ga0501046_0000705 Ga0501046_0000705_24697_25665 277
224 3300049581 Ga0501047_0072459 Ga0501047_0072459_2025_2993 277
225 3300049582 Ga0501048_0000707 Ga0501048_0000707_7552_8520 277
226 3300049584 Ga0501068_0004998 Ga0501068_0004998_4502_5470 277
227 3300049586 Ga0501070_0023977 Ga0501070_0023977_722_1690 277
228 3300049587 Ga0501071_0000133 Ga0501071_0000133_3444_4412 277
229 3300049588 Ga0501072_0002292 Ga0501072_0002292_6246_7214 277
230 3300049589 Ga0501073_0052792 Ga0501073_0052792_979_1947 277
231 3300049590 Ga0501074_0013231 Ga0501074_0013231_2393_3361 277
232 3300049591 Ga0501075_0000036 Ga0501075_0000036_43319_44287 277
233 3300049592 Ga0501076_0000220 Ga0501076_0000220_25628_26596 277
234 3300049593 Ga0501077_0002144 Ga0501077_0002144_7126_8094 277
235 3300049741 Ga0501079_0001209 Ga0501079_0001209_4375_5343 277
236 3300049742 Ga0501080_0066993 Ga0501080_0066993_1929_2897 277
237 3300049743 Ga0501081_0000074 Ga0501081_0000074_3691_4659 277
238 3300049824 Ga0501045_0001533 Ga0501045_0001533_11102_12070 277
239 3300050514 nmdc:mga08x19_144_c1 nmdc:mga08x19_144_c1_45166_46134 277
240 3300054114 Ga0501084_0002769 Ga0501084_0002769_8707_9675 277
241 3300060353 Ga0501082_0007385 Ga0501082_0007385_1384_2352 277
242 3300061734 Ga0530510_0005181 Ga0530510_0005181_4467_5435 277
243 3300005330 Ga0070690_100001791 Ga0070690_1000017919 278
244 3300005334 Ga0068869_100003399 Ga0068869_1000033994 278
245 3300005336 Ga0070680_100006209 Ga0070680_1000062099 278
246 3300005337 Ga0070682_100045546 Ga0070682_1000455462 278
247 3300005338 Ga0068868_100000449 Ga0068868_1000004496 278
248 3300005340 Ga0070689_100005157 Ga0070689_1000051579 278
249 3300005341 Ga0070691_10004174 Ga0070691_100041748 278
250 3300005343 Ga0070687_100001173 Ga0070687_1000011739 278
251 3300005440 Ga0070705_100001344 Ga0070705_1000013442 278
252 3300005441 Ga0070700_100001732 Ga0070700_10000173210 278
253 3300005444 Ga0070694_100002752 Ga0070694_1000027529 278
254 3300005458 Ga0070681_10035133 Ga0070681_100351336 278
255 3300005459 Ga0068867_100010574 Ga0068867_1000105747 278
256 3300005530 Ga0070679_100014735 Ga0070679_1000147355 278
257 3300005543 Ga0070672_100176458 Ga0070672_1001764582 278
258 3300005544 Ga0070686_100004387 Ga0070686_1000043873 278
259 3300005545 Ga0070695_100001112 Ga0070695_10000111210 278
260 3300005546 Ga0070696_100004740 Ga0070696_1000047403 278
261 3300005547 Ga0070693_100000174 Ga0070693_10000017427 278
262 3300005549 Ga0070704_100001537 Ga0070704_1000015378 278
263 3300005563 Ga0068855_100022677 Ga0068855_1000226772 278
264 3300005578 Ga0068854_100003562 Ga0068854_1000035627 278
265 3300005614 Ga0068856_100016156 Ga0068856_1000161566 278
266 3300005615 Ga0070702_100000064 Ga0070702_1000000649 278
267 3300005617 Ga0068859_100010947 Ga0068859_1000109475 278
268 3300005718 Ga0068866_10000766 Ga0068866_100007668 278
269 3300005719 Ga0068861_100011229 Ga0068861_1000112298 278
270 3300005842 Ga0068858_100016647 Ga0068858_1000166475 278
271 3300005843 Ga0068860_100015309 Ga0068860_1000153099 278
272 3300005844 Ga0068862_100004610 Ga0068862_1000046109 278
273 3300006163 Ga0070715_10105052 Ga0070715_101050522 278
274 3300006237 Ga0097621_100003083 Ga0097621_10000308311 278
275 3300006358 Ga0068871_100007842 Ga0068871_1000078422 278
276 3300006844 Ga0075428_100003071 Ga0075428_1000030713 278
277 3300006847 Ga0075431_100010305 Ga0075431_1000103053 278
278 3300006880 Ga0075429_100005146 Ga0075429_1000051469 278
279 3300006880 Ga0075429_100010505 Ga0075429_1000105053 278
280 3300006881 Ga0068865_100000441 Ga0068865_1000004411 278
281 3300006931 Ga0097620_100010947 Ga0097620_1000109475 278
282 3300009094 Ga0111539_10038524 Ga0111539_100385244 278
283 3300009098 Ga0105245_10007522 Ga0105245_100075222 278
284 3300009147 Ga0114129_10000467 Ga0114129_1000046741 278
285 3300009147 Ga0114129_10031057 Ga0114129_100310572 278
286 3300009148 Ga0105243_10003839 Ga0105243_100038398 278
287 3300009176 Ga0105242_10000524 Ga0105242_100005248 278
288 3300009553 Ga0105249_10004718 Ga0105249_100047189 278
289 3300010375 Ga0105239_10059647 Ga0105239_100596473 278
290 3300013297 Ga0157378_10002315 Ga0157378_1000231517 278
291 3300014969 Ga0157376_10021214 Ga0157376_100212142 278
292 3300025899 Ga0207642_10000664 Ga0207642_100006647 278
293 3300025912 Ga0207707_10230975 Ga0207707_102309752 278
294 3300025918 Ga0207662_10000112 Ga0207662_100001127 278
295 3300025927 Ga0207687_10004822 Ga0207687_100048227 278
296 3300025933 Ga0207706_10434144 Ga0207706_104341441 278
297 3300025934 Ga0207686_10007513 Ga0207686_100075132 278
298 3300025935 Ga0207709_10002341 Ga0207709_100023419 278
299 3300025936 Ga0207670_10003955 Ga0207670_100039558 278
300 3300025938 Ga0207704_10001120 Ga0207704_100011209 278
301 3300025942 Ga0207689_10006788 Ga0207689_100067888 278
302 3300025961 Ga0207712_10006042 Ga0207712_100060428 278
303 3300025981 Ga0207640_10007344 Ga0207640_100073446 278
304 3300026035 Ga0207703_10003924 Ga0207703_100039245 278
305 3300026041 Ga0207639_10067819 Ga0207639_100678192 278
306 3300026075 Ga0207708_10001613 Ga0207708_100016139 278
307 3300026089 Ga0207648_10000205 Ga0207648_1000020558 278
308 3300026118 Ga0207675_100000353 Ga0207675_10000035327 278
309 3300027695 Ga0209966_1004582 Ga0209966_10045823 278
310 3300027907 Ga0207428_10003904 Ga0207428_1000390413 278
311 3300028794 Ga0307515_10060251 Ga0307515_100602512 278
312 3300035207 Ga0373942_0036693 Ga0373942_0036693_126_1094 278
313 3300050507 nmdc:mga05p37_26966_c1 nmdc:mga05p37_26966_c1_4138_5103 278
314 3300050507 nmdc:mga05p37_5534_c1 nmdc:mga05p37_5534_c1_12010_12978 278
315 3300050508 nmdc:mga09592_2360_c1 nmdc:mga09592_2360_c1_14212_15180 278
316 3300050508 nmdc:mga09592_330105_c1 nmdc:mga09592_330105_c1_305_1270 278
317 3300050511 nmdc:mga08y16_6044_c1 nmdc:mga08y16_6044_c1_1681_2649 278
318 3300005456 Ga0070678_100367754 Ga0070678_1003677542 279
319 3300005468 Ga0070707_100008628 Ga0070707_1000086282 279
320 3300005544 Ga0070686_100020649 Ga0070686_1000206492 279
321 3300006844 Ga0075428_100009028 Ga0075428_1000090287 279
322 3300006847 Ga0075431_100045218 Ga0075431_1000452182 279
323 3300009147 Ga0114129_10101165 Ga0114129_101011653 279
324 3300013297 Ga0157378_10107508 Ga0157378_101075082 279
325 3300025922 Ga0207646_10045783 Ga0207646_100457833 279
326 3300050507 nmdc:mga05p37_288723_c1 nmdc:mga05p37_288723_c1_564_1508 279
327 3300050515 nmdc:mga0a205_308371_c1 nmdc:mga0a205_308371_c1_65_952 279
328 3300005290 Ga0065712_10075254 Ga0065712_100752543 280
329 3300005327 Ga0070658_10027758 Ga0070658_100277583 280
330 3300005335 Ga0070666_10017293 Ga0070666_100172936 280
331 3300005338 Ga0068868_100062027 Ga0068868_1000620273 280
332 3300005340 Ga0070689_100026938 Ga0070689_1000269382 280
333 3300005354 Ga0070675_100120411 Ga0070675_1001204112 280
334 3300005356 Ga0070674_100173390 Ga0070674_1001733902 280
335 3300005365 Ga0070688_100035183 Ga0070688_1000351833 280
336 3300005456 Ga0070678_100031089 Ga0070678_1000310894 280
337 3300005471 Ga0070698_100138072 Ga0070698_1001380722 280
338 3300005518 Ga0070699_100642807 Ga0070699_1006428071 280
339 3300005536 Ga0070697_100059071 Ga0070697_1000590712 280
340 3300005543 Ga0070672_100040899 Ga0070672_1000408993 280
341 3300005544 Ga0070686_100044349 Ga0070686_1000443491 280
342 3300005615 Ga0070702_100006583 Ga0070702_1000065834 280
343 3300005616 Ga0068852_100164938 Ga0068852_1001649382 280
344 3300005617 Ga0068859_100138485 Ga0068859_1001384852 280
345 3300005618 Ga0068864_100175281 Ga0068864_1001752812 280
346 3300005718 Ga0068866_10034870 Ga0068866_100348702 280
347 3300005719 Ga0068861_100006869 Ga0068861_1000068693 280
348 3300005840 Ga0068870_10077522 Ga0068870_100775221 280
349 3300005841 Ga0068863_100015566 Ga0068863_1000155663 280
350 3300005842 Ga0068858_100035358 Ga0068858_1000353583 280
351 3300005842 Ga0068858_100120291 Ga0068858_1001202913 280
352 3300005843 Ga0068860_100013859 Ga0068860_1000138595 280
353 3300005844 Ga0068862_100005062 Ga0068862_1000050627 280
354 3300006237 Ga0097621_100028624 Ga0097621_1000286245 280
355 3300006358 Ga0068871_100008816 Ga0068871_1000088162 280
356 3300006931 Ga0097620_100138504 Ga0097620_1001385042 280
357 3300009101 Ga0105247_10009631 Ga0105247_100096313 280
358 3300009148 Ga0105243_10011531 Ga0105243_100115312 280
359 3300009174 Ga0105241_10249704 Ga0105241_102497041 280
360 3300009176 Ga0105242_10005056 Ga0105242_100050568 280
361 3300009177 Ga0105248_10304381 Ga0105248_103043812 280
362 3300009551 Ga0105238_10179307 Ga0105238_101793072 280
363 3300009553 Ga0105249_10046464 Ga0105249_100464642 280
364 3300011119 Ga0105246_10066681 Ga0105246_100666811 280
365 3300013296 Ga0157374_10053996 Ga0157374_100539964 280
366 3300013308 Ga0157375_10176793 Ga0157375_101767932 280
367 3300014325 Ga0163163_10144214 Ga0163163_101442142 280
368 3300014326 Ga0157380_10017365 Ga0157380_100173653 280
369 3300014745 Ga0157377_10023436 Ga0157377_100234361 280
370 3300014969 Ga0157376_10002756 Ga0157376_100027564 280
371 3300017792 Ga0163161_10141728 Ga0163161_101417281 280
372 3300025315 Ga0207697_10007431 Ga0207697_100074312 280
373 3300025899 Ga0207642_10050593 Ga0207642_100505932 280
374 3300025903 Ga0207680_10203532 Ga0207680_102035322 280
375 3300025908 Ga0207643_10033279 Ga0207643_100332792 280
376 3300025913 Ga0207695_10027990 Ga0207695_100279905 280
377 3300025914 Ga0207671_10086548 Ga0207671_100865482 280
378 3300025926 Ga0207659_10051999 Ga0207659_100519992 280
379 3300025927 Ga0207687_10021764 Ga0207687_100217642 280
380 3300025931 Ga0207644_10159119 Ga0207644_101591191 280
381 3300025934 Ga0207686_10164502 Ga0207686_101645022 280
382 3300025935 Ga0207709_10126953 Ga0207709_101269532 280
383 3300025938 Ga0207704_10017993 Ga0207704_100179932 280
384 3300025940 Ga0207691_10001701 Ga0207691_1000170115 280
385 3300025941 Ga0207711_10212454 Ga0207711_102124541 280
386 3300025942 Ga0207689_10003706 Ga0207689_100037065 280
387 3300025949 Ga0207667_10248788 Ga0207667_102487881 280
388 3300025961 Ga0207712_10010887 Ga0207712_100108875 280
389 3300026035 Ga0207703_10000663 Ga0207703_1000066326 280
390 3300026035 Ga0207703_10104433 Ga0207703_101044332 280
391 3300026067 Ga0207678_10010449 Ga0207678_100104492 280
392 3300026088 Ga0207641_10272169 Ga0207641_102721692 280
393 3300026095 Ga0207676_10183474 Ga0207676_101834742 280
394 3300026118 Ga0207675_100009842 Ga0207675_1000098425 280
395 3300026121 Ga0207683_10022573 Ga0207683_100225732 280
396 3300028380 Ga0268265_10002600 Ga0268265_100026008 280
397 3300028381 Ga0268264_10018814 Ga0268264_100188144 280
398 3300038725 Ga0400484_14929 Ga0400484_14929_1714_2670 280
399 3300038726 Ga0400490_09917 Ga0400490_09917_1513_2472 280
400 3300046615 Ga0495656_0072828 Ga0495656_0072828_173_1144 280
401 3300046664 Ga0495659_0067574 Ga0495659_0067574_87_1058 280
402 3300046684 Ga0495669_0076282 Ga0495669_0076282_554_1426 280
403 3300046691 Ga0495670_0078915 Ga0495670_0078915_493_1464 280
404 3300047443 Ga0495687_034578 Ga0495687_034578_368_1333 280
405 3300048928 Ga0496125_0001476 Ga0496125_0001476_23202_24167 280
406 3300005471 Ga0070698_100024281 Ga0070698_1000242812 281
407 3300032133 Ga0316583_10024058 Ga0316583_100240582 281
408 3300053078 Ga0495612_0013153 Ga0495612_0013153_991_1959 281
409 3300005295 Ga0065707_10110683 Ga0065707_101106832 282
410 3300005334 Ga0068869_100002260 Ga0068869_1000022603 282
411 3300005335 Ga0070666_10090535 Ga0070666_100905352 282
412 3300005337 Ga0070682_100000123 Ga0070682_1000001232 282
413 3300005340 Ga0070689_100061988 Ga0070689_1000619882 282
414 3300005353 Ga0070669_100024221 Ga0070669_1000242213 282
415 3300005355 Ga0070671_100000492 Ga0070671_10000049222 282
416 3300005355 Ga0070671_100198487 Ga0070671_1001984871 282
417 3300005367 Ga0070667_100008436 Ga0070667_1000084362 282
418 3300005467 Ga0070706_100093928 Ga0070706_1000939282 282
419 3300005468 Ga0070707_100357313 Ga0070707_1003573131 282
420 3300005536 Ga0070697_100000184 Ga0070697_10000018440 282
421 3300005546 Ga0070696_100002882 Ga0070696_1000028822 282
422 3300005548 Ga0070665_100009137 Ga0070665_1000091377 282
423 3300005617 Ga0068859_100000565 Ga0068859_10000056510 282
424 3300005841 Ga0068863_100010314 Ga0068863_1000103144 282
425 3300005842 Ga0068858_100001130 Ga0068858_10000113013 282
426 3300005843 Ga0068860_100012268 Ga0068860_1000122682 282
427 3300006846 Ga0075430_100026682 Ga0075430_1000266822 282
428 3300006931 Ga0097620_100000565 Ga0097620_10000056526 282
429 3300009101 Ga0105247_10000212 Ga0105247_1000021228 282
430 3300009148 Ga0105243_10605769 Ga0105243_106057691 282
431 3300009177 Ga0105248_10108391 Ga0105248_101083912 282
432 3300009553 Ga0105249_10006781 Ga0105249_100067813 282
433 3300013297 Ga0157378_10727011 Ga0157378_107270111 282
434 3300014325 Ga0163163_10004742 Ga0163163_100047425 282
435 3300014968 Ga0157379_10003249 Ga0157379_100032495 282
436 3300025900 Ga0207710_10012665 Ga0207710_100126653 282
437 3300025910 Ga0207684_10061439 Ga0207684_100614392 282
438 3300025922 Ga0207646_10278692 Ga0207646_102786921 282
439 3300025923 Ga0207681_10008178 Ga0207681_100081785 282
440 3300025931 Ga0207644_10002473 Ga0207644_100024734 282
441 3300025935 Ga0207709_10379467 Ga0207709_103794672 282
442 3300025936 Ga0207670_10075558 Ga0207670_100755582 282
443 3300025941 Ga0207711_10067021 Ga0207711_100670212 282
444 3300025942 Ga0207689_10005913 Ga0207689_100059134 282
445 3300025961 Ga0207712_10022078 Ga0207712_100220782 282
446 3300025986 Ga0207658_10037313 Ga0207658_100373132 282
447 3300026035 Ga0207703_10001035 Ga0207703_1000103517 282
448 3300026075 Ga0207708_10185012 Ga0207708_101850121 282
449 3300026088 Ga0207641_10097285 Ga0207641_100972852 282
450 3300028381 Ga0268264_10013500 Ga0268264_100135002 282
451 3300030521 Ga0307511_10002142 Ga0307511_100021422 282
452 3300042461 Ga0439460_0000057 Ga0439460_0000057_4239_5207 282
453 3300048911 Ga0496108_0183745 Ga0496108_0183745_10_975 282
454 3300048915 Ga0496112_0256883 Ga0496112_0256883_17_982 282
455 3300048924 Ga0496121_0000371 Ga0496121_0000371_20152_21117 282
456 3300049587 Ga0501071_0285246 Ga0501071_0285246_57_1025 282
457 3300050507 nmdc:mga05p37_112055_c1 nmdc:mga05p37_112055_c1_597_1496 282
458 3300053178 Ga0500637_0001302 Ga0500637_0001302_2468_3433 282
459 3300006844 Ga0075428_100010270 Ga0075428_1000102702 283
460 3300027665 Ga0209983_1003473 Ga0209983_10034734 283
461 3300027682 Ga0209971_1007600 Ga0209971_10076002 283
462 3300027876 Ga0209974_10012954 Ga0209974_100129542 283
463 3300041408 Ga0439453_0004089 Ga0439453_0004089_964_1932 283
464 3300042003 Ga0439443_006665 Ga0439443_006665_431_1399 283
465 3300005335 Ga0070666_10011965 Ga0070666_100119652 284
466 3300005468 Ga0070707_100166306 Ga0070707_1001663062 284
467 3300005471 Ga0070698_100210323 Ga0070698_1002103232 284
468 3300013100 Ga0157373_10005713 Ga0157373_100057137 284
469 3300013104 Ga0157370_10014396 Ga0157370_100143962 284
470 3300013105 Ga0157369_10000169 Ga0157369_100001697 284
471 3300013306 Ga0163162_10000349 Ga0163162_1000034915 284
472 3300014497 Ga0182008_10000840 Ga0182008_100008401 284
473 3300015261 Ga0182006_1002298 Ga0182006_10022987 284
474 3300015262 Ga0182007_10000016 Ga0182007_1000001625 284
475 3300025292 Ga0209676_1000106 Ga0209676_1000106158 284
476 3300025298 Ga0209050_1000456 Ga0209050_100045646 284
477 3300025903 Ga0207680_10074549 Ga0207680_100745492 284
478 3300025922 Ga0207646_10039206 Ga0207646_100392062 284
479 3300031731 Ga0307405_10000025 Ga0307405_1000002578 284
480 3300031903 Ga0307407_10000016 Ga0307407_1000001651 284
481 3300031995 Ga0307409_100059769 Ga0307409_1000597693 284
482 3300032002 Ga0307416_100000036 Ga0307416_10000003651 284
483 3300035086 Ga0373934_0010704 Ga0373934_0010704_799_1767 284
484 3300035118 Ga0373954_0000664 Ga0373954_0000664_8263_9231 284
485 3300036401 Ga0373937_0002310 Ga0373937_0002310_11765_12733 284
486 3300013297 Ga0157378_10033548 Ga0157378_100335483 285
487 3300025944 Ga0207661_10459505 Ga0207661_104595051 285
488 3300046472 Ga0495580_0000111 Ga0495580_0000111_14852_15811 285
489 3300046684 Ga0495669_0005776 Ga0495669_0005776_2092_3060 285
490 3300005347 Ga0070668_100062118 Ga0070668_1000621182 286
491 3300005353 Ga0070669_100321927 Ga0070669_1003219271 286
492 3300005445 Ga0070708_100000002 Ga0070708_100000002170 286
493 3300005471 Ga0070698_100005045 Ga0070698_1000050456 286
494 3300005518 Ga0070699_100001009 Ga0070699_1000010093 286
495 3300036401 Ga0373937_0122319 Ga0373937_0122319_780_1748 286
496 3300005467 Ga0070706_100001955 Ga0070706_10000195516 287
497 3300025910 Ga0207684_10025275 Ga0207684_100252752 287
498 3300005341 Ga0070691_10049622 Ga0070691_100496222 288
499 3300005406 Ga0070703_10011913 Ga0070703_100119132 288
500 3300005438 Ga0070701_10021299 Ga0070701_100212992 288
501 3300005441 Ga0070700_100018818 Ga0070700_1000188182 288
502 3300005468 Ga0070707_100095388 Ga0070707_1000953882 288
503 3300005518 Ga0070699_100016107 Ga0070699_1000161074 288
504 3300005546 Ga0070696_100025677 Ga0070696_1000256772 288
505 3300005546 Ga0070696_100206141 Ga0070696_1002061412 288
506 3300005617 Ga0068859_100013392 Ga0068859_1000133922 288
507 3300005843 Ga0068860_100184036 Ga0068860_1001840362 288
508 3300006846 Ga0075430_100018296 Ga0075430_1000182967 288
509 3300006852 Ga0075433_10085125 Ga0075433_100851252 288
510 3300006931 Ga0097620_100013393 Ga0097620_1000133932 288
511 3300009148 Ga0105243_10024906 Ga0105243_100249062 288
512 3300009174 Ga0105241_10092787 Ga0105241_100927872 288
513 3300009176 Ga0105242_10011906 Ga0105242_100119062 288
514 3300021358 Ga0213873_10000002 Ga0213873_10000002857 288
515 3300021384 Ga0213876_10000001 Ga0213876_10000001940 288
516 3300025900 Ga0207710_10036351 Ga0207710_100363512 288
517 3300025912 Ga0207707_10021721 Ga0207707_100217213 288
518 3300025917 Ga0207660_10067585 Ga0207660_100675852 288
519 3300025921 Ga0207652_10130965 Ga0207652_101309652 288
520 3300025922 Ga0207646_10296675 Ga0207646_102966752 288
521 3300025934 Ga0207686_10043759 Ga0207686_100437592 288
522 3300025935 Ga0207709_10038267 Ga0207709_100382672 288
523 3300025938 Ga0207704_10045390 Ga0207704_100453903 288
524 3300025942 Ga0207689_10053306 Ga0207689_100533062 288
525 3300025961 Ga0207712_10106442 Ga0207712_101064422 288
526 3300026075 Ga0207708_10000133 Ga0207708_1000013320 288
527 3300026075 Ga0207708_10053681 Ga0207708_100536812 288
528 3300027462 Ga0210000_1003736 Ga0210000_10037363 288
529 3300028381 Ga0268264_10335315 Ga0268264_103353151 288
530 3300037312 Ga0395899_0009873 Ga0395899_0009873_843_1808 288
531 3300037418 Ga0395900_0010794 Ga0395900_0010794_2059_3024 288
532 3300037466 Ga0395898_0024863 Ga0395898_0024863_4338_5303 288
533 3300038443 Ga0395901_0003510 Ga0395901_0003510_8819_9784 288
534 3300039437 Ga0436365_0404975 Ga0436365_0404975_153679_154629 288
535 3300039453 Ga0436362_0660519 Ga0436362_0660519_67016_67966 288
536 3300042001 Ga0439441_003375 Ga0439441_003375_725_1678 288
537 3300042876 Ga0451577_0170400 Ga0451577_0170400_433_1398 288
538 3300046455 Ga0495603_0122247 Ga0495603_0122247_152_1111 288
539 3300046512 Ga0495610_0000039 Ga0495610_0000039_162448_163410 288
540 3300047319 Ga0495674_0296630 Ga0495674_0296630_298_1257 288
541 3300048917 Ga0496114_0012980 Ga0496114_0012980_2270_3229 288
542 3300048918 Ga0496115_0050116 Ga0496115_0050116_1371_2330 288
543 3300050507 nmdc:mga05p37_128361_c1 nmdc:mga05p37_128361_c1_1152_2117 288
544 3300050510 nmdc:mga06r32_42448_c1 nmdc:mga06r32_42448_c1_3047_4015 288
545 3300050514 nmdc:mga08x19_4045_c1 nmdc:mga08x19_4045_c1_4341_5270 288
546 3300053077 Ga0495601_0275922 Ga0495601_0275922_40_999 288
547 3300005327 Ga0070658_10213056 Ga0070658_102130563 289
548 3300017792 Ga0163161_10168224 Ga0163161_101682242 289
549 3300025937 Ga0207669_10238384 Ga0207669_102383842 289
550 3300044712 Ga0453684_0001096 Ga0453684_0001096_28025_28987 289
551 3300006880 Ga0075429_100146354 Ga0075429_1001463542 290
552 3300009147 Ga0114129_10020824 Ga0114129_100208247 290
553 3300050508 nmdc:mga09592_97619_c1 nmdc:mga09592_97619_c1_1075_2043 290
554 3300010375 Ga0105239_10091442 Ga0105239_100914423 291
555 3300011119 Ga0105246_10084236 Ga0105246_100842361 291
556 3300025933 Ga0207706_10334841 Ga0207706_103348412 291
557 3300047443 Ga0495687_001403 Ga0495687_001403_6656_7612 291
558 iso_pu_bacteria 2919534386 2919534475 291
559 3300031251 Ga0265327_10003664 Ga0265327_100036648 292
560 iso_pu_bacteria 2599185184 2599479358 292
561 iso_pu_bacteria 2842903701 2842906042 292
562 iso_pu_bacteria 2928078545 2928082335 292
563 iso_pu_bacteria 2928147474 2928149085 292
564 iso_pu_bacteria 2932082852 2932088374 292
565 3300002773 JGI25152J39213_1000006 JGI25152J39213_1000006108 293
566 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005126 293
567 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004294 293
568 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004294 293
569 3300006871 Ga0075434_100053000 Ga0075434_1000530001 293
570 3300017792 Ga0163161_10000281 Ga0163161_1000028124 293
571 3300025245 Ga0207425_1000008 Ga0207425_1000008144 293
572 3300025258 Ga0209129_1000040 Ga0209129_1000040121 293
573 3300025294 Ga0209025_1000020 Ga0209025_1000020144 293
574 3300025297 Ga0209758_1000022 Ga0209758_1000022144 293
575 3300046512 Ga0495610_0000103 Ga0495610_0000103_3370_4332 293
576 iso_pu_bacteria 2852623160 2852624967 293
577 iso_pu_bacteria 2884933994 2884936008 293
578 iso_pu_bacteria 2919437846 2919442946 293
579 3300035691 Ga0373931_0076777 Ga0373931_0076777_172_1119 294
580 3300037418 Ga0395900_0033794 Ga0395900_0033794_2099_3046 294
581 iso_pu_bacteria 2508501125 2509131278 294
582 iso_pu_bacteria 2510065045 2510251442 294
583 iso_pu_bacteria 2512047030 2512345599 294
584 iso_pu_bacteria 2513237150 2513952871 294
585 iso_pu_bacteria 2513237151 2513961893 294
586 iso_pu_bacteria 2513237165 2514042386 294
587 iso_pu_bacteria 2513237166 2514052622 294
588 iso_pu_bacteria 2515154122 2515680884 294
589 iso_pu_bacteria 2526164512 2526213709 294
590 iso_pu_bacteria 2526164713 2527075412 294
591 iso_pu_bacteria 2547132512 2548849202 294
592 iso_pu_bacteria 2562617112 2563058760 294
593 iso_pu_bacteria 2574179768 2574429360 294
594 iso_pu_bacteria 2596583598 2597028757 294
595 iso_pu_bacteria 2599185178 2599445438 294
596 iso_pu_bacteria 2599185292 2599906588 294
597 iso_pu_bacteria 2643221569 2643860793 294
598 iso_pu_bacteria 2643221594 2643981365 294
599 iso_pu_bacteria 2643221621 2644119445 294
600 iso_pu_bacteria 2711768613 2713476585 294
601 iso_pu_bacteria 2718217991 2719640557 294
602 iso_pu_bacteria 2721755763 2723877129 294
603 iso_pu_bacteria 2738541296 2738818609 294
604 iso_pu_bacteria 2738541298 2738831234 294
605 iso_pu_bacteria 2738541306 2738872762 294
606 iso_pu_bacteria 2738543002 2739184392 294
607 iso_pu_bacteria 2738543008 2739219361 294
608 iso_pu_bacteria 2739367655 2739610876 294
609 iso_pu_bacteria 2744054900 2746085836 294
610 iso_pu_bacteria 2744054901 2746096274 294
611 iso_pu_bacteria 2751185846 2753566613 294
612 iso_pu_bacteria 2791355137 2792836008 294
613 iso_pu_bacteria 2808606384 2808972832 294
614 iso_pu_bacteria 2808606390 2809007814 294
615 iso_pu_bacteria 2808606391 2809014646 294
616 iso_pu_bacteria 2808606395 2809035282 294
617 iso_pu_bacteria 2818991450 2819620039 294
618 iso_pu_bacteria 2834641062 2834641852 294
619 iso_pu_bacteria 2842324504 2842328693 294
620 iso_pu_bacteria 2842348783 2842353009 294
621 iso_pu_bacteria 2842454564 2842458646 294
622 iso_pu_bacteria 2846037992 2846039948 294
623 iso_pu_bacteria 2855730933 2855731032 294
624 iso_pu_bacteria 2855767633 2855770367 294
625 iso_pu_bacteria 2857537821 2857542255 294
626 iso_pu_bacteria 2857542790 2857545076 294
627 iso_pu_bacteria 2857576091 2857578545 294
628 iso_pu_bacteria 2858950400 2858953543 294
629 iso_pu_bacteria 2881412998 2881414574 294
630 iso_pu_bacteria 2881927736 2881929472 294
631 iso_pu_bacteria 2885266251 2885266912 294
632 iso_pu_bacteria 2885270888 2885273044 294
633 iso_pu_bacteria 2887375801 2887379997 294
634 iso_pu_bacteria 2895511927 2895518319 294
635 iso_pu_bacteria 2900577576 2900581236 294
636 iso_pu_bacteria 2900634093 2900634326 294
637 iso_pu_bacteria 2902682994 2902683661 294
638 iso_pu_bacteria 2904434214 2904438072 294
639 iso_pu_bacteria 2904483920 2904484631 294
640 iso_pu_bacteria 2919527303 2919531406 294
641 iso_pu_bacteria 2921643360 2921646940 294
642 iso_pu_bacteria 2928058823 2928062769 294
643 iso_pu_bacteria 2928108538 2928110403 294
644 iso_pu_bacteria 2928135762 2928138463 294
645 iso_pu_bacteria 2928503688 2928505475 294
646 iso_pu_bacteria 2941479691 2941484686 294
647 iso_pu_bacteria 2945934425 2945937308 294
648 iso_pu_bacteria 2990703756 2990705999 294
649 iso_pu_bacteria 2998344455 2998347244 294
650 iso_pu_bacteria 639633007 639786034 294
651 iso_pu_bacteria 641736151 642425787 294
652 iso_pu_bacteria 642555112 642593171 294
653 iso_pu_bacteria 642555113 642622067 294
654 iso_pu_bacteria 644736347 644747515 294
655 iso_pu_bacteria 8002392321 8002393303 294
656 iso_pu_bacteria 8003400568 8003404602 294
657 iso_pu_bacteria 8048746797 8048749004 294
