F497192

General Info

Members Datasets Scaffolds Average Seq Length
3021 842 3021 37

Family's Representative Sequence

Representative Sequence 3300049130|Ga0501310_020385|Ga0501310_020385_577_690
Length 37
Sequence MKVAPSIKPRCPKCRVIKRHGRVMIICANPKHKQKQG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
82 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
83 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
84 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
85 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
86 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
87 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
88 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
89 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
90 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
91 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
92 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
93 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
94 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
242 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
243 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
244 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
247 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
248 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
249 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
250 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
251 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
252 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
253 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
254 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
255 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
256 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
257 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
258 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
259 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
260 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
261 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
265 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
266 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
267 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
268 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
269 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
270 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
271 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
272 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
278 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
279 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
280 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
281 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
282 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
283 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
284 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
285 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
286 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
287 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
288 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
289 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
290 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
291 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
294 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
295 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
296 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
297 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
298 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
300 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
301 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
304 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
305 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
306 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
307 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
308 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
309 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
310 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
311 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
312 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
313 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
314 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
315 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
316 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
318 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
320 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
321 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
322 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
323 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
324 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
325 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
326 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
327 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
328 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
329 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
330 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
331 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
332 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
333 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
334 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
335 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
336 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
337 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
348 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
349 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
350 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
351 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
352 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
353 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
354 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
355 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
356 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
357 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
358 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
359 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
360 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
361 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
362 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
363 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
364 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
365 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
366 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
367 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
368 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
369 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
370 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
371 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
372 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
373 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
374 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
375 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
376 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
377 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
378 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
379 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
380 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
381 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
382 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
383 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
384 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
385 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
386 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
387 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
388 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
389 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
390 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
391 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
392 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
393 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
394 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
395 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
396 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
397 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
398 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
399 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
400 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
401 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
402 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
403 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
404 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
405 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
406 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
407 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
408 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
409 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
410 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
411 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
412 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
413 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
414 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
415 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
416 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
417 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
418 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
419 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
420 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
421 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
422 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
423 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
424 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
425 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
426 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
427 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
428 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
429 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
430 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
431 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
432 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
433 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
434 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
435 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
436 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
437 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
438 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
439 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
440 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
441 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
442 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
443 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
444 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
445 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
446 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
447 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
448 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
449 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
450 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
451 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
452 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
453 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
454 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
455 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
456 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
457 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
458 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
459 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
460 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
461 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
462 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
463 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
464 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
465 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
466 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
467 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
468 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
469 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
470 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
471 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
472 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
473 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
474 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
475 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
476 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
477 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
478 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
479 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
480 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
481 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
482 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
483 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
484 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
485 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
486 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
487 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
488 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
489 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
490 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
491 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
492 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
493 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
494 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
495 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
496 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
497 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
498 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
499 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
500 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
501 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
502 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
503 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
504 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
505 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
506 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
507 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
508 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
509 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
510 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
511 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
512 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
513 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
514 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
515 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
516 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
517 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
518 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
519 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
520 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
521 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
522 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
523 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
524 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
525 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
526 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
527 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
528 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
529 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
530 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
531 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
532 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
533 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
534 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
535 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
536 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
537 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
538 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
539 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
540 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
541 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
542 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
543 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
544 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
545 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
546 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
547 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
548 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
549 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
550 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
551 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
552 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
553 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
554 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