658 iso_pu_bacteria 8055225921 8055226722 294
659 iso_pu_bacteria 8055266321 8055268897 294
660 iso_pu_bacteria 8055301274 8055302156 294
661 3300006844 Ga0075428_100004249 Ga0075428_1000042498 295
662 3300009094 Ga0111539_10000470 Ga0111539_100004705 295
663 3300027111 Ga0209281_1007844 Ga0209281_10078441 295
664 3300027876 Ga0209974_10033058 Ga0209974_100330582 295
665 3300027907 Ga0207428_10005651 Ga0207428_100056516 295
666 3300050511 nmdc:mga08y16_2934_c1 nmdc:mga08y16_2934_c1_1460_2425 295
667 iso_pu_bacteria 2511231002 2511245480 295
668 iso_pu_bacteria 2513020051 2513230921 295
669 iso_pu_bacteria 2547132374 2548498205 295
670 iso_pu_bacteria 2585427687 2586209765 295
671 iso_pu_bacteria 2585428057 2587730487 295
672 iso_pu_bacteria 2585428058 2587736090 295
673 iso_pu_bacteria 2585428062 2587754700 295
674 iso_pu_bacteria 2599185214 2599624600 295
675 iso_pu_bacteria 2599185226 2599672538 295
676 iso_pu_bacteria 2599185227 2599683538 295
677 iso_pu_bacteria 2599185229 2599694147 295
678 iso_pu_bacteria 2600255292 2601670043 295
679 iso_pu_bacteria 2643221544 2643746152 295
680 iso_pu_bacteria 2643221554 2643787825 295
681 iso_pu_bacteria 2643221556 2643802874 295
682 iso_pu_bacteria 2643221570 2643867485 295
683 iso_pu_bacteria 2643221585 2643937071 295
684 iso_pu_bacteria 2643221592 2643969084 295
685 iso_pu_bacteria 2643221596 2643991281 295
686 iso_pu_bacteria 2643221603 2644028856 295
687 iso_pu_bacteria 2643221609 2644057023 295
688 iso_pu_bacteria 2643221611 2644070846 295
689 iso_pu_bacteria 2643221625 2644139684 295
690 iso_pu_bacteria 2643221628 2644163115 295
691 iso_pu_bacteria 2643221638 2644211937 295
692 iso_pu_bacteria 2643221639 2644217951 295
693 iso_pu_bacteria 2643221644 2644247851 295
694 iso_pu_bacteria 2643221645 2644251810 295
695 iso_pu_bacteria 2643221646 2644258306 295
696 iso_pu_bacteria 2643221648 2644275420 295
697 iso_pu_bacteria 2643221652 2644295084 295
698 iso_pu_bacteria 2643221654 2644304525 295
699 iso_pu_bacteria 2643221656 2644318236 295
700 iso_pu_bacteria 2643221658 2644328139 295
701 iso_pu_bacteria 2643221660 2644341325 295
702 iso_pu_bacteria 2643221664 2644360469 295
703 iso_pu_bacteria 2643221672 2644398547 295
704 iso_pu_bacteria 2643221683 2644468712 295
705 iso_pu_bacteria 2643221684 2644472383 295
706 iso_pu_bacteria 2643221717 2644648737 295
707 iso_pu_bacteria 2721755523 2722884805 295
708 iso_pu_bacteria 2738541277 2738720123 295
709 iso_pu_bacteria 2738541280 2738740490 295
710 iso_pu_bacteria 2738541283 2738758852 295
711 iso_pu_bacteria 2738541284 2738762070 295
712 iso_pu_bacteria 2738541297 2738828774 295
713 iso_pu_bacteria 2738541300 2738843256 295
714 iso_pu_bacteria 2738541302 2738854238 295
715 iso_pu_bacteria 2738541307 2738881667 295
716 iso_pu_bacteria 2738541337 2739057090 295
717 iso_pu_bacteria 2738541357 2739152570 295
718 iso_pu_bacteria 2738543003 2739194490 295
719 iso_pu_bacteria 2738543012 2739244056 295
720 iso_pu_bacteria 2738543018 2739272107 295
721 iso_pu_bacteria 2738543019 2739279322 295
722 iso_pu_bacteria 2738543026 2739320966 295
723 iso_pu_bacteria 2738543029 2739339207 295
724 iso_pu_bacteria 2738543030 2739341151 295
725 iso_pu_bacteria 2739367651 2739587342 295
726 iso_pu_bacteria 2739367656 2739617491 295
727 iso_pu_bacteria 2739367663 2739647934 295
728 iso_pu_bacteria 2808606418 2809142803 295
729 iso_pu_bacteria 2816332133 2816472382 295
730 iso_pu_bacteria 2818991436 2819541048 295
731 iso_pu_bacteria 2818991437 2819550177 295
732 iso_pu_bacteria 2818991446 2819596000 295
733 iso_pu_bacteria 2821131069 2821133002 295
734 iso_pu_bacteria 2831265667 2831266850 295
735 iso_pu_bacteria 2831864461 2831868184 295
736 iso_pu_bacteria 2838054893 2838056910 295
737 iso_pu_bacteria 2839138175 2839144406 295
738 iso_pu_bacteria 2842677519 2842678746 295
739 iso_pu_bacteria 2842711865 2842714677 295
740 iso_pu_bacteria 2842718218 2842720143 295
741 iso_pu_bacteria 2842722452 2842726789 295
742 iso_pu_bacteria 2842733646 2842736839 295
743 iso_pu_bacteria 2842747753 2842747911 295
744 iso_pu_bacteria 2842909656 2842911630 295
745 iso_pu_bacteria 2849281842 2849285170 295
746 iso_pu_bacteria 2857547612 2857550889 295
747 iso_pu_bacteria 2857553236 2857558412 295
748 iso_pu_bacteria 2857558681 2857563603 295
749 iso_pu_bacteria 2857564685 2857567189 295
750 iso_pu_bacteria 2857627736 2857630432 295
751 iso_pu_bacteria 2881101125 2881101665 295
752 iso_pu_bacteria 2885080285 2885080498 295
753 iso_pu_bacteria 2885192300 2885192914 295
754 iso_pu_bacteria 2885198086 2885199184 295
755 iso_pu_bacteria 2885211737 2885212553 295
756 iso_pu_bacteria 2886848708 2886854268 295
757 iso_pu_bacteria 2899924645 2899925350 295
758 iso_pu_bacteria 2902048731 2902049382 295
759 iso_pu_bacteria 2904424332 2904427220 295
760 iso_pu_bacteria 2904445276 2904449820 295
761 iso_pu_bacteria 2904449895 2904455416 295
762 iso_pu_bacteria 2904456579 2904460584 295
763 iso_pu_bacteria 2904479285 2904481842 295
764 iso_pu_bacteria 2919186247 2919189035 295
765 iso_pu_bacteria 2919462493 2919464372 295
766 iso_pu_bacteria 2919476304 2919479913 295
767 iso_pu_bacteria 2928037797 2928038528 295
768 iso_pu_bacteria 2928044640 2928045867 295
769 iso_pu_bacteria 2928051484 2928053542 295
770 iso_pu_bacteria 2928064002 2928067089 295
771 iso_pu_bacteria 2928070936 2928071008 295
772 iso_pu_bacteria 2928084124 2928085043 295
773 iso_pu_bacteria 2928115317 2928115882 295
774 iso_pu_bacteria 2929520902 2929524793 295
775 iso_pu_bacteria 2932410948 2932413542 295
776 iso_pu_bacteria 2932416698 2932417602 295
777 iso_pu_bacteria 2932422444 2932424983 295
778 iso_pu_bacteria 2939631187 2939632574 295
779 iso_pu_bacteria 2939664404 2939666810 295
780 iso_pu_bacteria 2945909444 2945912562 295
781 iso_pu_bacteria 2945945610 2945947206 295
782 iso_pu_bacteria 2945972063 2945976893 295
783 iso_pu_bacteria 2945984333 2945985152 295
784 iso_pu_bacteria 2945997725 2946002895 295
785 iso_pu_bacteria 2954016120 2954019755 295
786 iso_pu_bacteria 2954767861 2954771920 295
787 iso_pu_bacteria 2974320154 2974322886 295
788 iso_pu_bacteria 2990710928 2990713271 295
789 iso_pu_bacteria 8047673197 8047678519 295
790 3300003323 rootH1_10060699 rootH1_100606992 296
791 3300005354 Ga0070675_100106028 Ga0070675_1001060281 296
792 3300005440 Ga0070705_100014405 Ga0070705_1000144053 296
793 3300005444 Ga0070694_100064033 Ga0070694_1000640332 296
794 3300005445 Ga0070708_100120772 Ga0070708_1001207722 296
795 3300005467 Ga0070706_100181802 Ga0070706_1001818021 296
796 3300005468 Ga0070707_100010422 Ga0070707_1000104221 296
797 3300005471 Ga0070698_100006643 Ga0070698_1000066437 296
798 3300005518 Ga0070699_100063889 Ga0070699_1000638891 296
799 3300005518 Ga0070699_100316104 Ga0070699_1003161042 296
800 3300005536 Ga0070697_100002067 Ga0070697_1000020673 296
801 3300005543 Ga0070672_100003539 Ga0070672_10000353911 296
802 3300005543 Ga0070672_100035847 Ga0070672_1000358472 296
803 3300005547 Ga0070693_100127010 Ga0070693_1001270102 296
804 3300005563 Ga0068855_100011132 Ga0068855_1000111322 296
805 3300005614 Ga0068856_100251843 Ga0068856_1002518432 296
806 3300005844 Ga0068862_100006256 Ga0068862_1000062564 296
807 3300006852 Ga0075433_10003458 Ga0075433_100034589 296
808 3300006871 Ga0075434_100312926 Ga0075434_1003129261 296
809 3300006881 Ga0068865_100162923 Ga0068865_1001629232 296
810 3300007265 Ga0099794_10022672 Ga0099794_100226722 296
811 3300009093 Ga0105240_10000096 Ga0105240_10000096104 296
812 3300009094 Ga0111539_10018072 Ga0111539_100180728 296
813 3300009098 Ga0105245_10002747 Ga0105245_100027475 296
814 3300009147 Ga0114129_10382172 Ga0114129_103821722 296
815 3300009147 Ga0114129_10537975 Ga0114129_105379752 296
816 3300009148 Ga0105243_10070538 Ga0105243_100705382 296
817 3300009174 Ga0105241_10003014 Ga0105241_100030144 296
818 3300013306 Ga0163162_10405388 Ga0163162_104053882 296
819 3300025893 Ga0207682_10024091 Ga0207682_100240912 296
820 3300025904 Ga0207647_10080847 Ga0207647_100808472 296
821 3300025910 Ga0207684_10000399 Ga0207684_1000039927 296
822 3300025911 Ga0207654_10026881 Ga0207654_100268812 296
823 3300025913 Ga0207695_10006974 Ga0207695_1000697410 296
824 3300025922 Ga0207646_10001337 Ga0207646_1000133724 296
825 3300025923 Ga0207681_10017797 Ga0207681_100177972 296
826 3300025926 Ga0207659_10081233 Ga0207659_100812333 296
827 3300025927 Ga0207687_10003156 Ga0207687_100031566 296
828 3300025938 Ga0207704_10106379 Ga0207704_101063792 296
829 3300025940 Ga0207691_10003494 Ga0207691_100034942 296
830 3300025944 Ga0207661_10132783 Ga0207661_101327832 296
831 3300025949 Ga0207667_10002421 Ga0207667_1000242120 296
832 3300026078 Ga0207702_10210517 Ga0207702_102105172 296
833 3300026116 Ga0207674_10423870 Ga0207674_104238701 296
834 3300026118 Ga0207675_100055265 Ga0207675_1000552651 296
835 3300027876 Ga0209974_10013503 Ga0209974_100135032 296
836 3300027907 Ga0207428_10000429 Ga0207428_1000042932 296
837 3300028380 Ga0268265_10006044 Ga0268265_100060443 296
838 3300028381 Ga0268264_10050866 Ga0268264_100508662 296
839 3300030731 Ga0316177_1126523 Ga0316177_11265233 296
840 3300030732 Ga0316176_1155407 Ga0316176_11554073 296
841 3300030742 Ga0316183_1003610 Ga0316183_100361060 296
842 3300030744 Ga0316181_1008908 Ga0316181_100890824 296
843 3300031852 Ga0307410_10070483 Ga0307410_100704832 296
844 3300031995 Ga0307409_100083307 Ga0307409_1000833072 296
845 3300035691 Ga0373931_0010350 Ga0373931_0010350_1785_2753 296
846 3300035725 Ga0373947_0186625 Ga0373947_0186625_249_1202 296
847 3300042876 Ga0451577_0000095 Ga0451577_0000095_86682_87656 296
848 3300042876 Ga0451577_0000674 Ga0451577_0000674_41294_42268 296
849 3300042876 Ga0451577_0059759 Ga0451577_0059759_696_1661 296
850 3300044712 Ga0453684_0000090 Ga0453684_0000090_115865_116839 296
851 3300044712 Ga0453684_0001963 Ga0453684_0001963_50929_51903 296
852 3300044712 Ga0453684_0066551 Ga0453684_0066551_1014_1967 296
853 3300045051 Ga0451576_0001091 Ga0451576_0001091_2902_3876 296
854 3300045051 Ga0451576_0022121 Ga0451576_0022121_4742_5695 296
855 3300045051 Ga0451576_0096897 Ga0451576_0096897_944_1918 296
856 3300045051 Ga0451576_0144562 Ga0451576_0144562_596_1570 296
857 3300046471 Ga0495650_0000081 Ga0495650_0000081_3720_4673 296
858 3300046492 Ga0495585_0000275 Ga0495585_0000275_28977_29930 296
859 3300046507 Ga0495606_0000034 Ga0495606_0000034_15880_16833 296
860 3300046507 Ga0495606_0007000 Ga0495606_0007000_8941_9894 296
861 3300046512 Ga0495610_0002487 Ga0495610_0002487_2037_2990 296
862 3300046513 Ga0495616_0006622 Ga0495616_0006622_3684_4637 296
863 3300046558 Ga0495633_0019527 Ga0495633_0019527_1728_2681 296
864 3300046660 Ga0495625_0000591 Ga0495625_0000591_3570_4523 296
865 3300046665 Ga0495661_0006672 Ga0495661_0006672_1853_2806 296
866 3300046694 Ga0495649_0000014 Ga0495649_0000014_244625_245578 296
867 3300046810 Ga0495660_0027196 Ga0495660_0027196_658_1611 296
868 3300047443 Ga0495687_001035 Ga0495687_001035_17691_18644 296
869 3300048905 Ga0496102_0017182 Ga0496102_0017182_2878_3846 296
870 3300048919 Ga0496116_0000019 Ga0496116_0000019_259172_260128 296
871 3300048924 Ga0496121_0000018 Ga0496121_0000018_279224_280180 296
872 3300049569 Ga0501032_0059634 Ga0501032_0059634_75_1040 296
873 3300049577 Ga0501041_0107539 Ga0501041_0107539_710_1675 296
874 3300049578 Ga0501042_0005173 Ga0501042_0005173_7100_8065 296
875 3300049582 Ga0501048_0043514 Ga0501048_0043514_1197_2162 296
876 3300049588 Ga0501072_0041117 Ga0501072_0041117_126_1091 296
877 3300049588 Ga0501072_0053398 Ga0501072_0053398_1455_2420 296
878 3300049590 Ga0501074_0064341 Ga0501074_0064341_1366_2331 296
879 3300049591 Ga0501075_0010258 Ga0501075_0010258_4058_5023 296
880 3300049592 Ga0501076_0008599 Ga0501076_0008599_2354_3319 296
881 3300049593 Ga0501077_0043933 Ga0501077_0043933_1838_2803 296
882 3300049743 Ga0501081_0001159 Ga0501081_0001159_168_1133 296
883 3300049824 Ga0501045_0116607 Ga0501045_0116607_291_1256 296
884 3300050511 nmdc:mga08y16_6783_c1 nmdc:mga08y16_6783_c1_6166_7119 296
885 3300050512 nmdc:mga0n895_20303_c1 nmdc:mga0n895_20303_c1_513_1481 296
886 3300050512 nmdc:mga0n895_250187_c1 nmdc:mga0n895_250187_c1_650_1603 296
887 3300050515 nmdc:mga0a205_11976_c1 nmdc:mga0a205_11976_c1_378_1331 296
888 3300050515 nmdc:mga0a205_17810_c1 nmdc:mga0a205_17810_c1_1026_1979 296
889 3300053125 Ga0500618_033500 Ga0500618_033500_196_1149 296
890 3300054114 Ga0501084_0248911 Ga0501084_0248911_88_1053 296
891 iso_pu_bacteria 2738543023 2739301950 296
892 iso_pu_bacteria 2775506987 2776615304 296
893 3300005337 Ga0070682_100000001 Ga0070682_100000001519 297
894 3300005340 Ga0070689_100000313 Ga0070689_10000031314 297
895 3300005343 Ga0070687_100045473 Ga0070687_1000454731 297
896 3300005467 Ga0070706_100000377 Ga0070706_1000003773 297
897 3300005543 Ga0070672_100002404 Ga0070672_1000024049 297
898 3300005618 Ga0068864_100000997 Ga0068864_10000099719 297
899 3300005842 Ga0068858_100008710 Ga0068858_1000087103 297
900 3300006844 Ga0075428_100035952 Ga0075428_1000359525 297
901 3300006847 Ga0075431_100034322 Ga0075431_1000343224 297
902 3300006847 Ga0075431_100492991 Ga0075431_1004929912 297
903 3300009094 Ga0111539_10000052 Ga0111539_1000005261 297
904 3300009098 Ga0105245_10019755 Ga0105245_100197553 297
905 3300013297 Ga0157378_10049082 Ga0157378_100490822 297
906 3300013308 Ga0157375_10000001 Ga0157375_100000014 297
907 3300014326 Ga0157380_10007203 Ga0157380_100072033 297
908 3300014497 Ga0182008_10150984 Ga0182008_101509841 297
909 3300025908 Ga0207643_10079836 Ga0207643_100798362 297
910 3300025910 Ga0207684_10001184 Ga0207684_100011842 297
911 3300025910 Ga0207684_10151111 Ga0207684_101511112 297
912 3300025918 Ga0207662_10006173 Ga0207662_100061732 297
913 3300025927 Ga0207687_10002009 Ga0207687_1000200913 297
914 3300025933 Ga0207706_10262266 Ga0207706_102622662 297
915 3300025936 Ga0207670_10000755 Ga0207670_100007554 297
916 3300025938 Ga0207704_10008648 Ga0207704_100086484 297
917 3300025940 Ga0207691_10000269 Ga0207691_1000026947 297
918 3300026035 Ga0207703_10000046 Ga0207703_10000046142 297
919 3300026095 Ga0207676_10000013 Ga0207676_10000013218 297
920 3300027907 Ga0207428_10000003 Ga0207428_1000000361 297
921 3300031239 Ga0265328_10024605 Ga0265328_100246052 297
922 3300031665 Ga0316575_10005476 Ga0316575_100054762 297
923 3300031691 Ga0316579_10006085 Ga0316579_100060854 297
924 3300031691 Ga0316579_10012506 Ga0316579_100125062 297
925 3300031727 Ga0316576_10009558 Ga0316576_100095583 297
926 3300031727 Ga0316576_10063753 Ga0316576_100637531 297
927 3300031727 Ga0316576_10089934 Ga0316576_100899342 297
928 3300031728 Ga0316578_10000034 Ga0316578_100000342 297
929 3300031728 Ga0316578_10001360 Ga0316578_100013605 297
930 3300031728 Ga0316578_10019102 Ga0316578_100191022 297
931 3300031728 Ga0316578_10161969 Ga0316578_101619692 297
932 3300031733 Ga0316577_10000159 Ga0316577_1000015918 297
933 3300032137 Ga0316585_10000072 Ga0316585_100000725 297
934 3300032139 Ga0316580_10000248 Ga0316580_100002486 297
935 3300032168 Ga0316593_10018906 Ga0316593_100189061 297
936 3300032168 Ga0316593_10078378 Ga0316593_100783782 297
937 3300033524 Ga0316592_1031204 Ga0316592_10312041 297
938 3300033528 Ga0316588_1028303 Ga0316588_10283031 297
939 3300035398 Ga0316574_0000640 Ga0316574_0000640_7474_8430 297
940 3300036647 Ga0316582_0004956 Ga0316582_0004956_3604_4560 297
941 3300036712 Ga0316584_0000500 Ga0316584_0000500_15047_16003 297
942 3300036712 Ga0316584_0008519 Ga0316584_0008519_1353_2309 297
943 3300036712 Ga0316584_0101518 Ga0316584_0101518_1048_2004 297
944 3300037588 Ga0316581_0019722 Ga0316581_0019722_218_1174 297
945 3300038726 Ga0400490_03747 Ga0400490_03747_4407_5363 297
946 3300038726 Ga0400490_46903 Ga0400490_46903_1312_2268 297
947 3300038735 Ga0400485_13276 Ga0400485_13276_1022_1978 297
948 3300038741 Ga0400488_07133 Ga0400488_07133_132_1088 297
949 3300038741 Ga0400488_29469 Ga0400488_29469_741_1697 297
950 3300038742 Ga0400486_00114 Ga0400486_00114_1021_1977 297
951 3300039062 Ga0400483_127586 Ga0400483_127586_3116_4072 297
952 3300039062 Ga0400483_189073 Ga0400483_189073_44_1000 297
953 3300039093 Ga0400489_12713 Ga0400489_12713_475_1431 297
954 3300046515 Ga0495620_0006244 Ga0495620_0006244_4704_5669 297
955 3300049573 Ga0501037_0002756 Ga0501037_0002756_2415_3371 297
956 3300049573 Ga0501037_0010675 Ga0501037_0010675_3864_4826 297
957 3300049574 Ga0501038_0000828 Ga0501038_0000828_21460_22416 297
958 3300049575 Ga0501039_0083988 Ga0501039_0083988_882_1838 297
959 3300049580 Ga0501046_0005527 Ga0501046_0005527_5495_6451 297
960 3300049581 Ga0501047_0066881 Ga0501047_0066881_2477_3439 297
961 3300049585 Ga0501069_0008846 Ga0501069_0008846_1993_2949 297
962 3300049586 Ga0501070_0011990 Ga0501070_0011990_3850_4806 297
963 3300049590 Ga0501074_0005430 Ga0501074_0005430_2964_3926 297
964 3300049591 Ga0501075_0013892 Ga0501075_0013892_2393_3349 297
965 3300049742 Ga0501080_0012425 Ga0501080_0012425_4405_5367 297
966 3300050508 nmdc:mga09592_347287_c1 nmdc:mga09592_347287_c1_246_1196 297
967 3300050510 nmdc:mga06r32_2480_c1 nmdc:mga06r32_2480_c1_11150_12112 297
968 3300050510 nmdc:mga06r32_321665_c1 nmdc:mga06r32_321665_c1_424_1374 297
969 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_859393_860343 297
970 iso_pu_bacteria 2511231003 2511248518 297
971 iso_pu_bacteria 2511231026 2511384016 297
972 iso_pu_bacteria 2521172590 2521557831 297
973 iso_pu_bacteria 2551306416 2553002950 297
974 iso_pu_bacteria 2765235838 2765568944 297
975 iso_pu_bacteria 2808606386 2808984538 297
976 iso_pu_bacteria 2808606415 2809128131 297
977 iso_pu_bacteria 2808606419 2809151868 297
978 iso_pu_bacteria 2818991445 2819593403 297
979 iso_pu_bacteria 2818991449 2819615027 297
980 iso_pu_bacteria 2839094727 2839096174 297
981 iso_pu_bacteria 2852618963 2852619916 297
982 iso_pu_bacteria 2884811622 2884813993 297
983 iso_pu_bacteria 2884836552 2884839935 297
984 iso_pu_bacteria 2884852848 2884857297 297
985 iso_pu_bacteria 2896154374 2896157884 297
986 iso_pu_bacteria 2904439833 2904441409 297
987 iso_pu_bacteria 2904530477 2904531654 297
988 iso_pu_bacteria 2904584206 2904586706 297
989 iso_pu_bacteria 2904589729 2904593261 297
990 iso_pu_bacteria 2904601388 2904602895 297
991 iso_pu_bacteria 2919046199 2919046294 297
992 iso_pu_bacteria 2919079590 2919079601 297
993 iso_pu_bacteria 2923510766 2923511049 297
994 iso_pu_bacteria 2928130867 2928131001 297
995 2162886007 SwRhRL2b_contig_3536978 SwRhRL2b_0062.00002190 298
996 3300001915 JGI24741J21665_1000812 JGI24741J21665_10008122 298
997 3300001979 JGI24740J21852_10001296 JGI24740J21852_1000129610 298
998 3300001979 JGI24740J21852_10001980 JGI24740J21852_100019802 298
999 3300001979 JGI24740J21852_10007839 JGI24740J21852_100078394 298
1000 3300001990 JGI24737J22298_10064721 JGI24737J22298_100647211 298
1001 3300002067 JGI24735J21928_10000801 JGI24735J21928_100008019 298
1002 3300002075 JGI24738J21930_10000986 JGI24738J21930_100009867 298
1003 3300002705 JGI25156J39149_1005207 JGI25156J39149_10052073 298
1004 3300002705 JGI25156J39149_1007051 JGI25156J39149_10070511 298
1005 3300002738 JGI25154J39366_1000703 JGI25154J39366_10007038 298
1006 3300003187 JGI25151J46595_10000277 JGI25151J46595_1000027742 298
1007 3300003187 JGI25151J46595_10037267 JGI25151J46595_100372672 298
1008 3300003203 JGI25406J46586_10008436 JGI25406J46586_100084367 298
1009 3300003354 JGI25160J50197_1000102 JGI25160J50197_100010259 298
1010 3300003751 Ga0055538_1004126 Ga0055538_10041261 298
1011 3300003752 Ga0055539_1000246 Ga0055539_100024620 298
1012 3300003756 Ga0055533_1002041 Ga0055533_10020415 298
1013 3300003756 Ga0055533_1002283 Ga0055533_10022831 298
1014 3300003756 Ga0055533_1003652 Ga0055533_10036521 298
1015 3300003758 Ga0055532_1000001 Ga0055532_1000001285 298
1016 3300003758 Ga0055532_1000002 Ga0055532_1000002169 298
1017 3300003758 Ga0055532_1000029 Ga0055532_1000029216 298
1018 3300003759 Ga0055525_1000378 Ga0055525_10003786 298
1019 3300003760 Ga0055527_1000002 Ga0055527_1000002473 298
1020 3300003760 Ga0055527_1000383 Ga0055527_10003835 298
1021 3300003761 Ga0055535_1000001 Ga0055535_1000001719 298
1022 3300003762 Ga0055542_1000001 Ga0055542_1000001285 298
1023 3300003762 Ga0055542_1000735 Ga0055542_10007354 298
1024 3300003763 Ga0055529_1000001 Ga0055529_1000001719 298
1025 3300003763 Ga0055529_1000028 Ga0055529_100002811 298
1026 3300003763 Ga0055529_1001788 Ga0055529_10017885 298
1027 3300003773 Ga0055537_1002368 Ga0055537_10023687 298
1028 3300003773 Ga0055537_1002377 Ga0055537_10023772 298
1029 3300003775 Ga0055524_1000493 Ga0055524_100049318 298
1030 3300003781 Ga0055536_1000124 Ga0055536_100012448 298
1031 3300003841 Ga0055541_1000762 Ga0055541_10007623 298
1032 3300005262 Ga0065165_1000787 Ga0065165_100078723 298
1033 3300005288 Ga0065714_10166280 Ga0065714_101662801 298
1034 3300005289 Ga0065704_10016834 Ga0065704_100168341 298
1035 3300005327 Ga0070658_10089514 Ga0070658_100895142 298
1036 3300005329 Ga0070683_100121556 Ga0070683_1001215562 298
1037 3300005330 Ga0070690_100009371 Ga0070690_1000093712 298
1038 3300005330 Ga0070690_100010317 Ga0070690_1000103172 298
1039 3300005330 Ga0070690_100020329 Ga0070690_1000203292 298
1040 3300005330 Ga0070690_100040675 Ga0070690_1000406752 298
1041 3300005330 Ga0070690_100056938 Ga0070690_1000569382 298
1042 3300005330 Ga0070690_100371708 Ga0070690_1003717081 298
1043 3300005331 Ga0070670_100008004 Ga0070670_1000080049 298
1044 3300005331 Ga0070670_100039722 Ga0070670_1000397222 298
1045 3300005331 Ga0070670_100068678 Ga0070670_1000686782 298
1046 3300005331 Ga0070670_100094152 Ga0070670_1000941521 298
1047 3300005334 Ga0068869_100002944 Ga0068869_1000029445 298
1048 3300005334 Ga0068869_100009039 Ga0068869_1000090392 298
1049 3300005334 Ga0068869_100209408 Ga0068869_1002094081 298
1050 3300005335 Ga0070666_10000702 Ga0070666_1000070217 298
1051 3300005335 Ga0070666_10030025 Ga0070666_100300252 298
1052 3300005335 Ga0070666_10052799 Ga0070666_100527992 298
1053 3300005335 Ga0070666_10225015 Ga0070666_102250151 298
1054 3300005338 Ga0068868_100000679 Ga0068868_10000067921 298
1055 3300005338 Ga0068868_100000963 Ga0068868_1000009639 298
1056 3300005338 Ga0068868_100063696 Ga0068868_1000636962 298
1057 3300005340 Ga0070689_100004270 Ga0070689_1000042708 298
1058 3300005340 Ga0070689_100026092 Ga0070689_1000260922 298
1059 3300005344 Ga0070661_100000063 Ga0070661_10000006382 298
1060 3300005347 Ga0070668_100000613 Ga0070668_1000006138 298
1061 3300005347 Ga0070668_100027160 Ga0070668_1000271602 298
1062 3300005353 Ga0070669_100000169 Ga0070669_10000016941 298
1063 3300005353 Ga0070669_100069431 Ga0070669_1000694312 298
1064 3300005354 Ga0070675_100001515 Ga0070675_10000151512 298
1065 3300005354 Ga0070675_100120224 Ga0070675_1001202243 298
1066 3300005355 Ga0070671_100003154 Ga0070671_1000031546 298
1067 3300005355 Ga0070671_100003542 Ga0070671_1000035425 298
1068 3300005355 Ga0070671_100009875 Ga0070671_1000098757 298
1069 3300005355 Ga0070671_100018139 Ga0070671_1000181393 298
1070 3300005355 Ga0070671_100058128 Ga0070671_1000581283 298
1071 3300005355 Ga0070671_100140750 Ga0070671_1001407502 298
1072 3300005356 Ga0070674_100029419 Ga0070674_1000294192 298
1073 3300005364 Ga0070673_100000466 Ga0070673_10000046610 298
1074 3300005364 Ga0070673_100001265 Ga0070673_1000012654 298
1075 3300005365 Ga0070688_100000868 Ga0070688_10000086811 298
1076 3300005365 Ga0070688_100105451 Ga0070688_1001054512 298
1077 3300005366 Ga0070659_100000309 Ga0070659_1000003094 298
1078 3300005367 Ga0070667_100000628 Ga0070667_10000062820 298
1079 3300005367 Ga0070667_100001660 Ga0070667_10000166013 298
1080 3300005367 Ga0070667_100003283 Ga0070667_1000032832 298
1081 3300005367 Ga0070667_100006529 Ga0070667_1000065292 298
1082 3300005367 Ga0070667_100027791 Ga0070667_1000277911 298
1083 3300005367 Ga0070667_100141893 Ga0070667_1001418932 298
1084 3300005367 Ga0070667_100149966 Ga0070667_1001499662 298
1085 3300005367 Ga0070667_100303281 Ga0070667_1003032811 298
1086 3300005434 Ga0070709_10007633 Ga0070709_100076335 298
1087 3300005436 Ga0070713_100000082 Ga0070713_10000008210 298
1088 3300005436 Ga0070713_100004766 Ga0070713_1000047665 298
1089 3300005436 Ga0070713_100022973 Ga0070713_1000229735 298
1090 3300005437 Ga0070710_10165626 Ga0070710_101656262 298
1091 3300005438 Ga0070701_10030877 Ga0070701_100308772 298
1092 3300005439 Ga0070711_100003379 Ga0070711_1000033796 298
1093 3300005441 Ga0070700_100023518 Ga0070700_1000235182 298
1094 3300005441 Ga0070700_100059211 Ga0070700_1000592112 298
1095 3300005444 Ga0070694_100109061 Ga0070694_1001090612 298
1096 3300005445 Ga0070708_100000054 Ga0070708_1000000542 298
1097 3300005445 Ga0070708_100013041 Ga0070708_1000130415 298
1098 3300005455 Ga0070663_100000006 Ga0070663_100000006145 298
1099 3300005455 Ga0070663_100105567 Ga0070663_1001055672 298
1100 3300005456 Ga0070678_100000359 Ga0070678_10000035911 298
1101 3300005456 Ga0070678_100017423 Ga0070678_1000174232 298
1102 3300005456 Ga0070678_100059295 Ga0070678_1000592954 298
1103 3300005456 Ga0070678_100072989 Ga0070678_1000729892 298
1104 3300005456 Ga0070678_100161930 Ga0070678_1001619302 298
1105 3300005457 Ga0070662_100003473 Ga0070662_1000034732 298
1106 3300005458 Ga0070681_10000615 Ga0070681_1000061513 298
1107 3300005459 Ga0068867_100000870 Ga0068867_1000008702 298
1108 3300005459 Ga0068867_100006473 Ga0068867_1000064739 298
1109 3300005459 Ga0068867_100087983 Ga0068867_1000879832 298
1110 3300005459 Ga0068867_100330902 Ga0068867_1003309022 298
1111 3300005466 Ga0070685_10005854 Ga0070685_100058546 298
1112 3300005467 Ga0070706_100001538 Ga0070706_1000015382 298
1113 3300005468 Ga0070707_100018196 Ga0070707_1000181963 298
1114 3300005468 Ga0070707_100067750 Ga0070707_1000677502 298
1115 3300005468 Ga0070707_100348189 Ga0070707_1003481891 298
1116 3300005471 Ga0070698_100008337 Ga0070698_1000083376 298
1117 3300005471 Ga0070698_100027104 Ga0070698_1000271042 298
1118 3300005530 Ga0070679_100131131 Ga0070679_1001311312 298
1119 3300005535 Ga0070684_100027191 Ga0070684_1000271912 298
1120 3300005539 Ga0068853_100027933 Ga0068853_1000279333 298
1121 3300005539 Ga0068853_100029543 Ga0068853_1000295432 298
1122 3300005543 Ga0070672_100000363 Ga0070672_1000003632 298
1123 3300005543 Ga0070672_100047360 Ga0070672_1000473602 298
1124 3300005543 Ga0070672_100157815 Ga0070672_1001578152 298
1125 3300005544 Ga0070686_100016050 Ga0070686_1000160505 298
1126 3300005544 Ga0070686_100059827 Ga0070686_1000598272 298
1127 3300005544 Ga0070686_100061550 Ga0070686_1000615502 298
1128 3300005545 Ga0070695_100069439 Ga0070695_1000694392 298
1129 3300005546 Ga0070696_100000730 Ga0070696_10000073011 298
1130 3300005546 Ga0070696_100192395 Ga0070696_1001923952 298
1131 3300005548 Ga0070665_100001806 Ga0070665_10000180614 298
1132 3300005548 Ga0070665_100003125 Ga0070665_10000312511 298
1133 3300005548 Ga0070665_100003481 Ga0070665_10000348110 298
1134 3300005548 Ga0070665_100041068 Ga0070665_1000410682 298
1135 3300005548 Ga0070665_100048820 Ga0070665_1000488202 298
1136 3300005549 Ga0070704_100256086 Ga0070704_1002560862 298
1137 3300005564 Ga0070664_100000002 Ga0070664_100000002120 298
1138 3300005564 Ga0070664_100035096 Ga0070664_1000350962 298
1139 3300005564 Ga0070664_100097101 Ga0070664_1000971012 298
1140 3300005578 Ga0068854_100001848 Ga0068854_1000018482 298
1141 3300005578 Ga0068854_100029644 Ga0068854_1000296442 298
1142 3300005614 Ga0068856_100000028 Ga0068856_10000002853 298
1143 3300005614 Ga0068856_100004556 Ga0068856_1000045564 298
1144 3300005614 Ga0068856_100130589 Ga0068856_1001305892 298
1145 3300005615 Ga0070702_100281230 Ga0070702_1002812301 298
1146 3300005616 Ga0068852_100090103 Ga0068852_1000901032 298
1147 3300005616 Ga0068852_100101714 Ga0068852_1001017142 298
1148 3300005617 Ga0068859_100001391 Ga0068859_10000139110 298
1149 3300005617 Ga0068859_100001763 Ga0068859_1000017637 298
1150 3300005617 Ga0068859_100003641 Ga0068859_1000036412 298
1151 3300005617 Ga0068859_100026071 Ga0068859_1000260713 298
1152 3300005617 Ga0068859_100043567 Ga0068859_1000435673 298
1153 3300005617 Ga0068859_100049897 Ga0068859_1000498973 298
1154 3300005617 Ga0068859_100054947 Ga0068859_1000549472 298
1155 3300005617 Ga0068859_100066208 Ga0068859_1000662084 298
1156 3300005617 Ga0068859_100314102 Ga0068859_1003141022 298
1157 3300005618 Ga0068864_100000426 Ga0068864_1000004268 298
1158 3300005618 Ga0068864_100006457 Ga0068864_1000064576 298
1159 3300005618 Ga0068864_100015090 Ga0068864_1000150905 298
1160 3300005618 Ga0068864_100029317 Ga0068864_1000293173 298
1161 3300005618 Ga0068864_100040370 Ga0068864_1000403702 298
1162 3300005718 Ga0068866_10002116 Ga0068866_100021164 298
1163 3300005718 Ga0068866_10126330 Ga0068866_101263301 298
1164 3300005719 Ga0068861_100002330 Ga0068861_10000233010 298
1165 3300005719 Ga0068861_100015073 Ga0068861_1000150732 298
1166 3300005834 Ga0068851_10003126 Ga0068851_100031263 298
1167 3300005840 Ga0068870_10017028 Ga0068870_100170284 298
1168 3300005840 Ga0068870_10068659 Ga0068870_100686592 298
1169 3300005841 Ga0068863_100005285 Ga0068863_1000052859 298
1170 3300005841 Ga0068863_100005760 Ga0068863_1000057608 298
1171 3300005841 Ga0068863_100006870 Ga0068863_1000068705 298
1172 3300005841 Ga0068863_100042216 Ga0068863_1000422162 298
1173 3300005841 Ga0068863_100062025 Ga0068863_1000620252 298
1174 3300005841 Ga0068863_100069420 Ga0068863_1000694202 298
1175 3300005842 Ga0068858_100001482 Ga0068858_10000148216 298
1176 3300005842 Ga0068858_100002236 Ga0068858_1000022363 298
1177 3300005842 Ga0068858_100005069 Ga0068858_1000050696 298
1178 3300005842 Ga0068858_100005342 Ga0068858_1000053422 298
1179 3300005842 Ga0068858_100044815 Ga0068858_1000448152 298
1180 3300005842 Ga0068858_100057657 Ga0068858_1000576573 298
1181 3300005842 Ga0068858_100135536 Ga0068858_1001355362 298
1182 3300005843 Ga0068860_100003152 Ga0068860_10000315211 298
1183 3300005843 Ga0068860_100014757 Ga0068860_1000147575 298
1184 3300005843 Ga0068860_100122061 Ga0068860_1001220612 298
1185 3300005843 Ga0068860_100149892 Ga0068860_1001498922 298
1186 3300005843 Ga0068860_100336948 Ga0068860_1003369481 298
1187 3300005844 Ga0068862_100062528 Ga0068862_1000625282 298
1188 3300005844 Ga0068862_100101371 Ga0068862_1001013712 298
1189 3300005844 Ga0068862_100370732 Ga0068862_1003707321 298
1190 3300005937 Ga0081455_10000099 Ga0081455_1000009913 298
1191 3300005985 Ga0081539_10000004 Ga0081539_10000004258 298
1192 3300005985 Ga0081539_10009727 Ga0081539_100097279 298
1193 3300006028 Ga0070717_10000216 Ga0070717_1000021637 298
1194 3300006042 Ga0075368_10008636 Ga0075368_100086362 298
1195 3300006048 Ga0075363_100047297 Ga0075363_1000472972 298
1196 3300006051 Ga0075364_10019521 Ga0075364_100195214 298
1197 3300006051 Ga0075364_10020991 Ga0075364_100209913 298
1198 3300006051 Ga0075364_10053618 Ga0075364_100536182 298
1199 3300006051 Ga0075364_10169150 Ga0075364_101691502 298
1200 3300006051 Ga0075364_10182707 Ga0075364_101827072 298
1201 3300006051 Ga0075364_10213656 Ga0075364_102136562 298
1202 3300006173 Ga0070716_100012448 Ga0070716_1000124485 298
1203 3300006175 Ga0070712_100005427 Ga0070712_1000054272 298
1204 3300006178 Ga0075367_10178347 Ga0075367_101783472 298
1205 3300006237 Ga0097621_100000850 Ga0097621_10000085013 298
1206 3300006237 Ga0097621_100015544 Ga0097621_1000155444 298
1207 3300006237 Ga0097621_100017304 Ga0097621_1000173043 298
1208 3300006237 Ga0097621_100142704 Ga0097621_1001427041 298
1209 3300006358 Ga0068871_100000242 Ga0068871_10000024226 298
1210 3300006358 Ga0068871_100000936 Ga0068871_10000093613 298
1211 3300006358 Ga0068871_100011024 Ga0068871_1000110242 298
1212 3300006844 Ga0075428_100022859 Ga0075428_1000228593 298
1213 3300006844 Ga0075428_100135045 Ga0075428_1001350452 298
1214 3300006844 Ga0075428_100203880 Ga0075428_1002038802 298
1215 3300006846 Ga0075430_100019263 Ga0075430_1000192632 298
1216 3300006852 Ga0075433_10013495 Ga0075433_100134952 298
1217 3300006871 Ga0075434_100009983 Ga0075434_1000099836 298
1218 3300006871 Ga0075434_100176299 Ga0075434_1001762992 298
1219 3300006880 Ga0075429_100000003 Ga0075429_10000000398 298
1220 3300006880 Ga0075429_100083338 Ga0075429_1000833382 298
1221 3300006881 Ga0068865_100009857 Ga0068865_1000098575 298
1222 3300006914 Ga0075436_100058923 Ga0075436_1000589232 298
1223 3300006931 Ga0097620_100001391 Ga0097620_10000139112 298
1224 3300006931 Ga0097620_100001763 Ga0097620_1000017637 298
1225 3300006931 Ga0097620_100003641 Ga0097620_10000364111 298
1226 3300006931 Ga0097620_100026070 Ga0097620_1000260703 298
1227 3300006931 Ga0097620_100043565 Ga0097620_1000435653 298
1228 3300006931 Ga0097620_100049895 Ga0097620_1000498953 298
1229 3300006931 Ga0097620_100054954 Ga0097620_1000549542 298
1230 3300006931 Ga0097620_100066207 Ga0097620_1000662072 298
1231 3300006931 Ga0097620_100314072 Ga0097620_1003140722 298
1232 3300006948 Ga0099826_10000004 Ga0099826_10000004421 298
1233 3300006948 Ga0099826_10082944 Ga0099826_100829442 298
1234 3300007076 Ga0075435_100000148 Ga0075435_10000014812 298
1235 3300007076 Ga0075435_100000252 Ga0075435_1000002528 298
1236 3300007076 Ga0075435_100001831 Ga0075435_10000183114 298
1237 3300007076 Ga0075435_100064930 Ga0075435_1000649302 298
1238 3300007076 Ga0075435_100072868 Ga0075435_1000728682 298
1239 3300007265 Ga0099794_10037849 Ga0099794_100378492 298
1240 3300007788 Ga0099795_10000015 Ga0099795_100000157 298
1241 3300009011 Ga0105251_10000043 Ga0105251_10000043108 298
1242 3300009011 Ga0105251_10000918 Ga0105251_1000091810 298
1243 3300009011 Ga0105251_10018619 Ga0105251_100186193 298
1244 3300009036 Ga0105244_10106408 Ga0105244_101064081 298
1245 3300009093 Ga0105240_10010737 Ga0105240_100107373 298
1246 3300009093 Ga0105240_10023942 Ga0105240_100239425 298
1247 3300009093 Ga0105240_10053037 Ga0105240_100530373 298
1248 3300009094 Ga0111539_10014421 Ga0111539_100144218 298
1249 3300009094 Ga0111539_10198485 Ga0111539_101984853 298
1250 3300009098 Ga0105245_10006429 Ga0105245_100064294 298
1251 3300009098 Ga0105245_10009132 Ga0105245_100091325 298
1252 3300009101 Ga0105247_10068377 Ga0105247_100683772 298
1253 3300009147 Ga0114129_10007207 Ga0114129_1000720713 298
1254 3300009148 Ga0105243_10064073 Ga0105243_100640732 298
1255 3300009148 Ga0105243_10084779 Ga0105243_100847793 298
1256 3300009148 Ga0105243_10110846 Ga0105243_101108462 298
1257 3300009148 Ga0105243_10206421 Ga0105243_102064212 298
1258 3300009174 Ga0105241_10012933 Ga0105241_100129335 298
1259 3300009176 Ga0105242_10016812 Ga0105242_100168122 298
1260 3300009176 Ga0105242_10037191 Ga0105242_100371914 298
1261 3300009177 Ga0105248_10000927 Ga0105248_100009278 298
1262 3300009177 Ga0105248_10005028 Ga0105248_100050285 298
1263 3300009177 Ga0105248_10007054 Ga0105248_100070543 298
1264 3300009177 Ga0105248_10041492 Ga0105248_100414925 298
1265 3300009545 Ga0105237_10087341 Ga0105237_100873412 298
1266 3300009551 Ga0105238_10057203 Ga0105238_100572032 298
1267 3300009551 Ga0105238_10169630 Ga0105238_101696302 298
1268 3300009553 Ga0105249_10032626 Ga0105249_100326263 298
1269 3300009553 Ga0105249_10257385 Ga0105249_102573852 298
1270 3300009553 Ga0105249_10317539 Ga0105249_103175391 298
1271 3300010159 Ga0099796_10000044 Ga0099796_1000004415 298
1272 3300011119 Ga0105246_10005346 Ga0105246_100053462 298
1273 3300011119 Ga0105246_10219537 Ga0105246_102195371 298
1274 3300013100 Ga0157373_10004784 Ga0157373_100047849 298
1275 3300013102 Ga0157371_10000123 Ga0157371_100001233 298
1276 3300013104 Ga0157370_10000013 Ga0157370_10000013112 298
1277 3300013105 Ga0157369_10000787 Ga0157369_1000078731 298
1278 3300013105 Ga0157369_10194310 Ga0157369_101943102 298
1279 3300013296 Ga0157374_10003025 Ga0157374_1000302510 298
1280 3300013296 Ga0157374_10003398 Ga0157374_100033982 298
1281 3300013296 Ga0157374_10006790 Ga0157374_100067905 298
1282 3300013296 Ga0157374_10072657 Ga0157374_100726571 298
1283 3300013296 Ga0157374_10079933 Ga0157374_100799332 298
1284 3300013297 Ga0157378_10055858 Ga0157378_100558581 298
1285 3300013306 Ga0163162_10001767 Ga0163162_100017679 298
1286 3300013306 Ga0163162_10006232 Ga0163162_100062326 298
1287 3300013306 Ga0163162_10007605 Ga0163162_100076052 298
1288 3300013306 Ga0163162_10022923 Ga0163162_100229234 298
1289 3300013306 Ga0163162_10052780 Ga0163162_100527802 298
1290 3300013307 Ga0157372_10000067 Ga0157372_1000006737 298
1291 3300013308 Ga0157375_10001878 Ga0157375_1000187811 298
1292 3300013308 Ga0157375_10004775 Ga0157375_100047752 298
1293 3300013308 Ga0157375_10011061 Ga0157375_100110616 298
1294 3300013308 Ga0157375_10062436 Ga0157375_100624362 298
1295 3300013308 Ga0157375_10633514 Ga0157375_106335141 298
1296 3300014325 Ga0163163_10001234 Ga0163163_1000123410 298
1297 3300014325 Ga0163163_10006531 Ga0163163_100065313 298
1298 3300014325 Ga0163163_10028741 Ga0163163_100287412 298
1299 3300014325 Ga0163163_10064678 Ga0163163_100646782 298
1300 3300014325 Ga0163163_10138534 Ga0163163_101385342 298
1301 3300014325 Ga0163163_10181035 Ga0163163_101810352 298
1302 3300014326 Ga0157380_10007072 Ga0157380_100070723 298
1303 3300014326 Ga0157380_10034873 Ga0157380_100348732 298
1304 3300014497 Ga0182008_10073362 Ga0182008_100733622 298
1305 3300014745 Ga0157377_10000024 Ga0157377_10000024112 298
1306 3300014968 Ga0157379_10000672 Ga0157379_100006729 298
1307 3300014968 Ga0157379_10002563 Ga0157379_1000256314 298
1308 3300014968 Ga0157379_10005542 Ga0157379_100055428 298
1309 3300014968 Ga0157379_10014368 Ga0157379_100143682 298
1310 3300014968 Ga0157379_10018408 Ga0157379_100184082 298
1311 3300014968 Ga0157379_10105787 Ga0157379_101057873 298
1312 3300014969 Ga0157376_10000400 Ga0157376_1000040017 298
1313 3300014969 Ga0157376_10000673 Ga0157376_1000067313 298
1314 3300014969 Ga0157376_10005428 Ga0157376_100054284 298
1315 3300014969 Ga0157376_10042273 Ga0157376_100422733 298
1316 3300014969 Ga0157376_10099496 Ga0157376_100994962 298
1317 3300015261 Ga0182006_1002522 Ga0182006_10025229 298
1318 3300015261 Ga0182006_1008920 Ga0182006_10089203 298
1319 3300015262 Ga0182007_10005205 Ga0182007_100052053 298
1320 3300016635 Ga0183361_10006 Ga0183361_10006222 298
1321 3300017792 Ga0163161_10015827 Ga0163161_100158275 298
1322 3300017792 Ga0163161_10149879 Ga0163161_101498792 298
1323 3300017792 Ga0163161_10159841 Ga0163161_101598412 298
1324 3300017792 Ga0163161_10348054 Ga0163161_103480541 298
1325 3300020075 Ga0206349_1733961 Ga0206349_17339612 298
1326 3300020076 Ga0206355_1008944 Ga0206355_10089442 298
1327 3300020077 Ga0206351_10549872 Ga0206351_105498723 298
1328 3300020080 Ga0206350_10951374 Ga0206350_109513742 298
1329 3300020610 Ga0154015_1218115 Ga0154015_121811515 298
1330 3300021361 Ga0213872_10123187 Ga0213872_101231871 298
1331 3300025224 Ga0209784_100003 Ga0209784_100003543 298
1332 3300025224 Ga0209784_100347 Ga0209784_1003473 298
1333 3300025225 Ga0209566_100002 Ga0209566_1000021586 298
1334 3300025225 Ga0209566_100402 Ga0209566_10040219 298
1335 3300025225 Ga0209566_102320 Ga0209566_1023201 298
1336 3300025226 Ga0209674_100005 Ga0209674_100005653 298
1337 3300025226 Ga0209674_100008 Ga0209674_100008603 298
1338 3300025226 Ga0209674_100161 Ga0209674_10016165 298
1339 3300025226 Ga0209674_100179 Ga0209674_1001795 298
1340 3300025228 Ga0209672_100001 Ga0209672_1000011116 298
1341 3300025228 Ga0209672_100052 Ga0209672_100052164 298
1342 3300025228 Ga0209672_102021 Ga0209672_1020212 298
1343 3300025229 Ga0209147_100001 Ga0209147_1000011116 298
1344 3300025229 Ga0209147_100002 Ga0209147_1000021700 298
1345 3300025230 Ga0209563_100004 Ga0209563_100004999 298
1346 3300025230 Ga0209563_102766 Ga0209563_1027662 298
1347 3300025231 Ga0207427_100670 Ga0207427_1006703 298
1348 3300025242 Ga0209258_100001 Ga0209258_1000011116 298
1349 3300025242 Ga0209258_100002 Ga0209258_1000021700 298
1350 3300025246 Ga0209646_1000022 Ga0209646_1000022359 298
1351 3300025250 Ga0209026_1006104 Ga0209026_10061042 298
1352 3300025253 Ga0209677_100009 Ga0209677_100009633 298
1353 3300025253 Ga0209677_101812 Ga0209677_1018123 298
1354 3300025254 Ga0209148_1000003 Ga0209148_10000031116 298
1355 3300025254 Ga0209148_1000021 Ga0209148_1000021453 298
1356 3300025256 Ga0209759_1000030 Ga0209759_100003025 298
1357 3300025256 Ga0209759_1000260 Ga0209759_10002601 298
1358 3300025256 Ga0209759_1006866 Ga0209759_10068663 298
1359 3300025261 Ga0209233_1000016 Ga0209233_100001676 298
1360 3300025263 Ga0209565_1000391 Ga0209565_100039124 298
1361 3300025263 Ga0209565_1004058 Ga0209565_10040583 298
1362 3300025272 Ga0209455_1000001 Ga0209455_10000011116 298
1363 3300025272 Ga0209455_1000021 Ga0209455_1000021287 298
1364 3300025272 Ga0209455_1000747 Ga0209455_100074710 298
1365 3300025273 Ga0209673_1028818 Ga0209673_10288182 298
1366 3300025284 Ga0209130_1018780 Ga0209130_10187801 298
1367 3300025284 Ga0209130_1019829 Ga0209130_10198293 298
1368 3300025284 Ga0209130_1024631 Ga0209130_10246311 298
1369 3300025291 Ga0209675_1000767 Ga0209675_100076721 298
1370 3300025291 Ga0209675_1000928 Ga0209675_10009283 298
1371 3300025291 Ga0209675_1004265 Ga0209675_10042657 298
1372 3300025292 Ga0209676_1000014 Ga0209676_1000014113 298
1373 3300025292 Ga0209676_1004645 Ga0209676_10046452 298
1374 3300025294 Ga0209025_1000003 Ga0209025_1000003189 298
1375 3300025294 Ga0209025_1000232 Ga0209025_100023295 298
1376 3300025294 Ga0209025_1000246 Ga0209025_1000246130 298
1377 3300025294 Ga0209025_1001132 Ga0209025_10011323 298
1378 3300025294 Ga0209025_1001868 Ga0209025_100186821 298
1379 3300025295 Ga0209564_1001012 Ga0209564_10010123 298
1380 3300025295 Ga0209564_1001995 Ga0209564_100199515 298
1381 3300025295 Ga0209564_1004537 Ga0209564_10045373 298
1382 3300025297 Ga0209758_1011446 Ga0209758_10114465 298
1383 3300025299 Ga0209256_1000291 Ga0209256_100029159 298
1384 3300025299 Ga0209256_1000689 Ga0209256_100068927 298
1385 3300025302 Ga0207426_1000125 Ga0207426_1000125182 298
1386 3300025302 Ga0207426_1002951 Ga0207426_10029513 298
1387 3300025304 Ga0209257_1004114 Ga0209257_100411413 298
1388 3300025315 Ga0207697_10003849 Ga0207697_100038496 298
1389 3300025728 Ga0207655_1058170 Ga0207655_10581701 298
1390 3300025735 Ga0207713_1000240 Ga0207713_100024010 298
1391 3300025735 Ga0207713_1006774 Ga0207713_10067747 298
1392 3300025885 Ga0207653_10033421 Ga0207653_100334212 298
1393 3300025899 Ga0207642_10002098 Ga0207642_100020985 298
1394 3300025899 Ga0207642_10016178 Ga0207642_100161783 298
1395 3300025900 Ga0207710_10037443 Ga0207710_100374433 298
1396 3300025903 Ga0207680_10002464 Ga0207680_100024648 298
1397 3300025903 Ga0207680_10003213 Ga0207680_100032133 298
1398 3300025903 Ga0207680_10075665 Ga0207680_100756651 298
1399 3300025907 Ga0207645_10023200 Ga0207645_100232003 298
1400 3300025907 Ga0207645_10063638 Ga0207645_100636383 298
1401 3300025907 Ga0207645_10148320 Ga0207645_101483202 298
1402 3300025908 Ga0207643_10005854 Ga0207643_100058544 298
1403 3300025908 Ga0207643_10015982 Ga0207643_100159822 298
1404 3300025908 Ga0207643_10079088 Ga0207643_100790882 298
1405 3300025908 Ga0207643_10104879 Ga0207643_101048792 298
1406 3300025910 Ga0207684_10021690 Ga0207684_100216905 298
1407 3300025910 Ga0207684_10054572 Ga0207684_100545724 298
1408 3300025912 Ga0207707_10001577 Ga0207707_1000157713 298
1409 3300025913 Ga0207695_10000887 Ga0207695_100008875 298
1410 3300025913 Ga0207695_10025935 Ga0207695_100259354 298
1411 3300025915 Ga0207693_10000712 Ga0207693_1000071216 298
1412 3300025916 Ga0207663_10011997 Ga0207663_100119975 298
1413 3300025917 Ga0207660_10235904 Ga0207660_102359042 298
1414 3300025918 Ga0207662_10028669 Ga0207662_100286693 298
1415 3300025918 Ga0207662_10050417 Ga0207662_100504173 298
1416 3300025920 Ga0207649_10000118 Ga0207649_1000011810 298
1417 3300025921 Ga0207652_10228995 Ga0207652_102289952 298
1418 3300025922 Ga0207646_10006170 Ga0207646_100061702 298
1419 3300025922 Ga0207646_10044820 Ga0207646_100448205 298
1420 3300025923 Ga0207681_10000648 Ga0207681_1000064814 298
1421 3300025923 Ga0207681_10002682 Ga0207681_1000268210 298
1422 3300025923 Ga0207681_10113440 Ga0207681_101134402 298
1423 3300025925 Ga0207650_10064656 Ga0207650_100646564 298
1424 3300025925 Ga0207650_10142528 Ga0207650_101425281 298
1425 3300025925 Ga0207650_10163730 Ga0207650_101637301 298
1426 3300025925 Ga0207650_10349373 Ga0207650_103493731 298
1427 3300025926 Ga0207659_10001002 Ga0207659_100010025 298
1428 3300025926 Ga0207659_10003004 Ga0207659_1000300410 298
1429 3300025926 Ga0207659_10066323 Ga0207659_100663233 298
1430 3300025927 Ga0207687_10001571 Ga0207687_1000157110 298
1431 3300025927 Ga0207687_10016111 Ga0207687_100161112 298
1432 3300025928 Ga0207700_10021278 Ga0207700_100212785 298
1433 3300025928 Ga0207700_10448862 Ga0207700_104488621 298
1434 3300025931 Ga0207644_10005832 Ga0207644_100058322 298
1435 3300025931 Ga0207644_10079559 Ga0207644_100795592 298
1436 3300025931 Ga0207644_10103707 Ga0207644_101037071 298
1437 3300025932 Ga0207690_10000455 Ga0207690_100004558 298
1438 3300025933 Ga0207706_10014421 Ga0207706_100144214 298
1439 3300025934 Ga0207686_10002320 Ga0207686_100023205 298
1440 3300025935 Ga0207709_10072844 Ga0207709_100728442 298
1441 3300025936 Ga0207670_10027399 Ga0207670_100273994 298
1442 3300025936 Ga0207670_10089072 Ga0207670_100890722 298
1443 3300025936 Ga0207670_10228247 Ga0207670_102282471 298
1444 3300025937 Ga0207669_10021824 Ga0207669_100218242 298
1445 3300025937 Ga0207669_10057697 Ga0207669_100576973 298
1446 3300025937 Ga0207669_10116169 Ga0207669_101161691 298
1447 3300025938 Ga0207704_10005088 Ga0207704_100050886 298
1448 3300025939 Ga0207665_10023227 Ga0207665_100232272 298
1449 3300025940 Ga0207691_10000250 Ga0207691_1000025039 298
1450 3300025940 Ga0207691_10050111 Ga0207691_100501113 298
1451 3300025940 Ga0207691_10061798 Ga0207691_100617982 298
1452 3300025940 Ga0207691_10066047 Ga0207691_100660471 298
1453 3300025940 Ga0207691_10074819 Ga0207691_100748192 298
1454 3300025940 Ga0207691_10110437 Ga0207691_101104373 298
1455 3300025941 Ga0207711_10001751 Ga0207711_1000175111 298
1456 3300025941 Ga0207711_10004442 Ga0207711_100044424 298
1457 3300025941 Ga0207711_10030749 Ga0207711_100307494 298
1458 3300025941 Ga0207711_10098106 Ga0207711_100981063 298
1459 3300025941 Ga0207711_10167300 Ga0207711_101673002 298
1460 3300025941 Ga0207711_10373936 Ga0207711_103739361 298
1461 3300025942 Ga0207689_10004261 Ga0207689_100042613 298
1462 3300025942 Ga0207689_10014604 Ga0207689_100146047 298
1463 3300025942 Ga0207689_10015537 Ga0207689_100155372 298
1464 3300025942 Ga0207689_10032521 Ga0207689_100325211 298
1465 3300025942 Ga0207689_10169745 Ga0207689_101697452 298
1466 3300025942 Ga0207689_10339176 Ga0207689_103391761 298
1467 3300025944 Ga0207661_10137465 Ga0207661_101374652 298
1468 3300025945 Ga0207679_10000001 Ga0207679_10000001293 298
1469 3300025945 Ga0207679_10131746 Ga0207679_101317461 298
1470 3300025945 Ga0207679_10188604 Ga0207679_101886042 298
1471 3300025960 Ga0207651_10002729 Ga0207651_100027298 298
1472 3300025960 Ga0207651_10256701 Ga0207651_102567012 298
1473 3300025961 Ga0207712_10238531 Ga0207712_102385311 298
1474 3300025972 Ga0207668_10001922 Ga0207668_1000192211 298
1475 3300025972 Ga0207668_10003817 Ga0207668_100038172 298
1476 3300025972 Ga0207668_10006870 Ga0207668_100068702 298
1477 3300025972 Ga0207668_10016955 Ga0207668_100169553 298
1478 3300025972 Ga0207668_10045399 Ga0207668_100453993 298
1479 3300025972 Ga0207668_10065074 Ga0207668_100650742 298
1480 3300025981 Ga0207640_10000183 Ga0207640_1000018315 298
1481 3300025981 Ga0207640_10185819 Ga0207640_101858191 298
1482 3300025986 Ga0207658_10001054 Ga0207658_1000105413 298
1483 3300025986 Ga0207658_10008330 Ga0207658_100083303 298
1484 3300025986 Ga0207658_10011808 Ga0207658_100118085 298
1485 3300025986 Ga0207658_10191192 Ga0207658_101911922 298
1486 3300026023 Ga0207677_10000405 Ga0207677_1000040511 298
1487 3300026023 Ga0207677_10005852 Ga0207677_100058525 298
1488 3300026023 Ga0207677_10013070 Ga0207677_100130703 298
1489 3300026023 Ga0207677_10105943 Ga0207677_101059432 298
1490 3300026035 Ga0207703_10000470 Ga0207703_1000047010 298
1491 3300026035 Ga0207703_10001406 Ga0207703_1000140614 298
1492 3300026035 Ga0207703_10042632 Ga0207703_100426323 298
1493 3300026035 Ga0207703_10123660 Ga0207703_101236602 298
1494 3300026041 Ga0207639_10000051 Ga0207639_1000005173 298
1495 3300026041 Ga0207639_10224561 Ga0207639_102245612 298
1496 3300026041 Ga0207639_10443788 Ga0207639_104437882 298
1497 3300026067 Ga0207678_10000001 Ga0207678_10000001141 298
1498 3300026067 Ga0207678_10138183 Ga0207678_101381832 298
1499 3300026075 Ga0207708_10007845 Ga0207708_100078452 298
1500 3300026075 Ga0207708_10115599 Ga0207708_101155992 298
1501 3300026078 Ga0207702_10000009 Ga0207702_1000000987 298
1502 3300026078 Ga0207702_10037703 Ga0207702_100377033 298
1503 3300026088 Ga0207641_10002216 Ga0207641_100022162 298
1504 3300026088 Ga0207641_10002267 Ga0207641_1000226710 298
1505 3300026088 Ga0207641_10002373 Ga0207641_100023739 298
1506 3300026088 Ga0207641_10228716 Ga0207641_102287161 298
1507 3300026089 Ga0207648_10008185 Ga0207648_100081852 298
1508 3300026089 Ga0207648_10013654 Ga0207648_100136542 298
1509 3300026089 Ga0207648_10014371 Ga0207648_100143719 298
1510 3300026095 Ga0207676_10000116 Ga0207676_1000011644 298
1511 3300026095 Ga0207676_10003146 Ga0207676_1000314610 298
1512 3300026095 Ga0207676_10010013 Ga0207676_100100134 298
1513 3300026095 Ga0207676_10037037 Ga0207676_100370372 298
1514 3300026116 Ga0207674_10027192 Ga0207674_100271925 298
1515 3300026118 Ga0207675_100001686 Ga0207675_1000016863 298
1516 3300026118 Ga0207675_100011445 Ga0207675_1000114456 298
1517 3300026118 Ga0207675_100026512 Ga0207675_1000265125 298
1518 3300026118 Ga0207675_100037019 Ga0207675_1000370192 298
1519 3300026118 Ga0207675_100062299 Ga0207675_1000622993 298
1520 3300026118 Ga0207675_100077970 Ga0207675_1000779703 298
1521 3300026118 Ga0207675_100153929 Ga0207675_1001539292 298
1522 3300026121 Ga0207683_10000135 Ga0207683_1000013513 298
1523 3300026121 Ga0207683_10001991 Ga0207683_100019916 298
1524 3300026121 Ga0207683_10009629 Ga0207683_100096296 298
1525 3300026121 Ga0207683_10016645 Ga0207683_100166452 298
1526 3300026121 Ga0207683_10079983 Ga0207683_100799833 298