555 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
556 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
557 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
558 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
559 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
560 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
561 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
562 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
563 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
564 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
565 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
566 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
567 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
568 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
569 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
570 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
571 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
572 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
573 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
574 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
575 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
576 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
577 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
588 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
589 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
590 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
591 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
592 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
593 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
594 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
595 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
596 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
597 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
598 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
599 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
600 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
627 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
629 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
631 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
636 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
638 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
639 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
640 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
641 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
642 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
643 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
644 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
645 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
646 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
647 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
648 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
649 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
650 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
651 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
652 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
653 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
654 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
655 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
656 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
657 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
658 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
659 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
660 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
661 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
662 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
663 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
664 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
665 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
666 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
667 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
668 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
669 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
670 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
671 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
672 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
673 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
674 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
675 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
676 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
677 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
678 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
679 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
680 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
681 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
682 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
683 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
684 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
685 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
686 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
687 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
688 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
689 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
690 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
691 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
692 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
693 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
694 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
695 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
696 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
697 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
698 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
699 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
700 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
701 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
702 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
703 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
704 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
705 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
706 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
707 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
708 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
709 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
711 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
712 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
713 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
714 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
715 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
716 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
717 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
718 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
719 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
720 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
721 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
722 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
723 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
724 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
725 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
726 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
727 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
728 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
729 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
730 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
731 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
732 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
733 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
734 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
735 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
736 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
737 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
738 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
739 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
740 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
741 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
742 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
743 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
744 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
745 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
746 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
747 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
748 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
749 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
750 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
751 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
752 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
753 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
754 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
755 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
756 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
757 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
758 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
759 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
760 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
761 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
762 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
763 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
764 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
765 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
766 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
767 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
768 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
769 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
770 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
771 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
772 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
773 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
774 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
775 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
776 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
777 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
778 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
779 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
780 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
781 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
782 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
783 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
784 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
785 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
786 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
787 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
788 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
789 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
790 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
791 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
792 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
793 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
801 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
802 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
808 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
809 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
810 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
811 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
812 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
813 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
814 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
815 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
816 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
817 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
818 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
819 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
820 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
821 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
822 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
823 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
824 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
825 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
826 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
827 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
828 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
829 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
830 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
831 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
832 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
833 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
834 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
835 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
836 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
837 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
838 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
839 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
840 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
841 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
842 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.23
Metatranscriptomes 8.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0.13
Rhizoplane 2.71
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_287973 2162886007 Bacteria 1851
2 CNXas_1006948 3300000545 Bacteria 799
3 LJQas_1042220 3300000549 Bacteria 541
4 JGI24741J21665_1053947 3300001915 Bacteria 592
5 JGI24740J21852_10000716 3300001979 Bacteria 14401
6 JGI24739J22299_10069704 3300001989 Bacteria 1095
7 JGI24737J22298_10138299 3300001990 Bacteria 719
8 JGI24743J22301_10132512 3300001991 Bacteria 551
9 JGI24735J21928_10144632 3300002067 Bacteria 686
10 JGI24738J21930_10028464 3300002075 Bacteria 1143
11 JGI24744J21845_10053506 3300002077 Bacteria 742
12 JGI24744J21845_10104736 3300002077 Bacteria 523
13 JGI24742J22300_10113280 3300002244 Bacteria 531
14 JGI25152J39213_1009630 3300002773 Bacteria 2277
15 Ga0055536_1020445 3300003781 Bacteria 2043
16 Ga0070672_100003683 3300005543 Bacteria 9963
17 Ga0070672_100023592 3300005543 Bacteria 4537
18 Ga0070672_100041046 3300005543 Bacteria 3554
19 Ga0070672_100112769 3300005543 Bacteria 2218
20 Ga0070672_100283416 3300005543 Bacteria 1401
21 Ga0070672_100322446 3300005543 Bacteria 1313
22 Ga0070672_100362257 3300005543 Bacteria 1238
23 Ga0070672_100734821 3300005543 Bacteria 865
24 Ga0070672_102002158 3300005543 Bacteria 522
25 Ga0070665_100068159 3300005548 Bacteria 3567
26 Ga0070665_100118186 3300005548 Bacteria 2653
27 Ga0070665_100287403 3300005548 Bacteria 1647
28 Ga0070665_100315432 3300005548 Bacteria 1567
29 Ga0070665_100610812 3300005548 Bacteria 1103
30 Ga0070665_100823033 3300005548 Bacteria 942
31 Ga0070665_101212002 3300005548 Bacteria 765
32 Ga0070665_101533186 3300005548 Bacteria 675
33 Ga0070665_101681409 3300005548 Bacteria 642
34 Ga0070665_102079534 3300005548 Bacteria 572
35 Ga0068855_100029685 3300005563 Bacteria 6537
36 Ga0068855_100195427 3300005563 Bacteria 2279
37 Ga0068855_100684797 3300005563 Bacteria 1098
38 Ga0068855_101019909 3300005563 Bacteria 868
39 Ga0068855_101952326 3300005563 Bacteria 594
40 Ga0070664_100024806 3300005564 Bacteria 4965
41 Ga0070664_100452049 3300005564 Bacteria 1179
42 Ga0070664_100459657 3300005564 Bacteria 1169
43 Ga0070664_100693074 3300005564 Bacteria 949
44 Ga0070664_100733603 3300005564 Bacteria 921
45 Ga0070664_102096079 3300005564 Bacteria 537
46 Ga0070664_102386365 3300005564 Bacteria 501
47 Ga0068857_100216057 3300005577 Bacteria 1750
48 Ga0068857_100259181 3300005577 Bacteria 1595
49 Ga0068857_100288431 3300005577 Bacteria 1511
50 Ga0068857_101293324 3300005577 Bacteria 708
51 Ga0068857_101723776 3300005577 Bacteria 613
52 Ga0068857_102096970 3300005577 Bacteria 555
53 Ga0068854_100140881 3300005578 Bacteria 1850
54 Ga0068854_100368170 3300005578 Bacteria 1181
55 Ga0068854_100429063 3300005578 Bacteria 1099
56 Ga0068854_100590982 3300005578 Bacteria 946
57 Ga0068854_100617081 3300005578 Bacteria 928
58 Ga0068854_100880655 3300005578 Bacteria 786
59 Ga0068856_100086907 3300005614 Bacteria 3108
60 Ga0068856_100141771 3300005614 Bacteria 2411
61 Ga0068856_100295656 3300005614 Bacteria 1636
62 Ga0068856_100573527 3300005614 Bacteria 1149
63 Ga0068856_102167337 3300005614 Bacteria 565
64 Ga0068852_100048973 3300005616 Bacteria 3613
65 Ga0068852_100053334 3300005616 Bacteria 3480
66 Ga0068852_100547214 3300005616 Bacteria 1157
67 Ga0068852_100635919 3300005616 Bacteria 1073
68 Ga0068852_100720434 3300005616 Bacteria 1009
69 Ga0068852_101014778 3300005616 Bacteria 848
70 Ga0068852_101026076 3300005616 Bacteria 844
71 Ga0068852_101055706 3300005616 Bacteria 832
72 Ga0068852_101912590 3300005616 Bacteria 615
73 Ga0068852_102240510 3300005616 Bacteria 568
74 Ga0068852_102622828 3300005616 Bacteria 523
75 Ga0068859_100054995 3300005617 Bacteria 4004
76 Ga0068859_100106010 3300005617 Bacteria 2870
77 Ga0068859_100150198 3300005617 Bacteria 2405
78 Ga0068859_100150725 3300005617 Bacteria 2401
79 Ga0068859_100602529 3300005617 Bacteria 1192
80 Ga0068859_101001328 3300005617 Bacteria 918
81 Ga0068859_101200518 3300005617 Bacteria 835
82 Ga0068859_101395572 3300005617 Bacteria 773
83 Ga0068864_100141584 3300005618 Bacteria 2170
84 Ga0068864_100182246 3300005618 Bacteria 1920