1527 3300026121 Ga0207683_10476319 Ga0207683_104763191 298
1528 3300026142 Ga0207698_10084835 Ga0207698_100848352 298
1529 3300026142 Ga0207698_10196567 Ga0207698_101965672 298
1530 3300027312 Ga0209371_1003542 Ga0209371_10035422 298
1531 3300027512 Ga0209179_1000010 Ga0209179_100001056 298
1532 3300027666 Ga0209282_1000027 Ga0209282_100002767 298
1533 3300027907 Ga0207428_10132368 Ga0207428_101323682 298
1534 3300028379 Ga0268266_10004460 Ga0268266_100044607 298
1535 3300028379 Ga0268266_10005315 Ga0268266_100053159 298
1536 3300028379 Ga0268266_10064441 Ga0268266_100644413 298
1537 3300028379 Ga0268266_10081005 Ga0268266_100810052 298
1538 3300028379 Ga0268266_10232207 Ga0268266_102322072 298
1539 3300028380 Ga0268265_10004134 Ga0268265_100041343 298
1540 3300028380 Ga0268265_10135553 Ga0268265_101355532 298
1541 3300028381 Ga0268264_10001218 Ga0268264_1000121813 298
1542 3300028381 Ga0268264_10002397 Ga0268264_100023979 298
1543 3300028381 Ga0268264_10009538 Ga0268264_100095383 298
1544 3300028381 Ga0268264_10056158 Ga0268264_100561583 298
1545 3300028381 Ga0268264_10104946 Ga0268264_101049462 298
1546 3300028381 Ga0268264_10260017 Ga0268264_102600172 298
1547 3300028573 Ga0265334_10000338 Ga0265334_1000033812 298
1548 3300028577 Ga0265318_10000616 Ga0265318_1000061612 298
1549 3300028800 Ga0265338_10003965 Ga0265338_1000396515 298
1550 3300028800 Ga0265338_10016757 Ga0265338_100167573 298
1551 3300030500 Ga0268256_1003237 Ga0268256_10032377 298
1552 3300030521 Ga0307511_10000040 Ga0307511_1000004036 298
1553 3300031235 Ga0265330_10001287 Ga0265330_1000128710 298
1554 3300031238 Ga0265332_10000013 Ga0265332_10000013121 298
1555 3300031239 Ga0265328_10002630 Ga0265328_100026304 298
1556 3300031240 Ga0265320_10004288 Ga0265320_100042882 298
1557 3300031240 Ga0265320_10129856 Ga0265320_101298561 298
1558 3300031241 Ga0265325_10002547 Ga0265325_1000254710 298
1559 3300031241 Ga0265325_10054134 Ga0265325_100541341 298
1560 3300031242 Ga0265329_10009075 Ga0265329_100090752 298
1561 3300031247 Ga0265340_10012493 Ga0265340_100124932 298
1562 3300031247 Ga0265340_10031095 Ga0265340_100310952 298
1563 3300031249 Ga0265339_10020126 Ga0265339_100201262 298
1564 3300031250 Ga0265331_10011463 Ga0265331_100114632 298
1565 3300031251 Ga0265327_10041840 Ga0265327_100418402 298
1566 3300031251 Ga0265327_10082527 Ga0265327_100825272 298
1567 3300031344 Ga0265316_10022484 Ga0265316_100224842 298
1568 3300031548 Ga0307408_100422813 Ga0307408_1004228131 298
1569 3300031595 Ga0265313_10001678 Ga0265313_1000167813 298
1570 3300031665 Ga0316575_10000044 Ga0316575_1000004415 298
1571 3300031665 Ga0316575_10024170 Ga0316575_100241702 298
1572 3300031665 Ga0316575_10070129 Ga0316575_100701291 298
1573 3300031691 Ga0316579_10001389 Ga0316579_100013892 298
1574 3300031711 Ga0265314_10009622 Ga0265314_100096226 298
1575 3300031711 Ga0265314_10080078 Ga0265314_100800781 298
1576 3300031712 Ga0265342_10004299 Ga0265342_100042998 298
1577 3300031727 Ga0316576_10002059 Ga0316576_100020593 298
1578 3300031728 Ga0316578_10005109 Ga0316578_100051095 298
1579 3300031728 Ga0316578_10017829 Ga0316578_100178292 298
1580 3300031731 Ga0307405_10095709 Ga0307405_100957091 298
1581 3300031733 Ga0316577_10001223 Ga0316577_100012231 298
1582 3300031824 Ga0307413_10173756 Ga0307413_101737562 298
1583 3300031911 Ga0307412_10000517 Ga0307412_1000051715 298
1584 3300031911 Ga0307412_10001984 Ga0307412_100019847 298
1585 3300032133 Ga0316583_10003885 Ga0316583_100038853 298
1586 3300032133 Ga0316583_10006085 Ga0316583_100060853 298
1587 3300032139 Ga0316580_10042784 Ga0316580_100427842 298
1588 3300035083 Ga0373926_0005073 Ga0373926_0005073_62_1030 298
1589 3300035083 Ga0373926_0006370 Ga0373926_0006370_2462_3430 298
1590 3300035086 Ga0373934_0007124 Ga0373934_0007124_212_1180 298
1591 3300035086 Ga0373934_0063607 Ga0373934_0063607_15_983 298
1592 3300035089 Ga0373944_0008624 Ga0373944_0008624_617_1585 298
1593 3300035089 Ga0373944_0010603 Ga0373944_0010603_943_1911 298
1594 3300035113 Ga0373936_0009320 Ga0373936_0009320_2286_3254 298
1595 3300035113 Ga0373936_0053080 Ga0373936_0053080_17_985 298
1596 3300035114 Ga0373939_0047628 Ga0373939_0047628_11_979 298
1597 3300035115 Ga0373941_0056695 Ga0373941_0056695_143_1111 298
1598 3300035118 Ga0373954_0000511 Ga0373954_0000511_4980_5948 298
1599 3300035118 Ga0373954_0041456 Ga0373954_0041456_589_1557 298
1600 3300035119 Ga0373956_0092453 Ga0373956_0092453_409_1377 298
1601 3300035121 Ga0373960_0009118 Ga0373960_0009118_248_1216 298
1602 3300035171 Ga0373946_0103301 Ga0373946_0103301_247_1215 298
1603 3300035172 Ga0373955_0007065 Ga0373955_0007065_3855_4823 298
1604 3300035172 Ga0373955_0100024 Ga0373955_0100024_88_1047 298
1605 3300035207 Ga0373942_0012448 Ga0373942_0012448_528_1496 298
1606 3300035398 Ga0316574_0005234 Ga0316574_0005234_2402_3361 298
1607 3300035398 Ga0316574_0054690 Ga0316574_0054690_51_1010 298
1608 3300035398 Ga0316574_0086539 Ga0316574_0086539_772_1731 298
1609 3300035398 Ga0316574_0110230 Ga0316574_0110230_505_1464 298
1610 3300035410 Ga0373924_0013797 Ga0373924_0013797_2009_2977 298
1611 3300035692 Ga0373935_0032053 Ga0373935_0032053_1467_2435 298
1612 3300035692 Ga0373935_0210887 Ga0373935_0210887_118_1086 298
1613 3300035724 Ga0373933_0005238 Ga0373933_0005238_2599_3567 298
1614 3300035724 Ga0373933_0063753 Ga0373933_0063753_1247_2215 298
1615 3300035725 Ga0373947_0005778 Ga0373947_0005778_1513_2481 298
1616 3300036401 Ga0373937_0002644 Ga0373937_0002644_10594_11562 298
1617 3300036401 Ga0373937_0005522 Ga0373937_0005522_939_1907 298
1618 3300036401 Ga0373937_0099932 Ga0373937_0099932_23_982 298
1619 3300036401 Ga0373937_0103339 Ga0373937_0103339_1647_2615 298
1620 3300036712 Ga0316584_0010407 Ga0316584_0010407_1425_2399 298
1621 3300037068 Ga0373925_0005260 Ga0373925_0005260_344_1312 298
1622 3300037068 Ga0373925_0087690 Ga0373925_0087690_831_1799 298
1623 3300037068 Ga0373925_0217629 Ga0373925_0217629_105_1073 298
1624 3300037418 Ga0395900_0007411 Ga0395900_0007411_7395_8360 298
1625 3300037418 Ga0395900_0063495 Ga0395900_0063495_2203_3165 298
1626 3300037418 Ga0395900_0107797 Ga0395900_0107797_297_1268 298
1627 3300037471 Ga0395905_0000459 Ga0395905_0000459_56017_56988 298
1628 3300037471 Ga0395905_0006573 Ga0395905_0006573_5148_6119 298
1629 3300037471 Ga0395905_0284640 Ga0395905_0284640_513_1484 298
1630 3300039062 Ga0400483_048159 Ga0400483_048159_834_1817 298
1631 3300039062 Ga0400483_289455 Ga0400483_289455_476_1459 298
1632 3300039093 Ga0400489_95529 Ga0400489_95529_167_1126 298
1633 3300039447 Ga0436361_0441147 Ga0436361_0441147_246_1214 298
1634 3300039447 Ga0436361_0969208 Ga0436361_0969208_1495_2466 298
1635 3300042876 Ga0451577_0021208 Ga0451577_0021208_4222_5190 298
1636 3300042876 Ga0451577_0054789 Ga0451577_0054789_1852_2817 298
1637 3300042876 Ga0451577_0072030 Ga0451577_0072030_185_1150 298
1638 3300044656 Ga0466969_0038812 Ga0466969_0038812_441_1406 298
1639 3300044658 Ga0466972_0044311 Ga0466972_0044311_708_1673 298
1640 3300044658 Ga0466972_0065985 Ga0466972_0065985_173_1141 298
1641 3300044666 Ga0466977_0003177 Ga0466977_0003177_5822_6790 298
1642 3300044673 Ga0453683_0184879 Ga0453683_0184879_343_1311 298
1643 3300044684 Ga0466966_0015864 Ga0466966_0015864_438_1403 298
1644 3300044693 Ga0466961_0005511 Ga0466961_0005511_367_1332 298
1645 3300044693 Ga0466961_0020504 Ga0466961_0020504_2905_3876 298
1646 3300044712 Ga0453684_0000005 Ga0453684_0000005_199_1167 298
1647 3300044712 Ga0453684_0000069 Ga0453684_0000069_144_1109 298
1648 3300044712 Ga0453684_0000292 Ga0453684_0000292_213_1181 298
1649 3300044712 Ga0453684_0002457 Ga0453684_0002457_175_1143 298
1650 3300044712 Ga0453684_0156086 Ga0453684_0156086_1608_2567 298
1651 3300044712 Ga0453684_0320134 Ga0453684_0320134_343_1311 298
1652 3300044712 Ga0453684_0326064 Ga0453684_0326064_185_1150 298
1653 3300044712 Ga0453684_0425567 Ga0453684_0425567_404_1372 298
1654 3300045051 Ga0451576_0017345 Ga0451576_0017345_144_1109 298
1655 3300045051 Ga0451576_0095994 Ga0451576_0095994_1934_2899 298
1656 3300045051 Ga0451576_0165298 Ga0451576_0165298_1188_2153 298
1657 3300045051 Ga0451576_0260055 Ga0451576_0260055_584_1552 298
1658 3300045976 Ga0466967_0458257 Ga0466967_0458257_48_1016 298
1659 3300046454 Ga0495592_0000656 Ga0495592_0000656_16103_17071 298
1660 3300046454 Ga0495592_0005047 Ga0495592_0005047_64_1035 298
1661 3300046455 Ga0495603_0023574 Ga0495603_0023574_1099_2070 298
1662 3300046455 Ga0495603_0065433 Ga0495603_0065433_1085_2056 298
1663 3300046457 Ga0495590_0004432 Ga0495590_0004432_2126_3097 298
1664 3300046457 Ga0495590_0016892 Ga0495590_0016892_766_1737 298
1665 3300046458 Ga0495591_001067 Ga0495591_001067_14698_15669 298
1666 3300046459 Ga0495629_0001122 Ga0495629_0001122_3403_4374 298
1667 3300046459 Ga0495629_0001555 Ga0495629_0001555_5440_6411 298
1668 3300046459 Ga0495629_0005595 Ga0495629_0005595_7225_8196 298
1669 3300046459 Ga0495629_0011926 Ga0495629_0011926_4990_5961 298
1670 3300046461 Ga0495641_0023762 Ga0495641_0023762_2048_3019 298
1671 3300046461 Ga0495641_0029948 Ga0495641_0029948_235_1203 298
1672 3300046462 Ga0495651_0014567 Ga0495651_0014567_3851_4822 298
1673 3300046462 Ga0495651_0081100 Ga0495651_0081100_834_1802 298
1674 3300046463 Ga0495653_0017032 Ga0495653_0017032_3923_4894 298
1675 3300046463 Ga0495653_0068371 Ga0495653_0068371_919_1887 298
1676 3300046463 Ga0495653_0069892 Ga0495653_0069892_981_1952 298
1677 3300046463 Ga0495653_0078498 Ga0495653_0078498_438_1406 298
1678 3300046471 Ga0495650_0006594 Ga0495650_0006594_1887_2858 298
1679 3300046471 Ga0495650_0007975 Ga0495650_0007975_1959_2930 298
1680 3300046472 Ga0495580_0003364 Ga0495580_0003364_4886_5854 298
1681 3300046472 Ga0495580_0013334 Ga0495580_0013334_1956_2927 298
1682 3300046472 Ga0495580_0048268 Ga0495580_0048268_20_991 298
1683 3300046472 Ga0495580_0070877 Ga0495580_0070877_318_1283 298
1684 3300046472 Ga0495580_0112193 Ga0495580_0112193_285_1256 298
1685 3300046473 Ga0495582_0007041 Ga0495582_0007041_1369_2340 298
1686 3300046474 Ga0495605_0002346 Ga0495605_0002346_8507_9478 298
1687 3300046474 Ga0495605_0009123 Ga0495605_0009123_3758_4729 298
1688 3300046475 Ga0495639_0019210 Ga0495639_0019210_1082_2050 298
1689 3300046476 Ga0495662_0015959 Ga0495662_0015959_1738_2706 298
1690 3300046477 Ga0495664_0001630 Ga0495664_0001630_1242_2213 298
1691 3300046477 Ga0495664_0020070 Ga0495664_0020070_152_1123 298
1692 3300046477 Ga0495664_0054960 Ga0495664_0054960_1377_2345 298
1693 3300046492 Ga0495585_0014464 Ga0495585_0014464_1717_2688 298
1694 3300046499 Ga0495594_0108438 Ga0495594_0108438_190_1158 298
1695 3300046500 Ga0495596_0014151 Ga0495596_0014151_1059_2030 298
1696 3300046500 Ga0495596_0036601 Ga0495596_0036601_238_1209 298
1697 3300046501 Ga0495607_0002337 Ga0495607_0002337_5013_5981 298
1698 3300046506 Ga0495583_0006961 Ga0495583_0006961_3139_4110 298
1699 3300046507 Ga0495606_0003632 Ga0495606_0003632_14567_15538 298
1700 3300046507 Ga0495606_0013398 Ga0495606_0013398_735_1706 298
1701 3300046511 Ga0495608_0010013 Ga0495608_0010013_1469_2440 298
1702 3300046511 Ga0495608_0013655 Ga0495608_0013655_493_1461 298
1703 3300046511 Ga0495608_0056949 Ga0495608_0056949_627_1598 298
1704 3300046512 Ga0495610_0001322 Ga0495610_0001322_18737_19708 298
1705 3300046512 Ga0495610_0003388 Ga0495610_0003388_11359_12330 298
1706 3300046513 Ga0495616_0002264 Ga0495616_0002264_9527_10498 298
1707 3300046514 Ga0495618_0013126 Ga0495618_0013126_1372_2343 298
1708 3300046514 Ga0495618_0018749 Ga0495618_0018749_2762_3730 298
1709 3300046514 Ga0495618_0019154 Ga0495618_0019154_1242_2213 298
1710 3300046516 Ga0495628_0041838 Ga0495628_0041838_1446_2417 298
1711 3300046516 Ga0495628_0074301 Ga0495628_0074301_598_1569 298
1712 3300046517 Ga0495630_0028523 Ga0495630_0028523_1242_2213 298
1713 3300046517 Ga0495630_0042493 Ga0495630_0042493_878_1846 298
1714 3300046517 Ga0495630_0061102 Ga0495630_0061102_255_1226 298
1715 3300046517 Ga0495630_0106572 Ga0495630_0106572_305_1276 298
1716 3300046523 Ga0495644_0016601 Ga0495644_0016601_1591_2556 298
1717 3300046523 Ga0495644_0021387 Ga0495644_0021387_1224_2195 298
1718 3300046524 Ga0495648_0115321 Ga0495648_0115321_267_1238 298
1719 3300046526 Ga0495666_0007051 Ga0495666_0007051_3407_4378 298
1720 3300046526 Ga0495666_0019753 Ga0495666_0019753_1514_2482 298
1721 3300046526 Ga0495666_0019792 Ga0495666_0019792_1511_2482 298
1722 3300046526 Ga0495666_0035367 Ga0495666_0035367_249_1217 298
1723 3300046528 Ga0495642_0070860 Ga0495642_0070860_197_1165 298
1724 3300046529 Ga0495652_0027469 Ga0495652_0027469_933_1901 298
1725 3300046529 Ga0495652_0041947 Ga0495652_0041947_1630_2601 298
1726 3300046529 Ga0495652_0147434 Ga0495652_0147434_35_1006 298
1727 3300046529 Ga0495652_0151364 Ga0495652_0151364_570_1541 298
1728 3300046529 Ga0495652_0261084 Ga0495652_0261084_206_1177 298
1729 3300046531 Ga0495665_0007297 Ga0495665_0007297_1326_2297 298
1730 3300046531 Ga0495665_0009812 Ga0495665_0009812_340_1308 298
1731 3300046531 Ga0495665_0024365 Ga0495665_0024365_1007_1978 298
1732 3300046531 Ga0495665_0025100 Ga0495665_0025100_197_1168 298
1733 3300046531 Ga0495665_0095442 Ga0495665_0095442_515_1483 298
1734 3300046533 Ga0495640_0002796 Ga0495640_0002796_8895_9863 298
1735 3300046533 Ga0495640_0048207 Ga0495640_0048207_47_1015 298
1736 3300046535 Ga0495586_0000700 Ga0495586_0000700_10786_11754 298
1737 3300046535 Ga0495586_0001843 Ga0495586_0001843_5010_5978 298
1738 3300046535 Ga0495586_0124872 Ga0495586_0124872_93_1061 298
1739 3300046536 Ga0495587_0022001 Ga0495587_0022001_150_1121 298
1740 3300046536 Ga0495587_0127294 Ga0495587_0127294_95_1063 298
1741 3300046537 Ga0495598_0058623 Ga0495598_0058623_64_1029 298
1742 3300046538 Ga0495609_0049638 Ga0495609_0049638_647_1609 298
1743 3300046539 Ga0495621_0000296 Ga0495621_0000296_5429_6394 298
1744 3300046543 Ga0495645_0007321 Ga0495645_0007321_3929_4900 298
1745 3300046543 Ga0495645_0062660 Ga0495645_0062660_877_1848 298
1746 3300046543 Ga0495645_0106476 Ga0495645_0106476_20_988 298
1747 3300046543 Ga0495645_0117467 Ga0495645_0117467_105_1073 298
1748 3300046557 Ga0495622_0000384 Ga0495622_0000384_15299_16270 298
1749 3300046557 Ga0495622_0099965 Ga0495622_0099965_50_1018 298
1750 3300046559 Ga0495667_0001556 Ga0495667_0001556_8755_9723 298
1751 3300046559 Ga0495667_0107461 Ga0495667_0107461_502_1470 298
1752 3300046642 Ga0495634_0008971 Ga0495634_0008971_4931_5899 298
1753 3300046642 Ga0495634_0019668 Ga0495634_0019668_1368_2339 298
1754 3300046660 Ga0495625_0115707 Ga0495625_0115707_192_1163 298
1755 3300046663 Ga0495635_0081050 Ga0495635_0081050_139_1110 298
1756 3300046664 Ga0495659_0080610 Ga0495659_0080610_100_1059 298
1757 3300046665 Ga0495661_0036989 Ga0495661_0036989_1614_2585 298
1758 3300046674 Ga0495588_0004211 Ga0495588_0004211_4771_5739 298
1759 3300046675 Ga0495657_0229588 Ga0495657_0229588_100_1068 298
1760 3300046678 Ga0495599_0056256 Ga0495599_0056256_241_1209 298
1761 3300046678 Ga0495599_0072766 Ga0495599_0072766_1147_2118 298
1762 3300046679 Ga0495623_0015754 Ga0495623_0015754_3684_4655 298
1763 3300046680 Ga0495646_0049962 Ga0495646_0049962_206_1177 298
1764 3300046680 Ga0495646_0079511 Ga0495646_0079511_631_1602 298
1765 3300046681 Ga0495647_0000547 Ga0495647_0000547_3575_4543 298
1766 3300046681 Ga0495647_0005874 Ga0495647_0005874_696_1661 298
1767 3300046681 Ga0495647_0033098 Ga0495647_0033098_678_1646 298
1768 3300046683 Ga0495658_0003785 Ga0495658_0003785_4134_5102 298
1769 3300046683 Ga0495658_0054498 Ga0495658_0054498_899_1864 298
1770 3300046689 Ga0495613_0015729 Ga0495613_0015729_4044_5012 298
1771 3300046689 Ga0495613_0077604 Ga0495613_0077604_1331_2299 298
1772 3300046690 Ga0495624_0004640 Ga0495624_0004640_3385_4356 298
1773 3300046690 Ga0495624_0019396 Ga0495624_0019396_3355_4326 298
1774 3300046690 Ga0495624_0032633 Ga0495624_0032633_1459_2427 298
1775 3300046690 Ga0495624_0042322 Ga0495624_0042322_515_1486 298
1776 3300046690 Ga0495624_0048959 Ga0495624_0048959_236_1204 298
1777 3300046690 Ga0495624_0095750 Ga0495624_0095750_15_986 298
1778 3300046690 Ga0495624_0105787 Ga0495624_0105787_546_1517 298
1779 3300046691 Ga0495670_0092271 Ga0495670_0092271_125_1090 298
1780 3300046692 Ga0495671_0004296 Ga0495671_0004296_2164_3135 298
1781 3300046692 Ga0495671_0018768 Ga0495671_0018768_2570_3541 298
1782 3300046694 Ga0495649_0005369 Ga0495649_0005369_5628_6599 298
1783 3300046694 Ga0495649_0007581 Ga0495649_0007581_2940_3911 298
1784 3300046694 Ga0495649_0022647 Ga0495649_0022647_1357_2322 298
1785 3300046794 Ga0495589_0016505 Ga0495589_0016505_1994_2965 298
1786 3300046809 Ga0495600_0007477 Ga0495600_0007477_2633_3601 298
1787 3300046809 Ga0495600_0012320 Ga0495600_0012320_3499_4467 298
1788 3300047315 Ga0495581_0041545 Ga0495581_0041545_1273_2244 298
1789 3300047315 Ga0495581_0043641 Ga0495581_0043641_1187_2158 298
1790 3300047317 Ga0495604_0008096 Ga0495604_0008096_3499_4467 298
1791 3300047317 Ga0495604_0036357 Ga0495604_0036357_1573_2544 298
1792 3300047317 Ga0495604_0049532 Ga0495604_0049532_1096_2067 298
1793 3300047318 Ga0495636_0005697 Ga0495636_0005697_3464_4432 298
1794 3300047318 Ga0495636_0029847 Ga0495636_0029847_467_1438 298
1795 3300047319 Ga0495674_0074170 Ga0495674_0074170_1401_2372 298
1796 3300047319 Ga0495674_0171598 Ga0495674_0171598_293_1264 298
1797 3300047319 Ga0495674_0237369 Ga0495674_0237369_307_1275 298
1798 3300047320 Ga0495672_0009131 Ga0495672_0009131_2517_3488 298
1799 3300047321 Ga0495676_0170058 Ga0495676_0170058_263_1234 298
1800 3300047322 Ga0495680_0002481 Ga0495680_0002481_4360_5328 298
1801 3300047322 Ga0495680_0008190 Ga0495680_0008190_7188_8159 298
1802 3300047322 Ga0495680_0045496 Ga0495680_0045496_557_1528 298
1803 3300047322 Ga0495680_0070192 Ga0495680_0070192_206_1177 298
1804 3300047323 Ga0495683_0014520 Ga0495683_0014520_3064_4035 298
1805 3300047323 Ga0495683_0017929 Ga0495683_0017929_1249_2220 298
1806 3300047323 Ga0495683_0018880 Ga0495683_0018880_105_1076 298
1807 3300047443 Ga0495687_013128 Ga0495687_013128_2352_3323 298
1808 3300047444 Ga0495675_0014781 Ga0495675_0014781_945_1916 298
1809 3300047444 Ga0495675_0020266 Ga0495675_0020266_3091_4062 298
1810 3300047446 Ga0495679_000393 Ga0495679_000393_16812_17783 298
1811 3300047446 Ga0495679_018443 Ga0495679_018443_421_1392 298
1812 3300047469 Ga0495673_0005343 Ga0495673_0005343_5665_6636 298
1813 3300047470 Ga0495681_0029210 Ga0495681_0029210_985_1950 298
1814 3300047673 Ga0495593_0050898 Ga0495593_0050898_1199_2167 298
1815 3300047673 Ga0495593_0052812 Ga0495593_0052812_192_1163 298
1816 3300048088 Ga0495602_0073991 Ga0495602_0073991_1372_2343 298
1817 3300048088 Ga0495602_0104097 Ga0495602_0104097_1328_2299 298
1818 3300048088 Ga0495602_0140357 Ga0495602_0140357_407_1378 298
1819 3300048088 Ga0495602_0216035 Ga0495602_0216035_150_1118 298
1820 3300048089 Ga0495614_0017413 Ga0495614_0017413_155_1126 298
1821 3300048089 Ga0495614_0046312 Ga0495614_0046312_473_1444 298
1822 3300048091 Ga0495626_0017721 Ga0495626_0017721_167_1138 298
1823 3300048903 Ga0496100_0065127 Ga0496100_0065127_361_1332 298
1824 3300048903 Ga0496100_0106589 Ga0496100_0106589_717_1685 298
1825 3300048904 Ga0496101_0034375 Ga0496101_0034375_576_1544 298
1826 3300048904 Ga0496101_0055467 Ga0496101_0055467_1813_2784 298
1827 3300048904 Ga0496101_0058215 Ga0496101_0058215_1068_2039 298
1828 3300048904 Ga0496101_0170998 Ga0496101_0170998_465_1433 298
1829 3300048904 Ga0496101_0251750 Ga0496101_0251750_337_1302 298
1830 3300048905 Ga0496102_0002317 Ga0496102_0002317_32_1003 298
1831 3300048905 Ga0496102_0005979 Ga0496102_0005979_7864_8835 298
1832 3300048906 Ga0496103_0001266 Ga0496103_0001266_1216_2187 298
1833 3300048906 Ga0496103_0063848 Ga0496103_0063848_1262_2233 298
1834 3300048906 Ga0496103_0185938 Ga0496103_0185938_22_993 298
1835 3300048907 Ga0496104_0023100 Ga0496104_0023100_4298_5266 298
1836 3300048908 Ga0496105_0027773 Ga0496105_0027773_3070_4038 298
1837 3300048908 Ga0496105_0144541 Ga0496105_0144541_50_1015 298
1838 3300048910 Ga0496107_0052676 Ga0496107_0052676_388_1359 298
1839 3300048911 Ga0496108_0058208 Ga0496108_0058208_2093_3058 298
1840 3300048911 Ga0496108_0088391 Ga0496108_0088391_178_1146 298
1841 3300048912 Ga0496109_0013548 Ga0496109_0013548_4815_5783 298
1842 3300048912 Ga0496109_0047779 Ga0496109_0047779_1821_2789 298
1843 3300048912 Ga0496109_0058772 Ga0496109_0058772_1998_2963 298
1844 3300048913 Ga0496110_0033052 Ga0496110_0033052_1026_1997 298
1845 3300048913 Ga0496110_0076977 Ga0496110_0076977_923_1891 298
1846 3300048913 Ga0496110_0159930 Ga0496110_0159930_50_1015 298
1847 3300048913 Ga0496110_0200922 Ga0496110_0200922_655_1623 298
1848 3300048915 Ga0496112_0001019 Ga0496112_0001019_12121_13089 298
1849 3300048915 Ga0496112_0007712 Ga0496112_0007712_117_1076 298
1850 3300048915 Ga0496112_0285943 Ga0496112_0285943_409_1380 298
1851 3300048917 Ga0496114_0060896 Ga0496114_0060896_1922_2893 298
1852 3300048917 Ga0496114_0065647 Ga0496114_0065647_1392_2357 298
1853 3300048918 Ga0496115_0023078 Ga0496115_0023078_493_1461 298
1854 3300048918 Ga0496115_0142818 Ga0496115_0142818_23_994 298
1855 3300048919 Ga0496116_0002800 Ga0496116_0002800_2085_3056 298
1856 3300048919 Ga0496116_0031243 Ga0496116_0031243_382_1347 298
1857 3300048920 Ga0496117_0003524 Ga0496117_0003524_12466_13437 298
1858 3300048920 Ga0496117_0122973 Ga0496117_0122973_551_1522 298
1859 3300048921 Ga0496118_0001182 Ga0496118_0001182_22651_23622 298
1860 3300048921 Ga0496118_0010497 Ga0496118_0010497_8137_9102 298
1861 3300048921 Ga0496118_0016304 Ga0496118_0016304_3486_4457 298
1862 3300048921 Ga0496118_0064093 Ga0496118_0064093_1481_2452 298
1863 3300048921 Ga0496118_0064786 Ga0496118_0064786_37_1008 298
1864 3300048922 Ga0496119_0012099 Ga0496119_0012099_1128_2093 298
1865 3300048922 Ga0496119_0032080 Ga0496119_0032080_2141_3112 298
1866 3300048922 Ga0496119_0086290 Ga0496119_0086290_124_1095 298
1867 3300048923 Ga0496120_0012814 Ga0496120_0012814_1789_2754 298
1868 3300048924 Ga0496121_0001404 Ga0496121_0001404_2745_3710 298
1869 3300048924 Ga0496121_0011373 Ga0496121_0011373_7277_8248 298
1870 3300048924 Ga0496121_0014040 Ga0496121_0014040_5542_6513 298
1871 3300048924 Ga0496121_0018896 Ga0496121_0018896_2100_3071 298
1872 3300048924 Ga0496121_0030272 Ga0496121_0030272_1859_2824 298
1873 3300048924 Ga0496121_0054706 Ga0496121_0054706_2076_3047 298
1874 3300048924 Ga0496121_0092584 Ga0496121_0092584_985_1950 298
1875 3300048925 Ga0496122_0000029 Ga0496122_0000029_57212_58177 298
1876 3300048925 Ga0496122_0038955 Ga0496122_0038955_1498_2469 298
1877 3300048926 Ga0496123_0000531 Ga0496123_0000531_7448_8413 298
1878 3300048927 Ga0496124_0000024 Ga0496124_0000024_258975_259940 298
1879 3300048927 Ga0496124_0112898 Ga0496124_0112898_242_1213 298
1880 3300048927 Ga0496124_0156094 Ga0496124_0156094_456_1421 298
1881 3300048928 Ga0496125_0000244 Ga0496125_0000244_49143_50108 298
1882 3300048928 Ga0496125_0010345 Ga0496125_0010345_8132_9103 298
1883 3300048929 Ga0496126_0002625 Ga0496126_0002625_3333_4304 298
1884 3300048929 Ga0496126_0009820 Ga0496126_0009820_4582_5553 298
1885 3300048929 Ga0496126_0014290 Ga0496126_0014290_2584_3555 298
1886 3300048929 Ga0496126_0039369 Ga0496126_0039369_1572_2540 298
1887 3300048929 Ga0496126_0047837 Ga0496126_0047837_1998_2969 298
1888 3300049460 Ga0495682_0054612 Ga0495682_0054612_341_1312 298
1889 3300049568 Ga0501031_0014904 Ga0501031_0014904_2210_3172 298
1890 3300049568 Ga0501031_0027229 Ga0501031_0027229_2179_3138 298
1891 3300049568 Ga0501031_0045755 Ga0501031_0045755_1633_2595 298
1892 3300049569 Ga0501032_0005202 Ga0501032_0005202_5885_6847 298
1893 3300049570 Ga0501033_0010587 Ga0501033_0010587_1418_2377 298
1894 3300049570 Ga0501033_0035348 Ga0501033_0035348_989_1954 298
1895 3300049571 Ga0501034_0000379 Ga0501034_0000379_44073_45044 298
1896 3300049571 Ga0501034_0151733 Ga0501034_0151733_978_1940 298
1897 3300049571 Ga0501034_0203588 Ga0501034_0203588_485_1447 298
1898 3300049572 Ga0501036_0001842 Ga0501036_0001842_3351_4313 298
1899 3300049572 Ga0501036_0046990 Ga0501036_0046990_958_1917 298
1900 3300049572 Ga0501036_0265984 Ga0501036_0265984_114_1082 298
1901 3300049573 Ga0501037_0045331 Ga0501037_0045331_484_1446 298
1902 3300049574 Ga0501038_0006845 Ga0501038_0006845_3007_3966 298
1903 3300049574 Ga0501038_0060857 Ga0501038_0060857_355_1317 298
1904 3300049575 Ga0501039_0002674 Ga0501039_0002674_8241_9200 298
1905 3300049575 Ga0501039_0006011 Ga0501039_0006011_6528_7496 298
1906 3300049575 Ga0501039_0082325 Ga0501039_0082325_719_1687 298
1907 3300049576 Ga0501040_0009800 Ga0501040_0009800_1577_2536 298
1908 3300049576 Ga0501040_0033745 Ga0501040_0033745_2390_3358 298
1909 3300049577 Ga0501041_0000892 Ga0501041_0000892_650_1609 298
1910 3300049577 Ga0501041_0016391 Ga0501041_0016391_224_1192 298
1911 3300049577 Ga0501041_0062356 Ga0501041_0062356_485_1453 298
1912 3300049577 Ga0501041_0093134 Ga0501041_0093134_264_1232 298
1913 3300049577 Ga0501041_0135803 Ga0501041_0135803_62_1021 298
1914 3300049578 Ga0501042_0018221 Ga0501042_0018221_2177_3145 298
1915 3300049579 Ga0501043_0003611 Ga0501043_0003611_353_1315 298
1916 3300049579 Ga0501043_0410583 Ga0501043_0410583_23_988 298
1917 3300049580 Ga0501046_0004458 Ga0501046_0004458_8362_9321 298
1918 3300049580 Ga0501046_0029371 Ga0501046_0029371_3250_4212 298
1919 3300049580 Ga0501046_0120908 Ga0501046_0120908_902_1861 298
1920 3300049581 Ga0501047_0003174 Ga0501047_0003174_1054_2019 298
1921 3300049581 Ga0501047_0012421 Ga0501047_0012421_537_1499 298
1922 3300049582 Ga0501048_0000742 Ga0501048_0000742_16504_17463 298
1923 3300049584 Ga0501068_0005644 Ga0501068_0005644_2116_3075 298
1924 3300049585 Ga0501069_0038265 Ga0501069_0038265_681_1640 298
1925 3300049587 Ga0501071_0000230 Ga0501071_0000230_15883_16842 298
1926 3300049587 Ga0501071_0010254 Ga0501071_0010254_83_1051 298
1927 3300049588 Ga0501072_0000598 Ga0501072_0000598_8558_9517 298
1928 3300049588 Ga0501072_0010770 Ga0501072_0010770_3382_4350 298
1929 3300049588 Ga0501072_0289604 Ga0501072_0289604_77_1036 298
1930 3300049589 Ga0501073_0226735 Ga0501073_0226735_41_1000 298
1931 3300049590 Ga0501074_0026229 Ga0501074_0026229_2864_3823 298
1932 3300049590 Ga0501074_0044481 Ga0501074_0044481_1800_2768 298
1933 3300049590 Ga0501074_0072698 Ga0501074_0072698_737_1696 298
1934 3300049591 Ga0501075_0000499 Ga0501075_0000499_6055_7014 298
1935 3300049591 Ga0501075_0009426 Ga0501075_0009426_3426_4394 298
1936 3300049591 Ga0501075_0021081 Ga0501075_0021081_1623_2591 298
1937 3300049591 Ga0501075_0057419 Ga0501075_0057419_812_1771 298
1938 3300049591 Ga0501075_0213671 Ga0501075_0213671_335_1294 298
1939 3300049592 Ga0501076_0000743 Ga0501076_0000743_8447_9406 298
1940 3300049592 Ga0501076_0052762 Ga0501076_0052762_1557_2516 298
1941 3300049592 Ga0501076_0267043 Ga0501076_0267043_242_1210 298
1942 3300049593 Ga0501077_0010183 Ga0501077_0010183_3084_4043 298
1943 3300049593 Ga0501077_0060671 Ga0501077_0060671_840_1808 298
1944 3300049656 Ga0501209_001369 Ga0501209_001369_961_1929 298
1945 3300049741 Ga0501079_0000225 Ga0501079_0000225_24068_25027 298
1946 3300049741 Ga0501079_0004140 Ga0501079_0004140_381_1349 298
1947 3300049741 Ga0501079_0051491 Ga0501079_0051491_136_1104 298
1948 3300049742 Ga0501080_0074462 Ga0501080_0074462_606_1565 298
1949 3300049742 Ga0501080_0261472 Ga0501080_0261472_524_1495 298
1950 3300049743 Ga0501081_0000819 Ga0501081_0000819_13464_14423 298
1951 3300049743 Ga0501081_0039468 Ga0501081_0039468_1756_2715 298
1952 3300049743 Ga0501081_0060896 Ga0501081_0060896_578_1546 298
1953 3300049744 Ga0501083_0051673 Ga0501083_0051673_562_1521 298
1954 3300049822 Ga0501035_0008798 Ga0501035_0008798_8311_9273 298
1955 3300049822 Ga0501035_0017550 Ga0501035_0017550_1094_2059 298
1956 3300049822 Ga0501035_0021663 Ga0501035_0021663_1787_2752 298
1957 3300049822 Ga0501035_0058367 Ga0501035_0058367_1062_2021 298
1958 3300049823 Ga0501044_0000102 Ga0501044_0000102_4694_5659 298
1959 3300049823 Ga0501044_0001266 Ga0501044_0001266_353_1315 298
1960 3300049823 Ga0501044_0012539 Ga0501044_0012539_4179_5144 298
1961 3300049823 Ga0501044_0060261 Ga0501044_0060261_1897_2862 298
1962 3300049823 Ga0501044_0265035 Ga0501044_0265035_516_1484 298
1963 3300049824 Ga0501045_0000207 Ga0501045_0000207_14123_15082 298
1964 3300049824 Ga0501045_0014942 Ga0501045_0014942_1655_2623 298
1965 3300049824 Ga0501045_0020362 Ga0501045_0020362_1420_2379 298
1966 3300049824 Ga0501045_0052494 Ga0501045_0052494_1157_2125 298
1967 3300049824 Ga0501045_0169155 Ga0501045_0169155_549_1508 298
1968 3300050490 nmdc:mga03n38_36749_c1 nmdc:mga03n38_36749_c1_511_1476 298
1969 3300050491 nmdc:mga00v17_13047_c1 nmdc:mga00v17_13047_c1_2680_3642 298
1970 3300050491 nmdc:mga00v17_178689_c1 nmdc:mga00v17_178689_c1_205_1170 298
1971 3300050491 nmdc:mga00v17_488_c1 nmdc:mga00v17_488_c1_19583_20548 298
1972 3300050507 nmdc:mga05p37_976_c1 nmdc:mga05p37_976_c1_30788_31756 298
1973 3300050508 nmdc:mga09592_15280_c1 nmdc:mga09592_15280_c1_2524_3483 298
1974 3300050508 nmdc:mga09592_355_c1 nmdc:mga09592_355_c1_7326_8294 298
1975 3300050509 nmdc:mga0qj67_49054_c1 nmdc:mga0qj67_49054_c1_437_1396 298
1976 3300050510 nmdc:mga06r32_210229_c1 nmdc:mga06r32_210229_c1_449_1417 298
1977 3300050511 nmdc:mga08y16_14108_c1 nmdc:mga08y16_14108_c1_3104_4063 298
1978 3300050511 nmdc:mga08y16_693511_c1 nmdc:mga08y16_693511_c1_30_998 298
1979 3300050512 nmdc:mga0n895_109231_c1 nmdc:mga0n895_109231_c1_1370_2338 298
1980 3300050512 nmdc:mga0n895_159920_c1 nmdc:mga0n895_159920_c1_621_1589 298
1981 3300050513 nmdc:mga0rr50_10523_c1 nmdc:mga0rr50_10523_c1_2044_3012 298
1982 3300050513 nmdc:mga0rr50_145798_c1 nmdc:mga0rr50_145798_c1_760_1728 298
1983 3300050513 nmdc:mga0rr50_16290_c1 nmdc:mga0rr50_16290_c1_2603_3571 298
1984 3300050513 nmdc:mga0rr50_37_c1 nmdc:mga0rr50_37_c1_20102_21046 298
1985 3300050514 nmdc:mga08x19_2253_c1 nmdc:mga08x19_2253_c1_2005_2949 298
1986 3300050514 nmdc:mga08x19_76895_c1 nmdc:mga08x19_76895_c1_1142_2110 298
1987 3300050515 nmdc:mga0a205_245008_c1 nmdc:mga0a205_245008_c1_96_1055 298
1988 3300053090 Ga0500646_0000131 Ga0500646_0000131_20007_20972 298
1989 3300053090 Ga0500646_0040544 Ga0500646_0040544_186_1151 298
1990 3300053104 Ga0500556_0000152 Ga0500556_0000152_49464_50429 298
1991 3300053104 Ga0500556_0026669 Ga0500556_0026669_580_1545 298
1992 3300053121 Ga0500607_016715 Ga0500607_016715_2466_3434 298
1993 3300053124 Ga0500617_021479 Ga0500617_021479_140_1105 298
1994 3300053125 Ga0500618_008389 Ga0500618_008389_1782_2753 298
1995 3300053134 Ga0500658_0086971 Ga0500658_0086971_302_1267 298
1996 3300053139 Ga0500568_0002112 Ga0500568_0002112_9738_10703 298
1997 3300053149 Ga0500600_0008786 Ga0500600_0008786_2522_3487 298
1998 3300053151 Ga0500604_0002636 Ga0500604_0002636_1385_2350 298
1999 3300053153 Ga0500616_0000032 Ga0500616_0000032_267782_268747 298
2000 3300053161 Ga0500634_0045808 Ga0500634_0045808_973_1941 298
2001 3300053177 Ga0500636_0000870 Ga0500636_0000870_171_1139 298
2002 3300053729 Ga0500625_008812 Ga0500625_008812_3337_4305 298
2003 3300053732 Ga0500656_002142 Ga0500656_002142_677_1642 298
2004 3300054114 Ga0501084_0001080 Ga0501084_0001080_3086_4045 298
2005 3300054114 Ga0501084_0029297 Ga0501084_0029297_1218_2186 298
2006 3300059477 Ga0587084_004030 Ga0587084_004030_366_1334 298
2007 3300059492 Ga0587073_0017582 Ga0587073_0017582_285_1253 298
2008 3300059508 Ga0587088_008020 Ga0587088_008020_104_1072 298
2009 3300059605 Ga0587106_010144 Ga0587106_010144_101_1069 298
2010 3300059640 Ga0587067_001390 Ga0587067_001390_407_1375 298
2011 3300059641 Ga0587068_022319 Ga0587068_022319_61_1029 298
2012 3300059643 Ga0587072_000324 Ga0587072_000324_2566_3534 298
2013 3300059643 Ga0587072_012647 Ga0587072_012647_18_986 298
2014 3300059645 Ga0587076_009932 Ga0587076_009932_193_1161 298
2015 3300060353 Ga0501082_0001398 Ga0501082_0001398_1721_2680 298
2016 3300060353 Ga0501082_0034853 Ga0501082_0034853_1155_2123 298
2017 3300061734 Ga0530510_0000390 Ga0530510_0000390_8843_9802 298
2018 3300061734 Ga0530510_0047064 Ga0530510_0047064_1489_2448 298
2019 3300061734 Ga0530510_0068914 Ga0530510_0068914_446_1414 298
2020 3300001979 JGI24740J21852_10017042 JGI24740J21852_100170421 299
2021 3300001989 JGI24739J22299_10043291 JGI24739J22299_100432912 299
2022 3300002704 JGI25155J39150_1000174 JGI25155J39150_100017416 299
2023 3300002704 JGI25155J39150_1000640 JGI25155J39150_10006406 299
2024 3300002705 JGI25156J39149_1000002 JGI25156J39149_100000292 299
2025 3300002705 JGI25156J39149_1000168 JGI25156J39149_100016816 299
2026 3300002705 JGI25156J39149_1001483 JGI25156J39149_10014832 299
2027 3300002737 JGI25162J39368_1000083 JGI25162J39368_100008321 299
2028 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010225 299
2029 3300002738 JGI25154J39366_1000185 JGI25154J39366_100018516 299
2030 3300002738 JGI25154J39366_1000245 JGI25154J39366_100024513 299
2031 3300002738 JGI25154J39366_1000549 JGI25154J39366_10005499 299
2032 3300002739 JGI25158J39367_1014853 JGI25158J39367_10148531 299
2033 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001113 299
2034 3300002741 JGI25157J39369_1000399 JGI25157J39369_10003992 299
2035 3300002741 JGI25157J39369_1000429 JGI25157J39369_100042914 299
2036 3300002773 JGI25152J39213_1000204 JGI25152J39213_100020436 299
2037 3300002773 JGI25152J39213_1003414 JGI25152J39213_10034145 299
2038 3300002774 JGI25150J39212_1002631 JGI25150J39212_10026314 299
2039 3300002774 JGI25150J39212_1002688 JGI25150J39212_10026883 299
2040 3300002774 JGI25150J39212_1005032 JGI25150J39212_10050322 299
2041 3300002987 JGI25159J45721_1000897 JGI25159J45721_100089712 299
2042 3300002987 JGI25159J45721_1004328 JGI25159J45721_10043284 299
2043 3300002987 JGI25159J45721_1013462 JGI25159J45721_10134622 299
2044 3300003163 Ga0006759J45824_1057535 Ga0006759J45824_10575352 299
2045 3300003187 JGI25151J46595_10001330 JGI25151J46595_1000133012 299
2046 3300003187 JGI25151J46595_10007165 JGI25151J46595_100071652 299
2047 3300003187 JGI25151J46595_10010351 JGI25151J46595_100103513 299
2048 3300003187 JGI25151J46595_10013650 JGI25151J46595_100136502 299
2049 3300003187 JGI25151J46595_10020477 JGI25151J46595_100204772 299
2050 3300003214 JGI25165J46597_1000064 JGI25165J46597_100006421 299
2051 3300003215 JGI25153J46596_10003141 JGI25153J46596_100031415 299
2052 3300003323 rootH1_10032395 rootH1_100323952 299
2053 3300003354 JGI25160J50197_1000179 JGI25160J50197_100017932 299
2054 3300003354 JGI25160J50197_1004592 JGI25160J50197_10045923 299
2055 3300003374 JGI25161J50226_1000076 JGI25161J50226_100007659 299
2056 3300003374 JGI25161J50226_1002401 JGI25161J50226_10024013 299
2057 3300003374 JGI25161J50226_1003041 JGI25161J50226_10030411 299
2058 3300003544 Ga0007417J51691_1018019 Ga0007417J51691_10180192 299
2059 3300003544 Ga0007417J51691_1049231 Ga0007417J51691_10492311 299
2060 3300003574 Ga0007410J51695_1020662 Ga0007410J51695_10206622 299
2061 3300003575 Ga0007409J51694_1007615 Ga0007409J51694_10076152 299
2062 3300003575 Ga0007409J51694_1012812 Ga0007409J51694_10128122 299
2063 3300003577 Ga0007416J51690_1017424 Ga0007416J51690_10174243 299
2064 3300003611 Ga0007411J51799_109832 Ga0007411J51799_1098322 299
2065 3300003693 Ga0032354_1029923 Ga0032354_10299232 299
2066 3300003751 Ga0055538_1000002 Ga0055538_1000002829 299
2067 3300003751 Ga0055538_1000031 Ga0055538_1000031165 299
2068 3300003752 Ga0055539_1000002 Ga0055539_1000002829 299
2069 3300003752 Ga0055539_1000041 Ga0055539_1000041165 299
2070 3300003756 Ga0055533_1000004 Ga0055533_1000004829 299
2071 3300003756 Ga0055533_1000051 Ga0055533_100005121 299
2072 3300003758 Ga0055532_1000050 Ga0055532_100005097 299
2073 3300003759 Ga0055525_1000002 Ga0055525_1000002829 299
2074 3300003759 Ga0055525_1000011 Ga0055525_1000011439 299
2075 3300003759 Ga0055525_1000046 Ga0055525_100004627 299
2076 3300003759 Ga0055525_1000047 Ga0055525_100004788 299
2077 3300003759 Ga0055525_1000061 Ga0055525_1000061166 299
2078 3300003761 Ga0055535_1000612 Ga0055535_100061217 299
2079 3300003761 Ga0055535_1003298 Ga0055535_10032982 299
2080 3300003762 Ga0055542_1000004 Ga0055542_1000004208 299
2081 3300003763 Ga0055529_1000293 Ga0055529_100029339 299
2082 3300003771 Ga0055526_1000439 Ga0055526_100043917 299
2083 3300003771 Ga0055526_1000654 Ga0055526_10006546 299
2084 3300003771 Ga0055526_1000752 Ga0055526_10007522 299
2085 3300003771 Ga0055526_1014282 Ga0055526_10142823 299
2086 3300003773 Ga0055537_1000102 Ga0055537_100010256 299
2087 3300003773 Ga0055537_1000271 Ga0055537_10002713 299
2088 3300003773 Ga0055537_1000554 Ga0055537_10005543 299
2089 3300003775 Ga0055524_1000008 Ga0055524_100000885 299
2090 3300003775 Ga0055524_1000093 Ga0055524_1000093106 299
2091 3300003775 Ga0055524_1000183 Ga0055524_100018331 299
2092 3300003775 Ga0055524_1008015 Ga0055524_10080152 299
2093 3300003775 Ga0055524_1010115 Ga0055524_10101153 299
2094 3300003781 Ga0055536_1004090 Ga0055536_10040906 299
2095 3300003781 Ga0055536_1005630 Ga0055536_10056303 299
2096 3300003781 Ga0055536_1009755 Ga0055536_10097553 299
2097 3300003784 Ga0055534_1000251 Ga0055534_100025131 299
2098 3300003784 Ga0055534_1000432 Ga0055534_100043225 299
2099 3300003784 Ga0055534_1004363 Ga0055534_10043632 299
2100 3300003790 Ga0055528_1000744 Ga0055528_100074422 299
2101 3300003790 Ga0055528_1001274 Ga0055528_100127411 299
2102 3300003790 Ga0055528_1004763 Ga0055528_10047635 299
2103 3300003790 Ga0055528_1024292 Ga0055528_10242922 299
2104 3300003791 Ga0055530_10000285 Ga0055530_1000028538 299
2105 3300003791 Ga0055530_10005799 Ga0055530_100057995 299
2106 3300003791 Ga0055530_10006805 Ga0055530_100068055 299
2107 3300003792 Ga0055540_1000119 Ga0055540_100011919 299
2108 3300003792 Ga0055540_1000196 Ga0055540_100019648 299
2109 3300003792 Ga0055540_1002092 Ga0055540_100209210 299
2110 3300003792 Ga0055540_1003106 Ga0055540_10031068 299
2111 3300003792 Ga0055540_1004606 Ga0055540_10046065 299
2112 3300003792 Ga0055540_1009693 Ga0055540_10096932 299
2113 3300003794 Ga0055531_10000064 Ga0055531_100000644 299
2114 3300003794 Ga0055531_10000776 Ga0055531_1000077620 299
2115 3300003794 Ga0055531_10010231 Ga0055531_100102313 299
2116 3300003794 Ga0055531_10010751 Ga0055531_100107513 299
2117 3300003794 Ga0055531_10013212 Ga0055531_100132123 299
2118 3300003841 Ga0055541_1000002 Ga0055541_100000213 299
2119 3300003841 Ga0055541_1000028 Ga0055541_1000028166 299
2120 3300003841 Ga0055541_1000043 Ga0055541_100004343 299
2121 3300004625 Ga0055543_1000118 Ga0055543_100011827 299
2122 3300004625 Ga0055543_1002781 Ga0055543_10027813 299
2123 3300004625 Ga0055543_1008133 Ga0055543_10081333 299
2124 3300005262 Ga0065165_1000039 Ga0065165_1000039101 299
2125 3300005262 Ga0065165_1000074 Ga0065165_100007415 299
2126 3300005262 Ga0065165_1000233 Ga0065165_100023318 299
2127 3300005262 Ga0065165_1002662 Ga0065165_100266212 299
2128 3300005262 Ga0065165_1009408 Ga0065165_10094083 299
2129 3300005262 Ga0065165_1009565 Ga0065165_10095652 299
2130 3300005262 Ga0065165_1023871 Ga0065165_10238712 299
2131 3300005288 Ga0065714_10065075 Ga0065714_100650759 299
2132 3300005289 Ga0065704_10002117 Ga0065704_100021173 299
2133 3300005289 Ga0065704_10074755 Ga0065704_100747557 299
2134 3300005289 Ga0065704_10108249 Ga0065704_101082491 299
2135 3300005295 Ga0065707_10084798 Ga0065707_100847982 299
2136 3300005327 Ga0070658_10035989 Ga0070658_100359891 299
2137 3300005327 Ga0070658_10056212 Ga0070658_100562122 299
2138 3300005327 Ga0070658_10241650 Ga0070658_102416501 299
2139 3300005328 Ga0070676_10004849 Ga0070676_100048496 299
2140 3300005328 Ga0070676_10011623 Ga0070676_100116235 299
2141 3300005329 Ga0070683_100024131 Ga0070683_1000241315 299
2142 3300005330 Ga0070690_100011086 Ga0070690_1000110863 299
2143 3300005331 Ga0070670_100022364 Ga0070670_1000223642 299
2144 3300005331 Ga0070670_100027095 Ga0070670_1000270953 299
2145 3300005331 Ga0070670_100044925 Ga0070670_1000449253 299
2146 3300005331 Ga0070670_100053737 Ga0070670_1000537373 299
2147 3300005331 Ga0070670_100102307 Ga0070670_1001023072 299
2148 3300005331 Ga0070670_100109397 Ga0070670_1001093972 299
2149 3300005333 Ga0070677_10001379 Ga0070677_100013795 299
2150 3300005334 Ga0068869_100029342 Ga0068869_1000293422 299
2151 3300005334 Ga0068869_100056917 Ga0068869_1000569172 299
2152 3300005334 Ga0068869_100058219 Ga0068869_1000582192 299
2153 3300005334 Ga0068869_100067537 Ga0068869_1000675372 299
2154 3300005335 Ga0070666_10003075 Ga0070666_100030757 299
2155 3300005335 Ga0070666_10048476 Ga0070666_100484762 299
2156 3300005336 Ga0070680_100010892 Ga0070680_1000108925 299
2157 3300005336 Ga0070680_100019919 Ga0070680_1000199192 299
2158 3300005337 Ga0070682_100006866 Ga0070682_1000068662 299
2159 3300005337 Ga0070682_100033691 Ga0070682_1000336913 299
2160 3300005338 Ga0068868_100004301 Ga0068868_1000043017 299
2161 3300005338 Ga0068868_100004718 Ga0068868_1000047189 299
2162 3300005338 Ga0068868_100017218 Ga0068868_1000172182 299
2163 3300005338 Ga0068868_100059942 Ga0068868_1000599421 299
2164 3300005338 Ga0068868_100062285 Ga0068868_1000622852 299
2165 3300005339 Ga0070660_100001539 Ga0070660_10000153912 299
2166 3300005339 Ga0070660_100130338 Ga0070660_1001303382 299
2167 3300005343 Ga0070687_100081411 Ga0070687_1000814112 299
2168 3300005344 Ga0070661_100000171 Ga0070661_10000017123 299
2169 3300005344 Ga0070661_100061361 Ga0070661_1000613612 299
2170 3300005344 Ga0070661_100070616 Ga0070661_1000706162 299
2171 3300005344 Ga0070661_100115830 Ga0070661_1001158302 299
2172 3300005345 Ga0070692_10028855 Ga0070692_100288552 299
2173 3300005347 Ga0070668_100131863 Ga0070668_1001318631 299
2174 3300005347 Ga0070668_100277468 Ga0070668_1002774682 299
2175 3300005353 Ga0070669_100005737 Ga0070669_1000057376 299
2176 3300005353 Ga0070669_100030061 Ga0070669_1000300613 299
2177 3300005353 Ga0070669_100070241 Ga0070669_1000702412 299
2178 3300005353 Ga0070669_100094956 Ga0070669_1000949563 299
2179 3300005354 Ga0070675_100002078 Ga0070675_10000207810 299
2180 3300005354 Ga0070675_100007450 Ga0070675_1000074505 299
2181 3300005354 Ga0070675_100015931 Ga0070675_1000159317 299
2182 3300005354 Ga0070675_100016156 Ga0070675_1000161567 299
2183 3300005354 Ga0070675_100037121 Ga0070675_1000371212 299
2184 3300005354 Ga0070675_100057834 Ga0070675_1000578342 299
2185 3300005355 Ga0070671_100001763 Ga0070671_10000176315 299
2186 3300005355 Ga0070671_100061107 Ga0070671_1000611073 299
2187 3300005355 Ga0070671_100138012 Ga0070671_1001380122 299
2188 3300005356 Ga0070674_100019062 Ga0070674_1000190625 299
2189 3300005356 Ga0070674_100059284 Ga0070674_1000592843 299
2190 3300005356 Ga0070674_100075836 Ga0070674_1000758362 299
2191 3300005356 Ga0070674_100256606 Ga0070674_1002566061 299
2192 3300005364 Ga0070673_100001661 Ga0070673_1000016616 299
2193 3300005364 Ga0070673_100017418 Ga0070673_1000174181 299
2194 3300005364 Ga0070673_100195420 Ga0070673_1001954202 299
2195 3300005364 Ga0070673_100294553 Ga0070673_1002945531 299
2196 3300005366 Ga0070659_100000363 Ga0070659_10000036312 299
2197 3300005366 Ga0070659_100008037 Ga0070659_1000080376 299
2198 3300005366 Ga0070659_100019525 Ga0070659_1000195253 299
2199 3300005366 Ga0070659_100036335 Ga0070659_1000363352 299
2200 3300005366 Ga0070659_100047647 Ga0070659_1000476472 299
2201 3300005367 Ga0070667_100025755 Ga0070667_1000257555 299
2202 3300005367 Ga0070667_100087626 Ga0070667_1000876262 299
2203 3300005367 Ga0070667_100124401 Ga0070667_1001244012 299
2204 3300005367 Ga0070667_100270432 Ga0070667_1002704322 299
2205 3300005435 Ga0070714_100517523 Ga0070714_1005175231 299
2206 3300005438 Ga0070701_10058798 Ga0070701_100587982 299
2207 3300005441 Ga0070700_100050929 Ga0070700_1000509291 299
2208 3300005444 Ga0070694_100008531 Ga0070694_1000085317 299
2209 3300005445 Ga0070708_100245492 Ga0070708_1002454922 299
2210 3300005456 Ga0070678_100001521 Ga0070678_1000015217 299
2211 3300005456 Ga0070678_100024505 Ga0070678_1000245054 299
2212 3300005456 Ga0070678_100036171 Ga0070678_1000361712 299
2213 3300005456 Ga0070678_100063951 Ga0070678_1000639513 299
2214 3300005456 Ga0070678_100267818 Ga0070678_1002678181 299
2215 3300005457 Ga0070662_100010894 Ga0070662_1000108942 299
2216 3300005457 Ga0070662_100014970 Ga0070662_1000149702 299
2217 3300005457 Ga0070662_100065529 Ga0070662_1000655292 299
2218 3300005458 Ga0070681_10051714 Ga0070681_100517141 299
2219 3300005458 Ga0070681_10459484 Ga0070681_104594841 299
2220 3300005459 Ga0068867_100000385 Ga0068867_1000003859 299
2221 3300005459 Ga0068867_100015873 Ga0068867_1000158735 299
2222 3300005459 Ga0068867_100096357 Ga0068867_1000963572 299
2223 3300005459 Ga0068867_100209295 Ga0068867_1002092952 299
2224 3300005459 Ga0068867_100307120 Ga0068867_1003071201 299
2225 3300005467 Ga0070706_100002408 Ga0070706_10000240812 299
2226 3300005467 Ga0070706_100041395 Ga0070706_1000413954 299
2227 3300005468 Ga0070707_100012478 Ga0070707_1000124786 299
2228 3300005468 Ga0070707_100247067 Ga0070707_1002470672 299
2229 3300005468 Ga0070707_100260215 Ga0070707_1002602152 299
2230 3300005471 Ga0070698_100157906 Ga0070698_1001579062 299
2231 3300005518 Ga0070699_100005930 Ga0070699_1000059304 299
2232 3300005530 Ga0070679_100018568 Ga0070679_1000185685 299
2233 3300005539 Ga0068853_100010152 Ga0068853_1000101522 299
2234 3300005539 Ga0068853_100018926 Ga0068853_1000189262 299
2235 3300005539 Ga0068853_100137692 Ga0068853_1001376922 299
2236 3300005539 Ga0068853_100382507 Ga0068853_1003825071 299
2237 3300005543 Ga0070672_100003651 Ga0070672_1000036517 299
2238 3300005543 Ga0070672_100007729 Ga0070672_1000077292 299
2239 3300005543 Ga0070672_100019324 Ga0070672_1000193242 299
2240 3300005543 Ga0070672_100114846 Ga0070672_1001148462 299
2241 3300005543 Ga0070672_100117130 Ga0070672_1001171302 299
2242 3300005545 Ga0070695_100018532 Ga0070695_1000185322 299
2243 3300005546 Ga0070696_100008398 Ga0070696_1000083987 299
2244 3300005547 Ga0070693_100014170 Ga0070693_1000141704 299
2245 3300005547 Ga0070693_100113784 Ga0070693_1001137842 299
2246 3300005548 Ga0070665_100037597 Ga0070665_1000375974 299
2247 3300005548 Ga0070665_100050964 Ga0070665_1000509642 299
2248 3300005548 Ga0070665_100246409 Ga0070665_1002464092 299
2249 3300005548 Ga0070665_100374221 Ga0070665_1003742212 299
2250 3300005563 Ga0068855_100000065 Ga0068855_10000006548 299
2251 3300005563 Ga0068855_100018720 Ga0068855_1000187205 299
2252 3300005563 Ga0068855_100042078 Ga0068855_1000420783 299
2253 3300005563 Ga0068855_100064835 Ga0068855_1000648352 299
2254 3300005563 Ga0068855_100110706 Ga0068855_1001107062 299
2255 3300005563 Ga0068855_100122191 Ga0068855_1001221912 299
2256 3300005563 Ga0068855_100269505 Ga0068855_1002695052 299
2257 3300005564 Ga0070664_100003645 Ga0070664_10000364515 299
2258 3300005564 Ga0070664_100038389 Ga0070664_1000383893 299
2259 3300005564 Ga0070664_100047443 Ga0070664_1000474433 299
2260 3300005564 Ga0070664_100138711 Ga0070664_1001387112 299
2261 3300005577 Ga0068857_100227790 Ga0068857_1002277902 299
2262 3300005577 Ga0068857_100251763 Ga0068857_1002517632 299
2263 3300005577 Ga0068857_100326896 Ga0068857_1003268961 299
2264 3300005578 Ga0068854_100014548 Ga0068854_1000145483 299
2265 3300005578 Ga0068854_100018908 Ga0068854_1000189084 299
2266 3300005614 Ga0068856_100128021 Ga0068856_1001280213 299
2267 3300005614 Ga0068856_100247882 Ga0068856_1002478822 299
2268 3300005615 Ga0070702_100012960 Ga0070702_1000129606 299
2269 3300005616 Ga0068852_100032852 Ga0068852_1000328522 299
2270 3300005616 Ga0068852_100034426 Ga0068852_1000344262 299
2271 3300005616 Ga0068852_100043779 Ga0068852_1000437793 299
2272 3300005616 Ga0068852_100048938 Ga0068852_1000489383 299
2273 3300005616 Ga0068852_100377079 Ga0068852_1003770791 299
2274 3300005617 Ga0068859_100044892 Ga0068859_1000448925 299
2275 3300005617 Ga0068859_100059555 Ga0068859_1000595551 299
2276 3300005617 Ga0068859_100256901 Ga0068859_1002569013 299
2277 3300005617 Ga0068859_100261321 Ga0068859_1002613212 299
2278 3300005617 Ga0068859_100496992 Ga0068859_1004969922 299
2279 3300005618 Ga0068864_100008243 Ga0068864_1000082432 299
2280 3300005618 Ga0068864_100019355 Ga0068864_1000193555 299
2281 3300005618 Ga0068864_100058855 Ga0068864_1000588555 299
2282 3300005618 Ga0068864_100061034 Ga0068864_1000610343 299
2283 3300005618 Ga0068864_100148309 Ga0068864_1001483092 299
2284 3300005719 Ga0068861_100004622 Ga0068861_1000046224 299
2285 3300005719 Ga0068861_100051385 Ga0068861_1000513852 299
2286 3300005719 Ga0068861_100066028 Ga0068861_1000660282 299
2287 3300005719 Ga0068861_100193902 Ga0068861_1001939022 299
2288 3300005834 Ga0068851_10015520 Ga0068851_100155202 299
2289 3300005834 Ga0068851_10021848 Ga0068851_100218482 299
2290 3300005841 Ga0068863_100002920 Ga0068863_10000292012 299
2291 3300005841 Ga0068863_100006877 Ga0068863_10000687710 299
2292 3300005841 Ga0068863_100036198 Ga0068863_1000361982 299
2293 3300005841 Ga0068863_100037673 Ga0068863_1000376733 299
2294 3300005841 Ga0068863_100041069 Ga0068863_1000410693 299
2295 3300005841 Ga0068863_100083469 Ga0068863_1000834693 299
2296 3300005841 Ga0068863_100099699 Ga0068863_1000996993 299
2297 3300005841 Ga0068863_100310005 Ga0068863_1003100052 299
2298 3300005842 Ga0068858_100015995 Ga0068858_1000159954 299
2299 3300005842 Ga0068858_100054381 Ga0068858_1000543812 299
2300 3300005842 Ga0068858_100134542 Ga0068858_1001345422 299
2301 3300005842 Ga0068858_100138151 Ga0068858_1001381512 299
2302 3300005843 Ga0068860_100003404 Ga0068860_1000034044 299
2303 3300005843 Ga0068860_100023497 Ga0068860_1000234975 299
2304 3300005843 Ga0068860_100048989 Ga0068860_1000489893 299
2305 3300005843 Ga0068860_100049168 Ga0068860_1000491683 299
2306 3300005844 Ga0068862_100008778 Ga0068862_1000087783 299
2307 3300005844 Ga0068862_100016908 Ga0068862_1000169083 299
2308 3300005844 Ga0068862_100021734 Ga0068862_1000217343 299
2309 3300005844 Ga0068862_100035002 Ga0068862_1000350021 299
2310 3300006038 Ga0075365_10000471 Ga0075365_100004713 299
2311 3300006038 Ga0075365_10002728 Ga0075365_100027287 299
2312 3300006042 Ga0075368_10015357 Ga0075368_100153572 299
2313 3300006042 Ga0075368_10015523 Ga0075368_100155233 299
2314 3300006048 Ga0075363_100005898 Ga0075363_1000058984 299
2315 3300006048 Ga0075363_100009082 Ga0075363_1000090823 299