85 Ga0068864_100261472 3300005618 Bacteria 1610
86 Ga0068864_100288439 3300005618 Bacteria 1534
87 Ga0068864_100495663 3300005618 Bacteria 1174
88 Ga0068864_101664840 3300005618 Bacteria 642
89 Ga0068864_102248185 3300005618 Bacteria 552
90 Ga0068864_102652304 3300005618 Bacteria 507
91 Ga0068866_10014361 3300005718 Bacteria 3496
92 Ga0068866_10201130 3300005718 Bacteria 1190
93 Ga0068866_10707755 3300005718 Bacteria 691
94 Ga0068866_11166789 3300005718 Bacteria 555
95 Ga0068866_11337687 3300005718 Bacteria 522
96 Ga0068861_100003605 3300005719 Bacteria 10312
97 Ga0068861_100103054 3300005719 Bacteria 2273
98 Ga0068861_100332721 3300005719 Bacteria 1326
99 Ga0068861_100361602 3300005719 Bacteria 1276
100 Ga0068861_100416154 3300005719 Bacteria 1196
101 Ga0068861_100941778 3300005719 Bacteria 821
102 Ga0068861_101305807 3300005719 Bacteria 706
103 Ga0068861_101779292 3300005719 Bacteria 611
104 Ga0068861_102357148 3300005719 Bacteria 535
105 Ga0068851_10006696 3300005834 Bacteria 5270
106 Ga0068851_10212893 3300005834 Bacteria 1083
107 Ga0068851_10290361 3300005834 Bacteria 938
108 Ga0068851_10325794 3300005834 Bacteria 889
109 Ga0068851_10433219 3300005834 Bacteria 778
110 Ga0068851_10444447 3300005834 Bacteria 770
111 Ga0068870_10096798 3300005840 Bacteria 1660
112 Ga0068870_10284713 3300005840 Bacteria 1037
113 Ga0068870_10309766 3300005840 Bacteria 999
114 Ga0068870_10457309 3300005840 Bacteria 843
115 Ga0068870_10609962 3300005840 Bacteria 743
116 Ga0068870_10740636 3300005840 Bacteria 682
117 Ga0068870_10803275 3300005840 Bacteria 657
118 Ga0068863_100072268 3300005841 Bacteria 3264
119 Ga0068863_100191371 3300005841 Bacteria 1966
120 Ga0068863_100443854 3300005841 Bacteria 1273
121 Ga0068863_100461014 3300005841 Bacteria 1248
122 Ga0068863_100491575 3300005841 Bacteria 1208
123 Ga0068863_100579236 3300005841 Bacteria 1110
124 Ga0068863_100638359 3300005841 Bacteria 1055
125 Ga0068863_100955103 3300005841 Bacteria 859
126 Ga0068863_101303020 3300005841 Bacteria 733
127 Ga0068863_101700214 3300005841 Bacteria 641
128 Ga0068863_102025927 3300005841 Bacteria 586
129 Ga0068863_102697235 3300005841 Bacteria 505
130 Ga0068858_100056557 3300005842 Bacteria 3625
131 Ga0068858_100097783 3300005842 Bacteria 2736
132 Ga0068858_100226683 3300005842 Bacteria 1771
133 Ga0068858_100279175 3300005842 Bacteria 1590
134 Ga0068858_100369244 3300005842 Bacteria 1376
135 Ga0068858_100429630 3300005842 Bacteria 1271
136 Ga0068858_100632183 3300005842 Bacteria 1039
137 Ga0068858_100651233 3300005842 Bacteria 1023
138 Ga0068858_100673327 3300005842 Bacteria 1006
139 Ga0068858_100868225 3300005842 Bacteria 882
140 Ga0068858_101587003 3300005842 Bacteria 646
141 Ga0068860_100060890 3300005843 Bacteria 3587
142 Ga0068860_100181183 3300005843 Bacteria 2036
143 Ga0068860_100236076 3300005843 Bacteria 1778
144 Ga0068860_100464512 3300005843 Bacteria 1260
145 Ga0068860_100510103 3300005843 Bacteria 1201
146 Ga0068860_100927180 3300005843 Bacteria 888
147 Ga0068860_101561868 3300005843 Bacteria 682
148 Ga0068862_100018644 3300005844 Bacteria 5780
149 Ga0068862_100548369 3300005844 Bacteria 1104
150 Ga0068862_100637367 3300005844 Bacteria 1027
151 Ga0068862_100993517 3300005844 Bacteria 830
152 Ga0068862_101053379 3300005844 Bacteria 806
153 Ga0068862_101162947 3300005844 Bacteria 769
154 Ga0068862_101525407 3300005844 Bacteria 674
155 Ga0068862_101682817 3300005844 Bacteria 642
156 Ga0068862_102250380 3300005844 Bacteria 557
157 Ga0068862_102768703 3300005844 Bacteria 502
158 Ga0081455_10035348 3300005937 Bacteria 4467
159 Ga0081455_10044632 3300005937 Bacteria 3864
160 Ga0081455_10074572 3300005937 Bacteria 2802
161 Ga0081455_10112518 3300005937 Bacteria 2160
162 Ga0081455_10564665 3300005937 Bacteria 749
163 Ga0081538_10003017 3300005981 Bacteria 16026
164 Ga0081538_10127098 3300005981 Bacteria 1209
165 Ga0081538_10162889 3300005981 Bacteria 987
166 Ga0081540_1007975 3300005983 Bacteria 7459
167 Ga0081539_10000233 3300005985 Bacteria 130647
168 Ga0081539_10000660 3300005985 Bacteria 69312
169 Ga0081539_10000689 3300005985 Bacteria 67679
170 Ga0081539_10007364 3300005985 Bacteria 10068
171 Ga0081539_10008891 3300005985 Bacteria 8576
172 Ga0081539_10038073 3300005985 Bacteria 2855
173 Ga0081539_10044882 3300005985 Bacteria 2548
174 Ga0081539_10045884 3300005985 Bacteria 2509
175 Ga0081539_10248487 3300005985 Bacteria 792
176 Ga0081539_10433120 3300005985 Bacteria 545
177 Ga0070717_10038245 3300006028 Bacteria 3900
178 Ga0070717_10383457 3300006028 Bacteria 1260
179 Ga0070717_11475442 3300006028 Bacteria 617
180 Ga0075365_10426932 3300006038 Bacteria 936
181 Ga0075365_10632726 3300006038 Bacteria 756
182 Ga0075365_10665684 3300006038 Bacteria 736
183 Ga0075368_10164915 3300006042 Bacteria 929
184 Ga0075363_100080318 3300006048 Bacteria 1783
185 Ga0075363_100099362 3300006048 Bacteria 1609
186 Ga0075363_100434498 3300006048 Bacteria 774
187 Ga0075363_100453680 3300006048 Bacteria 758
188 Ga0075363_100559258 3300006048 Bacteria 683
189 Ga0075363_100829093 3300006048 Bacteria 563
190 Ga0075364_10020130 3300006051 Bacteria 4196
191 Ga0075364_10075343 3300006051 Bacteria 2226
192 Ga0075364_10340956 3300006051 Bacteria 1021
193 Ga0075364_10525841 3300006051 Bacteria 809
194 Ga0075364_10538228 3300006051 Bacteria 798
195 Ga0075364_11005909 3300006051 Bacteria 567
196 Ga0075364_11028086 3300006051 Bacteria 560
197 Ga0075364_11182459 3300006051 Bacteria 518
198 Ga0075364_11256183 3300006051 Bacteria 502
199 Ga0075432_10008199 3300006058 Bacteria 3561
200 Ga0075432_10106938 3300006058 Bacteria 1039
201 Ga0075432_10459022 3300006058 Bacteria 560
202 Ga0070715_10010443 3300006163 Bacteria 3309
203 Ga0070715_10087349 3300006163 Bacteria 1428
204 Ga0070716_100013911 3300006173 Bacteria 4112
205 Ga0070716_100461060 3300006173 Bacteria 929
206 Ga0070716_100507418 3300006173 Bacteria 891
207 Ga0070712_100075701 3300006175 Bacteria 2421
208 Ga0070712_100392285 3300006175 Bacteria 1145
209 Ga0070712_100584654 3300006175 Bacteria 944
210 Ga0075362_10040120 3300006177 Bacteria 2060
211 Ga0075362_10073691 3300006177 Bacteria 1563
212 Ga0075362_10114477 3300006177 Bacteria 1272
213 Ga0075362_10158752 3300006177 Bacteria 1088
214 Ga0075362_10185337 3300006177 Bacteria 1009
215 Ga0075362_10220573 3300006177 Bacteria 926
216 Ga0075362_10335164 3300006177 Bacteria 755
217 Ga0075362_10488436 3300006177 Bacteria 629
218 Ga0075367_10197995 3300006178 Bacteria 1255
219 Ga0075367_10341519 3300006178 Bacteria 944
220 Ga0075367_10469700 3300006178 Bacteria 797
221 Ga0075367_10578563 3300006178 Bacteria 713
222 Ga0075369_10038643 3300006186 Bacteria 2037
223 Ga0075369_10071586 3300006186 Bacteria 1526
224 Ga0075369_10158293 3300006186 Bacteria 1037
225 Ga0075366_10000795 3300006195 Bacteria 15124
226 Ga0075366_10014659 3300006195 Bacteria 4479
227 Ga0075366_10028911 3300006195 Bacteria 3254
228 Ga0075366_10042212 3300006195 Bacteria 2700
229 Ga0075366_10054314 3300006195 Bacteria 2379
230 Ga0075366_10054872 3300006195 Bacteria 2366
231 Ga0075366_10075085 3300006195 Bacteria 2016
232 Ga0075366_10078756 3300006195 Bacteria 1967
233 Ga0075366_10193988 3300006195 Bacteria 1234
234 Ga0075366_10225150 3300006195 Bacteria 1142
235 Ga0075366_10239297 3300006195 Bacteria 1106
236 Ga0075366_10341476 3300006195 Bacteria 918
237 Ga0075366_10574303 3300006195 Bacteria 698
238 Ga0075366_10587875 3300006195 Bacteria 690
239 Ga0075366_10776954 3300006195 Bacteria 595
240 Ga0075366_10848667 3300006195 Bacteria 568
241 Ga0075366_10951417 3300006195 Bacteria 535
242 Ga0097621_100001348 3300006237 Bacteria 16895
243 Ga0097621_100024717 3300006237 Bacteria 4694
244 Ga0097621_100096448 3300006237 Bacteria 2482
245 Ga0097621_100124757 3300006237 Bacteria 2186
246 Ga0097621_100207019 3300006237 Bacteria 1705
247 Ga0097621_100208978 3300006237 Bacteria 1697
248 Ga0097621_100366457 3300006237 Bacteria 1285
249 Ga0097621_100610857 3300006237 Bacteria 997
250 Ga0097621_100669172 3300006237 Bacteria 954
251 Ga0097621_100743523 3300006237 Bacteria 905
252 Ga0097621_100751208 3300006237 Bacteria 901
253 Ga0097621_101553071 3300006237 Bacteria 629
254 Ga0097621_101782504 3300006237 Bacteria 587
255 Ga0097621_102135520 3300006237 Bacteria 536
256 Ga0097621_102198545 3300006237 Bacteria 528
257 Ga0097621_102293204 3300006237 Bacteria 516
258 Ga0075370_10007567 3300006353 Bacteria 5537
259 Ga0075370_10011014 3300006353 Bacteria 4743
260 Ga0075370_10017764 3300006353 Bacteria 3847
261 Ga0075370_10092179 3300006353 Bacteria 1748
262 Ga0075370_10109456 3300006353 Bacteria 1603
263 Ga0075370_10113192 3300006353 Bacteria 1576
264 Ga0075370_10116063 3300006353 Bacteria 1556
265 Ga0075370_10332946 3300006353 Bacteria 905
266 Ga0075370_10437230 3300006353 Bacteria 787
267 Ga0075370_10527626 3300006353 Bacteria 713
268 Ga0075370_10602466 3300006353 Bacteria 666
269 Ga0075370_10653001 3300006353 Bacteria 638
270 Ga0068871_100000763 3300006358 Bacteria 21687
271 Ga0068871_100088427 3300006358 Bacteria 2577
272 Ga0068871_100113535 3300006358 Bacteria 2281
273 Ga0068871_100182341 3300006358 Bacteria 1805
274 Ga0068871_100222248 3300006358 Bacteria 1637
275 Ga0068871_100225065 3300006358 Bacteria 1626
276 Ga0068871_100278445 3300006358 Bacteria 1463
277 Ga0068871_100309390 3300006358 Bacteria 1389
278 Ga0068871_100450337 3300006358 Bacteria 1154
279 Ga0068871_101389404 3300006358 Bacteria 662
280 Ga0068871_101583364 3300006358 Bacteria 620
281 Ga0068871_101659950 3300006358 Bacteria 606
282 Ga0068871_101728194 3300006358 Bacteria 593
283 Ga0068871_101985762 3300006358 Bacteria 554
284 Ga0068871_102005629 3300006358 Bacteria 551
285 Ga0075428_100087301 3300006844 Bacteria 3402
286 Ga0075428_100097922 3300006844 Bacteria 3198
287 Ga0075428_100124570 3300006844 Bacteria 2805
288 Ga0075428_100282280 3300006844 Bacteria 1787
289 Ga0075428_100368653 3300006844 Bacteria 1540
290 Ga0075428_101323128 3300006844 Bacteria 757
291 Ga0075430_100000579 3300006846 Bacteria 27829
292 Ga0075430_100032221 3300006846 Bacteria 4450
293 Ga0075430_100082925 3300006846 Bacteria 2686
294 Ga0075430_100116646 3300006846 Bacteria 2225
295 Ga0075430_100240174 3300006846 Bacteria 1501
296 Ga0075430_100338621 3300006846 Bacteria 1243
297 Ga0075430_100523350 3300006846 Bacteria 978
298 Ga0075430_100632489 3300006846 Bacteria 883
299 Ga0075431_100004619 3300006847 Bacteria 13517
300 Ga0075431_100033449 3300006847 Bacteria 5298
301 Ga0075431_100039016 3300006847 Bacteria 4892
302 Ga0075431_100048983 3300006847 Bacteria 4358
303 Ga0075431_100135194 3300006847 Bacteria 2542
304 Ga0075431_100529656 3300006847 Bacteria 1167
305 Ga0075431_100570676 3300006847 Bacteria 1117
306 Ga0075431_100740948 3300006847 Bacteria 958
307 Ga0075431_100966651 3300006847 Bacteria 819
308 Ga0075431_101972812 3300006847 Bacteria 539
309 Ga0075433_10051780 3300006852 Bacteria 3577
310 Ga0075433_10059655 3300006852 Bacteria 3338
311 Ga0075433_10069107 3300006852 Bacteria 3101
312 Ga0075433_11244275 3300006852 Bacteria 646
313 Ga0075434_100000895 3300006871 Bacteria 23884
314 Ga0075434_100154481 3300006871 Bacteria 2314
315 Ga0075434_100307744 3300006871 Bacteria 1605
316 Ga0075434_100490516 3300006871 Bacteria 1249
317 Ga0075434_100742653 3300006871 Bacteria 998
318 Ga0075434_101186336 3300006871 Bacteria 776
319 Ga0075434_101704716 3300006871 Bacteria 638
320 Ga0075429_100005626 3300006880 Bacteria 10802
321 Ga0075429_100096242 3300006880 Bacteria 2582
322 Ga0075429_100169669 3300006880 Bacteria 1911
323 Ga0075429_100762692 3300006880 Bacteria 847
324 Ga0075429_100811117 3300006880 Bacteria 819
325 Ga0075429_100834561 3300006880 Bacteria 807
326 Ga0075429_101708931 3300006880 Bacteria 546
327 Ga0068865_100025006 3300006881 Bacteria 3923
328 Ga0068865_100171827 3300006881 Bacteria 1662
329 Ga0068865_100546122 3300006881 Bacteria 972
330 Ga0068865_100859042 3300006881 Bacteria 786
331 Ga0068865_101116693 3300006881 Bacteria 695
332 Ga0075436_100000458 3300006914 Bacteria 26344
333 Ga0075436_100000862 3300006914 Bacteria 20155
334 Ga0075436_100021757 3300006914 Bacteria 4401
335 Ga0075436_100131466 3300006914 Bacteria 1755
336 Ga0075436_100224062 3300006914 Bacteria 1335
337 Ga0075436_100327852 3300006914 Bacteria 1100
338 Ga0075436_100439590 3300006914 Bacteria 949
339 Ga0075436_101017769 3300006914 Bacteria 622
340 Ga0075436_101273876 3300006914 Bacteria 556
341 Ga0097620_100054995 3300006931 Bacteria 4004
342 Ga0097620_100106014 3300006931 Bacteria 2870
343 Ga0097620_100150202 3300006931 Bacteria 2405
344 Ga0097620_100150720 3300006931 Bacteria 2401
345 Ga0097620_100179650 3300006931 Bacteria 2199
346 Ga0097620_100602512 3300006931 Bacteria 1192
347 Ga0097620_101001383 3300006931 Bacteria 918
348 Ga0097620_101200512 3300006931 Bacteria 835
349 Ga0097620_101395558 3300006931 Bacteria 773
350 Ga0097620_102326491 3300006931 Bacteria 591
351 Ga0097620_102756194 3300006931 Bacteria 540
352 Ga0079104_1012935 3300006946 Bacteria 2596
353 Ga0099826_10043156 3300006948 Bacteria 3108
354 Ga0075435_100015133 3300007076 Bacteria 5791
355 Ga0075435_100054944 3300007076 Bacteria 3215
356 Ga0075435_100055171 3300007076 Bacteria 3208
357 Ga0075435_100070767 3300007076 Bacteria 2847
358 Ga0075435_100076334 3300007076 Bacteria 2745
359 Ga0075435_100393409 3300007076 Unclassified 1191
360 Ga0075435_100399085 3300007076 Bacteria 1183
361 Ga0075435_100546858 3300007076 Bacteria 1002
362 Ga0075435_100612268 3300007076 Bacteria 945
363 Ga0075435_100682889 3300007076 Bacteria 892
364 Ga0075435_100748354 3300007076 Bacteria 850
365 Ga0075435_101044973 3300007076 Bacteria 714
366 Ga0099794_10210147 3300007265 Bacteria 998
367 Ga0099794_10596485 3300007265 Bacteria 585
368 Ga0105244_10148436 3300009036 Bacteria 1124
369 Ga0105240_10018079 3300009093 Bacteria 9478
370 Ga0105240_10188805 3300009093 Bacteria 2425
371 Ga0105240_10249436 3300009093 Bacteria 2054
372 Ga0105240_12359451 3300009093 Bacteria 551
373 Ga0105240_12387206 3300009093 Bacteria 547
374 Ga0111539_10005656 3300009094 Bacteria 16167
375 Ga0111539_10006016 3300009094 Bacteria 15679
376 Ga0111539_10019122 3300009094 Bacteria 8465
377 Ga0111539_10079597 3300009094 Bacteria 3855
378 Ga0111539_10131868 3300009094 Bacteria 2926
379 Ga0111539_10256134 3300009094 Bacteria 2038
380 Ga0111539_11025035 3300009094 Bacteria 959
381 Ga0111539_11598667 3300009094 Bacteria 756
382 Ga0111539_11764982 3300009094 Bacteria 717
383 Ga0111539_12495534 3300009094 Bacteria 599
384 Ga0111539_12733018 3300009094 Bacteria 572
385 Ga0111539_12900970 3300009094 Bacteria 555
386 Ga0105245_10392784 3300009098 Bacteria 1384
387 Ga0105245_10673540 3300009098 Bacteria 1066
388 Ga0105245_10766643 3300009098 Bacteria 1001
389 Ga0105245_10913661 3300009098 Bacteria 920
390 Ga0105245_12007432 3300009098 Bacteria 632
391 Ga0105245_12212623 3300009098 Bacteria 604
392 Ga0105245_12220271 3300009098 Bacteria 603
393 Ga0105245_12334787 3300009098 Bacteria 588
394 Ga0105245_12892527 3300009098 Bacteria 532
395 Ga0105247_10136395 3300009101 Bacteria 1604
396 Ga0105247_10629098 3300009101 Bacteria 799
397 Ga0105247_10718569 3300009101 Bacteria 754
398 Ga0105247_10756847 3300009101 Bacteria 737
399 Ga0105247_11569819 3300009101 Bacteria 539
400 Ga0105247_11824737 3300009101 Bacteria 507
401 Ga0114129_10013928 3300009147 Bacteria 11456
402 Ga0114129_10195739 3300009147 Bacteria 2741
403 Ga0114129_10203927 3300009147 Bacteria 2677
404 Ga0114129_11140783 3300009147 Bacteria 974
405 Ga0114129_11375899 3300009147 Bacteria 872
406 Ga0114129_11496916 3300009147 Bacteria 829
407 Ga0114129_12012902 3300009147 Bacteria 698
408 Ga0114129_12851616 3300009147 Bacteria 573
409 Ga0114129_12989345 3300009147 Bacteria 556
410 Ga0114129_13337358 3300009147 Bacteria 518
411 Ga0105243_10010767 3300009148 Bacteria 6922
412 Ga0105243_10137487 3300009148 Bacteria 2081
413 Ga0105243_10311217 3300009148 Bacteria 1431
414 Ga0105243_10333269 3300009148 Bacteria 1387
415 Ga0105243_10462093 3300009148 Bacteria 1194
416 Ga0105243_10643911 3300009148 Bacteria 1026
417 Ga0105243_10770123 3300009148 Bacteria 945
418 Ga0105243_10924901 3300009148 Bacteria 869
419 Ga0105243_11213624 3300009148 Bacteria 768
420 Ga0105243_11247047 3300009148 Bacteria 759
421 Ga0105243_12935356 3300009148 Bacteria 517
422 Ga0105241_10162367 3300009174 Bacteria 1838
423 Ga0105241_10272185 3300009174 Bacteria 1443
424 Ga0105241_10298470 3300009174 Bacteria 1382
425 Ga0105241_10325869 3300009174 Bacteria 1326
426 Ga0105241_10370720 3300009174 Bacteria 1248
427 Ga0105241_10428996 3300009174 Bacteria 1165
428 Ga0105241_11357110 3300009174 Bacteria 679
429 Ga0105242_10048621 3300009176 Bacteria 3448
430 Ga0105242_10072922 3300009176 Bacteria 2853
431 Ga0105242_10126169 3300009176 Bacteria 2203
432 Ga0105242_10138198 3300009176 Bacteria 2111
433 Ga0105242_10195673 3300009176 Bacteria 1793
434 Ga0105242_10267504 3300009176 Bacteria 1547
435 Ga0105242_10289121 3300009176 Bacteria 1492
436 Ga0105242_10440962 3300009176 Bacteria 1225
437 Ga0105242_10469397 3300009176 Bacteria 1190
438 Ga0105242_10627434 3300009176 Bacteria 1042
439 Ga0105242_10832377 3300009176 Bacteria 917
440 Ga0105242_11000208 3300009176 Bacteria 844
441 Ga0105242_11331164 3300009176 Bacteria 743
442 Ga0105242_12441393 3300009176 Bacteria 570
443 Ga0105242_12479014 3300009176 Bacteria 567
444 Ga0105242_13299126 3300009176 Bacteria 502
445 Ga0105248_10133714 3300009177 Bacteria 2798
446 Ga0105248_10419639 3300009177 Bacteria 1507
447 Ga0105248_10461064 3300009177 Bacteria 1433
448 Ga0105248_10529875 3300009177 Bacteria 1328
449 Ga0105248_10689668 3300009177 Bacteria 1152
450 Ga0105248_10798576 3300009177 Bacteria 1065