2316 3300006048 Ga0075363_100058079 Ga0075363_1000580792 299
2317 3300006048 Ga0075363_100069140 Ga0075363_1000691402 299
2318 3300006051 Ga0075364_10017392 Ga0075364_100173923 299
2319 3300006051 Ga0075364_10025979 Ga0075364_100259793 299
2320 3300006051 Ga0075364_10030915 Ga0075364_100309153 299
2321 3300006051 Ga0075364_10076057 Ga0075364_100760571 299
2322 3300006051 Ga0075364_10095884 Ga0075364_100958842 299
2323 3300006177 Ga0075362_10000777 Ga0075362_100007779 299
2324 3300006177 Ga0075362_10004973 Ga0075362_100049733 299
2325 3300006177 Ga0075362_10039026 Ga0075362_100390262 299
2326 3300006177 Ga0075362_10039550 Ga0075362_100395502 299
2327 3300006177 Ga0075362_10039646 Ga0075362_100396463 299
2328 3300006178 Ga0075367_10003436 Ga0075367_100034363 299
2329 3300006178 Ga0075367_10010068 Ga0075367_100100683 299
2330 3300006178 Ga0075367_10025811 Ga0075367_100258113 299
2331 3300006178 Ga0075367_10063491 Ga0075367_100634913 299
2332 3300006186 Ga0075369_10002021 Ga0075369_100020219 299
2333 3300006195 Ga0075366_10000198 Ga0075366_100001989 299
2334 3300006195 Ga0075366_10004914 Ga0075366_100049146 299
2335 3300006195 Ga0075366_10008903 Ga0075366_100089036 299
2336 3300006195 Ga0075366_10009299 Ga0075366_100092992 299
2337 3300006195 Ga0075366_10014147 Ga0075366_100141473 299
2338 3300006195 Ga0075366_10015176 Ga0075366_100151764 299
2339 3300006195 Ga0075366_10034630 Ga0075366_100346303 299
2340 3300006195 Ga0075366_10039414 Ga0075366_100394143 299
2341 3300006195 Ga0075366_10087094 Ga0075366_100870941 299
2342 3300006195 Ga0075366_10089234 Ga0075366_100892342 299
2343 3300006195 Ga0075366_10137933 Ga0075366_101379332 299
2344 3300006237 Ga0097621_100002980 Ga0097621_1000029809 299
2345 3300006237 Ga0097621_100010068 Ga0097621_1000100685 299
2346 3300006353 Ga0075370_10007243 Ga0075370_100072433 299
2347 3300006353 Ga0075370_10007297 Ga0075370_100072974 299
2348 3300006353 Ga0075370_10007987 Ga0075370_100079874 299
2349 3300006353 Ga0075370_10009232 Ga0075370_100092323 299
2350 3300006353 Ga0075370_10011506 Ga0075370_100115064 299
2351 3300006353 Ga0075370_10017073 Ga0075370_100170733 299
2352 3300006353 Ga0075370_10057523 Ga0075370_100575232 299
2353 3300006353 Ga0075370_10093020 Ga0075370_100930202 299
2354 3300006358 Ga0068871_100025447 Ga0068871_1000254472 299
2355 3300006358 Ga0068871_100130136 Ga0068871_1001301362 299
2356 3300006871 Ga0075434_100455773 Ga0075434_1004557732 299
2357 3300006880 Ga0075429_100012631 Ga0075429_1000126316 299
2358 3300006881 Ga0068865_100026341 Ga0068865_1000263414 299
2359 3300006931 Ga0097620_100044892 Ga0097620_1000448922 299
2360 3300006931 Ga0097620_100059550 Ga0097620_1000595504 299
2361 3300006931 Ga0097620_100256919 Ga0097620_1002569193 299
2362 3300006931 Ga0097620_100261315 Ga0097620_1002613152 299
2363 3300006931 Ga0097620_100496970 Ga0097620_1004969701 299
2364 3300006944 Ga0099823_1000018 Ga0099823_100001818 299
2365 3300006946 Ga0079104_1000098 Ga0079104_1000098117 299
2366 3300006946 Ga0079104_1000273 Ga0079104_100027349 299
2367 3300006946 Ga0079104_1005795 Ga0079104_10057953 299
2368 3300006948 Ga0099826_10000001 Ga0099826_10000001557 299
2369 3300006948 Ga0099826_10002445 Ga0099826_100024453 299
2370 3300007076 Ga0075435_100257549 Ga0075435_1002575492 299
2371 3300009011 Ga0105251_10021102 Ga0105251_100211023 299
2372 3300009036 Ga0105244_10007145 Ga0105244_100071453 299
2373 3300009036 Ga0105244_10062026 Ga0105244_100620262 299
2374 3300009036 Ga0105244_10064518 Ga0105244_100645182 299
2375 3300009092 Ga0105250_10013024 Ga0105250_100130243 299
2376 3300009093 Ga0105240_10008179 Ga0105240_1000817910 299
2377 3300009093 Ga0105240_10008792 Ga0105240_1000879214 299
2378 3300009093 Ga0105240_10074217 Ga0105240_100742173 299
2379 3300009093 Ga0105240_10081441 Ga0105240_100814412 299
2380 3300009093 Ga0105240_10091956 Ga0105240_100919562 299
2381 3300009093 Ga0105240_10203758 Ga0105240_102037583 299
2382 3300009098 Ga0105245_10099688 Ga0105245_100996882 299
2383 3300009098 Ga0105245_10107967 Ga0105245_101079672 299
2384 3300009098 Ga0105245_10187032 Ga0105245_101870322 299
2385 3300009147 Ga0114129_10931635 Ga0114129_109316351 299
2386 3300009148 Ga0105243_10002368 Ga0105243_1000236811 299
2387 3300009148 Ga0105243_10005490 Ga0105243_100054906 299
2388 3300009148 Ga0105243_10014474 Ga0105243_100144745 299
2389 3300009148 Ga0105243_10042763 Ga0105243_100427633 299
2390 3300009148 Ga0105243_10044826 Ga0105243_100448262 299
2391 3300009148 Ga0105243_10078193 Ga0105243_100781933 299
2392 3300009148 Ga0105243_10161357 Ga0105243_101613572 299
2393 3300009174 Ga0105241_10041835 Ga0105241_100418352 299
2394 3300009176 Ga0105242_10045644 Ga0105242_100456443 299
2395 3300009177 Ga0105248_10000595 Ga0105248_1000059532 299
2396 3300009177 Ga0105248_10048842 Ga0105248_100488423 299
2397 3300009177 Ga0105248_10118105 Ga0105248_101181052 299
2398 3300009177 Ga0105248_10272700 Ga0105248_102727002 299
2399 3300009545 Ga0105237_10000674 Ga0105237_1000067420 299
2400 3300009545 Ga0105237_10001570 Ga0105237_100015705 299
2401 3300009545 Ga0105237_10007879 Ga0105237_100078793 299
2402 3300009545 Ga0105237_10011825 Ga0105237_100118251 299
2403 3300009545 Ga0105237_10095980 Ga0105237_100959803 299
2404 3300009551 Ga0105238_10001892 Ga0105238_100018922 299
2405 3300009551 Ga0105238_10008614 Ga0105238_100086147 299
2406 3300009551 Ga0105238_10020517 Ga0105238_100205172 299
2407 3300009551 Ga0105238_10021998 Ga0105238_100219984 299
2408 3300009551 Ga0105238_10151933 Ga0105238_101519332 299
2409 3300009553 Ga0105249_10262672 Ga0105249_102626722 299
2410 3300010375 Ga0105239_10004457 Ga0105239_100044579 299
2411 3300010375 Ga0105239_10038964 Ga0105239_100389643 299
2412 3300010375 Ga0105239_10046410 Ga0105239_100464102 299
2413 3300010375 Ga0105239_10068572 Ga0105239_100685722 299
2414 3300010375 Ga0105239_10299804 Ga0105239_102998042 299
2415 3300010375 Ga0105239_10608295 Ga0105239_106082951 299
2416 3300011119 Ga0105246_10169645 Ga0105246_101696452 299
2417 3300012497 Ga0157319_1000033 Ga0157319_10000339 299
2418 3300013100 Ga0157373_10050747 Ga0157373_100507472 299
2419 3300013102 Ga0157371_10000026 Ga0157371_10000026219 299
2420 3300013102 Ga0157371_10001949 Ga0157371_1000194915 299
2421 3300013104 Ga0157370_10006046 Ga0157370_100060461 299
2422 3300013104 Ga0157370_10016957 Ga0157370_100169577 299
2423 3300013104 Ga0157370_10294492 Ga0157370_102944921 299
2424 3300013105 Ga0157369_10221456 Ga0157369_102214562 299
2425 3300013105 Ga0157369_10224981 Ga0157369_102249811 299
2426 3300013296 Ga0157374_10432543 Ga0157374_104325432 299
2427 3300013297 Ga0157378_10009990 Ga0157378_100099908 299
2428 3300013297 Ga0157378_10084924 Ga0157378_100849242 299
2429 3300013297 Ga0157378_10229358 Ga0157378_102293582 299
2430 3300013297 Ga0157378_10249596 Ga0157378_102495962 299
2431 3300013306 Ga0163162_10007570 Ga0163162_100075707 299
2432 3300013306 Ga0163162_10009639 Ga0163162_100096399 299
2433 3300013306 Ga0163162_10079786 Ga0163162_100797862 299
2434 3300013306 Ga0163162_10343373 Ga0163162_103433731 299
2435 3300013307 Ga0157372_10080129 Ga0157372_100801293 299
2436 3300013307 Ga0157372_10280586 Ga0157372_102805862 299
2437 3300013308 Ga0157375_10008888 Ga0157375_100088886 299
2438 3300013308 Ga0157375_10029172 Ga0157375_100291723 299
2439 3300013308 Ga0157375_10038677 Ga0157375_100386773 299
2440 3300013308 Ga0157375_10054724 Ga0157375_100547243 299
2441 3300013308 Ga0157375_10149180 Ga0157375_101491803 299
2442 3300013308 Ga0157375_10216155 Ga0157375_102161552 299
2443 3300014325 Ga0163163_10544782 Ga0163163_105447822 299
2444 3300014326 Ga0157380_10159598 Ga0157380_101595982 299
2445 3300014497 Ga0182008_10000228 Ga0182008_1000022830 299
2446 3300014497 Ga0182008_10001327 Ga0182008_100013272 299
2447 3300014497 Ga0182008_10004335 Ga0182008_100043356 299
2448 3300014497 Ga0182008_10007071 Ga0182008_100070717 299
2449 3300014497 Ga0182008_10013248 Ga0182008_100132483 299
2450 3300014497 Ga0182008_10036384 Ga0182008_100363842 299
2451 3300014745 Ga0157377_10000223 Ga0157377_1000022324 299
2452 3300014745 Ga0157377_10001521 Ga0157377_100015213 299
2453 3300014968 Ga0157379_10041219 Ga0157379_100412193 299
2454 3300014968 Ga0157379_10052262 Ga0157379_100522622 299
2455 3300014968 Ga0157379_10159105 Ga0157379_101591052 299
2456 3300014968 Ga0157379_10263052 Ga0157379_102630522 299
2457 3300014969 Ga0157376_10008822 Ga0157376_100088224 299
2458 3300014969 Ga0157376_10045309 Ga0157376_100453092 299
2459 3300015261 Ga0182006_1000142 Ga0182006_100014238 299
2460 3300015261 Ga0182006_1000151 Ga0182006_100015121 299
2461 3300015261 Ga0182006_1001297 Ga0182006_100129711 299
2462 3300015261 Ga0182006_1006685 Ga0182006_10066852 299
2463 3300015261 Ga0182006_1029238 Ga0182006_10292382 299
2464 3300015261 Ga0182006_1047912 Ga0182006_10479121 299
2465 3300015262 Ga0182007_10000905 Ga0182007_1000090512 299
2466 3300015262 Ga0182007_10000920 Ga0182007_1000092012 299
2467 3300015262 Ga0182007_10001887 Ga0182007_1000188711 299
2468 3300015262 Ga0182007_10007647 Ga0182007_100076472 299
2469 3300015262 Ga0182007_10015205 Ga0182007_100152052 299
2470 3300015265 Ga0182005_1000013 Ga0182005_1000013376 299
2471 3300015265 Ga0182005_1000090 Ga0182005_100009030 299
2472 3300015265 Ga0182005_1000136 Ga0182005_10001366 299
2473 3300015683 Ga0183362_10001 Ga0183362_100011618 299
2474 3300017792 Ga0163161_10000768 Ga0163161_1000076815 299
2475 3300017792 Ga0163161_10003820 Ga0163161_100038203 299
2476 3300017792 Ga0163161_10013852 Ga0163161_100138523 299
2477 3300017792 Ga0163161_10031424 Ga0163161_100314243 299
2478 3300017792 Ga0163161_10032283 Ga0163161_100322832 299
2479 3300017792 Ga0163161_10042366 Ga0163161_100423663 299
2480 3300017792 Ga0163161_10045325 Ga0163161_100453253 299
2481 3300017792 Ga0163161_10193260 Ga0163161_101932602 299
2482 3300017792 Ga0163161_10364956 Ga0163161_103649561 299
2483 3300021361 Ga0213872_10000020 Ga0213872_1000002016 299
2484 3300021361 Ga0213872_10000048 Ga0213872_100000484 299
2485 3300021361 Ga0213872_10000710 Ga0213872_1000071027 299
2486 3300021361 Ga0213872_10011372 Ga0213872_100113724 299
2487 3300021361 Ga0213872_10021918 Ga0213872_100219182 299
2488 3300021361 Ga0213872_10022499 Ga0213872_100224994 299
2489 3300025206 Ga0209435_100001 Ga0209435_1000011204 299
2490 3300025206 Ga0209435_100029 Ga0209435_10002978 299
2491 3300025206 Ga0209435_100195 Ga0209435_10019512 299
2492 3300025208 Ga0209436_101070 Ga0209436_1010708 299
2493 3300025208 Ga0209436_106584 Ga0209436_1065843 299
2494 3300025224 Ga0209784_100002 Ga0209784_1000021049 299
2495 3300025224 Ga0209784_100039 Ga0209784_100039202 299
2496 3300025225 Ga0209566_100003 Ga0209566_1000031049 299
2497 3300025225 Ga0209566_100023 Ga0209566_100023202 299
2498 3300025226 Ga0209674_100004 Ga0209674_1000041049 299
2499 3300025226 Ga0209674_100040 Ga0209674_100040202 299
2500 3300025228 Ga0209672_100468 Ga0209672_10046820 299
2501 3300025229 Ga0209147_100004 Ga0209147_100004469 299
2502 3300025229 Ga0209147_102593 Ga0209147_1025934 299
2503 3300025230 Ga0209563_100003 Ga0209563_100003618 299
2504 3300025230 Ga0209563_100005 Ga0209563_100005765 299
2505 3300025230 Ga0209563_100006 Ga0209563_1000061049 299
2506 3300025230 Ga0209563_100072 Ga0209563_100072202 299
2507 3300025231 Ga0207427_100492 Ga0207427_10049216 299
2508 3300025233 Ga0209437_100053 Ga0209437_10005399 299
2509 3300025233 Ga0209437_100097 Ga0209437_100097202 299
2510 3300025242 Ga0209258_100022 Ga0209258_100022207 299
2511 3300025242 Ga0209258_100463 Ga0209258_1004632 299
2512 3300025245 Ga0207425_1000001 Ga0207425_100000161 299
2513 3300025245 Ga0207425_1000033 Ga0207425_100003351 299
2514 3300025245 Ga0207425_1000485 Ga0207425_10004853 299
2515 3300025245 Ga0207425_1000611 Ga0207425_10006112 299
2516 3300025245 Ga0207425_1004173 Ga0207425_10041733 299
2517 3300025245 Ga0207425_1013535 Ga0207425_10135352 299
2518 3300025246 Ga0209646_1000001 Ga0209646_10000011573 299
2519 3300025246 Ga0209646_1000007 Ga0209646_1000007496 299
2520 3300025246 Ga0209646_1000073 Ga0209646_1000073113 299
2521 3300025246 Ga0209646_1000109 Ga0209646_100010916 299
2522 3300025250 Ga0209026_1000001 Ga0209026_1000001226 299
2523 3300025250 Ga0209026_1000124 Ga0209026_100012477 299
2524 3300025250 Ga0209026_1003015 Ga0209026_10030159 299
2525 3300025250 Ga0209026_1005159 Ga0209026_10051593 299
2526 3300025253 Ga0209677_100003 Ga0209677_1000031049 299
2527 3300025253 Ga0209677_100041 Ga0209677_100041202 299
2528 3300025254 Ga0209148_1000034 Ga0209148_1000034207 299
2529 3300025254 Ga0209148_1000352 Ga0209148_100035240 299
2530 3300025256 Ga0209759_1000001 Ga0209759_10000011204 299
2531 3300025256 Ga0209759_1000108 Ga0209759_100010854 299
2532 3300025256 Ga0209759_1000706 Ga0209759_100070610 299
2533 3300025258 Ga0209129_1000003 Ga0209129_100000361 299
2534 3300025258 Ga0209129_1000023 Ga0209129_1000023289 299
2535 3300025258 Ga0209129_1000089 Ga0209129_100008926 299
2536 3300025258 Ga0209129_1001305 Ga0209129_100130511 299
2537 3300025258 Ga0209129_1008566 Ga0209129_10085662 299
2538 3300025261 Ga0209233_1000122 Ga0209233_1000122202 299
2539 3300025263 Ga0209565_1000003 Ga0209565_100000399 299
2540 3300025263 Ga0209565_1000040 Ga0209565_1000040192 299
2541 3300025263 Ga0209565_1000161 Ga0209565_100016128 299
2542 3300025263 Ga0209565_1000304 Ga0209565_100030421 299
2543 3300025263 Ga0209565_1000623 Ga0209565_100062317 299
2544 3300025263 Ga0209565_1001269 Ga0209565_10012693 299
2545 3300025263 Ga0209565_1001295 Ga0209565_100129511 299
2546 3300025263 Ga0209565_1002330 Ga0209565_10023306 299
2547 3300025272 Ga0209455_1000044 Ga0209455_1000044337 299
2548 3300025273 Ga0209673_1000017 Ga0209673_1000017470 299
2549 3300025273 Ga0209673_1000265 Ga0209673_100026521 299
2550 3300025273 Ga0209673_1000353 Ga0209673_100035331 299
2551 3300025273 Ga0209673_1000391 Ga0209673_10003913 299
2552 3300025273 Ga0209673_1001216 Ga0209673_100121622 299
2553 3300025273 Ga0209673_1007288 Ga0209673_10072881 299
2554 3300025273 Ga0209673_1011801 Ga0209673_10118012 299
2555 3300025273 Ga0209673_1012753 Ga0209673_10127532 299
2556 3300025273 Ga0209673_1040680 Ga0209673_10406801 299
2557 3300025284 Ga0209130_1000041 Ga0209130_1000041242 299
2558 3300025284 Ga0209130_1000113 Ga0209130_100011312 299
2559 3300025284 Ga0209130_1000177 Ga0209130_10001772 299
2560 3300025284 Ga0209130_1000359 Ga0209130_10003593 299
2561 3300025284 Ga0209130_1002256 Ga0209130_10022564 299
2562 3300025284 Ga0209130_1002618 Ga0209130_10026185 299
2563 3300025291 Ga0209675_1000024 Ga0209675_100002476 299
2564 3300025291 Ga0209675_1000119 Ga0209675_100011999 299
2565 3300025291 Ga0209675_1000127 Ga0209675_100012721 299
2566 3300025291 Ga0209675_1000128 Ga0209675_100012828 299
2567 3300025291 Ga0209675_1000223 Ga0209675_10002237 299
2568 3300025291 Ga0209675_1001446 Ga0209675_10014467 299
2569 3300025291 Ga0209675_1002670 Ga0209675_10026703 299
2570 3300025291 Ga0209675_1003378 Ga0209675_10033783 299
2571 3300025291 Ga0209675_1003815 Ga0209675_10038156 299
2572 3300025291 Ga0209675_1013772 Ga0209675_10137721 299
2573 3300025292 Ga0209676_1000005 Ga0209676_1000005515 299
2574 3300025292 Ga0209676_1000054 Ga0209676_1000054133 299
2575 3300025292 Ga0209676_1000437 Ga0209676_100043722 299
2576 3300025292 Ga0209676_1000785 Ga0209676_100078533 299
2577 3300025292 Ga0209676_1006138 Ga0209676_10061384 299
2578 3300025292 Ga0209676_1048778 Ga0209676_10487781 299
2579 3300025294 Ga0209025_1000484 Ga0209025_100048446 299
2580 3300025294 Ga0209025_1000717 Ga0209025_100071728 299
2581 3300025294 Ga0209025_1002474 Ga0209025_10024743 299
2582 3300025294 Ga0209025_1003667 Ga0209025_10036677 299
2583 3300025294 Ga0209025_1007211 Ga0209025_10072113 299
2584 3300025294 Ga0209025_1015075 Ga0209025_10150752 299
2585 3300025294 Ga0209025_1015776 Ga0209025_10157763 299
2586 3300025294 Ga0209025_1017930 Ga0209025_10179304 299
2587 3300025294 Ga0209025_1024218 Ga0209025_10242183 299
2588 3300025294 Ga0209025_1068211 Ga0209025_10682112 299
2589 3300025295 Ga0209564_1000002 Ga0209564_10000021125 299
2590 3300025295 Ga0209564_1000007 Ga0209564_1000007474 299
2591 3300025295 Ga0209564_1000016 Ga0209564_100001616 299
2592 3300025295 Ga0209564_1000051 Ga0209564_100005119 299
2593 3300025295 Ga0209564_1000053 Ga0209564_1000053272 299
2594 3300025295 Ga0209564_1000095 Ga0209564_1000095113 299
2595 3300025295 Ga0209564_1000958 Ga0209564_100095833 299
2596 3300025295 Ga0209564_1001115 Ga0209564_10011153 299
2597 3300025295 Ga0209564_1003647 Ga0209564_10036472 299
2598 3300025295 Ga0209564_1005444 Ga0209564_10054445 299
2599 3300025295 Ga0209564_1009277 Ga0209564_10092773 299
2600 3300025295 Ga0209564_1009307 Ga0209564_10093073 299
2601 3300025297 Ga0209758_1000041 Ga0209758_10000419 299
2602 3300025297 Ga0209758_1000064 Ga0209758_1000064190 299
2603 3300025297 Ga0209758_1000243 Ga0209758_100024341 299
2604 3300025297 Ga0209758_1001105 Ga0209758_100110518 299
2605 3300025297 Ga0209758_1004040 Ga0209758_10040403 299
2606 3300025297 Ga0209758_1004584 Ga0209758_10045843 299
2607 3300025297 Ga0209758_1010869 Ga0209758_10108693 299
2608 3300025297 Ga0209758_1025967 Ga0209758_10259672 299
2609 3300025298 Ga0209050_1000007 Ga0209050_1000007582 299
2610 3300025298 Ga0209050_1000011 Ga0209050_1000011430 299
2611 3300025298 Ga0209050_1000066 Ga0209050_1000066133 299
2612 3300025298 Ga0209050_1000138 Ga0209050_100013839 299
2613 3300025298 Ga0209050_1000471 Ga0209050_100047128 299
2614 3300025298 Ga0209050_1000478 Ga0209050_100047856 299
2615 3300025298 Ga0209050_1000723 Ga0209050_100072329 299
2616 3300025298 Ga0209050_1001271 Ga0209050_10012719 299
2617 3300025298 Ga0209050_1002074 Ga0209050_100207417 299
2618 3300025298 Ga0209050_1004989 Ga0209050_10049897 299
2619 3300025298 Ga0209050_1007739 Ga0209050_10077395 299
2620 3300025298 Ga0209050_1012069 Ga0209050_10120694 299
2621 3300025299 Ga0209256_1000003 Ga0209256_10000031406 299
2622 3300025299 Ga0209256_1000005 Ga0209256_10000051032 299
2623 3300025299 Ga0209256_1000024 Ga0209256_100002442 299
2624 3300025299 Ga0209256_1000078 Ga0209256_1000078180 299
2625 3300025299 Ga0209256_1000115 Ga0209256_1000115107 299
2626 3300025299 Ga0209256_1000210 Ga0209256_100021099 299
2627 3300025299 Ga0209256_1000895 Ga0209256_100089533 299
2628 3300025299 Ga0209256_1001323 Ga0209256_10013238 299
2629 3300025299 Ga0209256_1001589 Ga0209256_100158911 299
2630 3300025299 Ga0209256_1011754 Ga0209256_10117542 299
2631 3300025299 Ga0209256_1012348 Ga0209256_10123482 299
2632 3300025299 Ga0209256_1012450 Ga0209256_10124503 299
2633 3300025302 Ga0207426_1000001 Ga0207426_10000011196 299
2634 3300025302 Ga0207426_1000031 Ga0207426_100003133 299
2635 3300025302 Ga0207426_1000197 Ga0207426_100019713 299
2636 3300025302 Ga0207426_1000980 Ga0207426_100098025 299
2637 3300025302 Ga0207426_1017971 Ga0207426_10179713 299
2638 3300025303 Ga0209051_1000009 Ga0209051_1000009515 299
2639 3300025303 Ga0209051_1000044 Ga0209051_1000044133 299
2640 3300025303 Ga0209051_1000063 Ga0209051_100006319 299
2641 3300025303 Ga0209051_1000115 Ga0209051_100011544 299
2642 3300025303 Ga0209051_1000312 Ga0209051_100031239 299
2643 3300025303 Ga0209051_1000398 Ga0209051_100039833 299
2644 3300025303 Ga0209051_1002044 Ga0209051_100204411 299
2645 3300025303 Ga0209051_1003195 Ga0209051_10031958 299
2646 3300025303 Ga0209051_1012681 Ga0209051_10126813 299
2647 3300025303 Ga0209051_1022442 Ga0209051_10224422 299
2648 3300025303 Ga0209051_1023867 Ga0209051_10238672 299
2649 3300025304 Ga0209257_1000003 Ga0209257_10000031202 299
2650 3300025304 Ga0209257_1000011 Ga0209257_1000011489 299
2651 3300025304 Ga0209257_1000032 Ga0209257_1000032523 299
2652 3300025304 Ga0209257_1000055 Ga0209257_100005579 299
2653 3300025304 Ga0209257_1000082 Ga0209257_1000082133 299
2654 3300025304 Ga0209257_1000118 Ga0209257_1000118188 299
2655 3300025304 Ga0209257_1000669 Ga0209257_100066929 299
2656 3300025304 Ga0209257_1000978 Ga0209257_10009781 299
2657 3300025304 Ga0209257_1005323 Ga0209257_10053231 299
2658 3300025304 Ga0209257_1006936 Ga0209257_10069367 299
2659 3300025304 Ga0209257_1011253 Ga0209257_10112533 299
2660 3300025304 Ga0209257_1014294 Ga0209257_10142942 299
2661 3300025304 Ga0209257_1036598 Ga0209257_10365982 299
2662 3300025728 Ga0207655_1005400 Ga0207655_10054003 299
2663 3300025728 Ga0207655_1051290 Ga0207655_10512902 299
2664 3300025893 Ga0207682_10000737 Ga0207682_100007375 299
2665 3300025893 Ga0207682_10014412 Ga0207682_100144123 299
2666 3300025898 Ga0207692_10013114 Ga0207692_100131144 299
2667 3300025901 Ga0207688_10025869 Ga0207688_100258692 299
2668 3300025903 Ga0207680_10025319 Ga0207680_100253194 299
2669 3300025907 Ga0207645_10001462 Ga0207645_1000146213 299
2670 3300025909 Ga0207705_10030015 Ga0207705_100300154 299
2671 3300025909 Ga0207705_10285307 Ga0207705_102853072 299
2672 3300025910 Ga0207684_10018838 Ga0207684_100188383 299
2673 3300025911 Ga0207654_10022032 Ga0207654_100220322 299
2674 3300025911 Ga0207654_10089231 Ga0207654_100892312 299
2675 3300025911 Ga0207654_10089301 Ga0207654_100893012 299
2676 3300025912 Ga0207707_10195481 Ga0207707_101954811 299
2677 3300025913 Ga0207695_10000475 Ga0207695_1000047517 299
2678 3300025913 Ga0207695_10004636 Ga0207695_1000463612 299
2679 3300025913 Ga0207695_10018487 Ga0207695_100184876 299
2680 3300025913 Ga0207695_10098917 Ga0207695_100989173 299
2681 3300025913 Ga0207695_10142611 Ga0207695_101426112 299
2682 3300025914 Ga0207671_10005383 Ga0207671_100053838 299
2683 3300025914 Ga0207671_10010561 Ga0207671_100105611 299
2684 3300025914 Ga0207671_10014008 Ga0207671_100140083 299
2685 3300025914 Ga0207671_10070790 Ga0207671_100707903 299
2686 3300025917 Ga0207660_10012024 Ga0207660_100120246 299
2687 3300025917 Ga0207660_10341116 Ga0207660_103411161 299
2688 3300025919 Ga0207657_10002340 Ga0207657_1000234010 299
2689 3300025919 Ga0207657_10006936 Ga0207657_100069362 299
2690 3300025919 Ga0207657_10025011 Ga0207657_100250114 299
2691 3300025919 Ga0207657_10049823 Ga0207657_100498233 299
2692 3300025919 Ga0207657_10056303 Ga0207657_100563032 299
2693 3300025919 Ga0207657_10105845 Ga0207657_101058452 299
2694 3300025920 Ga0207649_10002632 Ga0207649_100026329 299
2695 3300025920 Ga0207649_10020789 Ga0207649_100207892 299
2696 3300025920 Ga0207649_10021054 Ga0207649_100210543 299
2697 3300025920 Ga0207649_10027972 Ga0207649_100279722 299
2698 3300025921 Ga0207652_10007084 Ga0207652_100070849 299
2699 3300025921 Ga0207652_10030770 Ga0207652_100307704 299
2700 3300025922 Ga0207646_10150481 Ga0207646_101504812 299
2701 3300025922 Ga0207646_10205580 Ga0207646_102055802 299
2702 3300025922 Ga0207646_10237664 Ga0207646_102376642 299
2703 3300025923 Ga0207681_10119741 Ga0207681_101197413 299
2704 3300025924 Ga0207694_10041783 Ga0207694_100417831 299
2705 3300025924 Ga0207694_10114749 Ga0207694_101147493 299
2706 3300025924 Ga0207694_10149210 Ga0207694_101492102 299
2707 3300025925 Ga0207650_10020385 Ga0207650_100203854 299
2708 3300025925 Ga0207650_10028511 Ga0207650_100285115 299
2709 3300025925 Ga0207650_10035201 Ga0207650_100352013 299
2710 3300025925 Ga0207650_10058613 Ga0207650_100586133 299
2711 3300025925 Ga0207650_10282128 Ga0207650_102821282 299
2712 3300025926 Ga0207659_10009755 Ga0207659_100097557 299
2713 3300025926 Ga0207659_10048422 Ga0207659_100484222 299
2714 3300025926 Ga0207659_10067923 Ga0207659_100679231 299
2715 3300025926 Ga0207659_10116581 Ga0207659_101165811 299
2716 3300025927 Ga0207687_10022649 Ga0207687_100226493 299
2717 3300025928 Ga0207700_10057989 Ga0207700_100579893 299
2718 3300025929 Ga0207664_10003701 Ga0207664_100037018 299
2719 3300025931 Ga0207644_10011075 Ga0207644_100110752 299
2720 3300025931 Ga0207644_10022031 Ga0207644_100220314 299
2721 3300025932 Ga0207690_10001749 Ga0207690_1000174911 299
2722 3300025932 Ga0207690_10005166 Ga0207690_100051666 299
2723 3300025932 Ga0207690_10142398 Ga0207690_101423982 299
2724 3300025933 Ga0207706_10004842 Ga0207706_1000484212 299
2725 3300025933 Ga0207706_10016942 Ga0207706_100169424 299
2726 3300025933 Ga0207706_10021145 Ga0207706_100211453 299
2727 3300025933 Ga0207706_10023955 Ga0207706_100239553 299
2728 3300025933 Ga0207706_10169417 Ga0207706_101694172 299
2729 3300025934 Ga0207686_10178822 Ga0207686_101788222 299
2730 3300025935 Ga0207709_10000105 Ga0207709_100001055 299
2731 3300025935 Ga0207709_10000295 Ga0207709_1000029514 299
2732 3300025935 Ga0207709_10002911 Ga0207709_100029118 299
2733 3300025935 Ga0207709_10007537 Ga0207709_100075374 299
2734 3300025935 Ga0207709_10012876 Ga0207709_100128763 299
2735 3300025937 Ga0207669_10002931 Ga0207669_100029314 299
2736 3300025938 Ga0207704_10001087 Ga0207704_1000108712 299
2737 3300025938 Ga0207704_10124952 Ga0207704_101249522 299
2738 3300025939 Ga0207665_10006550 Ga0207665_100065505 299
2739 3300025940 Ga0207691_10000073 Ga0207691_100000736 299
2740 3300025940 Ga0207691_10000906 Ga0207691_1000090610 299
2741 3300025940 Ga0207691_10032543 Ga0207691_100325432 299
2742 3300025940 Ga0207691_10067104 Ga0207691_100671043 299
2743 3300025940 Ga0207691_10090545 Ga0207691_100905453 299
2744 3300025940 Ga0207691_10098896 Ga0207691_100988962 299
2745 3300025940 Ga0207691_10248809 Ga0207691_102488092 299
2746 3300025941 Ga0207711_10099715 Ga0207711_100997151 299
2747 3300025941 Ga0207711_10266588 Ga0207711_102665882 299
2748 3300025942 Ga0207689_10003090 Ga0207689_100030905 299
2749 3300025942 Ga0207689_10019263 Ga0207689_100192634 299
2750 3300025942 Ga0207689_10033553 Ga0207689_100335534 299
2751 3300025942 Ga0207689_10038198 Ga0207689_100381985 299
2752 3300025942 Ga0207689_10048209 Ga0207689_100482092 299
2753 3300025942 Ga0207689_10055845 Ga0207689_100558453 299
2754 3300025942 Ga0207689_10156661 Ga0207689_101566612 299
2755 3300025945 Ga0207679_10000991 Ga0207679_1000099110 299
2756 3300025945 Ga0207679_10021714 Ga0207679_100217143 299
2757 3300025945 Ga0207679_10041047 Ga0207679_100410472 299
2758 3300025945 Ga0207679_10201073 Ga0207679_102010732 299
2759 3300025945 Ga0207679_10295732 Ga0207679_102957322 299
2760 3300025949 Ga0207667_10000025 Ga0207667_1000002589 299
2761 3300025949 Ga0207667_10013866 Ga0207667_100138663 299
2762 3300025949 Ga0207667_10021269 Ga0207667_100212698 299
2763 3300025949 Ga0207667_10022096 Ga0207667_100220963 299
2764 3300025949 Ga0207667_10064691 Ga0207667_100646911 299
2765 3300025949 Ga0207667_10440228 Ga0207667_104402282 299
2766 3300025960 Ga0207651_10006970 Ga0207651_100069705 299
2767 3300025960 Ga0207651_10011844 Ga0207651_100118445 299
2768 3300025960 Ga0207651_10021408 Ga0207651_100214083 299
2769 3300025960 Ga0207651_10038591 Ga0207651_100385912 299
2770 3300025961 Ga0207712_10102362 Ga0207712_101023622 299
2771 3300025972 Ga0207668_10004960 Ga0207668_100049602 299
2772 3300025972 Ga0207668_10052639 Ga0207668_100526394 299
2773 3300025972 Ga0207668_10128274 Ga0207668_101282742 299
2774 3300025981 Ga0207640_10011961 Ga0207640_100119614 299
2775 3300025981 Ga0207640_10033131 Ga0207640_100331313 299
2776 3300025981 Ga0207640_10052379 Ga0207640_100523792 299
2777 3300025986 Ga0207658_10006425 Ga0207658_100064252 299
2778 3300025986 Ga0207658_10056948 Ga0207658_100569482 299
2779 3300025986 Ga0207658_10170023 Ga0207658_101700232 299
2780 3300025986 Ga0207658_10231561 Ga0207658_102315612 299
2781 3300025986 Ga0207658_10296998 Ga0207658_102969982 299
2782 3300026023 Ga0207677_10025253 Ga0207677_100252534 299
2783 3300026035 Ga0207703_10020161 Ga0207703_100201612 299
2784 3300026035 Ga0207703_10036725 Ga0207703_100367253 299
2785 3300026035 Ga0207703_10089142 Ga0207703_100891422 299
2786 3300026035 Ga0207703_10138870 Ga0207703_101388702 299
2787 3300026041 Ga0207639_10002193 Ga0207639_100021939 299
2788 3300026041 Ga0207639_10010774 Ga0207639_100107743 299
2789 3300026041 Ga0207639_10102374 Ga0207639_101023742 299
2790 3300026041 Ga0207639_10114522 Ga0207639_101145222 299
2791 3300026067 Ga0207678_10006696 Ga0207678_1000669610 299
2792 3300026075 Ga0207708_10068492 Ga0207708_100684921 299
2793 3300026078 Ga0207702_10150973 Ga0207702_101509732 299
2794 3300026078 Ga0207702_10401430 Ga0207702_104014302 299
2795 3300026088 Ga0207641_10058576 Ga0207641_100585763 299
2796 3300026088 Ga0207641_10107074 Ga0207641_101070742 299
2797 3300026088 Ga0207641_10172654 Ga0207641_101726542 299
2798 3300026088 Ga0207641_10278932 Ga0207641_102789322 299
2799 3300026089 Ga0207648_10000556 Ga0207648_100005569 299
2800 3300026089 Ga0207648_10001151 Ga0207648_100011519 299
2801 3300026089 Ga0207648_10018070 Ga0207648_100180703 299
2802 3300026089 Ga0207648_10437307 Ga0207648_104373071 299
2803 3300026095 Ga0207676_10011955 Ga0207676_100119552 299
2804 3300026095 Ga0207676_10013940 Ga0207676_100139405 299
2805 3300026095 Ga0207676_10028978 Ga0207676_100289782 299
2806 3300026095 Ga0207676_10079099 Ga0207676_100790991 299
2807 3300026095 Ga0207676_10258070 Ga0207676_102580701 299
2808 3300026095 Ga0207676_10312829 Ga0207676_103128292 299
2809 3300026095 Ga0207676_10408598 Ga0207676_104085981 299
2810 3300026116 Ga0207674_10011128 Ga0207674_100111282 299
2811 3300026116 Ga0207674_10052624 Ga0207674_100526243 299
2812 3300026116 Ga0207674_10072755 Ga0207674_100727553 299
2813 3300026116 Ga0207674_10144782 Ga0207674_101447823 299
2814 3300026116 Ga0207674_10149467 Ga0207674_101494672 299
2815 3300026116 Ga0207674_10467163 Ga0207674_104671631 299
2816 3300026118 Ga0207675_100001125 Ga0207675_10000112527 299
2817 3300026118 Ga0207675_100005669 Ga0207675_1000056699 299
2818 3300026118 Ga0207675_100063606 Ga0207675_1000636062 299
2819 3300026118 Ga0207675_100070454 Ga0207675_1000704543 299
2820 3300026121 Ga0207683_10000125 Ga0207683_1000012565 299
2821 3300026121 Ga0207683_10024010 Ga0207683_100240106 299
2822 3300026121 Ga0207683_10047187 Ga0207683_100471873 299
2823 3300026121 Ga0207683_10074560 Ga0207683_100745602 299
2824 3300026121 Ga0207683_10145430 Ga0207683_101454302 299
2825 3300026142 Ga0207698_10068668 Ga0207698_100686683 299
2826 3300026142 Ga0207698_10100474 Ga0207698_101004743 299
2827 3300026142 Ga0207698_10169356 Ga0207698_101693562 299
2828 3300026142 Ga0207698_10178323 Ga0207698_101783232 299
2829 3300026142 Ga0207698_10330817 Ga0207698_103308172 299
2830 3300027111 Ga0209281_1000002 Ga0209281_10000021760 299
2831 3300027111 Ga0209281_1000416 Ga0209281_100041618 299
2832 3300027111 Ga0209281_1004749 Ga0209281_10047493 299
2833 3300027252 Ga0209973_1000926 Ga0209973_10009262 299
2834 3300027395 Ga0209996_1001989 Ga0209996_10019891 299
2835 3300027666 Ga0209282_1000001 Ga0209282_10000011695 299
2836 3300027666 Ga0209282_1000310 Ga0209282_100031018 299
2837 3300027695 Ga0209966_1000659 Ga0209966_10006593 299
2838 3300027876 Ga0209974_10000749 Ga0209974_100007499 299
2839 3300027907 Ga0207428_10060518 Ga0207428_100605183 299
2840 3300028379 Ga0268266_10009087 Ga0268266_100090875 299
2841 3300028379 Ga0268266_10024895 Ga0268266_100248956 299
2842 3300028379 Ga0268266_10038899 Ga0268266_100388995 299
2843 3300028380 Ga0268265_10023410 Ga0268265_100234103 299
2844 3300028380 Ga0268265_10025075 Ga0268265_100250753 299
2845 3300028380 Ga0268265_10110936 Ga0268265_101109361 299
2846 3300028380 Ga0268265_10278370 Ga0268265_102783702 299
2847 3300028381 Ga0268264_10014456 Ga0268264_100144562 299
2848 3300028381 Ga0268264_10028514 Ga0268264_100285142 299
2849 3300028786 Ga0307517_10002492 Ga0307517_1000249219 299
2850 3300028786 Ga0307517_10048416 Ga0307517_100484164 299
2851 3300028794 Ga0307515_10000006 Ga0307515_10000006177 299
2852 3300028794 Ga0307515_10000028 Ga0307515_10000028232 299
2853 3300028794 Ga0307515_10000043 Ga0307515_10000043211 299
2854 3300028794 Ga0307515_10000416 Ga0307515_1000041699 299
2855 3300028794 Ga0307515_10000459 Ga0307515_1000045974 299
2856 3300028794 Ga0307515_10007444 Ga0307515_1000744414 299
2857 3300028794 Ga0307515_10018602 Ga0307515_1001860213 299
2858 3300028794 Ga0307515_10088806 Ga0307515_100888064 299
2859 3300028794 Ga0307515_10112059 Ga0307515_101120593 299
2860 3300028794 Ga0307515_10121446 Ga0307515_101214463 299
2861 3300028794 Ga0307515_10157823 Ga0307515_101578232 299
2862 3300028794 Ga0307515_10162675 Ga0307515_101626752 299
2863 3300030522 Ga0307512_10118482 Ga0307512_101184822 299
2864 3300030731 Ga0316177_1154063 Ga0316177_11540632 299
2865 3300030733 Ga0314311_1127732 Ga0314311_11277324 299
2866 3300030734 Ga0316179_1066869 Ga0316179_10668693 299
2867 3300030735 Ga0316178_1038519 Ga0316178_10385192 299
2868 3300030736 Ga0316180_1083909 Ga0316180_10839092 299
2869 3300030742 Ga0316183_1066219 Ga0316183_10662193 299
2870 3300030744 Ga0316181_1002569 Ga0316181_10025692 299
2871 3300030745 Ga0316182_1003039 Ga0316182_10030393 299
2872 3300030745 Ga0316182_1192275 Ga0316182_11922751 299
2873 3300031235 Ga0265330_10000062 Ga0265330_1000006247 299
2874 3300031238 Ga0265332_10000001 Ga0265332_10000001385 299
2875 3300031238 Ga0265332_10018991 Ga0265332_100189913 299
2876 3300031239 Ga0265328_10007254 Ga0265328_100072543 299
2877 3300031240 Ga0265320_10016068 Ga0265320_100160682 299
2878 3300031241 Ga0265325_10013088 Ga0265325_100130882 299
2879 3300031251 Ga0265327_10000731 Ga0265327_1000073148 299
2880 3300031251 Ga0265327_10002253 Ga0265327_1000225312 299
2881 3300031251 Ga0265327_10062478 Ga0265327_100624782 299
2882 3300031344 Ga0265316_10002079 Ga0265316_100020799 299
2883 3300031456 Ga0307513_10000012 Ga0307513_1000001212 299
2884 3300031456 Ga0307513_10000021 Ga0307513_10000021156 299
2885 3300031456 Ga0307513_10005429 Ga0307513_100054292 299
2886 3300031456 Ga0307513_10015370 Ga0307513_100153708 299
2887 3300031456 Ga0307513_10049223 Ga0307513_100492233 299
2888 3300031456 Ga0307513_10288532 Ga0307513_102885321 299
2889 3300031507 Ga0307509_10000599 Ga0307509_1000059929 299
2890 3300031507 Ga0307509_10033058 Ga0307509_100330587 299
2891 3300031507 Ga0307509_10050936 Ga0307509_100509362 299
2892 3300031507 Ga0307509_10067465 Ga0307509_100674652 299
2893 3300031507 Ga0307509_10154467 Ga0307509_101544671 299
2894 3300031548 Ga0307408_100000056 Ga0307408_10000005613 299
2895 3300031548 Ga0307408_100000095 Ga0307408_10000009515 299
2896 3300031548 Ga0307408_100000864 Ga0307408_10000086412 299
2897 3300031548 Ga0307408_100042051 Ga0307408_1000420512 299
2898 3300031548 Ga0307408_100065306 Ga0307408_1000653062 299
2899 3300031548 Ga0307408_100080697 Ga0307408_1000806972 299
2900 3300031548 Ga0307408_100085494 Ga0307408_1000854943 299
2901 3300031548 Ga0307408_100093488 Ga0307408_1000934883 299
2902 3300031548 Ga0307408_100128215 Ga0307408_1001282152 299
2903 3300031548 Ga0307408_100504621 Ga0307408_1005046211 299
2904 3300031616 Ga0307508_10000047 Ga0307508_100000476 299
2905 3300031616 Ga0307508_10000204 Ga0307508_1000020446 299
2906 3300031616 Ga0307508_10000388 Ga0307508_1000038819 299
2907 3300031649 Ga0307514_10000979 Ga0307514_1000097926 299
2908 3300031649 Ga0307514_10024596 Ga0307514_100245963 299
2909 3300031711 Ga0265314_10000145 Ga0265314_1000014555 299
2910 3300031711 Ga0265314_10004359 Ga0265314_100043596 299
2911 3300031730 Ga0307516_10001121 Ga0307516_1000112120 299
2912 3300031730 Ga0307516_10008157 Ga0307516_1000815711 299
2913 3300031730 Ga0307516_10215889 Ga0307516_102158892 299
2914 3300031731 Ga0307405_10027693 Ga0307405_100276932 299
2915 3300031731 Ga0307405_10052528 Ga0307405_100525283 299
2916 3300031731 Ga0307405_10141032 Ga0307405_101410322 299
2917 3300031852 Ga0307410_10019465 Ga0307410_100194654 299
2918 3300031852 Ga0307410_10237070 Ga0307410_102370702 299
2919 3300031901 Ga0307406_10005421 Ga0307406_100054213 299
2920 3300031903 Ga0307407_10015089 Ga0307407_100150893 299
2921 3300031911 Ga0307412_10012336 Ga0307412_100123363 299
2922 3300031911 Ga0307412_10014387 Ga0307412_100143875 299
2923 3300031911 Ga0307412_10147393 Ga0307412_101473932 299
2924 3300031911 Ga0307412_10343752 Ga0307412_103437522 299
2925 3300031995 Ga0307409_100002755 Ga0307409_1000027553 299
2926 3300031995 Ga0307409_100041625 Ga0307409_1000416253 299
2927 3300032002 Ga0307416_100005127 Ga0307416_1000051273 299
2928 3300032002 Ga0307416_100080095 Ga0307416_1000800953 299
2929 3300032002 Ga0307416_100141507 Ga0307416_1001415071 299
2930 3300032002 Ga0307416_100252506 Ga0307416_1002525062 299
2931 3300032002 Ga0307416_100321278 Ga0307416_1003212781 299
2932 3300032002 Ga0307416_100473154 Ga0307416_1004731542 299
2933 3300032004 Ga0307414_10018294 Ga0307414_100182944 299
2934 3300032005 Ga0307411_10001214 Ga0307411_100012149 299
2935 3300032005 Ga0307411_10037583 Ga0307411_100375833 299
2936 3300032005 Ga0307411_10042556 Ga0307411_100425562 299
2937 3300032005 Ga0307411_10306949 Ga0307411_103069492 299
2938 3300032126 Ga0307415_100169715 Ga0307415_1001697152 299
2939 3300033179 Ga0307507_10068312 Ga0307507_100683123 299
2940 3300033180 Ga0307510_10006844 Ga0307510_100068449 299
2941 3300033180 Ga0307510_10115844 Ga0307510_101158442 299
2942 3300033180 Ga0307510_10161503 Ga0307510_101615032 299
2943 3300033180 Ga0307510_10207985 Ga0307510_102079852 299
2944 3300035112 Ga0373932_0040408 Ga0373932_0040408_220_1197 299
2945 3300035114 Ga0373939_0000029 Ga0373939_0000029_20936_21907 299
2946 3300035114 Ga0373939_0004613 Ga0373939_0004613_1623_2597 299
2947 3300035114 Ga0373939_0039174 Ga0373939_0039174_17_988 299
2948 3300035170 Ga0373943_0058921 Ga0373943_0058921_591_1562 299
2949 3300035241 Ga0373961_0003551 Ga0373961_0003551_1151_2122 299
2950 3300035242 Ga0373962_0015395 Ga0373962_0015395_48_1019 299
2951 3300035691 Ga0373931_0000407 Ga0373931_0000407_14520_15491 299
2952 3300035691 Ga0373931_0002605 Ga0373931_0002605_6860_7831 299
2953 3300035695 Ga0373927_0030979 Ga0373927_0030979_720_1691 299
2954 3300035695 Ga0373927_0077595 Ga0373927_0077595_292_1263 299
2955 3300036401 Ga0373937_0173376 Ga0373937_0173376_539_1510 299
2956 3300037068 Ga0373925_0003379 Ga0373925_0003379_1675_2646 299
2957 3300037068 Ga0373925_0055995 Ga0373925_0055995_1599_2570 299
2958 3300037312 Ga0395899_0000163 Ga0395899_0000163_46398_47375 299
2959 3300037312 Ga0395899_0001301 Ga0395899_0001301_7741_8793 299
2960 3300037312 Ga0395899_0001859 Ga0395899_0001859_3762_4736 299
2961 3300037312 Ga0395899_0041558 Ga0395899_0041558_401_1378 299
2962 3300037312 Ga0395899_0073339 Ga0395899_0073339_703_1680 299
2963 3300037312 Ga0395899_0074957 Ga0395899_0074957_1434_2411 299
2964 3300037312 Ga0395899_0091118 Ga0395899_0091118_647_1624 299
2965 3300037418 Ga0395900_0000133 Ga0395900_0000133_20857_21828 299
2966 3300037418 Ga0395900_0002123 Ga0395900_0002123_9691_10668 299
2967 3300037418 Ga0395900_0011264 Ga0395900_0011264_7523_8500 299
2968 3300037418 Ga0395900_0030463 Ga0395900_0030463_2318_3295 299
2969 3300037418 Ga0395900_0032373 Ga0395900_0032373_491_1465 299
2970 3300037418 Ga0395900_0040252 Ga0395900_0040252_2046_3023 299
2971 3300037418 Ga0395900_0059504 Ga0395900_0059504_2641_3651 299
2972 3300037418 Ga0395900_0128714 Ga0395900_0128714_324_1301 299
2973 3300037418 Ga0395900_0304281 Ga0395900_0304281_194_1168 299
2974 3300037466 Ga0395898_0003944 Ga0395898_0003944_7296_8267 299
2975 3300037466 Ga0395898_0007603 Ga0395898_0007603_10249_11226 299
2976 3300037466 Ga0395898_0049040 Ga0395898_0049040_669_1649 299
2977 3300037466 Ga0395898_0076721 Ga0395898_0076721_2163_3137 299
2978 3300037466 Ga0395898_0078013 Ga0395898_0078013_893_1870 299
2979 3300037471 Ga0395905_0000249 Ga0395905_0000249_76623_77597 299
2980 3300037471 Ga0395905_0002454 Ga0395905_0002454_9902_10954 299
2981 3300037471 Ga0395905_0002769 Ga0395905_0002769_5452_6540 299
2982 3300037471 Ga0395905_0002774 Ga0395905_0002774_2512_3483 299
2983 3300037471 Ga0395905_0003414 Ga0395905_0003414_9509_10486 299
2984 3300037471 Ga0395905_0004459 Ga0395905_0004459_5843_6817 299
2985 3300037471 Ga0395905_0011520 Ga0395905_0011520_3916_4893 299
2986 3300037471 Ga0395905_0012066 Ga0395905_0012066_4325_5302 299
2987 3300037471 Ga0395905_0069206 Ga0395905_0069206_711_1688 299
2988 3300037471 Ga0395905_0092710 Ga0395905_0092710_38_1015 299
2989 3300037471 Ga0395905_0093479 Ga0395905_0093479_244_1215 299
2990 3300037471 Ga0395905_0097148 Ga0395905_0097148_866_1837 299
2991 3300037471 Ga0395905_0144462 Ga0395905_0144462_242_1219 299
2992 3300037471 Ga0395905_0149641 Ga0395905_0149641_173_1144 299
2993 3300037471 Ga0395905_0176738 Ga0395905_0176738_328_1302 299
2994 3300037471 Ga0395905_0179211 Ga0395905_0179211_97_1068 299
2995 3300037471 Ga0395905_0373398 Ga0395905_0373398_120_1100 299
2996 3300038443 Ga0395901_0000097 Ga0395901_0000097_112476_113453 299
2997 3300038443 Ga0395901_0001818 Ga0395901_0001818_9174_10148 299
2998 3300038443 Ga0395901_0014164 Ga0395901_0014164_1863_2843 299
2999 3300038443 Ga0395901_0043096 Ga0395901_0043096_3673_4647 299
3000 3300038443 Ga0395901_0091963 Ga0395901_0091963_775_1752 299
3001 3300038443 Ga0395901_0189258 Ga0395901_0189258_409_1386 299
3002 3300038443 Ga0395901_0264060 Ga0395901_0264060_27_1001 299
3003 3300038443 Ga0395901_0403822 Ga0395901_0403822_235_1212 299
3004 3300038443 Ga0395901_0505709 Ga0395901_0505709_230_1207 299
3005 3300039447 Ga0436361_0146317 Ga0436361_0146317_18837_19808 299
3006 3300039447 Ga0436361_0173123 Ga0436361_0173123_621_1649 299
3007 3300039447 Ga0436361_0281261 Ga0436361_0281261_48_1019 299
3008 3300039447 Ga0436361_0296829 Ga0436361_0296829_11866_12846 299
3009 3300039447 Ga0436361_0661766 Ga0436361_0661766_28119_29090 299
3010 3300039447 Ga0436361_0734651 Ga0436361_0734651_1907_2878 299
3011 3300039447 Ga0436361_0756923 Ga0436361_0756923_3836_4813 299
3012 3300039447 Ga0436361_0890508 Ga0436361_0890508_1673_2647 299
3013 3300039447 Ga0436361_0946536 Ga0436361_0946536_1631_2605 299
3014 3300039447 Ga0436361_1083165 Ga0436361_1083165_2053_3024 299
3015 3300039447 Ga0436361_1096778 Ga0436361_1096778_519_1496 299
3016 3300039447 Ga0436361_1167030 Ga0436361_1167030_12499_13473 299
3017 3300041413 Ga0439465_0023617 Ga0439465_0023617_902_1873 299
3018 3300041451 Ga0451791_0481874 Ga0451791_0481874_502_1479 299
3019 3300041452 Ga0451793_1161440 Ga0451793_1161440_17_988 299
3020 3300041507 Ga0451851_0519729 Ga0451851_0519729_541_1521 299
3021 3300041509 Ga0451843_0571383 Ga0451843_0571383_66_1037 299
3022 3300041997 Ga0439431_0003184 Ga0439431_0003184_1345_2325 299
3023 3300041999 Ga0439433_0011201 Ga0439433_0011201_45_1025 299
3024 3300042007 Ga0439449_0001807 Ga0439449_0001807_1810_2790 299
3025 3300042007 Ga0439449_0008496 Ga0439449_0008496_2152_3132 299
3026 3300042010 Ga0439452_001623 Ga0439452_001623_1074_2054 299
3027 3300042015 Ga0439462_0005201 Ga0439462_0005201_1019_1996 299
3028 3300042115 Ga0450911_000104 Ga0450911_000104_15281_16261 299
3029 3300042125 Ga0450923_003900 Ga0450923_003900_258_1238 299
3030 3300042126 Ga0450888_001051 Ga0450888_001051_1605_2576 299
3031 3300042127 Ga0450890_003073 Ga0450890_003073_710_1681 299
3032 3300042130 Ga0450892_002332 Ga0450892_002332_74_1045 299
3033 3300042133 Ga0450896_014734 Ga0450896_014734_88_1059 299
3034 3300042438 Ga0439459_0001175 Ga0439459_0001175_395_1366 299
3035 3300042531 Ga0450918_000335 Ga0450918_000335_7060_8031 299
3036 3300042531 Ga0450918_000642 Ga0450918_000642_1945_2925 299
3037 3300042532 Ga0450893_0009149 Ga0450893_0009149_315_1286 299
3038 3300042876 Ga0451577_0007678 Ga0451577_0007678_8651_9625 299
3039 3300042876 Ga0451577_0022629 Ga0451577_0022629_2426_3400 299
3040 3300042876 Ga0451577_0200401 Ga0451577_0200401_647_1618 299
3041 3300044658 Ga0466972_0000041 Ga0466972_0000041_88859_89833 299
3042 3300044658 Ga0466972_0002562 Ga0466972_0002562_7967_8938 299
3043 3300044658 Ga0466972_0034246 Ga0466972_0034246_39_1010 299
3044 3300044673 Ga0453683_0027171 Ga0453683_0027171_1009_1986 299
3045 3300044683 Ga0466965_0000352 Ga0466965_0000352_12293_13267 299
3046 3300044683 Ga0466965_0009694 Ga0466965_0009694_2544_3515 299
3047 3300044683 Ga0466965_0114424 Ga0466965_0114424_399_1370 299
3048 3300044683 Ga0466965_0121561 Ga0466965_0121561_222_1193 299
3049 3300044684 Ga0466966_0012989 Ga0466966_0012989_734_1705 299
3050 3300044684 Ga0466966_0020803 Ga0466966_0020803_1165_2142 299
3051 3300044684 Ga0466966_0046312 Ga0466966_0046312_1589_2566 299
3052 3300044684 Ga0466966_0091085 Ga0466966_0091085_850_1821 299
3053 3300044694 Ga0466963_0010367 Ga0466963_0010367_3031_4002 299
3054 3300044694 Ga0466963_0026888 Ga0466963_0026888_438_1409 299
3055 3300044706 Ga0466964_0001842 Ga0466964_0001842_5169_6146 299
3056 3300044706 Ga0466964_0002193 Ga0466964_0002193_4492_5463 299
3057 3300044712 Ga0453684_0000126 Ga0453684_0000126_84784_85767 299
3058 3300044712 Ga0453684_0005726 Ga0453684_0005726_17744_18715 299
3059 3300044712 Ga0453684_0077064 Ga0453684_0077064_622_1596 299
3060 3300044712 Ga0453684_0285066 Ga0453684_0285066_750_1721 299
3061 3300044712 Ga0453684_0337331 Ga0453684_0337331_66_1040 299
3062 3300044719 Ga0466971_0004933 Ga0466971_0004933_3661_4632 299
3063 3300044735 Ga0466968_0018845 Ga0466968_0018845_1368_2342 299
3064 3300044765 Ga0466970_0003655 Ga0466970_0003655_3969_4940 299
3065 3300044765 Ga0466970_0005441 Ga0466970_0005441_3156_4130 299
3066 3300044765 Ga0466970_0069726 Ga0466970_0069726_677_1654 299
3067 3300044842 Ga0466957_0000007 Ga0466957_0000007_2991_3968 299
3068 3300044842 Ga0466957_0010652 Ga0466957_0010652_3693_4664 299
3069 3300045049 Ga0466959_0011860 Ga0466959_0011860_428_1399 299
3070 3300045049 Ga0466959_0019625 Ga0466959_0019625_1302_2273 299
3071 3300045049 Ga0466959_0105782 Ga0466959_0105782_489_1463 299
3072 3300045051 Ga0451576_0002387 Ga0451576_0002387_7059_8033 299
3073 3300045051 Ga0451576_0005477 Ga0451576_0005477_5538_6509 299
3074 3300045051 Ga0451576_0014782 Ga0451576_0014782_1696_2673 299
3075 3300045051 Ga0451576_0100244 Ga0451576_0100244_754_1725 299
3076 3300045051 Ga0451576_0218664 Ga0451576_0218664_31_1002 299
3077 3300045051 Ga0451576_0607205 Ga0451576_0607205_32_1036 299
3078 3300045836 Ga0466958_0018132 Ga0466958_0018132_3074_4045 299
3079 3300046452 Ga0495617_000009 Ga0495617_000009_235388_236365 299
3080 3300046452 Ga0495617_000021 Ga0495617_000021_212031_213005 299
3081 3300046452 Ga0495617_001664 Ga0495617_001664_6884_7864 299
3082 3300046453 Ga0495627_000008 Ga0495627_000008_321192_322166 299
3083 3300046453 Ga0495627_000119 Ga0495627_000119_21503_22480 299
3084 3300046454 Ga0495592_0004884 Ga0495592_0004884_2814_3785 299
3085 3300046455 Ga0495603_0235325 Ga0495603_0235325_34_1011 299
3086 3300046457 Ga0495590_0000010 Ga0495590_0000010_87010_87984 299
3087 3300046457 Ga0495590_0000253 Ga0495590_0000253_25114_26091 299
3088 3300046457 Ga0495590_0001564 Ga0495590_0001564_5436_6413 299
3089 3300046457 Ga0495590_0002391 Ga0495590_0002391_2977_3954 299
3090 3300046458 Ga0495591_000043 Ga0495591_000043_63676_64653 299
3091 3300046459 Ga0495629_0031532 Ga0495629_0031532_900_1877 299
3092 3300046462 Ga0495651_0000273 Ga0495651_0000273_7433_8407 299
3093 3300046463 Ga0495653_0000010 Ga0495653_0000010_210012_210986 299
3094 3300046463 Ga0495653_0001206 Ga0495653_0001206_17103_18077 299
3095 3300046471 Ga0495650_0000051 Ga0495650_0000051_305473_306450 299
3096 3300046471 Ga0495650_0000194 Ga0495650_0000194_1417_2391 299
3097 3300046471 Ga0495650_0000213 Ga0495650_0000213_109130_110107 299
3098 3300046471 Ga0495650_0000495 Ga0495650_0000495_55551_56525 299
3099 3300046471 Ga0495650_0021336 Ga0495650_0021336_533_1504 299
3100 3300046472 Ga0495580_0058594 Ga0495580_0058594_1369_2346 299
3101 3300046473 Ga0495582_0009205 Ga0495582_0009205_679_1656 299
3102 3300046474 Ga0495605_0000024 Ga0495605_0000024_158238_159215 299
3103 3300046474 Ga0495605_0000181 Ga0495605_0000181_3222_4196 299
3104 3300046474 Ga0495605_0000728 Ga0495605_0000728_14667_15644 299
3105 3300046474 Ga0495605_0040843 Ga0495605_0040843_960_1940 299
3106 3300046474 Ga0495605_0048924 Ga0495605_0048924_688_1665 299
3107 3300046475 Ga0495639_0003921 Ga0495639_0003921_254_1234 299
3108 3300046491 Ga0495584_0000062 Ga0495584_0000062_76834_77814 299
3109 3300046491 Ga0495584_0004512 Ga0495584_0004512_4050_5024 299
3110 3300046491 Ga0495584_0007351 Ga0495584_0007351_2135_3112 299
3111 3300046491 Ga0495584_0037057 Ga0495584_0037057_1174_2151 299
3112 3300046492 Ga0495585_0000796 Ga0495585_0000796_3280_4260 299
3113 3300046492 Ga0495585_0048510 Ga0495585_0048510_1164_2141 299
3114 3300046499 Ga0495594_0007010 Ga0495594_0007010_670_1647 299
3115 3300046499 Ga0495594_0126787 Ga0495594_0126787_451_1428 299
3116 3300046500 Ga0495596_0001969 Ga0495596_0001969_7595_8572 299
3117 3300046500 Ga0495596_0002616 Ga0495596_0002616_5461_6441 299
3118 3300046500 Ga0495596_0002916 Ga0495596_0002916_2470_3447 299
3119 3300046500 Ga0495596_0004316 Ga0495596_0004316_3022_3999 299
3120 3300046500 Ga0495596_0045878 Ga0495596_0045878_577_1557 299
3121 3300046501 Ga0495607_0005632 Ga0495607_0005632_1253_2230 299
3122 3300046501 Ga0495607_0017979 Ga0495607_0017979_681_1658 299
3123 3300046506 Ga0495583_0000006 Ga0495583_0000006_89890_90864 299
3124 3300046506 Ga0495583_0000045 Ga0495583_0000045_196390_197364 299
3125 3300046506 Ga0495583_0001184 Ga0495583_0001184_24659_25636 299
3126 3300046506 Ga0495583_0001186 Ga0495583_0001186_20484_21461 299
3127 3300046507 Ga0495606_0000014 Ga0495606_0000014_214532_215506 299
3128 3300046507 Ga0495606_0000111 Ga0495606_0000111_43830_44804 299
3129 3300046507 Ga0495606_0002129 Ga0495606_0002129_12435_13409 299
3130 3300046507 Ga0495606_0008283 Ga0495606_0008283_4779_5756 299
3131 3300046507 Ga0495606_0018077 Ga0495606_0018077_1387_2361 299
3132 3300046507 Ga0495606_0038736 Ga0495606_0038736_1576_2553 299
3133 3300046507 Ga0495606_0039803 Ga0495606_0039803_683_1657 299
3134 3300046511 Ga0495608_0009972 Ga0495608_0009972_4280_5254 299
3135 3300046512 Ga0495610_0000010 Ga0495610_0000010_472542_473516 299
3136 3300046512 Ga0495610_0000809 Ga0495610_0000809_28331_29308 299
3137 3300046512 Ga0495610_0016627 Ga0495610_0016627_1730_2704 299
3138 3300046512 Ga0495610_0027901 Ga0495610_0027901_370_1344 299
3139 3300046513 Ga0495616_0003155 Ga0495616_0003155_2734_3711 299
3140 3300046513 Ga0495616_0005227 Ga0495616_0005227_6954_7931 299
3141 3300046513 Ga0495616_0015058 Ga0495616_0015058_1636_2613 299
3142 3300046513 Ga0495616_0032035 Ga0495616_0032035_1316_2290 299
3143 3300046514 Ga0495618_0024550 Ga0495618_0024550_2166_3140 299
3144 3300046515 Ga0495620_0052750 Ga0495620_0052750_355_1335 299
3145 3300046516 Ga0495628_0000218 Ga0495628_0000218_47510_48484 299