451 Ga0105248_11086134 3300009177 Bacteria 904
452 Ga0105248_11316820 3300009177 Bacteria 817
453 Ga0105248_11411911 3300009177 Bacteria 788
454 Ga0105248_11564172 3300009177 Bacteria 747
455 Ga0105248_12638725 3300009177 Bacteria 573
456 Ga0105248_12697223 3300009177 Bacteria 567
457 Ga0105248_12774179 3300009177 Bacteria 559
458 Ga0105248_12993084 3300009177 Bacteria 538
459 Ga0105237_10000668 3300009545 Bacteria 47303
460 Ga0105237_10508405 3300009545 Bacteria 1211
461 Ga0105237_10852424 3300009545 Bacteria 918
462 Ga0105238_10003926 3300009551 Bacteria 14752
463 Ga0105238_10150486 3300009551 Bacteria 2302
464 Ga0105238_10618909 3300009551 Bacteria 1091
465 Ga0105238_10668360 3300009551 Bacteria 1050
466 Ga0105238_10790415 3300009551 Bacteria 964
467 Ga0105238_10845591 3300009551 Bacteria 932
468 Ga0105238_11344769 3300009551 Bacteria 741
469 Ga0105238_11503519 3300009551 Bacteria 702
470 Ga0105238_11693268 3300009551 Bacteria 663
471 Ga0105238_12026197 3300009551 Bacteria 609
472 Ga0105238_12433131 3300009551 Bacteria 559
473 Ga0105238_13051953 3300009551 Bacteria 502
474 Ga0105249_10010299 3300009553 Bacteria 8213
475 Ga0105249_10027358 3300009553 Bacteria 5145
476 Ga0105249_10045286 3300009553 Bacteria 4001
477 Ga0105249_10752296 3300009553 Bacteria 1037
478 Ga0105249_11710414 3300009553 Bacteria 702
479 Ga0105249_13403989 3300009553 Bacteria 512
480 Ga0105239_10001255 3300010375 Bacteria 34466
481 Ga0105239_10664913 3300010375 Bacteria 1190
482 Ga0105239_10700661 3300010375 Bacteria 1158
483 Ga0105239_12737696 3300010375 Bacteria 575
484 Ga0105239_13286151 3300010375 Bacteria 526
485 Ga0105239_13583782 3300010375 Bacteria 504
486 Ga0105246_10011361 3300011119 Bacteria 5527
487 Ga0105246_10161171 3300011119 Bacteria 1709
488 Ga0105246_10211478 3300011119 Bacteria 1514
489 Ga0105246_10455178 3300011119 Bacteria 1076
490 Ga0105246_10752211 3300011119 Bacteria 860
491 Ga0105246_10956253 3300011119 Bacteria 772
492 Ga0157337_1031430 3300012483 Bacteria 546
493 Ga0157343_1026992 3300012488 Bacteria 557
494 Ga0157322_1000335 3300012490 Bacteria 1618
495 Ga0157329_1026328 3300012491 Bacteria 579
496 Ga0157335_1015274 3300012492 Bacteria 674
497 Ga0157323_1004958 3300012495 Bacteria 873
498 Ga0157319_1024820 3300012497 Bacteria 609
499 Ga0157345_1001596 3300012498 Bacteria 1592
500 Ga0157347_1007541 3300012502 Bacteria 1089
501 Ga0157313_1031806 3300012503 Bacteria 603
502 Ga0157339_1001382 3300012505 Bacteria 1474
503 Ga0157339_1004914 3300012505 Bacteria 1034
504 Ga0157339_1014791 3300012505 Bacteria 762
505 Ga0157315_1003945 3300012508 Bacteria 1033
506 Ga0157316_1017552 3300012510 Bacteria 748
507 Ga0157327_1017780 3300012512 Bacteria 767
508 Ga0157327_1024572 3300012512 Bacteria 707
509 Ga0157373_10195615 3300013100 Bacteria 1425
510 Ga0157373_10597211 3300013100 Bacteria 803
511 Ga0157373_10647448 3300013100 Bacteria 772
512 Ga0157373_11344883 3300013100 Bacteria 542
513 Ga0157371_10248073 3300013102 Bacteria 1281
514 Ga0157371_10489763 3300013102 Bacteria 907
515 Ga0157371_10789486 3300013102 Bacteria 715
516 Ga0157370_10640531 3300013104 Bacteria 972
517 Ga0157370_10865376 3300013104 Bacteria 821
518 Ga0157370_11070726 3300013104 Bacteria 729
519 Ga0157370_11426723 3300013104 Bacteria 623
520 Ga0157369_10006334 3300013105 Bacteria 13736
521 Ga0157369_10018025 3300013105 Bacteria 7921
522 Ga0157369_10345919 3300013105 Bacteria 1544
523 Ga0157369_10711853 3300013105 Bacteria 1034
524 Ga0157369_11329350 3300013105 Bacteria 732
525 Ga0157374_10300435 3300013296 Bacteria 1588
526 Ga0157374_10633120 3300013296 Bacteria 1081
527 Ga0157374_11076256 3300013296 Bacteria 824
528 Ga0157374_11379308 3300013296 Bacteria 727
529 Ga0157378_10557092 3300013297 Bacteria 1152
530 Ga0157378_10944100 3300013297 Bacteria 895
531 Ga0157378_10979509 3300013297 Bacteria 879
532 Ga0157378_11424863 3300013297 Bacteria 736
533 Ga0157378_11448689 3300013297 Bacteria 730
534 Ga0157378_11710054 3300013297 Bacteria 676
535 Ga0157378_11727807 3300013297 Bacteria 673
536 Ga0157378_12015437 3300013297 Bacteria 627
537 Ga0157378_12178604 3300013297 Bacteria 605
538 Ga0157378_12191731 3300013297 Bacteria 604
539 Ga0157378_12593783 3300013297 Bacteria 559
540 Ga0157378_12671924 3300013297 Bacteria 552
541 Ga0163162_10041519 3300013306 Bacteria 4603
542 Ga0163162_10100821 3300013306 Bacteria 2979
543 Ga0163162_10104771 3300013306 Bacteria 2923
544 Ga0163162_10136837 3300013306 Bacteria 2561
545 Ga0163162_10250633 3300013306 Bacteria 1903
546 Ga0163162_10380564 3300013306 Bacteria 1545
547 Ga0163162_10601059 3300013306 Bacteria 1226
548 Ga0163162_10774452 3300013306 Bacteria 1078
549 Ga0163162_11667155 3300013306 Bacteria 728
550 Ga0163162_12199402 3300013306 Bacteria 633
551 Ga0157372_10117437 3300013307 Bacteria 3051
552 Ga0157372_10336659 3300013307 Bacteria 1758
553 Ga0157372_10712653 3300013307 Bacteria 1167
554 Ga0157372_11157752 3300013307 Bacteria 894
555 Ga0157372_11384338 3300013307 Bacteria 811
556 Ga0157372_11975283 3300013307 Bacteria 670
557 Ga0157375_10104130 3300013308 Bacteria 2926
558 Ga0157375_10445054 3300013308 Bacteria 1461
559 Ga0157375_10552720 3300013308 Bacteria 1313
560 Ga0157375_10788794 3300013308 Bacteria 1099
561 Ga0163163_10449795 3300014325 Bacteria 1348
562 Ga0163163_10605557 3300014325 Bacteria 1159
563 Ga0163163_10735633 3300014325 Bacteria 1050
564 Ga0163163_12066351 3300014325 Bacteria 629
565 Ga0163163_12089854 3300014325 Bacteria 626
566 Ga0157380_10019638 3300014326 Bacteria 5038
567 Ga0157380_10067462 3300014326 Bacteria 2881
568 Ga0157380_10394181 3300014326 Bacteria 1311
569 Ga0157380_11208815 3300014326 Bacteria 800
570 Ga0157380_12101027 3300014326 Bacteria 628
571 Ga0157380_12403644 3300014326 Bacteria 592
572 Ga0157380_12967283 3300014326 Bacteria 540
573 Ga0157380_13092981 3300014326 Bacteria 531
574 Ga0182008_10036650 3300014497 Bacteria 2454
575 Ga0182008_10104535 3300014497 Bacteria 1401
576 Ga0182008_10293293 3300014497 Bacteria 849
577 Ga0157377_10351102 3300014745 Bacteria 990
578 Ga0157377_10578573 3300014745 Bacteria 798
579 Ga0157377_11265991 3300014745 Bacteria 575
580 Ga0157379_10000101 3300014968 Bacteria 58702
581 Ga0157379_10063009 3300014968 Bacteria 3315
582 Ga0157379_10241188 3300014968 Bacteria 1640
583 Ga0157379_10565510 3300014968 Bacteria 1059
584 Ga0157379_10898922 3300014968 Bacteria 840
585 Ga0157379_10927398 3300014968 Bacteria 827
586 Ga0157379_10940404 3300014968 Bacteria 821
587 Ga0157379_11113536 3300014968 Bacteria 757
588 Ga0157379_11441036 3300014968 Bacteria 668
589 Ga0157376_10019067 3300014969 Bacteria 5277
590 Ga0157376_10073537 3300014969 Bacteria 2911
591 Ga0157376_10268618 3300014969 Bacteria 1601
592 Ga0157376_10357888 3300014969 Bacteria 1399
593 Ga0157376_10930518 3300014969 Bacteria 889
594 Ga0157376_11162778 3300014969 Bacteria 799
595 Ga0157376_11410533 3300014969 Bacteria 728
596 Ga0157376_11702857 3300014969 Bacteria 666
597 Ga0182006_1102890 3300015261 Bacteria 1011
598 Ga0182006_1187079 3300015261 Bacteria 689
599 Ga0182007_10001322 3300015262 Bacteria 13378
600 Ga0182007_10001550 3300015262 Bacteria 12241
601 Ga0182007_10058101 3300015262 Bacteria 1269
602 Ga0182007_10367484 3300015262 Bacteria 544
603 Ga0182005_1009589 3300015265 Bacteria 2810
604 Ga0182005_1064358 3300015265 Bacteria 1003
605 Ga0182005_1271275 3300015265 Bacteria 530
606 Ga0183362_10007 3300015683 Bacteria 240101
607 Ga0163161_10026626 3300017792 Bacteria 4096
608 Ga0163161_10214289 3300017792 Bacteria 1489
609 Ga0163161_10396318 3300017792 Bacteria 1106
610 Ga0163161_10647602 3300017792 Bacteria 875
611 Ga0163161_10742940 3300017792 Bacteria 820
612 Ga0163161_10798380 3300017792 Bacteria 793
613 Ga0163161_11385843 3300017792 Bacteria 614
614 Ga0163161_11956107 3300017792 Bacteria 522
615 Ga0197907_10798252 3300020069 Bacteria 3014
616 Ga0206356_10186274 3300020070 Bacteria 1102
617 Ga0206356_11548496 3300020070 Bacteria 1306
618 Ga0206351_10317039 3300020077 Bacteria 833
619 Ga0206352_10522260 3300020078 Bacteria 1111
620 Ga0206350_10797579 3300020080 Bacteria 1402
621 Ga0206354_11296228 3300020081 Bacteria 595
622 Ga0213872_10002765 3300021361 Bacteria 10055
623 Ga0213872_10008389 3300021361 Bacteria 5002
624 Ga0213872_10042043 3300021361 Bacteria 2084
625 Ga0213876_10005471 3300021384 Bacteria 6976
626 Ga0213876_10214522 3300021384 Bacteria 1023
627 Ga0213875_10001291 3300021388 Bacteria 16695
628 Ga0224712_10011440 3300022467 Bacteria 2755
629 Ga0224712_10056145 3300022467 Bacteria 1551
630 Ga0256744_136494 3300023309 Bacteria 560
631 Ga0209436_110262 3300025208 Bacteria 1724
632 Ga0209674_119133 3300025226 Bacteria 531
633 Ga0209672_100460 3300025228 Bacteria 23072
634 Ga0209147_101704 3300025229 Bacteria 7134
635 Ga0209563_100088 3300025230 Bacteria 175375
636 Ga0209258_100015 3300025242 Bacteria 706310
637 Ga0207425_1000229 3300025245 Bacteria 43700
638 Ga0209148_1000028 3300025254 Bacteria 582773
639 Ga0209759_1040955 3300025256 Bacteria 799
640 Ga0209129_1000049 3300025258 Bacteria 268086
641 Ga0209565_1000259 3300025263 Bacteria 56285
642 Ga0209565_1006420 3300025263 Bacteria 3300
643 Ga0209673_1000193 3300025273 Bacteria 123134
644 Ga0209673_1013086 3300025273 Bacteria 3300
645 Ga0209673_1020554 3300025273 Bacteria 2335
646 Ga0209130_1011183 3300025284 Bacteria 2415
647 Ga0209130_1024374 3300025284 Bacteria 1321
648 Ga0209675_1000220 3300025291 Bacteria 59335
649 Ga0209675_1000683 3300025291 Bacteria 23657
650 Ga0209675_1018718 3300025291 Bacteria 1929
651 Ga0209676_1000137 3300025292 Bacteria 179437
652 Ga0209676_1004019 3300025292 Bacteria 8470
653 Ga0209676_1066453 3300025292 Bacteria 874
654 Ga0209025_1000283 3300025294 Bacteria 114855
655 Ga0209025_1000707 3300025294 Bacteria 56879
656 Ga0209025_1072346 3300025294 Bacteria 1216
657 Ga0209025_1107843 3300025294 Bacteria 863
658 Ga0209564_1023191 3300025295 Bacteria 2165
659 Ga0209564_1059620 3300025295 Bacteria 863
660 Ga0209758_1000500 3300025297 Bacteria 63618
661 Ga0209758_1006862 3300025297 Bacteria 7957
662 Ga0209050_1000015 3300025298 Bacteria 759102
663 Ga0209050_1004273 3300025298 Bacteria 9808
664 Ga0209050_1033028 3300025298 Bacteria 1577
665 Ga0209050_1059391 3300025298 Bacteria 912
666 Ga0209256_1059387 3300025299 Bacteria 896
667 Ga0209256_1062403 3300025299 Bacteria 863
668 Ga0207426_1014799 3300025302 Bacteria 2849
669 Ga0207426_1014800 3300025302 Bacteria 2849
670 Ga0207426_1137638 3300025302 Bacteria 584
671 Ga0209051_1000010 3300025303 Bacteria 641298
672 Ga0209051_1002546 3300025303 Bacteria 12874
673 Ga0209051_1005321 3300025303 Bacteria 7574
674 Ga0209051_1035165 3300025303 Bacteria 1868
675 Ga0209257_1000026 3300025304 Bacteria 723225
676 Ga0209257_1000047 3300025304 Bacteria 460507
677 Ga0209257_1000205 3300025304 Bacteria 143735
678 Ga0209257_1009149 3300025304 Bacteria 5394
679 Ga0207697_10138206 3300025315 Bacteria 1055
680 Ga0207697_10261195 3300025315 Bacteria 767
681 Ga0207656_10001500 3300025321 Bacteria 7731
682 Ga0207656_10134788 3300025321 Bacteria 1160
683 Ga0207656_10136591 3300025321 Bacteria 1153
684 Ga0207655_1000800 3300025728 Bacteria 34234
685 Ga0207653_10000020 3300025885 Bacteria 136681
686 Ga0207653_10196802 3300025885 Bacteria 759
687 Ga0207682_10036976 3300025893 Bacteria 1977
688 Ga0207682_10057146 3300025893 Bacteria 1626
689 Ga0207682_10361686 3300025893 Bacteria 684
690 Ga0207692_10258030 3300025898 Bacteria 1047
691 Ga0207692_10367816 3300025898 Bacteria 890
692 Ga0207692_10569605 3300025898 Bacteria 725
693 Ga0207692_10582552 3300025898 Bacteria 718
694 Ga0207642_10006867 3300025899 Bacteria 3811
695 Ga0207642_10169807 3300025899 Bacteria 1179
696 Ga0207642_10229628 3300025899 Bacteria 1042
697 Ga0207642_10352100 3300025899 Bacteria 869
698 Ga0207642_10366049 3300025899 Bacteria 854
699 Ga0207642_10650750 3300025899 Bacteria 660
700 Ga0207710_10136098 3300025900 Bacteria 1183
701 Ga0207688_10015650 3300025901 Bacteria 4114
702 Ga0207688_10091919 3300025901 Bacteria 1743
703 Ga0207688_10264511 3300025901 Bacteria 1045
704 Ga0207688_10736514 3300025901 Bacteria 624
705 Ga0207688_11074528 3300025901 Bacteria 508
706 Ga0207680_10099361 3300025903 Bacteria 1867
707 Ga0207680_10423180 3300025903 Bacteria 943
708 Ga0207680_10641590 3300025903 Bacteria 760
709 Ga0207647_10086749 3300025904 Bacteria 1870
710 Ga0207685_10079282 3300025905 Bacteria 1354
711 Ga0207685_10209134 3300025905 Bacteria 921
712 Ga0207685_10644930 3300025905 Bacteria 572
713 Ga0207699_10054989 3300025906 Bacteria 2367
714 Ga0207699_10497569 3300025906 Bacteria 880
715 Ga0207645_10045061 3300025907 Bacteria 2820
716 Ga0207645_10080085 3300025907 Bacteria 2094
717 Ga0207645_10136871 3300025907 Bacteria 1595
718 Ga0207645_10216041 3300025907 Bacteria 1263
719 Ga0207645_10380941 3300025907 Bacteria 947
720 Ga0207645_11122351 3300025907 Bacteria 530
721 Ga0207643_10070404 3300025908 Bacteria 2012
722 Ga0207643_10091032 3300025908 Bacteria 1778
723 Ga0207643_10319370 3300025908 Bacteria 970
724 Ga0207643_10427435 3300025908 Bacteria 840
725 Ga0207643_10561315 3300025908 Bacteria 733
726 Ga0207705_10055659 3300025909 Bacteria 2852
727 Ga0207705_10078320 3300025909 Bacteria 2405
728 Ga0207705_10198578 3300025909 Bacteria 1519
729 Ga0207705_10529913 3300025909 Bacteria 915
730 Ga0207705_11372026 3300025909 Bacteria 538
731 Ga0207684_10032043 3300025910 Bacteria 4471
732 Ga0207684_10063333 3300025910 Bacteria 3140
733 Ga0207684_10089019 3300025910 Bacteria 2630
734 Ga0207684_10110116 3300025910 Bacteria 2357
735 Ga0207684_10170187 3300025910 Bacteria 1878
736 Ga0207684_10447333 3300025910 Bacteria 1109
737 Ga0207684_10517264 3300025910 Bacteria 1022
738 Ga0207654_10164286 3300025911 Bacteria 1437
739 Ga0207654_10170325 3300025911 Bacteria 1413
740 Ga0207654_10669833 3300025911 Bacteria 744
741 Ga0207654_11204590 3300025911 Bacteria 552
742 Ga0207707_10094896 3300025912 Bacteria 2607
743 Ga0207707_10305552 3300025912 Bacteria 1375
744 Ga0207707_10692209 3300025912 Bacteria 856
745 Ga0207695_10010589 3300025913 Bacteria 11272
746 Ga0207695_10031032 3300025913 Bacteria 5872
747 Ga0207695_10191445 3300025913 Bacteria 1963
748 Ga0207695_10194094 3300025913 Bacteria 1947
749 Ga0207695_10224933 3300025913 Bacteria 1783
750 Ga0207695_11579154 3300025913 Bacteria 537
751 Ga0207671_10004670 3300025914 Bacteria 12967
752 Ga0207671_10033433 3300025914 Bacteria 3826
753 Ga0207693_10058810 3300025915 Bacteria 3011
754 Ga0207693_10214708 3300025915 Bacteria 1512
755 Ga0207693_10523755 3300025915 Bacteria 925
756 Ga0207663_10052476 3300025916 Bacteria 2543
757 Ga0207663_10492107 3300025916 Bacteria 951
758 Ga0207663_10606871 3300025916 Bacteria 860
759 Ga0207663_10912922 3300025916 Bacteria 702
760 Ga0207660_10085454 3300025917 Bacteria 2327
761 Ga0207660_10511041 3300025917 Bacteria 975
762 Ga0207660_11166019 3300025917 Bacteria 627
763 Ga0207660_11437934 3300025917 Bacteria 558
764 Ga0207662_10391807 3300025918 Bacteria 940
765 Ga0207662_10445885 3300025918 Bacteria 884
766 Ga0207662_10493437 3300025918 Bacteria 842
767 Ga0207662_10598259 3300025918 Bacteria 767
768 Ga0207662_10978211 3300025918 Bacteria 600
769 Ga0207662_11162020 3300025918 Bacteria 549
770 Ga0207657_10046891 3300025919 Bacteria 3783
771 Ga0207657_10127672 3300025919 Bacteria 2087
772 Ga0207657_10604487 3300025919 Bacteria 855
773 Ga0207657_11125717 3300025919 Bacteria 599
774 Ga0207657_11190498 3300025919 Bacteria 579
775 Ga0207649_10075169 3300025920 Bacteria 2170
776 Ga0207649_10193924 3300025920 Bacteria 1430
777 Ga0207652_10109570 3300025921 Bacteria 2448
778 Ga0207652_10454216 3300025921 Bacteria 1155
779 Ga0207652_10749152 3300025921 Bacteria 869
780 Ga0207652_10917699 3300025921 Bacteria 773
781 Ga0207646_10192300 3300025922 Bacteria 1843
782 Ga0207646_10438908 3300025922 Bacteria 1178
783 Ga0207646_10742236 3300025922 Bacteria 876
784 Ga0207646_11187118 3300025922 Bacteria 669
785 Ga0207681_10000785 3300025923 Bacteria 20951
786 Ga0207681_10067424 3300025923 Bacteria 2481
787 Ga0207681_10197294 3300025923 Bacteria 1543
788 Ga0207681_10293628 3300025923 Bacteria 1284
789 Ga0207681_10435952 3300025923 Bacteria 1064
790 Ga0207681_10709818 3300025923 Bacteria 836
791 Ga0207681_10906203 3300025923 Bacteria 738
792 Ga0207681_11241736 3300025923 Bacteria 626
793 Ga0207694_10004619 3300025924 Bacteria 10727
794 Ga0207694_10015938 3300025924 Bacteria 5672
795 Ga0207694_10041314 3300025924 Bacteria 3553
796 Ga0207694_10503493 3300025924 Bacteria 1014
797 Ga0207694_10530285 3300025924 Bacteria 987
798 Ga0207694_11312918 3300025924 Bacteria 612
799 Ga0207694_11354556 3300025924 Bacteria 602
800 Ga0207650_10623767 3300025925 Bacteria 908
801 Ga0207650_10808755 3300025925 Bacteria 794
802 Ga0207650_11687123 3300025925 Bacteria 537
803 Ga0207659_10001704 3300025926 Bacteria 13045
804 Ga0207659_10172515 3300025926 Bacteria 1707
805 Ga0207659_10626768 3300025926 Bacteria 918
806 Ga0207659_11052261 3300025926 Bacteria 700
807 Ga0207659_11450268 3300025926 Bacteria 588
808 Ga0207687_10004768 3300025927 Bacteria 9019
809 Ga0207687_10032731 3300025927 Bacteria 3523
810 Ga0207687_10170724 3300025927 Bacteria 1677
811 Ga0207687_10207843 3300025927 Bacteria 1534
812 Ga0207687_10248241 3300025927 Bacteria 1413
813 Ga0207687_10447809 3300025927 Bacteria 1070
814 Ga0207687_11350790 3300025927 Bacteria 612
815 Ga0207687_11863969 3300025927 Bacteria 514
816 Ga0207700_10014025 3300025928 Bacteria 5237
817 Ga0207700_10024523 3300025928 Bacteria 4175
818 Ga0207700_11128191 3300025928 Bacteria 701
819 Ga0207700_11215145 3300025928 Bacteria 673
820 Ga0207664_10035462 3300025929 Bacteria 3849
821 Ga0207664_10527664 3300025929 Bacteria 1058
822 Ga0207644_10443852 3300025931 Bacteria 1065
823 Ga0207690_10073593 3300025932 Bacteria 2363
824 Ga0207690_10429285 3300025932 Bacteria 1059
825 Ga0207690_10430837 3300025932 Bacteria 1057
826 Ga0207690_10670154 3300025932 Bacteria 851
827 Ga0207706_10018751 3300025933 Bacteria 6224
828 Ga0207706_10055825 3300025933 Bacteria 3482
829 Ga0207706_10400034 3300025933 Bacteria 1191
830 Ga0207706_10718337 3300025933 Bacteria 853
831 Ga0207686_10009661 3300025934 Bacteria 5239
832 Ga0207686_10018299 3300025934 Bacteria 3966
833 Ga0207686_10039279 3300025934 Bacteria 2871
834 Ga0207686_10145174 3300025934 Bacteria 1645
835 Ga0207686_10471253 3300025934 Bacteria 969
836 Ga0207686_10615186 3300025934 Bacteria 856
837 Ga0207686_10684122 3300025934 Bacteria 814
838 Ga0207686_11078408 3300025934 Bacteria 654
839 Ga0207686_11812223 3300025934 Bacteria 505
840 Ga0207709_10012807 3300025935 Bacteria 4625
841 Ga0207709_10062560 3300025935 Bacteria 2330
842 Ga0207709_10087410 3300025935 Bacteria 2026
843 Ga0207709_10105358 3300025935 Bacteria 1874
844 Ga0207709_10304916 3300025935 Bacteria 1186
845 Ga0207709_10483853 3300025935 Bacteria 963
846 Ga0207709_10727804 3300025935 Bacteria 796
847 Ga0207709_10832672 3300025935 Bacteria 746
848 Ga0207709_11385368 3300025935 Bacteria 582
849 Ga0207670_10035507 3300025936 Bacteria 3233
850 Ga0207670_10089232 3300025936 Bacteria 2176
851 Ga0207670_10188169 3300025936 Bacteria 1560
852 Ga0207670_10250173 3300025936 Bacteria 1369
853 Ga0207670_10284676 3300025936 Bacteria 1289
854 Ga0207670_10287894 3300025936 Bacteria 1282
855 Ga0207670_11039009 3300025936 Bacteria 690
856 Ga0207670_11770552 3300025936 Bacteria 525
857 Ga0207670_11830110 3300025936 Bacteria 516
858 Ga0207670_11872237 3300025936 Bacteria 510
859 Ga0207669_10027248 3300025937 Bacteria 3125
860 Ga0207669_10039538 3300025937 Bacteria 2727
861 Ga0207669_10129626 3300025937 Bacteria 1730
862 Ga0207669_10333699 3300025937 Bacteria 1165
863 Ga0207669_10348904 3300025937 Bacteria 1142
864 Ga0207669_10463595 3300025937 Bacteria 1006
865 Ga0207669_10573908 3300025937 Bacteria 913
866 Ga0207669_10817083 3300025937 Bacteria 774
867 Ga0207669_11012854 3300025937 Bacteria 698
868 Ga0207669_11935649 3300025937 Bacteria 504
869 Ga0207704_10003227 3300025938 Bacteria 7388
870 Ga0207704_10072779 3300025938 Bacteria 2186
871 Ga0207704_10942707 3300025938 Bacteria 728
872 Ga0207704_10992688 3300025938 Bacteria 710
873 Ga0207665_10177665 3300025939 Bacteria 1540
874 Ga0207665_10334877 3300025939 Bacteria 1139
875 Ga0207665_10765157 3300025939 Bacteria 762
876 Ga0207691_10008862 3300025940 Bacteria 9656
877 Ga0207691_10028424 3300025940 Bacteria 5236
878 Ga0207691_10128652 3300025940 Bacteria 2238
879 Ga0207691_10138045 3300025940 Bacteria 2149
880 Ga0207691_10662958 3300025940 Bacteria 881
881 Ga0207691_11472453 3300025940 Bacteria 557
882 Ga0207691_11546157 3300025940 Bacteria 541
883 Ga0207711_10272442 3300025941 Bacteria 1557
884 Ga0207711_10498744 3300025941 Bacteria 1135
885 Ga0207711_10794937 3300025941 Bacteria 881
886 Ga0207711_10819348 3300025941 Bacteria 867
887 Ga0207689_10054363 3300025942 Bacteria 3297
888 Ga0207689_10091170 3300025942 Bacteria 2504
889 Ga0207689_10115140 3300025942 Bacteria 2210
890 Ga0207689_10306061 3300025942 Bacteria 1318
891 Ga0207689_10343160 3300025942 Bacteria 1241
892 Ga0207689_10514894 3300025942 Bacteria 1003
893 Ga0207689_10548047 3300025942 Bacteria 971
894 Ga0207689_10754787 3300025942 Bacteria 821
895 Ga0207689_10994608 3300025942 Bacteria 707
896 Ga0207689_11483960 3300025942 Bacteria 567
897 Ga0207689_11668841 3300025942 Bacteria 529
898 Ga0207661_10462622 3300025944 Bacteria 1156
899 Ga0207661_10906469 3300025944 Bacteria 812
900 Ga0207661_10958265 3300025944 Bacteria 788
901 Ga0207679_10005962 3300025945 Bacteria 7667
902 Ga0207679_10559371 3300025945 Bacteria 1027
903 Ga0207679_10821037 3300025945 Bacteria 848
904 Ga0207679_10879886 3300025945 Bacteria 819
905 Ga0207667_10046002 3300025949 Bacteria 4621
906 Ga0207667_10047925 3300025949 Bacteria 4520
907 Ga0207667_10092748 3300025949 Bacteria 3119
908 Ga0207667_10133891 3300025949 Bacteria 2552
909 Ga0207667_10195905 3300025949 Bacteria 2073
910 Ga0207667_10309845 3300025949 Bacteria 1613
911 Ga0207651_10151455 3300025960 Bacteria 1806
912 Ga0207651_10218411 3300025960 Bacteria 1539
913 Ga0207651_10325699 3300025960 Bacteria 1286
914 Ga0207651_10442753 3300025960 Bacteria 1113
915 Ga0207651_10473773 3300025960 Bacteria 1078
916 Ga0207651_10802727 3300025960 Bacteria 834
917 Ga0207651_10931374 3300025960 Bacteria 774
918 Ga0207651_11245381 3300025960 Bacteria 668
919 Ga0207651_11475399 3300025960 Bacteria 612
920 Ga0207651_11739325 3300025960 Bacteria 561
921 Ga0207651_11873094 3300025960 Bacteria 539
922 Ga0207712_10007287 3300025961 Bacteria 6976
923 Ga0207712_10043169 3300025961 Bacteria 3109
924 Ga0207712_10050066 3300025961 Bacteria 2915
925 Ga0207712_10434653 3300025961 Bacteria 1110
926 Ga0207712_10688908 3300025961 Bacteria 891
927 Ga0207712_11435301 3300025961 Bacteria 618
928 Ga0207668_10104561 3300025972 Bacteria 2111
929 Ga0207668_10336682 3300025972 Bacteria 1257
930 Ga0207668_10739809 3300025972 Bacteria 867
931 Ga0207668_11915350 3300025972 Bacteria 534
932 Ga0207640_10407536 3300025981 Bacteria 1109
933 Ga0207640_10447474 3300025981 Bacteria 1064
934 Ga0207640_10580346 3300025981 Bacteria 946
935 Ga0207640_10599106 3300025981 Bacteria 932
936 Ga0207640_10670369 3300025981 Bacteria 886
937 Ga0207640_10929399 3300025981 Bacteria 761
938 Ga0207658_10473860 3300025986 Bacteria 1111
939 Ga0207658_10739760 3300025986 Bacteria 890
940 Ga0207658_11137935 3300025986 Bacteria 713
941 Ga0207658_12067139 3300025986 Bacteria 518
942 Ga0207677_10165523 3300026023 Bacteria 1723
943 Ga0207677_10218695 3300026023 Bacteria 1526
944 Ga0207677_10382837 3300026023 Bacteria 1188
945 Ga0207677_10572303 3300026023 Bacteria 988
946 Ga0207677_10658594 3300026023 Bacteria 925
947 Ga0207677_10890763 3300026023 Bacteria 802
948 Ga0207677_10939758 3300026023 Bacteria 781
949 Ga0207677_11302172 3300026023 Bacteria 667
950 Ga0207677_11722339 3300026023 Bacteria 581
951 Ga0207677_12254367 3300026023 Bacteria 507
952 Ga0207703_10014366 3300026035 Bacteria 6175
953 Ga0207703_10197682 3300026035 Bacteria 1785
954 Ga0207703_10335896 3300026035 Bacteria 1387
955 Ga0207703_10360566 3300026035 Bacteria 1340
956 Ga0207703_10966532 3300026035 Bacteria 817
957 Ga0207703_11354912 3300026035 Bacteria 684
958 Ga0207703_11692243 3300026035 Bacteria 608
959 Ga0207639_10064481 3300026041 Bacteria 2840
960 Ga0207639_10127866 3300026041 Bacteria 2098
961 Ga0207639_10474076 3300026041 Bacteria 1140
962 Ga0207639_10564527 3300026041 Bacteria 1046
963 Ga0207639_10595836 3300026041 Bacteria 1019
964 Ga0207639_10603803 3300026041 Bacteria 1012
965 Ga0207639_11132795 3300026041 Bacteria 734
966 Ga0207639_11142698 3300026041 Bacteria 731
967 Ga0207678_10108665 3300026067 Bacteria 2366
968 Ga0207678_10547203 3300026067 Bacteria 1012
969 Ga0207678_11217370 3300026067 Bacteria 667
970 Ga0207678_11480312 3300026067 Bacteria 599
971 Ga0207678_11991798 3300026067 Bacteria 506
972 Ga0207708_10030248 3300026075 Bacteria 4107
973 Ga0207708_10079820 3300026075 Bacteria 2514
974 Ga0207708_10084014 3300026075 Bacteria 2448
975 Ga0207708_10087579 3300026075 Bacteria 2398
976 Ga0207708_10137712 3300026075 Bacteria 1913
977 Ga0207708_10227552 3300026075 Bacteria 1496
978 Ga0207708_10303308 3300026075 Bacteria 1299
979 Ga0207708_10342839 3300026075 Bacteria 1224
980 Ga0207708_10360158 3300026075 Bacteria 1195
981 Ga0207708_10874775 3300026075 Bacteria 777
982 Ga0207708_11318304 3300026075 Bacteria 633
983 Ga0207702_10015403 3300026078 Bacteria 6336
984 Ga0207702_10502798 3300026078 Bacteria 1182
985 Ga0207702_10599666 3300026078 Bacteria 1081
986 Ga0207702_10649164 3300026078 Bacteria 1038
987 Ga0207702_11230634 3300026078 Bacteria 743
988 Ga0207702_11822738 3300026078 Bacteria 600
989 Ga0207641_10072790 3300026088 Bacteria 2960
990 Ga0207641_10166673 3300026088 Bacteria 2007
991 Ga0207641_10723489 3300026088 Bacteria 981
992 Ga0207641_10728995 3300026088 Bacteria 977
993 Ga0207641_11032001 3300026088 Bacteria 820
994 Ga0207641_11290623 3300026088 Bacteria 730
995 Ga0207641_12296676 3300026088 Bacteria 539
996 Ga0207648_10009151 3300026089 Bacteria 9520
997 Ga0207648_10092725 3300026089 Bacteria 2641
998 Ga0207648_10127764 3300026089 Bacteria 2236
999 Ga0207648_10302886 3300026089 Bacteria 1434
1000 Ga0207648_10392158 3300026089 Bacteria 1257
1001 Ga0207648_10599212 3300026089 Bacteria 1015
1002 Ga0207648_10605048 3300026089 Bacteria 1010
1003 Ga0207648_10903364 3300026089 Bacteria 825
1004 Ga0207648_10922235 3300026089 Bacteria 816
1005 Ga0207648_10927209 3300026089 Bacteria 814
1006 Ga0207648_11043824 3300026089 Bacteria 766
1007 Ga0207648_11224338 3300026089 Bacteria 705
1008 Ga0207648_11242745 3300026089 Bacteria 700
1009 Ga0207648_11274291 3300026089 Bacteria 691
1010 Ga0207676_10170652 3300026095 Bacteria 1895
1011 Ga0207676_10192165 3300026095 Bacteria 1797
1012 Ga0207676_10266504 3300026095 Bacteria 1549
1013 Ga0207676_10544544 3300026095 Bacteria 1108
1014 Ga0207676_10691733 3300026095 Bacteria 987
1015 Ga0207676_11770366 3300026095 Bacteria 616
1016 Ga0207674_10081802 3300026116 Bacteria 3231
1017 Ga0207674_10181919 3300026116 Bacteria 2053
1018 Ga0207674_10233904 3300026116 Bacteria 1785
1019 Ga0207674_10349749 3300026116 Bacteria 1429
1020 Ga0207674_10718629 3300026116 Bacteria 964
1021 Ga0207674_11320704 3300026116 Bacteria 691
1022 Ga0207674_11344578 3300026116 Bacteria 684
1023 Ga0207674_11722504 3300026116 Bacteria 595
1024 Ga0207675_100004342 3300026118 Bacteria 13698
1025 Ga0207675_100007445 3300026118 Bacteria 10342
1026 Ga0207675_100125517 3300026118 Bacteria 2431
1027 Ga0207675_100270227 3300026118 Bacteria 1650
1028 Ga0207675_100289319 3300026118 Bacteria 1594
1029 Ga0207675_100310188 3300026118 Bacteria 1539
1030 Ga0207675_100356262 3300026118 Bacteria 1435
1031 Ga0207675_100438797 3300026118 Bacteria 1292
1032 Ga0207675_100483903 3300026118 Bacteria 1230
1033 Ga0207675_100984356 3300026118 Bacteria 861
1034 Ga0207675_101857178 3300026118 Bacteria 621
1035 Ga0207675_102015076 3300026118 Bacteria 595
1036 Ga0207683_10073724 3300026121 Bacteria 3020
1037 Ga0207683_10201151 3300026121 Bacteria 1811
1038 Ga0207683_10203504 3300026121 Bacteria 1800
1039 Ga0207683_10207138 3300026121 Bacteria 1784
1040 Ga0207683_10390371 3300026121 Bacteria 1280
1041 Ga0207683_10652062 3300026121 Bacteria 975
1042 Ga0207683_10712385 3300026121 Bacteria 931
1043 Ga0207683_10944875 3300026121 Bacteria 801
1044 Ga0207683_11245053 3300026121 Bacteria 689
1045 Ga0207698_10010326 3300026142 Bacteria 5990
1046 Ga0207698_10018098 3300026142 Bacteria 4794
1047 Ga0207698_10062007 3300026142 Bacteria 2917
1048 Ga0207698_10075692 3300026142 Bacteria 2691
1049 Ga0207698_10429314 3300026142 Bacteria 1270
1050 Ga0207698_10497375 3300026142 Bacteria 1186
1051 Ga0207698_11031683 3300026142 Bacteria 834
1052 Ga0207698_11615260 3300026142 Bacteria 664
1053 Ga0207698_12612653 3300026142 Bacteria 514
1054 Ga0207698_12701767 3300026142 Bacteria 505
1055 Ga0209281_1014758 3300027111 Bacteria 1646
1056 Ga0209969_1002421 3300027360 Bacteria 2580
1057 Ga0209969_1006837 3300027360 Bacteria 1606
1058 Ga0209969_1034742 3300027360 Bacteria 776
1059 Ga0209967_1001225 3300027364 Bacteria 3289
1060 Ga0209967_1002282 3300027364 Bacteria 2486
1061 Ga0209967_1004157 3300027364 Bacteria 1915
1062 Ga0209981_1000466 3300027378 Bacteria 5119
1063 Ga0209981_1020369 3300027378 Bacteria 946
1064 Ga0209996_1001407 3300027395 Bacteria 2891
1065 Ga0209996_1005695 3300027395 Bacteria 1599
1066 Ga0209996_1012092 3300027395 Bacteria 1157
1067 Ga0209996_1014406 3300027395 Bacteria 1074
1068 Ga0209996_1029306 3300027395 Bacteria 797
1069 Ga0209984_1010118 3300027424 Bacteria 1206
1070 Ga0210000_1001028 3300027462 Bacteria 3891
1071 Ga0210000_1001983 3300027462 Bacteria 2891
1072 Ga0210000_1002069 3300027462 Bacteria 2839
1073 Ga0210000_1003904 3300027462 Bacteria 2158
1074 Ga0210000_1054430 3300027462 Bacteria 644
1075 Ga0209995_1001957 3300027471 Bacteria 3224
1076 Ga0209995_1003526 3300027471 Bacteria 2491
1077 Ga0209995_1006615 3300027471 Bacteria 1864
1078 Ga0209995_1012179 3300027471 Bacteria 1402
1079 Ga0209995_1017528 3300027471 Bacteria 1178
1080 Ga0209968_1012084 3300027526 Bacteria 1344
1081 Ga0209968_1058196 3300027526 Bacteria 678
1082 Ga0209968_1088030 3300027526 Bacteria 562
1083 Ga0209999_1004058 3300027543 Bacteria 2631
1084 Ga0209999_1007091 3300027543 Bacteria 2015
1085 Ga0209999_1007290 3300027543 Bacteria 1988
1086 Ga0209999_1012353 3300027543 Bacteria 1546
1087 Ga0209999_1026964 3300027543 Bacteria 1063
1088 Ga0209982_1015872 3300027552 Bacteria 1145
1089 Ga0209970_1019672 3300027614 Bacteria 1138
1090 Ga0209983_1005142 3300027665 Bacteria 2721
1091 Ga0209983_1007490 3300027665 Bacteria 2237
1092 Ga0209983_1019317 3300027665 Bacteria 1416
1093 Ga0209282_1003491 3300027666 Bacteria 9346
1094 Ga0209971_1000807 3300027682 Bacteria 8071
1095 Ga0209971_1012773 3300027682 Bacteria 1989
1096 Ga0209971_1028260 3300027682 Bacteria 1342
1097 Ga0209966_1005332 3300027695 Bacteria 2206
1098 Ga0209966_1011832 3300027695 Bacteria 1595
1099 Ga0209998_10026248 3300027717 Bacteria 1272
1100 Ga0209813_10087573 3300027866 Bacteria 1040
1101 Ga0209974_10001043 3300027876 Bacteria 9809
1102 Ga0209974_10002476 3300027876 Bacteria 6685
1103 Ga0209974_10026410 3300027876 Bacteria 1922
1104 Ga0209974_10449305 3300027876 Bacteria 511
1105 Ga0207428_10000940 3300027907 Bacteria 32377
1106 Ga0207428_10005462 3300027907 Bacteria 11854
1107 Ga0207428_10007467 3300027907 Bacteria 9965
1108 Ga0207428_10030784 3300027907 Bacteria 4434
1109 Ga0207428_10494052 3300027907 Bacteria 889
1110 Ga0207428_10638880 3300027907 Bacteria 765
1111 Ga0268266_10012447 3300028379 Bacteria 7353
1112 Ga0268266_10024735 3300028379 Bacteria 5109
1113 Ga0268266_10114832 3300028379 Bacteria 2390
1114 Ga0268266_10135307 3300028379 Bacteria 2207
1115 Ga0268266_10774232 3300028379 Bacteria 926
1116 Ga0268266_10900485 3300028379 Bacteria 855
1117 Ga0268266_10953273 3300028379 Bacteria 830
1118 Ga0268265_10000858 3300028380 Bacteria 28507
1119 Ga0268265_10146043 3300028380 Bacteria 1987
1120 Ga0268265_10596469 3300028380 Bacteria 1055
1121 Ga0268265_10696899 3300028380 Bacteria 981
1122 Ga0268265_11013953 3300028380 Bacteria 820
1123 Ga0268265_11555381 3300028380 Bacteria 666
1124 Ga0268264_10202065 3300028381 Bacteria 1819
1125 Ga0268264_10409275 3300028381 Bacteria 1305
1126 Ga0268264_10437381 3300028381 Bacteria 1265
1127 Ga0268264_10441794 3300028381 Bacteria 1258
1128 Ga0268264_10617353 3300028381 Bacteria 1070
1129 Ga0268264_10868462 3300028381 Bacteria 904
1130 Ga0268264_11727172 3300028381 Bacteria 636
1131 Ga0268264_12639375 3300028381 Bacteria 507
1132 Ga0265337_1002965 3300028556 Bacteria 7526
1133 Ga0265326_10003019 3300028558 Bacteria 5597
1134 Ga0265319_1000335 3300028563 Bacteria 34634
1135 Ga0265319_1002743 3300028563 Bacteria 9454
1136 Ga0265334_10008628 3300028573 Bacteria 4325
1137 Ga0265318_10001647 3300028577 Bacteria 12876
1138 Ga0265318_10035150 3300028577 Bacteria 1928
1139 Ga0307517_10047808 3300028786 Bacteria 4423
1140 Ga0307517_10142364 3300028786 Bacteria 1678
1141 Ga0307515_10000063 3300028794 Bacteria 245504
1142 Ga0307515_10184880 3300028794 Bacteria 2018
1143 Ga0307515_10232392 3300028794 Bacteria 1633
1144 Ga0307515_10450121 3300028794 Bacteria 903
1145 Ga0307515_10640127 3300028794 Bacteria 675
1146 Ga0265338_10010133 3300028800 Bacteria 11121
1147 Ga0265338_10186135 3300028800 Bacteria 1578
1148 Ga0265338_10267468 3300028800 Bacteria 1254
1149 Ga0265324_10059771 3300029957 Bacteria 1303
1150 Ga0307511_10051346 3300030521 Bacteria 3308
1151 Ga0307512_10192432 3300030522 Bacteria 1122
1152 Ga0316177_1103656 3300030731 Bacteria 829
1153 Ga0316177_1125670 3300030731 Bacteria 1907
1154 Ga0316176_1019930 3300030732 Bacteria 2550
1155 Ga0316176_1194562 3300030732 Bacteria 661
1156 Ga0314311_1156198 3300030733 Bacteria 6393
1157 Ga0316179_1006797 3300030734 Bacteria 2010
1158 Ga0316178_1027803 3300030735 Bacteria 4966
1159 Ga0316178_1139668 3300030735 Bacteria 801
1160 Ga0316180_1000180 3300030736 Bacteria 1335
1161 Ga0316183_1001783 3300030742 Bacteria 2495
1162 Ga0316183_1157921 3300030742 Bacteria 647
1163 Ga0316181_1020929 3300030744 Bacteria 2709
1164 Ga0316181_1124463 3300030744 Bacteria 828
1165 Ga0316181_1241336 3300030744 Bacteria 585
1166 Ga0316182_1165347 3300030745 Bacteria 2509
1167 Ga0316182_1311139 3300030745 Bacteria 645
1168 Ga0265766_1000364 3300030863 Bacteria 1908
1169 Ga0265766_1015755 3300030863 Bacteria 587
1170 Ga0265769_101131 3300030888 Bacteria 1223
1171 Ga0265761_100256 3300030889 Bacteria 1962
1172 Ga0265332_10007637 3300031238 Bacteria 4886
1173 Ga0265332_10043520 3300031238 Bacteria 1939
1174 Ga0265328_10036159 3300031239 Bacteria 1825
1175 Ga0265325_10200569 3300031241 Bacteria 921
1176 Ga0265329_10290740 3300031242 Bacteria 551
1177 Ga0265340_10187097 3300031247 Bacteria 935
1178 Ga0265339_10005033 3300031249 Bacteria 8891
1179 Ga0265339_10033962 3300031249 Bacteria 2869
1180 Ga0265331_10005659 3300031250 Bacteria 7509
1181 Ga0265331_10048424 3300031250 Bacteria 2043
1182 Ga0265331_10217564 3300031250 Bacteria 859
1183 Ga0265327_10000020 3300031251 Bacteria 424552
1184 Ga0265327_10003591 3300031251 Bacteria 14634
1185 Ga0265327_10041542 3300031251 Bacteria 2477
1186 Ga0265327_10196534 3300031251 Bacteria 915
1187 Ga0265316_10008237 3300031344 Bacteria 9701
1188 Ga0307513_10140544 3300031456 Bacteria 2342