3146 3300046516 Ga0495628_0019472 Ga0495628_0019472_2792_3766 299
3147 3300046516 Ga0495628_0106809 Ga0495628_0106809_1005_1979 299
3148 3300046518 Ga0495631_0005890 Ga0495631_0005890_4305_5282 299
3149 3300046518 Ga0495631_0005928 Ga0495631_0005928_1856_2833 299
3150 3300046518 Ga0495631_0009824 Ga0495631_0009824_2995_3972 299
3151 3300046518 Ga0495631_0013828 Ga0495631_0013828_2308_3288 299
3152 3300046518 Ga0495631_0020256 Ga0495631_0020256_792_1769 299
3153 3300046519 Ga0495632_0000035 Ga0495632_0000035_160100_161077 299
3154 3300046519 Ga0495632_0000073 Ga0495632_0000073_28882_29859 299
3155 3300046519 Ga0495632_0000161 Ga0495632_0000161_2525_3502 299
3156 3300046519 Ga0495632_0008045 Ga0495632_0008045_3485_4462 299
3157 3300046519 Ga0495632_0008849 Ga0495632_0008849_1905_2876 299
3158 3300046519 Ga0495632_0042229 Ga0495632_0042229_1242_2219 299
3159 3300046519 Ga0495632_0159568 Ga0495632_0159568_40_1011 299
3160 3300046520 Ga0495637_0000009 Ga0495637_0000009_345521_346498 299
3161 3300046520 Ga0495637_0003958 Ga0495637_0003958_1606_2586 299
3162 3300046520 Ga0495637_0010473 Ga0495637_0010473_702_1679 299
3163 3300046522 Ga0495643_0000171 Ga0495643_0000171_64493_65470 299
3164 3300046522 Ga0495643_0000299 Ga0495643_0000299_375_1349 299
3165 3300046522 Ga0495643_0000856 Ga0495643_0000856_3128_4105 299
3166 3300046522 Ga0495643_0016276 Ga0495643_0016276_3012_3986 299
3167 3300046522 Ga0495643_0019763 Ga0495643_0019763_1255_2253 299
3168 3300046522 Ga0495643_0024502 Ga0495643_0024502_1891_2862 299
3169 3300046522 Ga0495643_0035096 Ga0495643_0035096_1229_2206 299
3170 3300046522 Ga0495643_0133827 Ga0495643_0133827_58_1038 299
3171 3300046523 Ga0495644_0023675 Ga0495644_0023675_83_1060 299
3172 3300046523 Ga0495644_0033176 Ga0495644_0033176_68_1045 299
3173 3300046524 Ga0495648_0000110 Ga0495648_0000110_41923_42897 299
3174 3300046524 Ga0495648_0000475 Ga0495648_0000475_1307_2284 299
3175 3300046524 Ga0495648_0000659 Ga0495648_0000659_3192_4166 299
3176 3300046524 Ga0495648_0014650 Ga0495648_0014650_264_1241 299
3177 3300046524 Ga0495648_0039181 Ga0495648_0039181_134_1108 299
3178 3300046526 Ga0495666_0003154 Ga0495666_0003154_3788_4765 299
3179 3300046526 Ga0495666_0012819 Ga0495666_0012819_818_1795 299
3180 3300046528 Ga0495642_0000125 Ga0495642_0000125_2389_3366 299
3181 3300046528 Ga0495642_0000257 Ga0495642_0000257_28311_29288 299
3182 3300046528 Ga0495642_0009095 Ga0495642_0009095_517_1515 299
3183 3300046529 Ga0495652_0127813 Ga0495652_0127813_32_1006 299
3184 3300046530 Ga0495654_0000002 Ga0495654_0000002_504514_505488 299
3185 3300046531 Ga0495665_0104461 Ga0495665_0104461_75_1052 299
3186 3300046535 Ga0495586_0001753 Ga0495586_0001753_1586_2566 299
3187 3300046536 Ga0495587_0029851 Ga0495587_0029851_2032_3009 299
3188 3300046538 Ga0495609_0000030 Ga0495609_0000030_172796_173773 299
3189 3300046538 Ga0495609_0000604 Ga0495609_0000604_20424_21398 299
3190 3300046538 Ga0495609_0002888 Ga0495609_0002888_7299_8273 299
3191 3300046538 Ga0495609_0003421 Ga0495609_0003421_2847_3824 299
3192 3300046538 Ga0495609_0005242 Ga0495609_0005242_2578_3555 299
3193 3300046538 Ga0495609_0006242 Ga0495609_0006242_2108_3085 299
3194 3300046538 Ga0495609_0035035 Ga0495609_0035035_1125_2099 299
3195 3300046542 Ga0495597_0000071 Ga0495597_0000071_22_999 299
3196 3300046542 Ga0495597_0000324 Ga0495597_0000324_28463_29440 299
3197 3300046542 Ga0495597_0000769 Ga0495597_0000769_1915_2892 299
3198 3300046542 Ga0495597_0001261 Ga0495597_0001261_987_1964 299
3199 3300046542 Ga0495597_0010865 Ga0495597_0010865_1310_2287 299
3200 3300046542 Ga0495597_0119417 Ga0495597_0119417_113_1087 299
3201 3300046543 Ga0495645_0107293 Ga0495645_0107293_846_1826 299
3202 3300046557 Ga0495622_0000012 Ga0495622_0000012_29815_30789 299
3203 3300046557 Ga0495622_0010884 Ga0495622_0010884_2951_3928 299
3204 3300046557 Ga0495622_0023124 Ga0495622_0023124_45_1022 299
3205 3300046558 Ga0495633_0000124 Ga0495633_0000124_95094_96068 299
3206 3300046558 Ga0495633_0040410 Ga0495633_0040410_831_1808 299
3207 3300046615 Ga0495656_0000514 Ga0495656_0000514_2123_3103 299
3208 3300046616 Ga0495668_0000038 Ga0495668_0000038_98442_99416 299
3209 3300046616 Ga0495668_0000071 Ga0495668_0000071_165631_166605 299
3210 3300046616 Ga0495668_0001401 Ga0495668_0001401_19392_20366 299
3211 3300046616 Ga0495668_0001962 Ga0495668_0001962_3225_4202 299
3212 3300046616 Ga0495668_0028279 Ga0495668_0028279_2167_3144 299
3213 3300046616 Ga0495668_0048214 Ga0495668_0048214_469_1446 299
3214 3300046642 Ga0495634_0003011 Ga0495634_0003011_585_1562 299
3215 3300046648 Ga0495611_0000631 Ga0495611_0000631_5436_6413 299
3216 3300046648 Ga0495611_0008179 Ga0495611_0008179_269_1246 299
3217 3300046648 Ga0495611_0013165 Ga0495611_0013165_1775_2755 299
3218 3300046660 Ga0495625_0002026 Ga0495625_0002026_6705_7685 299
3219 3300046660 Ga0495625_0004448 Ga0495625_0004448_6196_7167 299
3220 3300046660 Ga0495625_0031215 Ga0495625_0031215_1880_2851 299
3221 3300046660 Ga0495625_0048907 Ga0495625_0048907_831_1811 299
3222 3300046660 Ga0495625_0075196 Ga0495625_0075196_1082_2053 299
3223 3300046660 Ga0495625_0184733 Ga0495625_0184733_300_1280 299
3224 3300046663 Ga0495635_0001560 Ga0495635_0001560_1037_2017 299
3225 3300046663 Ga0495635_0020749 Ga0495635_0020749_1896_2870 299
3226 3300046665 Ga0495661_0001856 Ga0495661_0001856_13746_14723 299
3227 3300046665 Ga0495661_0002670 Ga0495661_0002670_3547_4545 299
3228 3300046665 Ga0495661_0014830 Ga0495661_0014830_2409_3386 299
3229 3300046665 Ga0495661_0041799 Ga0495661_0041799_16_996 299
3230 3300046665 Ga0495661_0049902 Ga0495661_0049902_553_1530 299
3231 3300046665 Ga0495661_0083941 Ga0495661_0083941_39_1016 299
3232 3300046665 Ga0495661_0086591 Ga0495661_0086591_146_1123 299
3233 3300046674 Ga0495588_0000062 Ga0495588_0000062_49516_50493 299
3234 3300046674 Ga0495588_0013634 Ga0495588_0013634_287_1264 299
3235 3300046674 Ga0495588_0028336 Ga0495588_0028336_302_1279 299
3236 3300046674 Ga0495588_0032627 Ga0495588_0032627_703_1680 299
3237 3300046674 Ga0495588_0063601 Ga0495588_0063601_23_1000 299
3238 3300046674 Ga0495588_0075438 Ga0495588_0075438_415_1392 299
3239 3300046678 Ga0495599_0017717 Ga0495599_0017717_300_1274 299
3240 3300046679 Ga0495623_0028982 Ga0495623_0028982_1026_2000 299
3241 3300046679 Ga0495623_0037516 Ga0495623_0037516_1040_2014 299
3242 3300046681 Ga0495647_0085994 Ga0495647_0085994_198_1169 299
3243 3300046684 Ga0495669_0000035 Ga0495669_0000035_20999_21976 299
3244 3300046690 Ga0495624_0008526 Ga0495624_0008526_6042_7013 299
3245 3300046691 Ga0495670_0036879 Ga0495670_0036879_1324_2301 299
3246 3300046692 Ga0495671_0000002 Ga0495671_0000002_527524_528498 299
3247 3300046692 Ga0495671_0001207 Ga0495671_0001207_15440_16420 299
3248 3300046692 Ga0495671_0001549 Ga0495671_0001549_12994_13971 299
3249 3300046692 Ga0495671_0002436 Ga0495671_0002436_131_1108 299
3250 3300046692 Ga0495671_0008259 Ga0495671_0008259_2584_3558 299
3251 3300046694 Ga0495649_0000028 Ga0495649_0000028_148596_149573 299
3252 3300046794 Ga0495589_0000021 Ga0495589_0000021_172971_173948 299
3253 3300046794 Ga0495589_0017549 Ga0495589_0017549_1479_2456 299
3254 3300046794 Ga0495589_0084408 Ga0495589_0084408_499_1476 299
3255 3300046809 Ga0495600_0001172 Ga0495600_0001172_6596_7570 299
3256 3300046809 Ga0495600_0006356 Ga0495600_0006356_5975_6952 299
3257 3300046810 Ga0495660_0000077 Ga0495660_0000077_91268_92245 299
3258 3300046810 Ga0495660_0001496 Ga0495660_0001496_13079_14053 299
3259 3300046810 Ga0495660_0025317 Ga0495660_0025317_1099_2076 299
3260 3300046810 Ga0495660_0074684 Ga0495660_0074684_790_1767 299
3261 3300047317 Ga0495604_0005207 Ga0495604_0005207_446_1423 299
3262 3300047318 Ga0495636_0006488 Ga0495636_0006488_1104_2081 299
3263 3300047320 Ga0495672_0000055 Ga0495672_0000055_63628_64605 299
3264 3300047320 Ga0495672_0000116 Ga0495672_0000116_124447_125424 299
3265 3300047320 Ga0495672_0000191 Ga0495672_0000191_22346_23320 299
3266 3300047320 Ga0495672_0000344 Ga0495672_0000344_52653_53627 299
3267 3300047320 Ga0495672_0000367 Ga0495672_0000367_31429_32403 299
3268 3300047320 Ga0495672_0003998 Ga0495672_0003998_2175_3152 299
3269 3300047321 Ga0495676_0000017 Ga0495676_0000017_166198_167175 299
3270 3300047321 Ga0495676_0150528 Ga0495676_0150528_303_1280 299
3271 3300047322 Ga0495680_0001614 Ga0495680_0001614_13727_14707 299
3272 3300047322 Ga0495680_0076236 Ga0495680_0076236_430_1407 299
3273 3300047323 Ga0495683_0000243 Ga0495683_0000243_1712_2692 299
3274 3300047323 Ga0495683_0006420 Ga0495683_0006420_1319_2296 299
3275 3300047323 Ga0495683_0026823 Ga0495683_0026823_1415_2392 299
3276 3300047443 Ga0495687_000012 Ga0495687_000012_243560_244537 299
3277 3300047443 Ga0495687_000036 Ga0495687_000036_240385_241362 299
3278 3300047443 Ga0495687_000065 Ga0495687_000065_152786_153763 299
3279 3300047443 Ga0495687_000086 Ga0495687_000086_63_1040 299
3280 3300047443 Ga0495687_000360 Ga0495687_000360_42113_43090 299
3281 3300047443 Ga0495687_002326 Ga0495687_002326_8146_9117 299
3282 3300047443 Ga0495687_005307 Ga0495687_005307_3182_4156 299
3283 3300047443 Ga0495687_006557 Ga0495687_006557_5774_6772 299
3284 3300047443 Ga0495687_009745 Ga0495687_009745_3127_4101 299
3285 3300047443 Ga0495687_012748 Ga0495687_012748_1569_2540 299
3286 3300047444 Ga0495675_0001986 Ga0495675_0001986_10280_11257 299
3287 3300047444 Ga0495675_0024677 Ga0495675_0024677_619_1596 299
3288 3300047444 Ga0495675_0082614 Ga0495675_0082614_791_1768 299
3289 3300047445 Ga0495677_0000450 Ga0495677_0000450_13972_14949 299
3290 3300047445 Ga0495677_0014309 Ga0495677_0014309_294_1274 299
3291 3300047445 Ga0495677_0034031 Ga0495677_0034031_491_1465 299
3292 3300047446 Ga0495679_008067 Ga0495679_008067_1431_2408 299
3293 3300047446 Ga0495679_029832 Ga0495679_029832_635_1609 299
3294 3300047447 Ga0495685_000093 Ga0495685_000093_720_1694 299
3295 3300047447 Ga0495685_012652 Ga0495685_012652_1840_2817 299
3296 3300047447 Ga0495685_028021 Ga0495685_028021_31_1005 299
3297 3300047469 Ga0495673_0000005 Ga0495673_0000005_379398_380372 299
3298 3300047469 Ga0495673_0000026 Ga0495673_0000026_413629_414603 299
3299 3300047469 Ga0495673_0000028 Ga0495673_0000028_3136_4110 299
3300 3300047470 Ga0495681_0000016 Ga0495681_0000016_2157_3134 299
3301 3300047470 Ga0495681_0000140 Ga0495681_0000140_2433_3410 299
3302 3300047472 Ga0495686_0008158 Ga0495686_0008158_1722_2699 299
3303 3300047472 Ga0495686_0016926 Ga0495686_0016926_376_1350 299
3304 3300047673 Ga0495593_0005044 Ga0495593_0005044_4600_5580 299
3305 3300048088 Ga0495602_0051288 Ga0495602_0051288_2219_3193 299
3306 3300048089 Ga0495614_0016490 Ga0495614_0016490_416_1396 299
3307 3300048089 Ga0495614_0048324 Ga0495614_0048324_59_1039 299
3308 3300048091 Ga0495626_0000017 Ga0495626_0000017_155718_156698 299
3309 3300048091 Ga0495626_0001186 Ga0495626_0001186_1997_2974 299
3310 3300048091 Ga0495626_0006968 Ga0495626_0006968_2135_3112 299
3311 3300048091 Ga0495626_0019185 Ga0495626_0019185_909_1886 299
3312 3300048091 Ga0495626_0047449 Ga0495626_0047449_807_1784 299
3313 3300048903 Ga0496100_0264101 Ga0496100_0264101_64_1041 299
3314 3300048904 Ga0496101_0075566 Ga0496101_0075566_91_1071 299
3315 3300048904 Ga0496101_0075886 Ga0496101_0075886_130_1107 299
3316 3300048905 Ga0496102_0000158 Ga0496102_0000158_3388_4365 299
3317 3300048905 Ga0496102_0000631 Ga0496102_0000631_16033_17010 299
3318 3300048905 Ga0496102_0007177 Ga0496102_0007177_7882_8853 299
3319 3300048905 Ga0496102_0026934 Ga0496102_0026934_882_1859 299
3320 3300048905 Ga0496102_0100033 Ga0496102_0100033_1601_2605 299
3321 3300048906 Ga0496103_0013287 Ga0496103_0013287_3110_4087 299
3322 3300048907 Ga0496104_0083311 Ga0496104_0083311_700_1671 299
3323 3300048907 Ga0496104_0133192 Ga0496104_0133192_1221_2192 299
3324 3300048908 Ga0496105_0011012 Ga0496105_0011012_5708_6688 299
3325 3300048909 Ga0496106_0014044 Ga0496106_0014044_4473_5444 299
3326 3300048909 Ga0496106_0281449 Ga0496106_0281449_242_1213 299
3327 3300048909 Ga0496106_0289664 Ga0496106_0289664_138_1142 299
3328 3300048910 Ga0496107_0009678 Ga0496107_0009678_5655_6626 299
3329 3300048910 Ga0496107_0092610 Ga0496107_0092610_26_1030 299
3330 3300048911 Ga0496108_0058546 Ga0496108_0058546_399_1376 299
3331 3300048911 Ga0496108_0072308 Ga0496108_0072308_945_1925 299
3332 3300048911 Ga0496108_0085441 Ga0496108_0085441_1549_2520 299
3333 3300048911 Ga0496108_0242070 Ga0496108_0242070_527_1498 299
3334 3300048912 Ga0496109_0241515 Ga0496109_0241515_440_1411 299
3335 3300048912 Ga0496109_0255946 Ga0496109_0255946_537_1508 299
3336 3300048912 Ga0496109_0307276 Ga0496109_0307276_61_1032 299
3337 3300048913 Ga0496110_0026087 Ga0496110_0026087_3142_4122 299
3338 3300048913 Ga0496110_0093526 Ga0496110_0093526_1050_2027 299
3339 3300048915 Ga0496112_0005630 Ga0496112_0005630_5059_6030 299
3340 3300048915 Ga0496112_0044166 Ga0496112_0044166_732_1736 299
3341 3300048915 Ga0496112_0221475 Ga0496112_0221475_236_1219 299
3342 3300048915 Ga0496112_0250665 Ga0496112_0250665_208_1185 299
3343 3300048917 Ga0496114_0030090 Ga0496114_0030090_775_1746 299
3344 3300048917 Ga0496114_0035569 Ga0496114_0035569_2326_3300 299
3345 3300048917 Ga0496114_0199917 Ga0496114_0199917_692_1672 299
3346 3300048918 Ga0496115_0011962 Ga0496115_0011962_2383_3360 299
3347 3300048919 Ga0496116_0052390 Ga0496116_0052390_895_1875 299
3348 3300048920 Ga0496117_0000045 Ga0496117_0000045_292067_293089 299
3349 3300048920 Ga0496117_0004688 Ga0496117_0004688_6500_7480 299
3350 3300048921 Ga0496118_0000041 Ga0496118_0000041_292067_293089 299
3351 3300048921 Ga0496118_0009784 Ga0496118_0009784_4410_5390 299
3352 3300048921 Ga0496118_0069796 Ga0496118_0069796_736_1719 299
3353 3300048924 Ga0496121_0002658 Ga0496121_0002658_3290_4264 299
3354 3300048924 Ga0496121_0006478 Ga0496121_0006478_4511_5503 299
3355 3300048924 Ga0496121_0006612 Ga0496121_0006612_9556_10530 299
3356 3300048924 Ga0496121_0036545 Ga0496121_0036545_2567_3547 299
3357 3300048924 Ga0496121_0053901 Ga0496121_0053901_1361_2341 299
3358 3300048925 Ga0496122_0000452 Ga0496122_0000452_3030_4007 299
3359 3300048925 Ga0496122_0000472 Ga0496122_0000472_64251_65231 299
3360 3300048925 Ga0496122_0001764 Ga0496122_0001764_1830_2810 299
3361 3300048925 Ga0496122_0029842 Ga0496122_0029842_1482_2459 299
3362 3300048925 Ga0496122_0049391 Ga0496122_0049391_124_1095 299
3363 3300048926 Ga0496123_0000314 Ga0496123_0000314_61799_62779 299
3364 3300048926 Ga0496123_0000361 Ga0496123_0000361_26234_27214 299
3365 3300048926 Ga0496123_0029319 Ga0496123_0029319_1751_2722 299
3366 3300048926 Ga0496123_0039550 Ga0496123_0039550_1240_2220 299
3367 3300048927 Ga0496124_0019170 Ga0496124_0019170_1363_2340 299
3368 3300048927 Ga0496124_0020600 Ga0496124_0020600_4501_5478 299
3369 3300048927 Ga0496124_0062060 Ga0496124_0062060_1986_2966 299
3370 3300048927 Ga0496124_0296487 Ga0496124_0296487_20_997 299
3371 3300048928 Ga0496125_0000621 Ga0496125_0000621_2912_3883 299
3372 3300048928 Ga0496125_0002948 Ga0496125_0002948_1366_2340 299
3373 3300048928 Ga0496125_0009804 Ga0496125_0009804_3776_4750 299
3374 3300048928 Ga0496125_0042420 Ga0496125_0042420_2043_3023 299
3375 3300048929 Ga0496126_0112348 Ga0496126_0112348_278_1249 299
3376 3300048929 Ga0496126_0119065 Ga0496126_0119065_1237_2211 299
3377 3300049128 Ga0501308_000070 Ga0501308_000070_3323_4297 299
3378 3300049129 Ga0501309_005253 Ga0501309_005253_456_1427 299
3379 3300049459 Ga0495678_000006 Ga0495678_000006_457763_458737 299
3380 3300049459 Ga0495678_000025 Ga0495678_000025_64404_65381 299
3381 3300049459 Ga0495678_000041 Ga0495678_000041_13763_14740 299
3382 3300049459 Ga0495678_000103 Ga0495678_000103_101035_102009 299
3383 3300049459 Ga0495678_006359 Ga0495678_006359_11_988 299
3384 3300049459 Ga0495678_018449 Ga0495678_018449_2149_3126 299
3385 3300049460 Ga0495682_0000822 Ga0495682_0000822_4132_5106 299
3386 3300049522 Ga0501299_007651 Ga0501299_007651_505_1476 299
3387 3300049579 Ga0501043_0000010 Ga0501043_0000010_10228_11199 299
3388 3300049579 Ga0501043_0019175 Ga0501043_0019175_3816_4796 299
3389 3300049580 Ga0501046_0000097 Ga0501046_0000097_11543_12514 299
3390 3300049581 Ga0501047_0000026 Ga0501047_0000026_214157_215128 299
3391 3300049581 Ga0501047_0045467 Ga0501047_0045467_2595_3575 299
3392 3300049591 Ga0501075_0091123 Ga0501075_0091123_1145_2119 299
3393 3300049591 Ga0501075_0298654 Ga0501075_0298654_162_1151 299
3394 3300049649 Ga0501198_000030 Ga0501198_000030_31651_32622 299
3395 3300049662 Ga0501222_000047 Ga0501222_000047_31617_32588 299
3396 3300049662 Ga0501222_001490 Ga0501222_001490_991_1962 299
3397 3300049669 Ga0501235_005191 Ga0501235_005191_1452_2423 299
3398 3300049704 Ga0501221_004223 Ga0501221_004223_913_1884 299
3399 3300049705 Ga0501225_0027038 Ga0501225_0027038_371_1351 299
3400 3300049706 Ga0501229_000756 Ga0501229_000756_1278_2249 299
3401 3300049743 Ga0501081_0102334 Ga0501081_0102334_716_1705 299
3402 3300049759 Ga0501262_001482 Ga0501262_001482_863_1834 299
3403 3300049769 Ga0501272_006528 Ga0501272_006528_47_1018 299
3404 3300049776 Ga0501280_000868 Ga0501280_000868_194_1180 299
3405 3300049778 Ga0501282_003508 Ga0501282_003508_17_1003 299
3406 3300049822 Ga0501035_0084946 Ga0501035_0084946_490_1467 299
3407 3300049823 Ga0501044_0016719 Ga0501044_0016719_3465_4445 299
3408 3300050489 nmdc:mga03683_12249_c1 nmdc:mga03683_12249_c1_510_1490 299
3409 3300050489 nmdc:mga03683_15884_c1 nmdc:mga03683_15884_c1_1127_2098 299
3410 3300050489 nmdc:mga03683_2391_c1 nmdc:mga03683_2391_c1_427_1398 299
3411 3300050490 nmdc:mga03n38_16173_c1 nmdc:mga03n38_16173_c1_1380_2360 299
3412 3300050490 nmdc:mga03n38_19578_c1 nmdc:mga03n38_19578_c1_949_1920 299
3413 3300050490 nmdc:mga03n38_25725_c1 nmdc:mga03n38_25725_c1_730_1701 299
3414 3300050491 nmdc:mga00v17_12911_c1 nmdc:mga00v17_12911_c1_2955_3926 299
3415 3300050491 nmdc:mga00v17_18408_c1 nmdc:mga00v17_18408_c1_710_1681 299
3416 3300050492 nmdc:mga0yw44_5873_c1 nmdc:mga0yw44_5873_c1_1804_2784 299
3417 3300050492 nmdc:mga0yw44_8514_c1 nmdc:mga0yw44_8514_c1_4056_5027 299
3418 3300050493 nmdc:mga0k408_23253_c1 nmdc:mga0k408_23253_c1_2220_3191 299
3419 3300050493 nmdc:mga0k408_25827_c1 nmdc:mga0k408_25827_c1_1544_2515 299
3420 3300050493 nmdc:mga0k408_28029_c1 nmdc:mga0k408_28029_c1_182_1153 299
3421 3300050493 nmdc:mga0k408_357_c1 nmdc:mga0k408_357_c1_19370_20341 299
3422 3300050493 nmdc:mga0k408_35_c1 nmdc:mga0k408_35_c1_18127_19098 299
3423 3300050493 nmdc:mga0k408_40041_c1 nmdc:mga0k408_40041_c1_1442_2413 299
3424 3300050493 nmdc:mga0k408_75560_c1 nmdc:mga0k408_75560_c1_964_1935 299
3425 3300050493 nmdc:mga0k408_9569_c1 nmdc:mga0k408_9569_c1_567_1538 299
3426 3300050494 nmdc:mga06z11_1160_c1 nmdc:mga06z11_1160_c1_6360_7331 299
3427 3300050496 nmdc:mga07m45_11917_c1 nmdc:mga07m45_11917_c1_3017_3988 299
3428 3300050496 nmdc:mga07m45_12754_c1 nmdc:mga07m45_12754_c1_559_1530 299
3429 3300050496 nmdc:mga07m45_13610_c1 nmdc:mga07m45_13610_c1_1395_2375 299
3430 3300050496 nmdc:mga07m45_15768_c1 nmdc:mga07m45_15768_c1_1578_2558 299
3431 3300050496 nmdc:mga07m45_17986_c1 nmdc:mga07m45_17986_c1_1044_2015 299
3432 3300050496 nmdc:mga07m45_18166_c1 nmdc:mga07m45_18166_c1_1367_2347 299
3433 3300050496 nmdc:mga07m45_22527_c1 nmdc:mga07m45_22527_c1_305_1276 299
3434 3300050496 nmdc:mga07m45_38596_c1 nmdc:mga07m45_38596_c1_891_1862 299
3435 3300050496 nmdc:mga07m45_5320_c1 nmdc:mga07m45_5320_c1_1664_2635 299
3436 3300050496 nmdc:mga07m45_622_c1 nmdc:mga07m45_622_c1_2308_3279 299
3437 3300050496 nmdc:mga07m45_66453_c1 nmdc:mga07m45_66453_c1_826_1806 299
3438 3300050496 nmdc:mga07m45_746_c1 nmdc:mga07m45_746_c1_8132_9103 299
3439 3300050496 nmdc:mga07m45_7532_c1 nmdc:mga07m45_7532_c1_1568_2539 299
3440 3300050496 nmdc:mga07m45_84_c1 nmdc:mga07m45_84_c1_30650_31630 299
3441 3300050512 nmdc:mga0n895_7965_c1 nmdc:mga0n895_7965_c1_3189_4190 299
3442 3300050513 nmdc:mga0rr50_280891_c1 nmdc:mga0rr50_280891_c1_222_1193 299
3443 3300050513 nmdc:mga0rr50_8812_c1 nmdc:mga0rr50_8812_c1_959_1960 299
3444 3300050515 nmdc:mga0a205_5666_c1 nmdc:mga0a205_5666_c1_1972_2973 299
3445 3300053077 Ga0495601_0018551 Ga0495601_0018551_3000_3974 299
3446 3300053079 Ga0500610_0153907 Ga0500610_0153907_96_1076 299
3447 3300053083 Ga0495655_0035845 Ga0495655_0035845_244_1221 299
3448 3300053086 Ga0500578_0000013 Ga0500578_0000013_164338_165309 299
3449 3300053087 Ga0500643_015502 Ga0500643_015502_356_1336 299
3450 3300053093 Ga0500651_0024815 Ga0500651_0024815_823_1803 299
3451 3300053093 Ga0500651_0041150 Ga0500651_0041150_1214_2185 299
3452 3300053117 Ga0500593_000220 Ga0500593_000220_1552_2529 299
3453 3300053117 Ga0500593_018103 Ga0500593_018103_1714_2685 299
3454 3300053121 Ga0500607_010153 Ga0500607_010153_1447_2427 299
3455 3300053125 Ga0500618_000173 Ga0500618_000173_1752_2726 299
3456 3300053130 Ga0500642_0005561 Ga0500642_0005561_1620_2591 299
3457 3300053131 Ga0500652_000843 Ga0500652_000843_6301_7272 299
3458 3300053134 Ga0500658_0031456 Ga0500658_0031456_1067_2047 299
3459 3300053136 Ga0500559_0000908 Ga0500559_0000908_11597_12568 299
3460 3300053136 Ga0500559_0008211 Ga0500559_0008211_2044_3024 299
3461 3300053139 Ga0500568_0001384 Ga0500568_0001384_2117_3097 299
3462 3300053139 Ga0500568_0009348 Ga0500568_0009348_228_1217 299
3463 3300053139 Ga0500568_0037456 Ga0500568_0037456_910_1881 299
3464 3300053141 Ga0500574_000499 Ga0500574_000499_2067_3041 299
3465 3300053148 Ga0500590_117920 Ga0500590_117920_183_1202 299
3466 3300053153 Ga0500616_0032165 Ga0500616_0032165_651_1631 299
3467 3300053154 Ga0500619_000274 Ga0500619_000274_2119_3090 299
3468 3300053156 Ga0500622_0000054 Ga0500622_0000054_129275_130246 299
3469 3300053156 Ga0500622_0000733 Ga0500622_0000733_13050_14021 299
3470 3300053156 Ga0500622_0005865 Ga0500622_0005865_5922_6893 299
3471 3300059477 Ga0587084_002207 Ga0587084_002207_919_1893 299
3472 3300059493 Ga0587077_003642 Ga0587077_003642_224_1198 299
3473 3300059504 Ga0587082_010558 Ga0587082_010558_260_1234 299
3474 3300059507 Ga0587086_006549 Ga0587086_006549_232_1206 299
3475 3300059508 Ga0587088_004681 Ga0587088_004681_187_1164 299
3476 3300059510 Ga0587090_001225 Ga0587090_001225_163_1137 299
3477 3300059510 Ga0587090_014355 Ga0587090_014355_92_1069 299
3478 3300059511 Ga0587091_007031 Ga0587091_007031_440_1414 299
3479 3300059639 Ga0587062_005483 Ga0587062_005483_196_1170 299
3480 3300059641 Ga0587068_000151 Ga0587068_000151_3858_4835 299
3481 3300059641 Ga0587068_001384 Ga0587068_001384_1009_1983 299
3482 3300059643 Ga0587072_027859 Ga0587072_027859_21_998 299
3483 3300059645 Ga0587076_004411 Ga0587076_004411_518_1492 299
3484 3300059651 Ga0587105_001386 Ga0587105_001386_56_1033 299
3485 3300060344 Ga0587071_019357 Ga0587071_019357_34_1011 299
3486 3300060346 Ga0587111_0002268 Ga0587111_0002268_97_1071 299
3487 3300061719 Ga0466962_0014036 Ga0466962_0014036_2093_3064 299
3488 3300061719 Ga0466962_0076489 Ga0466962_0076489_351_1328 299
3489 iso_pu_bacteria 2738543013 2739249320 299
3490 2162886007 SwRhRL2b_contig_20252 SwRhRL2b_0549.00002210 300
3491 3300003323 rootH1_10218092 rootH1_102180922 300
3492 3300005288 Ga0065714_10003130 Ga0065714_100031307 300
3493 3300005288 Ga0065714_10064583 Ga0065714_1006458322 300
3494 3300005289 Ga0065704_10070246 Ga0065704_1007024617 300
3495 3300013100 Ga0157373_10001474 Ga0157373_100014749 300
3496 3300013102 Ga0157371_10002243 Ga0157371_1000224310 300
3497 3300014497 Ga0182008_10000002 Ga0182008_10000002400 300
3498 3300015261 Ga0182006_1028407 Ga0182006_10284071 300
3499 3300031911 Ga0307412_10000085 Ga0307412_1000008528 300
3500 3300032004 Ga0307414_10010495 Ga0307414_100104954 300
3501 3300053093 Ga0500651_0000078 Ga0500651_0000078_53442_54407 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

44

353

1

PF01039

Carboxyl_trans

Carboxyl transferase domain

58

331

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.8971 8 297
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8968 8 299
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8925 8 299
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8828 1 299
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8794 8 299
ID Description Score Start End Superfamily
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9229 36 296 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9126 36 296 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9073 8 299 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8808 8 299 3.90.226.10
5iniB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.82 52 279 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2N8GSY0-F1-model_v4 deleted 0.9816 81 177
AF-A0A7C6HFE7-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9799 35 292 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A428MBL3-F1-model_v4 deleted 0.9767 35 294
AF-A0A519XY57-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9766 22 299 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A0H5STH1-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9762 35 294 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Feature Viewer

pLDDT pTM Quality
89.26 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map