1189 Ga0307513_10157577 3300031456 Bacteria 2168
1190 Ga0307513_10169430 3300031456 Bacteria 2063
1191 Ga0307513_10379773 3300031456 Bacteria 1153
1192 Ga0307513_10468000 3300031456 Bacteria 982
1193 Ga0307509_10000112 3300031507 Bacteria 117028
1194 Ga0307509_10037446 3300031507 Bacteria 5304
1195 Ga0307509_10087935 3300031507 Bacteria 3191
1196 Ga0307509_10595177 3300031507 Bacteria 779
1197 Ga0307408_100000089 3300031548 Bacteria 100712
1198 Ga0307408_100075173 3300031548 Bacteria 2509
1199 Ga0307408_100084789 3300031548 Bacteria 2377
1200 Ga0307408_100192376 3300031548 Bacteria 1645
1201 Ga0307408_100273652 3300031548 Bacteria 1403
1202 Ga0307408_100373293 3300031548 Bacteria 1217
1203 Ga0307408_100620275 3300031548 Bacteria 963
1204 Ga0307408_100693067 3300031548 Bacteria 915
1205 Ga0307408_100952078 3300031548 Bacteria 789
1206 Ga0307408_101097420 3300031548 Bacteria 738
1207 Ga0307408_101175379 3300031548 Bacteria 715
1208 Ga0307408_101175787 3300031548 Bacteria 714
1209 Ga0307408_101177700 3300031548 Bacteria 714
1210 Ga0307408_101190085 3300031548 Bacteria 710
1211 Ga0307408_101368431 3300031548 Bacteria 665
1212 Ga0307408_101508877 3300031548 Bacteria 636
1213 Ga0307408_101679124 3300031548 Bacteria 605
1214 Ga0307408_101729312 3300031548 Bacteria 596
1215 Ga0307408_101786530 3300031548 Bacteria 587
1216 Ga0307408_101860347 3300031548 Bacteria 576
1217 Ga0307408_102068129 3300031548 Bacteria 548
1218 Ga0307408_102361451 3300031548 Bacteria 516
1219 Ga0307508_10561599 3300031616 Bacteria 740
1220 Ga0307508_10741990 3300031616 Bacteria 594
1221 Ga0307514_10187898 3300031649 Bacteria 1320
1222 Ga0316575_10303861 3300031665 Bacteria 675
1223 Ga0316579_10013752 3300031691 Bacteria 3486
1224 Ga0265314_10000003 3300031711 Bacteria 1653386
1225 Ga0265314_10205869 3300031711 Bacteria 1159
1226 Ga0265342_10470648 3300031712 Bacteria 643
1227 Ga0316578_10133551 3300031728 Bacteria 1494
1228 Ga0307516_10643464 3300031730 Bacteria 715
1229 Ga0307516_10752227 3300031730 Bacteria 634
1230 Ga0307405_10034470 3300031731 Bacteria 3012
1231 Ga0307405_10059631 3300031731 Bacteria 2405
1232 Ga0307405_10181873 3300031731 Bacteria 1510
1233 Ga0307405_10187482 3300031731 Bacteria 1490
1234 Ga0307405_10268782 3300031731 Bacteria 1277
1235 Ga0307405_10433230 3300031731 Bacteria 1038
1236 Ga0307405_10478385 3300031731 Bacteria 994
1237 Ga0307405_10580545 3300031731 Bacteria 912
1238 Ga0307405_10678691 3300031731 Bacteria 850
1239 Ga0307405_10800585 3300031731 Bacteria 789
1240 Ga0307405_11139521 3300031731 Bacteria 672
1241 Ga0307405_11266726 3300031731 Bacteria 640
1242 Ga0307405_11438765 3300031731 Bacteria 604
1243 Ga0307405_11677162 3300031731 Bacteria 562
1244 Ga0307405_11694976 3300031731 Bacteria 560
1245 Ga0307413_10140657 3300031824 Bacteria 1667
1246 Ga0307413_10531930 3300031824 Bacteria 950
1247 Ga0307413_10582678 3300031824 Bacteria 913
1248 Ga0307413_10607990 3300031824 Bacteria 896
1249 Ga0307413_10762008 3300031824 Bacteria 810
1250 Ga0307413_11060588 3300031824 Bacteria 698
1251 Ga0307413_11280941 3300031824 Bacteria 640
1252 Ga0307413_11392416 3300031824 Bacteria 616
1253 Ga0307413_11404745 3300031824 Bacteria 614
1254 Ga0307410_10114676 3300031852 Bacteria 1955
1255 Ga0307410_10118959 3300031852 Bacteria 1923
1256 Ga0307410_10146382 3300031852 Bacteria 1753
1257 Ga0307410_10394541 3300031852 Bacteria 1116
1258 Ga0307410_10420906 3300031852 Bacteria 1083
1259 Ga0307410_10839694 3300031852 Bacteria 783
1260 Ga0307410_10879874 3300031852 Bacteria 766
1261 Ga0307410_10997715 3300031852 Bacteria 722
1262 Ga0307410_11025201 3300031852 Bacteria 712
1263 Ga0307410_11802766 3300031852 Bacteria 544
1264 Ga0307410_11941269 3300031852 Bacteria 524
1265 Ga0326468_10006373 3300031889 Bacteria 1091
1266 Ga0326468_10049428 3300031889 Bacteria 632
1267 Ga0307406_10000446 3300031901 Bacteria 24118
1268 Ga0307406_10216114 3300031901 Bacteria 1422
1269 Ga0307406_10257870 3300031901 Bacteria 1317
1270 Ga0307406_10267651 3300031901 Bacteria 1296
1271 Ga0307406_10441573 3300031901 Bacteria 1041
1272 Ga0307406_10505835 3300031901 Bacteria 980
1273 Ga0307406_11250646 3300031901 Bacteria 646
1274 Ga0307406_11368337 3300031901 Bacteria 619
1275 Ga0307406_11774360 3300031901 Bacteria 548
1276 Ga0307407_10006277 3300031903 Bacteria 5257
1277 Ga0307407_10059301 3300031903 Bacteria 2228
1278 Ga0307407_10169771 3300031903 Bacteria 1435
1279 Ga0307407_10309219 3300031903 Bacteria 1105
1280 Ga0307407_10339649 3300031903 Bacteria 1060
1281 Ga0307407_10746486 3300031903 Bacteria 741
1282 Ga0307407_10876376 3300031903 Bacteria 687
1283 Ga0307407_11060367 3300031903 Bacteria 628
1284 Ga0307407_11188289 3300031903 Bacteria 595
1285 Ga0307412_10041129 3300031911 Bacteria 2993
1286 Ga0307412_10074591 3300031911 Bacteria 2324
1287 Ga0307412_10113968 3300031911 Bacteria 1935
1288 Ga0307412_10227322 3300031911 Bacteria 1434
1289 Ga0307412_10271374 3300031911 Bacteria 1327
1290 Ga0307412_10334708 3300031911 Bacteria 1209
1291 Ga0307412_10347870 3300031911 Bacteria 1189
1292 Ga0307412_10437975 3300031911 Bacteria 1073
1293 Ga0307412_10505041 3300031911 Bacteria 1007
1294 Ga0307412_10873002 3300031911 Bacteria 786
1295 Ga0307412_10907900 3300031911 Bacteria 772
1296 Ga0307412_10997147 3300031911 Bacteria 740
1297 Ga0307412_11050911 3300031911 Bacteria 722
1298 Ga0307412_11102643 3300031911 Bacteria 706
1299 Ga0307412_11294049 3300031911 Bacteria 656
1300 Ga0307412_12069760 3300031911 Bacteria 528
1301 Ga0307409_100004038 3300031995 Bacteria 8151
1302 Ga0307409_100022307 3300031995 Bacteria 4362
1303 Ga0307409_100047745 3300031995 Bacteria 3252
1304 Ga0307409_100107020 3300031995 Bacteria 2335
1305 Ga0307409_100271293 3300031995 Bacteria 1562
1306 Ga0307409_100282355 3300031995 Bacteria 1535
1307 Ga0307409_100283224 3300031995 Bacteria 1533
1308 Ga0307409_100504930 3300031995 Bacteria 1178
1309 Ga0307409_100753800 3300031995 Bacteria 977
1310 Ga0307409_101811647 3300031995 Bacteria 639
1311 Ga0307416_100159497 3300032002 Bacteria 2082
1312 Ga0307416_100172377 3300032002 Bacteria 2016
1313 Ga0307416_100179915 3300032002 Bacteria 1980
1314 Ga0307416_100206239 3300032002 Bacteria 1870
1315 Ga0307416_100263458 3300032002 Bacteria 1686
1316 Ga0307416_100285096 3300032002 Bacteria 1631
1317 Ga0307416_100310299 3300032002 Bacteria 1573
1318 Ga0307416_100388138 3300032002 Bacteria 1429
1319 Ga0307416_100395584 3300032002 Bacteria 1417
1320 Ga0307416_100406416 3300032002 Bacteria 1401
1321 Ga0307416_100408653 3300032002 Bacteria 1397
1322 Ga0307416_100444070 3300032002 Bacteria 1348
1323 Ga0307416_100487170 3300032002 Bacteria 1294
1324 Ga0307416_100561991 3300032002 Bacteria 1216
1325 Ga0307416_100732161 3300032002 Bacteria 1080
1326 Ga0307416_100798019 3300032002 Bacteria 1039
1327 Ga0307416_100834906 3300032002 Bacteria 1019
1328 Ga0307416_100976618 3300032002 Bacteria 949
1329 Ga0307416_101273798 3300032002 Bacteria 841
1330 Ga0307416_101300071 3300032002 Bacteria 833
1331 Ga0307416_101485092 3300032002 Bacteria 783
1332 Ga0307416_101576500 3300032002 Bacteria 762
1333 Ga0307416_101714541 3300032002 Bacteria 733
1334 Ga0307416_102123162 3300032002 Bacteria 663
1335 Ga0307416_102440668 3300032002 Bacteria 622
1336 Ga0307416_102522336 3300032002 Bacteria 612
1337 Ga0307416_102560500 3300032002 Bacteria 608
1338 Ga0307416_102797262 3300032002 Bacteria 583
1339 Ga0307416_103013416 3300032002 Bacteria 563
1340 Ga0307416_103146620 3300032002 Bacteria 552
1341 Ga0307416_103376906 3300032002 Bacteria 534
1342 Ga0307414_10128822 3300032004 Bacteria 1960
1343 Ga0307414_10278969 3300032004 Bacteria 1403
1344 Ga0307414_10343210 3300032004 Bacteria 1279
1345 Ga0307414_10509130 3300032004 Bacteria 1066
1346 Ga0307414_10886902 3300032004 Bacteria 817
1347 Ga0307414_10941371 3300032004 Bacteria 793
1348 Ga0307414_10942848 3300032004 Bacteria 793
1349 Ga0307414_11043465 3300032004 Bacteria 753
1350 Ga0307414_11141732 3300032004 Bacteria 720
1351 Ga0307414_11523320 3300032004 Bacteria 622
1352 Ga0307411_10000085 3300032005 Bacteria 28904
1353 Ga0307411_10023560 3300032005 Bacteria 3649
1354 Ga0307411_10077886 3300032005 Bacteria 2271
1355 Ga0307411_10214230 3300032005 Bacteria 1489
1356 Ga0307411_10282426 3300032005 Bacteria 1322
1357 Ga0307411_10461116 3300032005 Bacteria 1065
1358 Ga0307411_10544620 3300032005 Bacteria 989
1359 Ga0307411_10747773 3300032005 Bacteria 856
1360 Ga0307411_11904285 3300032005 Bacteria 553
1361 Ga0316053_117863 3300032120 Bacteria 541
1362 Ga0307415_100098538 3300032126 Bacteria 2137
1363 Ga0307415_100192606 3300032126 Bacteria 1610
1364 Ga0307415_100202159 3300032126 Bacteria 1577
1365 Ga0307415_100247231 3300032126 Bacteria 1447
1366 Ga0307415_100347606 3300032126 Bacteria 1247
1367 Ga0307415_100686236 3300032126 Bacteria 922
1368 Ga0307415_100758746 3300032126 Bacteria 881
1369 Ga0307415_100944812 3300032126 Bacteria 798
1370 Ga0307415_101004782 3300032126 Bacteria 775
1371 Ga0307415_101023079 3300032126 Bacteria 769
1372 Ga0307415_101165381 3300032126 Bacteria 724
1373 Ga0307415_101228415 3300032126 Bacteria 707
1374 Ga0307415_101618725 3300032126 Bacteria 622
1375 Ga0316583_10002208 3300032133 Bacteria 6709
1376 Ga0316583_10040468 3300032133 Bacteria 1650
1377 Ga0316593_10000192 3300032168 Bacteria 9387
1378 Ga0316593_10000748 3300032168 Bacteria 6408
1379 Ga0316593_10005016 3300032168 Bacteria 3454
1380 Ga0307507_10181557 3300033179 Bacteria 1503
1381 Ga0307510_10329758 3300033180 Bacteria 981
1382 Ga0316587_1083879 3300033529 Bacteria 604
1383 Ga0316596_1000625 3300033541 Bacteria 6297
1384 Ga0373930_0115603 3300034816 Bacteria 649
1385 Ga0373948_0043328 3300034817 Bacteria 948
1386 Ga0373948_0171472 3300034817 Bacteria 552
1387 Ga0373950_0048562 3300034818 Bacteria 829
1388 Ga0373958_0020371 3300034819 Bacteria 1221
1389 Ga0373958_0038056 3300034819 Bacteria 973
1390 Ga0373958_0132797 3300034819 Bacteria 611
1391 Ga0373938_0002317 3300034957 Bacteria 3065
1392 Ga0373938_0045689 3300034957 Bacteria 987
1393 Ga0373938_0196010 3300034957 Bacteria 558
1394 Ga0373926_0022817 3300035083 Bacteria 2172
1395 Ga0373926_0043937 3300035083 Bacteria 1600
1396 Ga0373926_0440314 3300035083 Bacteria 517
1397 Ga0373928_0022540 3300035084 Bacteria 1337
1398 Ga0373928_0129486 3300035084 Bacteria 683
1399 Ga0373928_0241186 3300035084 Bacteria 535
1400 Ga0373929_0052229 3300035085 Bacteria 937
1401 Ga0373929_0081359 3300035085 Bacteria 790
1402 Ga0373934_0064489 3300035086 Bacteria 1462
1403 Ga0373934_0078177 3300035086 Bacteria 1327
1404 Ga0373940_0177462 3300035088 Bacteria 691
1405 Ga0373940_0228555 3300035088 Bacteria 621
1406 Ga0373949_0000042 3300035090 Bacteria 46169
1407 Ga0373949_0278301 3300035090 Bacteria 525
1408 Ga0373951_0027911 3300035091 Bacteria 1320
1409 Ga0373952_0094913 3300035092 Bacteria 779
1410 Ga0373952_0187743 3300035092 Bacteria 599
1411 Ga0373923_0141498 3300035111 Bacteria 1088
1412 Ga0373923_0174750 3300035111 Bacteria 985
1413 Ga0373923_0229677 3300035111 Bacteria 864
1414 Ga0373923_0461279 3300035111 Bacteria 617
1415 Ga0373932_0035988 3300035112 Bacteria 1403
1416 Ga0373932_0105692 3300035112 Bacteria 922
1417 Ga0373936_0036639 3300035113 Bacteria 1957
1418 Ga0373936_0043210 3300035113 Bacteria 1811
1419 Ga0373936_0190634 3300035113 Bacteria 902
1420 Ga0373936_0237969 3300035113 Bacteria 811
1421 Ga0373939_0006647 3300035114 Bacteria 2792
1422 Ga0373939_0030675 3300035114 Bacteria 1548
1423 Ga0373939_0188546 3300035114 Bacteria 773
1424 Ga0373941_0047797 3300035115 Bacteria 1349
1425 Ga0373941_0152546 3300035115 Bacteria 849
1426 Ga0373941_0206407 3300035115 Bacteria 749
1427 Ga0373953_0013114 3300035117 Bacteria 2952
1428 Ga0373953_0178677 3300035117 Bacteria 915
1429 Ga0373954_0000068 3300035118 Bacteria 37051
1430 Ga0373954_0274156 3300035118 Bacteria 831
1431 Ga0373954_0699328 3300035118 Bacteria 503
1432 Ga0373956_0090633 3300035119 Bacteria 1410
1433 Ga0373956_0093057 3300035119 Bacteria 1392
1434 Ga0373956_0143582 3300035119 Bacteria 1121
1435 Ga0373957_0014366 3300035120 Bacteria 2706
1436 Ga0373957_0044059 3300035120 Bacteria 1688
1437 Ga0373957_0083584 3300035120 Bacteria 1263
1438 Ga0373957_0110392 3300035120 Bacteria 1107
1439 Ga0373960_0000482 3300035121 Bacteria 7922
1440 Ga0373960_0010947 3300035121 Bacteria 2224
1441 Ga0373960_0215032 3300035121 Bacteria 685
1442 Ga0373960_0223284 3300035121 Bacteria 675
1443 Ga0373960_0346646 3300035121 Bacteria 562
1444 Ga0373960_0424301 3300035121 Bacteria 517
1445 Ga0373943_0229005 3300035170 Bacteria 1038
1446 Ga0373943_0533144 3300035170 Bacteria 688
1447 Ga0373943_0791117 3300035170 Bacteria 564
1448 Ga0373946_0069230 3300035171 Bacteria 1520
1449 Ga0373946_0288710 3300035171 Bacteria 809
1450 Ga0373946_0402204 3300035171 Bacteria 691
1451 Ga0373955_0002904 3300035172 Bacteria 7521
1452 Ga0373955_0046924 3300035172 Bacteria 2337
1453 Ga0373955_0080448 3300035172 Bacteria 1840
1454 Ga0373942_0011667 3300035207 Bacteria 2087
1455 Ga0373942_0182146 3300035207 Bacteria 689
1456 Ga0373942_0227585 3300035207 Bacteria 627
1457 Ga0373961_0000015 3300035241 Bacteria 111392
1458 Ga0373961_0161440 3300035241 Bacteria 770
1459 Ga0373962_0188300 3300035242 Bacteria 693
1460 Ga0373962_0269618 3300035242 Bacteria 596
1461 Ga0373962_0377766 3300035242 Bacteria 517
1462 Ga0373924_0002538 3300035410 Bacteria 6158
1463 Ga0373924_0003908 3300035410 Bacteria 5168
1464 Ga0373924_0301185 3300035410 Bacteria 712
1465 Ga0373924_0421001 3300035410 Bacteria 598
1466 Ga0373931_0000535 3300035691 Bacteria 15604
1467 Ga0373931_0094413 3300035691 Bacteria 1672
1468 Ga0373931_0176172 3300035691 Bacteria 1263
1469 Ga0373931_0295302 3300035691 Bacteria 999
1470 Ga0373931_1209819 3300035691 Bacteria 517
1471 Ga0373935_0021499 3300035692 Bacteria 3951
1472 Ga0373935_0102161 3300035692 Bacteria 1892
1473 Ga0373935_0257402 3300035692 Bacteria 1223
1474 Ga0373935_0275973 3300035692 Bacteria 1182
1475 Ga0373935_0295391 3300035692 Bacteria 1144
1476 Ga0373935_0485400 3300035692 Bacteria 896
1477 Ga0373935_0769220 3300035692 Bacteria 710
1478 Ga0373927_0046371 3300035695 Bacteria 2812
1479 Ga0373927_0461278 3300035695 Bacteria 839
1480 Ga0373927_0489670 3300035695 Bacteria 813
1481 Ga0373933_0063556 3300035724 Bacteria 2231
1482 Ga0373933_0070222 3300035724 Bacteria 2130
1483 Ga0373933_0302728 3300035724 Bacteria 1035
1484 Ga0373933_0737190 3300035724 Bacteria 648
1485 Ga0373933_0755737 3300035724 Bacteria 640
1486 Ga0373947_0009447 3300035725 Bacteria 5600
1487 Ga0373947_0043014 3300035725 Bacteria 2697
1488 Ga0373947_0281708 3300035725 Bacteria 1105
1489 Ga0373947_0345173 3300035725 Bacteria 998
1490 Ga0373947_0695344 3300035725 Bacteria 694
1491 Ga0373947_0984656 3300035725 Bacteria 575
1492 Ga0373937_0002051 3300036401 Bacteria 16843
1493 Ga0373937_0002498 3300036401 Bacteria 15273
1494 Ga0373937_0160684 3300036401 Bacteria 2106
1495 Ga0373937_0300334 3300036401 Bacteria 1517
1496 Ga0373937_0382862 3300036401 Bacteria 1334
1497 Ga0373937_1858827 3300036401 Bacteria 548
1498 Ga0265778_007130 3300036457 Bacteria 1218
1499 Ga0373925_0008267 3300037068 Bacteria 7573
1500 Ga0373925_0019406 3300037068 Bacteria 4944
1501 Ga0373925_0582410 3300037068 Bacteria 921
1502 Ga0373925_0624969 3300037068 Bacteria 887
1503 Ga0373925_0850483 3300037068 Bacteria 752
1504 Ga0373925_1782202 3300037068 Bacteria 502
1505 Ga0395899_0158389 3300037312 Bacteria 1601
1506 Ga0395899_0274789 3300037312 Bacteria 1148
1507 Ga0395900_0094973 3300037418 Bacteria 3063
1508 Ga0395900_0227961 3300037418 Bacteria 1875
1509 Ga0395900_0260958 3300037418 Bacteria 1730
1510 Ga0395900_0388831 3300037418 Bacteria 1361
1511 Ga0395900_0554082 3300037418 Bacteria 1094
1512 Ga0395900_1584946 3300037418 Bacteria 566
1513 Ga0395900_1668003 3300037418 Bacteria 548
1514 Ga0395900_1727168 3300037418 Bacteria 537
1515 Ga0395898_0091988 3300037466 Bacteria 2917
1516 Ga0395898_1199351 3300037466 Bacteria 690
1517 Ga0395898_1702328 3300037466 Bacteria 553
1518 Ga0395898_1794233 3300037466 Bacteria 535
1519 Ga0395898_1946063 3300037466 Bacteria 508
1520 Ga0395905_0002424 3300037471 Bacteria 20687
1521 Ga0395905_0002507 3300037471 Bacteria 20284
1522 Ga0395905_0204218 3300037471 Bacteria 1852
1523 Ga0395905_0482283 3300037471 Bacteria 1139
1524 Ga0395905_0560750 3300037471 Bacteria 1043
1525 Ga0395905_0866380 3300037471 Bacteria 806
1526 Ga0395905_1793181 3300037471 Bacteria 519
1527 Ga0395905_1904515 3300037471 Bacteria 501
1528 Ga0436364_1234629 3300037853 Bacteria 861
1529 Ga0395901_0066674 3300038443 Bacteria 3749
1530 Ga0395901_0075954 3300038443 Bacteria 3505
1531 Ga0395901_0231361 3300038443 Bacteria 1929
1532 Ga0395901_0907926 3300038443 Bacteria 862
1533 Ga0395901_1009562 3300038443 Bacteria 807
1534 Ga0400490_03371 3300038726 Bacteria 14955
1535 Ga0436365_0331513 3300039437 Bacteria 517
1536 Ga0436365_0493876 3300039437 Bacteria 1080
1537 Ga0436365_0511742 3300039437 Bacteria 636
1538 Ga0436365_0646920 3300039437 Bacteria 617
1539 Ga0436365_0979522 3300039437 Bacteria 2250
1540 Ga0436365_0995968 3300039437 Bacteria 2516
1541 Ga0436365_1156689 3300039437 Bacteria 898
1542 Ga0436365_1393832 3300039437 Bacteria 2033
1543 Ga0436365_1829024 3300039437 Bacteria 1577
1544 Ga0436365_1864317 3300039437 Bacteria 565
1545 Ga0436360_0879567 3300039438 Bacteria 1506
1546 Ga0436361_0148596 3300039447 Bacteria 3626
1547 Ga0436361_0182699 3300039447 Bacteria 1100
1548 Ga0436361_0275583 3300039447 Bacteria 1217
1549 Ga0436361_0405071 3300039447 Bacteria 13061
1550 Ga0436361_0421532 3300039447 Bacteria 996
1551 Ga0436361_0472363 3300039447 Bacteria 1001
1552 Ga0436361_0509304 3300039447 Bacteria 776
1553 Ga0436361_0776332 3300039447 Bacteria 4883
1554 Ga0436363_0107511 3300039450 Bacteria 606
1555 Ga0436363_0673704 3300039450 Bacteria 1699
1556 Ga0436363_1011320 3300039450 Bacteria 697
1557 Ga0436363_1161920 3300039450 Bacteria 1110
1558 Ga0436363_1362656 3300039450 Bacteria 1024
1559 Ga0436363_1398290 3300039450 Unclassified 597
1560 Ga0436363_1622102 3300039450 Bacteria 753
1561 Ga0436363_1658820 3300039450 Bacteria 721
1562 Ga0436362_0406983 3300039453 Bacteria 922
1563 Ga0436362_0539891 3300039453 Bacteria 718
1564 Ga0436362_0851522 3300039453 Bacteria 914
1565 Ga0436362_1277522 3300039453 Bacteria 620
1566 Ga0439436_0023910 3300041404 Bacteria 1806
1567 Ga0439436_0070581 3300041404 Bacteria 973
1568 Ga0439438_055651 3300041405 Bacteria 997
1569 Ga0439438_081680 3300041405 Bacteria 793
1570 Ga0439439_0025226 3300041406 Bacteria 1496
1571 Ga0439439_0028319 3300041406 Bacteria 1418
1572 Ga0439439_0244616 3300041406 Bacteria 530
1573 Ga0439439_0251774 3300041406 Bacteria 524
1574 Ga0439447_058768 3300041407 Bacteria 907
1575 Ga0439447_080608 3300041407 Bacteria 752
1576 Ga0439447_096082 3300041407 Bacteria 680
1577 Ga0439453_0000163 3300041408 Bacteria 6099
1578 Ga0439453_0029432 3300041408 Bacteria 1034
1579 Ga0439453_0057961 3300041408 Bacteria 796
1580 Ga0439453_0123802 3300041408 Bacteria 595
1581 Ga0439453_0127455 3300041408 Bacteria 588
1582 Ga0439461_0015712 3300041410 Bacteria 1453
1583 Ga0439461_0090344 3300041410 Bacteria 734
1584 Ga0439461_0153396 3300041410 Bacteria 596
1585 Ga0439461_0164631 3300041410 Bacteria 579
1586 Ga0439466_0013514 3300041411 Bacteria 2987
1587 Ga0439466_0016489 3300041411 Bacteria 2669
1588 Ga0439466_0251595 3300041411 Bacteria 535
1589 Ga0439465_0001025 3300041413 Bacteria 8893
1590 Ga0451787_234705 3300041441 Bacteria 556
1591 Ga0451787_543246 3300041441 Bacteria 1478
1592 Ga0451789_0296371 3300041443 Bacteria 734
1593 Ga0451789_0338698 3300041443 Bacteria 1201
1594 Ga0451794_19623 3300041446 Bacteria 517
1595 Ga0451794_34026 3300041446 Bacteria 533
1596 Ga0451791_1018582 3300041451 Bacteria 509
1597 Ga0451791_1152850 3300041451 Bacteria 1292
1598 Ga0451791_1828290 3300041451 Bacteria 730
1599 Ga0451793_0272307 3300041452 Bacteria 1367
1600 Ga0451793_1858884 3300041452 Bacteria 660
1601 Ga0451797_0027218 3300041453 Bacteria 1404
1602 Ga0451797_0610734 3300041453 Bacteria 539
1603 Ga0451797_0810762 3300041453 Bacteria 919
1604 Ga0451797_1029164 3300041453 Bacteria 516
1605 Ga0451797_1237319 3300041453 Bacteria 631
1606 Ga0451799_15134 3300041454 Bacteria 630
1607 Ga0451801_28156 3300041455 Bacteria 573
1608 Ga0451803_03900 3300041457 Bacteria 591
1609 Ga0451800_0428694 3300041459 Bacteria 511
1610 Ga0451800_1055116 3300041459 Bacteria 770
1611 Ga0451800_1067832 3300041459 Bacteria 1617
1612 Ga0451802_0337526 3300041460 Bacteria 618
1613 Ga0451802_1235073 3300041460 Bacteria 1007
1614 Ga0451802_1546900 3300041460 Bacteria 774
1615 Ga0451805_010711 3300041461 Bacteria 642
1616 Ga0451805_026922 3300041461 Bacteria 875
1617 Ga0451805_054753 3300041461 Bacteria 665
1618 Ga0451804_0032116 3300041463 Bacteria 1166
1619 Ga0451804_0958318 3300041463 Bacteria 826
1620 Ga0451804_0961676 3300041463 Bacteria 624
1621 Ga0451807_0112616 3300041486 Bacteria 605
1622 Ga0451807_1729784 3300041486 Bacteria 1376
1623 Ga0451807_1867510 3300041486 Bacteria 705
1624 Ga0451807_2039794 3300041486 Bacteria 672
1625 Ga0451833_0810760 3300041491 Bacteria 1490
1626 Ga0451833_1158611 3300041491 Bacteria 610
1627 Ga0451833_1340573 3300041491 Bacteria 968
1628 Ga0451833_1453880 3300041491 Bacteria 538
1629 Ga0451835_1050461 3300041492 Bacteria 1174
1630 Ga0451837_0483972 3300041494 Bacteria 1285
1631 Ga0451837_1536618 3300041494 Bacteria 585
1632 Ga0451839_0046429 3300041496 Bacteria 616
1633 Ga0451839_0232015 3300041496 Bacteria 816
1634 Ga0451840_24907 3300041497 Bacteria 662
1635 Ga0451841_1048641 3300041498 Bacteria 656
1636 Ga0451845_0284123 3300041501 Bacteria 831
1637 Ga0451845_0427097 3300041501 Bacteria 512
1638 Ga0451846_03452 3300041502 Bacteria 849
1639 Ga0451849_0280464 3300041505 Bacteria 784
1640 Ga0451849_0453990 3300041505 Bacteria 541
1641 Ga0451849_1575111 3300041505 Bacteria 636
1642 Ga0451850_36419 3300041506 Bacteria 562
1643 Ga0451851_1378734 3300041507 Bacteria 818
1644 Ga0451843_1185394 3300041509 Bacteria 876
1645 Ga0451843_1571034 3300041509 Bacteria 899
1646 Ga0451854_20469 3300041510 Bacteria 535
1647 Ga0451855_1639300 3300041511 Bacteria 512
1648 Ga0451855_1762118 3300041511 Bacteria 845
1649 Ga0451853_0172883 3300041512 Bacteria 595
1650 Ga0451853_1568238 3300041512 Bacteria 1325
1651 Ga0451853_2494744 3300041512 Bacteria 806
1652 Ga0451853_4070058 3300041512 Bacteria 1381
1653 Ga0439431_0002191 3300041997 Bacteria 4307
1654 Ga0439431_0125595 3300041997 Bacteria 718
1655 Ga0439431_0177244 3300041997 Bacteria 614
1656 Ga0439431_0251363 3300041997 Bacteria 524
1657 Ga0439433_0000255 3300041999 Bacteria 8970
1658 Ga0439433_0002915 3300041999 Bacteria 3663
1659 Ga0439433_0065507 3300041999 Bacteria 871
1660 Ga0439437_001351 3300042000 Bacteria 2581
1661 Ga0439441_000152 3300042001 Bacteria 5981
1662 Ga0439441_004072 3300042001 Bacteria 2194
1663 Ga0439441_047045 3300042001 Bacteria 879
1664 Ga0439441_082830 3300042001 Bacteria 701
1665 Ga0439442_013403 3300042002 Bacteria 1681
1666 Ga0439442_020364 3300042002 Bacteria 1374
1667 Ga0439442_027840 3300042002 Bacteria 1178
1668 Ga0439443_000105 3300042003 Bacteria 5243
1669 Ga0439443_015521 3300042003 Bacteria 1157
1670 Ga0439443_024891 3300042003 Bacteria 962
1671 Ga0439445_0005378 3300042004 Bacteria 2917
1672 Ga0439445_0044729 3300042004 Bacteria 1183
1673 Ga0439448_0092707 3300042005 Bacteria 1021
1674 Ga0439448_0200999 3300042005 Bacteria 699
1675 Ga0439448_0225862 3300042005 Bacteria 659
1676 Ga0439432_001484 3300042006 Bacteria 8802
1677 Ga0439432_148348 3300042006 Bacteria 688
1678 Ga0439449_0002613 3300042007 Bacteria 7017
1679 Ga0439449_0013168 3300042007 Bacteria 3111
1680 Ga0439449_0050038 3300042007 Bacteria 1546
1681 Ga0439450_003710 3300042008 Bacteria 2551
1682 Ga0439450_042005 3300042008 Bacteria 1064
1683 Ga0439451_046775 3300042009 Bacteria 866
1684 Ga0439452_003623 3300042010 Bacteria 5374
1685 Ga0439452_032621 3300042010 Bacteria 1271
1686 Ga0439452_128748 3300042010 Bacteria 537
1687 Ga0439454_053826 3300042011 Bacteria 685
1688 Ga0439455_0004910 3300042012 Bacteria 2683
1689 Ga0439455_0051017 3300042012 Bacteria 1081
1690 Ga0439455_0195020 3300042012 Bacteria 585
1691 Ga0439457_008883 3300042014 Bacteria 2354
1692 Ga0439462_0007562 3300042015 Bacteria 2722
1693 Ga0439463_170397 3300042016 Bacteria 565
1694 Ga0439463_192461 3300042016 Bacteria 529
1695 Ga0450911_024388 3300042115 Bacteria 786
1696 Ga0450912_003334 3300042116 Bacteria 1138
1697 Ga0450912_036266 3300042116 Bacteria 525
1698 Ga0450913_002200 3300042117 Bacteria 1174
1699 Ga0450914_001729 3300042118 Bacteria 1437
1700 Ga0450915_000125 3300042119 Bacteria 1928
1701 Ga0450915_011765 3300042119 Bacteria 625
1702 Ga0450917_000001 3300042120 Bacteria 12228
1703 Ga0450917_004112 3300042120 Bacteria 1059
1704 Ga0450919_045514 3300042121 Bacteria 512
1705 Ga0450920_005861 3300042122 Bacteria 2195
1706 Ga0450920_038422 3300042122 Bacteria 952
1707 Ga0450921_012190 3300042123 Bacteria 742
1708 Ga0450922_004876 3300042124 Bacteria 1238
1709 Ga0450922_007146 3300042124 Bacteria 1044
1710 Ga0450923_009190 3300042125 Bacteria 1723
1711 Ga0450923_029699 3300042125 Bacteria 1109
1712 Ga0450923_119583 3300042125 Bacteria 620
1713 Ga0450888_000155 3300042126 Bacteria 5904
1714 Ga0450890_003431 3300042127 Bacteria 2103
1715 Ga0450890_004058 3300042127 Bacteria 1922
1716 Ga0450890_065840 3300042127 Bacteria 573
1717 Ga0450897_043455 3300042128 Bacteria 532
1718 Ga0450891_000655 3300042129 Bacteria 3612
1719 Ga0450892_001248 3300042130 Bacteria 2585
1720 Ga0450894_033389 3300042131 Bacteria 724
1721 Ga0450895_032903 3300042132 Bacteria 511
1722 Ga0450896_043484 3300042133 Bacteria 704
1723 Ga0450896_045205 3300042133 Bacteria 692
1724 Ga0450898_012656 3300042134 Bacteria 1397
1725 Ga0450898_076991 3300042134 Bacteria 675
1726 Ga0450898_135599 3300042134 Bacteria 532
1727 Ga0450899_009309 3300042135 Bacteria 1082
1728 Ga0450899_039060 3300042135 Bacteria 591
1729 Ga0450900_001889 3300042136 Bacteria 2137
1730 Ga0450900_038916 3300042136 Bacteria 707
1731 Ga0450902_029292 3300042137 Bacteria 924
1732 Ga0450902_039131 3300042137 Bacteria 805
1733 Ga0450903_009902 3300042138 Bacteria 1549
1734 Ga0450904_007953 3300042139 Bacteria 1047
1735 Ga0450904_009530 3300042139 Bacteria 957
1736 Ga0450905_028497 3300042142 Bacteria 852
1737 Ga0450905_036462 3300042142 Bacteria 771
1738 Ga0450905_101678 3300042142 Bacteria 516
1739 Ga0450889_000161 3300042144 Bacteria 6993
1740 Ga0450889_012411 3300042144 Bacteria 893
1741 Ga0450906_011839 3300042145 Bacteria 1624
1742 Ga0450906_060039 3300042145 Bacteria 676
1743 Ga0450907_071118 3300042146 Bacteria 603
1744 Ga0450910_002285 3300042147 Bacteria 2509
1745 Ga0450910_002869 3300042147 Bacteria 2271
1746 Ga0450910_013115 3300042147 Bacteria 1204
1747 Ga0450910_089493 3300042147 Bacteria 544
1748 Ga0439446_0001588 3300042156 Bacteria 5227
1749 Ga0439446_0130157 3300042156 Bacteria 815
1750 Ga0439446_0250787 3300042156 Bacteria 610
1751 Ga0439446_0357333 3300042156 Bacteria 521
1752 Ga0439446_0366148 3300042156 Bacteria 516
1753 Ga0439458_0038859 3300042157 Bacteria 1150
1754 Ga0450908_010556 3300042184 Bacteria 1703
1755 Ga0450909_009901 3300042185 Bacteria 1392
1756 Ga0439434_0000888 3300042435 Bacteria 8613
1757 Ga0439434_0006911 3300042435 Bacteria 3316
1758 Ga0439434_0015416 3300042435 Bacteria 2280
1759 Ga0439434_0153075 3300042435 Bacteria 764
1760 Ga0439434_0197385 3300042435 Bacteria 678
1761 Ga0439435_0000151 3300042436 Bacteria 9438
1762 Ga0439435_0000450 3300042436 Bacteria 6472
1763 Ga0439435_0017909 3300042436 Bacteria 1796
1764 Ga0439435_0185457 3300042436 Bacteria 681
1765 Ga0439444_0000187 3300042437 Bacteria 5744
1766 Ga0439444_0123483 3300042437 Bacteria 606
1767 Ga0439444_0127206 3300042437 Bacteria 599
1768 Ga0439459_0022825 3300042438 Bacteria 1214
1769 Ga0439459_0059935 3300042438 Bacteria 858
1770 Ga0439459_0114950 3300042438 Bacteria 672
1771 Ga0439464_0007633 3300042439 Bacteria 2829
1772 Ga0439464_0098794 3300042439 Bacteria 885
1773 Ga0439460_0002368 3300042461 Bacteria 4535
1774 Ga0439460_0002790 3300042461 Bacteria 4204
1775 Ga0439460_0016114 3300042461 Bacteria 1987
1776 Ga0439460_0020551 3300042461 Bacteria 1795
1777 Ga0450916_013181 3300042530 Bacteria 1063
1778 Ga0450916_016454 3300042530 Bacteria 980
1779 Ga0450918_000550 3300042531 Bacteria 8018
1780 Ga0450918_132676 3300042531 Bacteria 504
1781 Ga0450893_0000283 3300042532 Bacteria 6918
1782 Ga0450893_0024570 3300042532 Bacteria 1052
1783 Ga0450893_0040669 3300042532 Bacteria 851
1784 Ga0450901_036481 3300042533 Bacteria 549
1785 Ga0451577_0001340 3300042876 Bacteria 33403
1786 Ga0451577_0016336 3300042876 Bacteria 6877
1787 Ga0451577_0376588 3300042876 Bacteria 1288
1788 Ga0451577_0397740 3300042876 Bacteria 1250
1789 Ga0451577_0873900 3300042876 Bacteria 810
1790 Ga0451577_1704663 3300042876 Bacteria 554
1791 Ga0439440_0001395 3300042993 Bacteria 4388
1792 Ga0466969_0495359 3300044656 Bacteria 557
1793 Ga0453683_0030645 3300044673 Bacteria 3400
1794 Ga0453683_0736736 3300044673 Bacteria 647
1795 Ga0453683_0743117 3300044673 Bacteria 644
1796 Ga0453683_0902762 3300044673 Bacteria 584
1797 Ga0466965_0113116 3300044683 Bacteria 1396
1798 Ga0466965_0450366 3300044683 Bacteria 717
1799 Ga0466965_0677095 3300044683 Bacteria 590
1800 Ga0466965_0749720 3300044683 Bacteria 563
1801 Ga0466966_0151478 3300044684 Bacteria 1414
1802 Ga0466963_0764695 3300044694 Bacteria 681
1803 Ga0466964_0116873 3300044706 Bacteria 1197
1804 Ga0453684_0002255 3300044712 Bacteria 47769
1805 Ga0453684_0017342 3300044712 Bacteria 11158
1806 Ga0453684_0040166 3300044712 Bacteria 6361
1807 Ga0453684_0050212 3300044712 Bacteria 5490
1808 Ga0453684_0302399 3300044712 Bacteria 1818
1809 Ga0453684_1691731 3300044712 Bacteria 647
1810 Ga0453684_2299735 3300044712 Bacteria 536
1811 Ga0466968_0158872 3300044735 Bacteria 1042
1812 Ga0466957_0004472 3300044842 Bacteria 7796
1813 Ga0466957_0656389 3300044842 Bacteria 738
1814 Ga0466960_0142993 3300044901 Bacteria 1272
1815 Ga0466960_0589374 3300044901 Bacteria 659
1816 Ga0466959_0160421 3300045049 Bacteria 1581
1817 Ga0451576_0018146 3300045051 Bacteria 7719
1818 Ga0451576_0031258 3300045051 Bacteria 5679
1819 Ga0451576_0179381 3300045051 Bacteria 2211
1820 Ga0451576_0194615 3300045051 Bacteria 2118
1821 Ga0451576_0515031 3300045051 Bacteria 1257
1822 Ga0451576_0882059 3300045051 Bacteria 939
1823 Ga0451576_0885161 3300045051 Bacteria 937
1824 Ga0451576_0923863 3300045051 Bacteria 915
1825 Ga0451576_1083525 3300045051 Bacteria 839
1826 Ga0451576_1158584 3300045051 Bacteria 808
1827 Ga0451576_2413382 3300045051 Bacteria 538
1828 Ga0466958_0019624 3300045836 Bacteria 3935
1829 Ga0466958_0922738 3300045836 Bacteria 570
1830 Ga0466967_0004582 3300045976 Bacteria 9368
1831 Ga0466967_0119707 3300045976 Bacteria 2431
1832 Ga0466967_1562794 3300045976 Bacteria 657
1833 Ga0466967_2527583 3300045976 Bacteria 508
1834 Ga0495627_011372 3300046453 Bacteria 3196
1835 Ga0495592_0002591 3300046454 Bacteria 12773
1836 Ga0495592_0431085 3300046454 Bacteria 830
1837 Ga0495603_0156829 3300046455 Bacteria 1321
1838 Ga0495603_0319980 3300046455 Bacteria 891
1839 Ga0495603_0571582 3300046455 Bacteria 647
1840 Ga0495603_0679674 3300046455 Bacteria 589
1841 Ga0495590_0121607 3300046457 Bacteria 936
1842 Ga0495591_153809 3300046458 Bacteria 552
1843 Ga0495629_0555901 3300046459 Bacteria 770
1844 Ga0495638_0089863 3300046460 Bacteria 1852
1845 Ga0495638_0134393 3300046460 Bacteria 1450
1846 Ga0495651_0828662 3300046462 Bacteria 569
1847 Ga0495653_0040102 3300046463 Bacteria 3662
1848 Ga0495653_0046670 3300046463 Bacteria 3354
1849 Ga0495653_0233793 3300046463 Bacteria 1229
1850 Ga0495580_0002023 3300046472 Bacteria 17847
1851 Ga0495582_0345531 3300046473 Bacteria 857
1852 Ga0495582_0709286 3300046473 Bacteria 582
1853 Ga0495605_0204714 3300046474 Bacteria 859
1854 Ga0495605_0225301 3300046474 Bacteria 809
1855 Ga0495639_0019706 3300046475 Bacteria 2943
1856 Ga0495639_0076571 3300046475 Bacteria 1552
1857 Ga0495664_0558176 3300046477 Bacteria 682
1858 Ga0495584_0064668 3300046491 Bacteria 1839
1859 Ga0495584_0275074 3300046491 Bacteria 856
1860 Ga0495585_0099260 3300046492 Bacteria 1559
1861 Ga0495596_0025431 3300046500 Bacteria 2393
1862 Ga0495596_0399102 3300046500 Bacteria 536
1863 Ga0495607_0048033 3300046501 Bacteria 2497
1864 Ga0495583_0000510 3300046506 Bacteria 55787
1865 Ga0495583_0032023 3300046506 Bacteria 2542
1866 Ga0495608_0023140 3300046511 Bacteria 4260
1867 Ga0495608_0207182 3300046511 Bacteria 1234
1868 Ga0495608_0500806 3300046511 Bacteria 736
1869 Ga0495610_0006839 3300046512 Bacteria 7732
1870 Ga0495616_0013153 3300046513 Bacteria 4677
1871 Ga0495616_0165692 3300046513 Bacteria 991
1872 Ga0495618_0405347 3300046514 Bacteria 833
1873 Ga0495620_0025718 3300046515 Bacteria 2780
1874 Ga0495620_0131573 3300046515 Bacteria 982
1875 Ga0495628_0294638 3300046516 Bacteria 1202
1876 Ga0495628_1030200 3300046516 Bacteria 565
1877 Ga0495630_0180697 3300046517 Bacteria 1609
1878 Ga0495630_0489604 3300046517 Bacteria 943
1879 Ga0495630_0831643 3300046517 Bacteria 704
1880 Ga0495631_0000456 3300046518 Bacteria 27772
1881 Ga0495631_0081452 3300046518 Bacteria 1396
1882 Ga0495632_0381640 3300046519 Bacteria 617
1883 Ga0495632_0392465 3300046519 Bacteria 607
1884 Ga0495637_0001023 3300046520 Bacteria 17604
1885 Ga0495643_0118456 3300046522 Bacteria 1340
1886 Ga0495644_0098268 3300046523 Bacteria 1107
1887 Ga0495644_0183484 3300046523 Bacteria 805
1888 Ga0495663_0003486 3300046525 Bacteria 4532
1889 Ga0495663_0032130 3300046525 Bacteria 1562
1890 Ga0495663_0049439 3300046525 Bacteria 1299
1891 Ga0495663_0132327 3300046525 Bacteria 842
1892 Ga0495642_0050101 3300046528 Bacteria 1716
1893 Ga0495642_0069793 3300046528 Bacteria 1468
1894 Ga0495642_0111575 3300046528 Bacteria 1169
1895 Ga0495652_0016132 3300046529 Bacteria 6682
1896 Ga0495652_0224633 3300046529 Bacteria 1409
1897 Ga0495654_0061232 3300046530 Bacteria 1808
1898 Ga0495654_0151793 3300046530 Bacteria 1024
1899 Ga0495640_0418822 3300046533 Bacteria 821
1900 Ga0495640_0854966 3300046533 Bacteria 540
1901 Ga0495586_0210692 3300046535 Bacteria 1103
1902 Ga0495587_0006957 3300046536 Bacteria 7346
1903 Ga0495587_0159793 3300046536 Bacteria 1283
1904 Ga0495598_0009757 3300046537 Bacteria 2280
1905 Ga0495598_0021669 3300046537 Bacteria 1712
1906 Ga0495598_0126136 3300046537 Bacteria 873
1907 Ga0495598_0128955 3300046537 Bacteria 865
1908 Ga0495598_0247784 3300046537 Bacteria 659
1909 Ga0495598_0448057 3300046537 Bacteria 511
1910 Ga0495609_0065953 3300046538 Bacteria 1595
1911 Ga0495609_0119522 3300046538 Bacteria 1134
1912 Ga0495621_0015191 3300046539 Bacteria 2451
1913 Ga0495621_0042108 3300046539 Bacteria 1606
1914 Ga0495621_0089786 3300046539 Bacteria 1157
1915 Ga0495621_0472234 3300046539 Bacteria 539
1916 Ga0495621_0517594 3300046539 Bacteria 516
1917 Ga0495597_0356769 3300046542 Bacteria 560
1918 Ga0495645_0020802 3300046543 Bacteria 4740
1919 Ga0495645_0672548 3300046543 Bacteria 631
1920 Ga0495622_0124830 3300046557 Bacteria 1174
1921 Ga0495622_0142635 3300046557 Bacteria 1087
1922 Ga0495622_0372839 3300046557 Bacteria 616
1923 Ga0495633_0072659 3300046558 Bacteria 1604
1924 Ga0495633_0140210 3300046558 Bacteria 1118
1925 Ga0495667_0020109 3300046559 Bacteria 4502
1926 Ga0495667_0349366 3300046559 Bacteria 934
1927 Ga0495656_0018788 3300046615 Bacteria 2660
1928 Ga0495656_0145910 3300046615 Bacteria 1139
1929 Ga0495656_0241536 3300046615 Bacteria 910
1930 Ga0495656_0377610 3300046615 Bacteria 738
1931 Ga0495656_0383828 3300046615 Bacteria 732
1932 Ga0495668_0051941 3300046616 Bacteria 2269
1933 Ga0495668_0073920 3300046616 Bacteria 1872
1934 Ga0495634_0217770 3300046642 Bacteria 1180
1935 Ga0495634_0627490 3300046642 Bacteria 622
1936 Ga0495634_0664206 3300046642 Bacteria 601
1937 Ga0495634_0764301 3300046642 Bacteria 553
1938 Ga0495611_0042850 3300046648 Bacteria 2022
1939 Ga0495611_0497706 3300046648 Bacteria 554
1940 Ga0495625_0054960 3300046660 Bacteria 2841
1941 Ga0495635_0082296 3300046663 Bacteria 2203
1942 Ga0495635_0149128 3300046663 Bacteria 1592
1943 Ga0495635_0510182 3300046663 Bacteria 791
1944 Ga0495659_0070333 3300046664 Bacteria 1310
1945 Ga0495659_0084897 3300046664 Bacteria 1207
1946 Ga0495659_0373677 3300046664 Bacteria 612
1947 Ga0495661_0028969 3300046665 Bacteria 3538
1948 Ga0495661_0031733 3300046665 Bacteria 3347
1949 Ga0495588_0071551 3300046674 Bacteria 1803
1950 Ga0495588_0170051 3300046674 Bacteria 1152
1951 Ga0495657_0076887 3300046675 Bacteria 2167
1952 Ga0495657_0256580 3300046675 Bacteria 1051
1953 Ga0495657_0489003 3300046675 Bacteria 718
1954 Ga0495599_0009248 3300046678 Bacteria 6015
1955 Ga0495623_0006008 3300046679 Bacteria 7899
1956 Ga0495646_0071331 3300046680 Bacteria 2044
1957 Ga0495647_0158405 3300046681 Bacteria 974
1958 Ga0495658_0005887 3300046683 Bacteria 6016
1959 Ga0495658_0154697 3300046683 Bacteria 1411
1960 Ga0495658_0157238 3300046683 Bacteria 1400
1961 Ga0495658_1036411 3300046683 Bacteria 523
1962 Ga0495669_0005007 3300046684 Bacteria 5509
1963 Ga0495669_0190130 3300046684 Bacteria 980
1964 Ga0495669_0304048 3300046684 Bacteria 769
1965 Ga0495669_0610377 3300046684 Bacteria 531
1966 Ga0495624_0208455 3300046690 Bacteria 1186
1967 Ga0495624_0846490 3300046690 Bacteria 540
1968 Ga0495624_0900497 3300046690 Bacteria 521
1969 Ga0495670_0040622 3300046691 Bacteria 2320
1970 Ga0495670_0193245 3300046691 Bacteria 1076
1971 Ga0495670_0258159 3300046691 Bacteria 930
1972 Ga0495671_0010918 3300046692 Bacteria 5018
1973 Ga0495671_0164555 3300046692 Bacteria 1079
1974 Ga0495671_0446039 3300046692 Bacteria 619
1975 Ga0495671_0517842 3300046692 Bacteria 569
1976 Ga0495649_0000961 3300046694 Bacteria 22764
1977 Ga0495649_0017328 3300046694 Bacteria 4066
1978 Ga0495589_0004694 3300046794 Bacteria 7256
1979 Ga0495589_0119262 3300046794 Bacteria 1271
1980 Ga0495589_0402924 3300046794 Bacteria 628
1981 Ga0495600_0063519 3300046809 Bacteria 2413
1982 Ga0495600_0284804 3300046809 Bacteria 1045
1983 Ga0495600_0654504 3300046809 Bacteria 635
1984 Ga0495660_0049677 3300046810 Bacteria 2288
1985 Ga0495660_0311485 3300046810 Bacteria 710
1986 Ga0495581_0831116 3300047315 Bacteria 529
1987 Ga0495604_0273991 3300047317 Bacteria 1142
1988 Ga0495604_0281279 3300047317 Bacteria 1124
1989 Ga0495604_0536407 3300047317 Bacteria 756
1990 Ga0495604_0615397 3300047317 Bacteria 695
1991 Ga0495636_0019553 3300047318 Bacteria 2724
1992 Ga0495636_0022968 3300047318 Bacteria 2523
1993 Ga0495636_0125797 3300047318 Bacteria 1137
1994 Ga0495636_0196122 3300047318 Bacteria 921
1995 Ga0495636_0244271 3300047318 Bacteria 829
1996 Ga0495672_0501133 3300047320 Bacteria 540
1997 Ga0495676_0006299 3300047321 Bacteria 10919
1998 Ga0495680_0056613 3300047322 Bacteria 3035
1999 Ga0495680_0136376 3300047322 Bacteria 1799
2000 Ga0495680_0809622 3300047322 Bacteria 611
2001 Ga0495675_0199142 3300047444 Bacteria 1220
2002 Ga0495675_0334372 3300047444 Bacteria 894
2003 Ga0495677_0104061 3300047445 Bacteria 1076
2004 Ga0495677_0309710 3300047445 Bacteria 621
2005 Ga0495685_203691 3300047447 Bacteria 634
2006 Ga0495685_217113 3300047447 Bacteria 611
2007 Ga0495681_0020260 3300047470 Bacteria 3612
2008 Ga0495681_0087097 3300047470 Bacteria 1385
2009 Ga0495684_0097665 3300047471 Bacteria 2222
2010 Ga0495684_0107824 3300047471 Bacteria 2104
2011 Ga0495684_0109620 3300047471 Bacteria 2085
2012 Ga0495686_0108812 3300047472 Bacteria 1664
2013 Ga0495686_0696001 3300047472 Bacteria 519
2014 Ga0495593_0003632 3300047673 Bacteria 9213
2015 Ga0495593_0233207 3300047673 Bacteria 923
2016 Ga0495602_0149764 3300048088 Bacteria 1836
2017 Ga0495602_0816339 3300048088 Bacteria 625
2018 Ga0495614_0008776 3300048089 Bacteria 4489
2019 Ga0495615_0027964 3300048090 Bacteria 1328
2020 Ga0495615_0054768 3300048090 Bacteria 1036
2021 Ga0495615_0060106 3300048090 Bacteria 1001
2022 Ga0495615_0163551 3300048090 Bacteria 670
2023 Ga0495615_0253264 3300048090 Bacteria 559
2024 Ga0495626_0343219 3300048091 Bacteria 584
2025 Ga0496100_0027093 3300048903 Bacteria 3520
2026 Ga0496101_0007848 3300048904 Bacteria 6942
2027 Ga0496101_0028824 3300048904 Bacteria 3879
2028 Ga0496101_0100394 3300048904 Bacteria 2165
2029 Ga0496102_0007579 3300048905 Bacteria 9273
2030 Ga0496103_0118117 3300048906 Bacteria 1688
2031 Ga0496104_0008378 3300048907 Bacteria 9189
2032 Ga0496104_0081990 3300048907 Bacteria 3076
2033 Ga0496104_0168941 3300048907 Bacteria 2097
2034 Ga0496105_0009457 3300048908 Bacteria 7626
2035 Ga0496105_0061638 3300048908 Bacteria 3095
2036 Ga0496105_0545719 3300048908 Bacteria 905
2037 Ga0496106_0019165 3300048909 Bacteria 5073
2038 Ga0496106_0745513 3300048909 Bacteria 779
2039 Ga0496106_1324859 3300048909 Bacteria 558
2040 Ga0496107_0175168 3300048910 Bacteria 1592
2041 Ga0496107_0433633 3300048910 Bacteria 977
2042 Ga0496107_1275245 3300048910 Bacteria 526
2043 Ga0496108_0085225 3300048911 Bacteria 2682
2044 Ga0496108_0300557 3300048911 Bacteria 1398
2045 Ga0496108_0767644 3300048911 Bacteria 833
2046 Ga0496108_1147680 3300048911 Bacteria 659
2047 Ga0496109_0029780 3300048912 Bacteria 4891
2048 Ga0496109_0033215 3300048912 Bacteria 4642
2049 Ga0496109_0061852 3300048912 Bacteria 3424
2050 Ga0496109_0184417 3300048912 Bacteria 1961
2051 Ga0496109_0789501 3300048912 Bacteria 888
2052 Ga0496109_0945569 3300048912 Bacteria 800
2053 Ga0496109_1894963 3300048912 Bacteria 529
2054 Ga0496110_0121293 3300048913 Bacteria 2355
2055 Ga0496110_0400325 3300048913 Bacteria 1251
2056 Ga0496110_0679555 3300048913 Bacteria 930
2057 Ga0496110_0914324 3300048913 Bacteria 784
2058 Ga0496111_0004330 3300048914 Bacteria 8955
2059 Ga0496111_0159024 3300048914 Bacteria 1677
2060 Ga0496111_1215265 3300048914 Bacteria 534
2061 Ga0496111_1215531 3300048914 Bacteria 534
2062 Ga0496112_0144099 3300048915 Bacteria 2351
2063 Ga0496112_1066555 3300048915 Bacteria 727
2064 Ga0496113_0078179 3300048916 Bacteria 2531
2065 Ga0496113_1599523 3300048916 Bacteria 501
2066 Ga0496114_0109050 3300048917 Bacteria 2370
2067 Ga0496114_0934371 3300048917 Bacteria 749
2068 Ga0496114_1188405 3300048917 Bacteria 649
2069 Ga0496115_0025679 3300048918 Bacteria 4590
2070 Ga0496115_0069392 3300048918 Bacteria 2855
2071 Ga0496115_0813320 3300048918 Bacteria 726
2072 Ga0496118_0175469 3300048921 Bacteria 1302
2073 Ga0496118_0177124 3300048921 Bacteria 1294
2074 Ga0496121_0057197 3300048924 Bacteria 3234
2075 Ga0496121_0059866 3300048924 Bacteria 3137
2076 Ga0496122_0000317 3300048925 Bacteria 105883
2077 Ga0496122_0144833 3300048925 Bacteria 1478
2078 Ga0496122_0265638 3300048925 Bacteria 949
2079 Ga0496123_0000264 3300048926 Bacteria 105015
2080 Ga0496123_0280093 3300048926 Bacteria 806
2081 Ga0496124_0001830 3300048927 Bacteria 29398
2082 Ga0496124_0018476 3300048927 Bacteria 6527
2083 Ga0496124_0385587 3300048927 Bacteria 978
2084 Ga0496125_0013937 3300048928 Bacteria 7862
2085 Ga0496125_0142135 3300048928 Bacteria 1667
2086 Ga0496126_0064442 3300048929 Bacteria 3283
2087 Ga0501306_000065 3300049127 Bacteria 5503
2088 Ga0501306_000344 3300049127 Bacteria 3372
2089 Ga0501306_010759 3300049127 Bacteria 1156
2090 Ga0501306_035075 3300049127 Bacteria 760
2091 Ga0501306_045711 3300049127 Bacteria 690
2092 Ga0501306_061479 3300049127 Bacteria 619
2093 Ga0501308_000024 3300049128 Bacteria 6782
2094 Ga0501309_000014 3300049129 Bacteria 8867
2095 Ga0501309_005473 3300049129 Bacteria 1514
2096 Ga0501309_016010 3300049129 Bacteria 1019
2097 Ga0501309_053940 3300049129 Bacteria 636
2098 Ga0501309_082019 3300049129 Bacteria 542
2099 Ga0501310_000059 3300049130 Bacteria 10166
2100 Ga0501310_000843 3300049130 Bacteria 2733
2101 Ga0501310_004173 3300049130 Bacteria 1441
2102 Ga0501310_010340 3300049130 Bacteria 1040
2103 Ga0501310_012592 3300049130 Bacteria 972
2104 Ga0501310_020385 3300049130 Bacteria 822
2105 Ga0501310_025346 3300049130 Bacteria 763
2106 Ga0501310_077457 3300049130 Bacteria 517
2107 Ga0501341_01338 3300049131 Bacteria 1215
2108 Ga0501341_03585 3300049131 Bacteria 882
2109 Ga0501343_017449 3300049132 Bacteria 620
2110 Ga0501344_02207 3300049133 Bacteria 995
2111 Ga0501304_000014 3300049160 Bacteria 8417
2112 Ga0501304_005307 3300049160 Bacteria 1006
2113 Ga0501305_000004 3300049161 Bacteria 13267
2114 Ga0501305_006260 3300049161 Bacteria 1472
2115 Ga0501305_011644 3300049161 Bacteria 1191
2116 Ga0501305_025965 3300049161 Bacteria 891
2117 Ga0501305_030417 3300049161 Bacteria 839
2118 Ga0501305_032285 3300049161 Bacteria 821
2119 Ga0501305_058491 3300049161 Bacteria 659
2120 Ga0501305_077712 3300049161 Bacteria 592
2121 Ga0501307_000035 3300049162 Bacteria 5016
2122 Ga0501307_021704 3300049162 Bacteria 840
2123 Ga0501307_051652 3300049162 Bacteria 620
2124 Ga0501307_069140 3300049162 Bacteria 560
2125 Ga0501307_078072 3300049162 Bacteria 537
2126 Ga0501290_030526 3300049513 Bacteria 771
2127 Ga0501290_032393 3300049513 Bacteria 754
2128 Ga0501290_076177 3300049513 Bacteria 565
2129 Ga0501291_002523 3300049514 Bacteria 2200
2130 Ga0501291_004079 3300049514 Bacteria 1848
2131 Ga0501291_089829 3300049514 Bacteria 625
2132 Ga0501292_059248 3300049515 Bacteria 692
2133 Ga0501292_119718 3300049515 Bacteria 536
2134 Ga0501293_012170 3300049516 Bacteria 761
2135 Ga0501294_006275 3300049517 Bacteria 1136
2136 Ga0501295_059225 3300049518 Bacteria 835
2137 Ga0501295_113620 3300049518 Bacteria 645
2138 Ga0501295_182030 3300049518 Bacteria 527
2139 Ga0501296_003536 3300049519 Bacteria 1669
2140 Ga0501297_004866 3300049520 Bacteria 1389
2141 Ga0501298_022143 3300049521 Bacteria 1195
2142 Ga0501298_023940 3300049521 Bacteria 1160
2143 Ga0501298_032703 3300049521 Bacteria 1027
2144 Ga0501298_049969 3300049521 Bacteria 866
2145 Ga0501298_078916 3300049521 Bacteria 721
2146 Ga0501298_103997 3300049521 Bacteria 651
2147 Ga0501298_108353 3300049521 Bacteria 641
2148 Ga0501298_115749 3300049521 Bacteria 626
2149 Ga0501299_001676 3300049522 Bacteria 2922
2150 Ga0501299_054034 3300049522 Bacteria 836
2151 Ga0501300_000354 3300049523 Bacteria 6950
2152 Ga0501300_052618 3300049523 Bacteria 631
2153 Ga0501300_073203 3300049523 Bacteria 557
2154 Ga0501300_074091 3300049523 Bacteria 554
2155 Ga0501301_004205 3300049524 Bacteria 1014
2156 Ga0501303_008735 3300049526 Bacteria 924
2157 Ga0501303_016431 3300049526 Bacteria 750
2158 Ga0501311_000245 3300049527 Bacteria 3322
2159 Ga0501311_063586 3300049527 Bacteria 601
2160 Ga0501311_090636 3300049527 Bacteria 531
2161 Ga0501311_095971 3300049527 Bacteria 520
2162 Ga0501312_000016 3300049528 Bacteria 9244
2163 Ga0501312_019873 3300049528 Bacteria 990
2164 Ga0501312_021089 3300049528 Bacteria 968
2165 Ga0501312_050631 3300049528 Bacteria 700
2166 Ga0501312_095696 3300049528 Bacteria 552
2167 Ga0501313_000738 3300049529 Bacteria 2447
2168 Ga0501313_022356 3300049529 Bacteria 788
2169 Ga0501314_000017 3300049530 Bacteria 8558
2170 Ga0501314_000466 3300049530 Bacteria 2518
2171 Ga0501314_008758 3300049530 Bacteria 920
2172 Ga0501314_015344 3300049530 Bacteria 757
2173 Ga0501314_035658 3300049530 Bacteria 566
2174 Ga0501315_000518 3300049531 Bacteria 2723
2175 Ga0501315_022980 3300049531 Bacteria 853
2176 Ga0501315_028681 3300049531 Bacteria 791
2177 Ga0501315_030611 3300049531 Bacteria 774
2178 Ga0501315_041738 3300049531 Bacteria 696
2179 Ga0501315_045279 3300049531 Bacteria 677
2180 Ga0501315_104445 3300049531 Bacteria 503
2181 Ga0501316_000284 3300049532 Bacteria 3215
2182 Ga0501316_002193 3300049532 Bacteria 1783
2183 Ga0501316_013435 3300049532 Bacteria 968
2184 Ga0501316_019513 3300049532 Bacteria 845
2185 Ga0501317_000411 3300049533 Bacteria 2940
2186 Ga0501317_013033 3300049533 Bacteria 1034
2187 Ga0501317_014492 3300049533 Bacteria 1000
2188 Ga0501317_045653 3300049533 Bacteria 682
2189 Ga0501317_048941 3300049533 Bacteria 666
2190 Ga0501317_066544 3300049533 Bacteria 601
2191 Ga0501317_079695 3300049533 Bacteria 565
2192 Ga0501317_085243 3300049533 Bacteria 552
2193 Ga0501318_000081 3300049534 Bacteria 4058
2194 Ga0501318_000274 3300049534 Bacteria 2975
2195 Ga0501318_009035 3300049534 Bacteria 1078
2196 Ga0501318_026184 3300049534 Bacteria 768
2197 Ga0501318_029938 3300049534 Bacteria 736
2198 Ga0501318_035258 3300049534 Bacteria 697
2199 Ga0501318_036088 3300049534 Bacteria 691
2200 Ga0501318_059874 3300049534 Bacteria 582
2201 Ga0501319_002629 3300049535 Bacteria 1151
2202 Ga0501319_032051 3300049535 Bacteria 509
2203 Ga0501320_000232 3300049536 Bacteria 2918
2204 Ga0501320_002008 3300049536 Bacteria 1580
2205 Ga0501320_016177 3300049536 Bacteria 822
2206 Ga0501320_060991 3300049536 Bacteria 530
2207 Ga0501321_001908 3300049537 Bacteria 1737
2208 Ga0501321_016273 3300049537 Bacteria 884
2209 Ga0501321_033817 3300049537 Bacteria 694
2210 Ga0501321_057224 3300049537 Bacteria 582
2211 Ga0501321_081143 3300049537 Bacteria 517
2212 Ga0501322_000238 3300049538 Bacteria 2389
2213 Ga0501323_000147 3300049539 Bacteria 4162
2214 Ga0501323_017097 3300049539 Bacteria 929
2215 Ga0501323_020130 3300049539 Bacteria 874
2216 Ga0501323_023138 3300049539 Bacteria 832
2217 Ga0501323_025424 3300049539 Bacteria 806
2218 Ga0501323_060295 3300049539 Bacteria 591
2219 Ga0501324_002476 3300049540 Bacteria 1339
2220 Ga0501324_002605 3300049540 Bacteria 1319
2221 Ga0501324_009867 3300049540 Bacteria 862
2222 Ga0501324_012248 3300049540 Bacteria 801
2223 Ga0501325_000417 3300049541 Bacteria 1991
2224 Ga0501325_004818 3300049541 Bacteria 1050
2225 Ga0501325_009085 3300049541 Bacteria 876
2226 Ga0501325_040662 3300049541 Bacteria 565
2227 Ga0501325_056453 3300049541 Bacteria 510
2228 Ga0501326_11671 3300049542 Bacteria 536
2229 Ga0501328_00193 3300049544 Bacteria 1768
2230 Ga0501331_02849 3300049547 Bacteria 911
2231 Ga0501332_04973 3300049548 Bacteria 805
2232 Ga0501332_13741 3300049548 Bacteria 566
2233 Ga0501333_005747 3300049549 Bacteria 811
2234 Ga0501334_09783 3300049550 Bacteria 686
2235 Ga0501334_09792 3300049550 Bacteria 686
2236 Ga0501335_003108 3300049551 Bacteria 1390
2237 Ga0501335_033625 3300049551 Bacteria 587
2238 Ga0501335_036454 3300049551 Bacteria 570
2239 Ga0501335_045084 3300049551 Bacteria 527
2240 Ga0501336_004018 3300049552 Bacteria 1018
2241 Ga0501336_022061 3300049552 Bacteria 585
2242 Ga0501340_011592 3300049556 Bacteria 659
2243 Ga0501340_021732 3300049556 Bacteria 542
2244 Ga0501031_0000096 3300049568 Bacteria 47006
2245 Ga0501031_0004257 3300049568 Bacteria 9243
2246 Ga0501031_0054391 3300049568 Bacteria 2608
2247 Ga0501031_0236056 3300049568 Bacteria 1189
2248 Ga0501031_0279182 3300049568 Bacteria 1084
2249 Ga0501031_0384592 3300049568 Bacteria 908
2250 Ga0501031_0606794 3300049568 Bacteria 704
2251 Ga0501031_0631876 3300049568 Bacteria 688
2252 Ga0501032_0048499 3300049569 Bacteria 2867
2253 Ga0501032_0061106 3300049569 Bacteria 2526
2254 Ga0501032_0624887 3300049569 Bacteria 685
2255 Ga0501032_0841583 3300049569 Bacteria 579
2256 Ga0501033_0000586 3300049570 Bacteria 33688
2257 Ga0501033_0007474 3300049570 Bacteria 8507
2258 Ga0501033_0051102 3300049570 Bacteria 3064
2259 Ga0501033_0074606 3300049570 Bacteria 2490
2260 Ga0501033_0257346 3300049570 Bacteria 1236
2261 Ga0501033_1150643 3300049570 Bacteria 515
2262 Ga0501034_0310274 3300049571 Bacteria 1512
2263 Ga0501034_0715454 3300049571 Bacteria 899
2264 Ga0501034_0747781 3300049571 Bacteria 873
2265 Ga0501034_1407050 3300049571 Bacteria 572
2266 Ga0501034_1584473 3300049571 Bacteria 528
2267 Ga0501036_0004359 3300049572 Bacteria 11418
2268 Ga0501036_0004445 3300049572 Bacteria 11332
2269 Ga0501036_0027052 3300049572 Bacteria 4847
2270 Ga0501036_0056409 3300049572 Bacteria 3328
2271 Ga0501036_0072626 3300049572 Bacteria 2908
2272 Ga0501036_0101926 3300049572 Bacteria 2428
2273 Ga0501036_0123171 3300049572 Bacteria 2190
2274 Ga0501036_0274233 3300049572 Bacteria 1412
2275 Ga0501036_0285955 3300049572 Bacteria 1380
2276 Ga0501036_0329692 3300049572 Bacteria 1275
2277 Ga0501036_0334209 3300049572 Bacteria 1265
2278 Ga0501036_0505141 3300049572 Bacteria 1006
2279 Ga0501036_1189594 3300049572 Bacteria 621
2280 Ga0501036_1735921 3300049572 Bacteria 503
2281 Ga0501037_0005636 3300049573 Bacteria 9129
2282 Ga0501037_0019086 3300049573 Bacteria 5054
2283 Ga0501037_0036167 3300049573 Bacteria 3639
2284 Ga0501037_0041509 3300049573 Bacteria 3383
2285 Ga0501037_0146917 3300049573 Bacteria 1686
2286 Ga0501037_0469548 3300049573 Bacteria 856
2287 Ga0501037_0645281 3300049573 Bacteria 708
2288 Ga0501037_0875992 3300049573 Bacteria 590
2289 Ga0501038_0000891 3300049574 Bacteria 26448
2290 Ga0501038_0012346 3300049574 Bacteria 7806
2291 Ga0501038_0026095 3300049574 Bacteria 5204
2292 Ga0501038_0085121 3300049574 Bacteria 2659
2293 Ga0501038_0141371 3300049574 Bacteria 1969
2294 Ga0501038_0198085 3300049574 Bacteria 1613
2295 Ga0501038_0391808 3300049574 Bacteria 1076
2296 Ga0501038_0452183 3300049574 Bacteria 987
2297 Ga0501038_0914425 3300049574 Bacteria 647
2298 Ga0501038_1383655 3300049574 Bacteria 506
2299 Ga0501039_0005177 3300049575 Bacteria 9877
2300 Ga0501039_0010874 3300049575 Bacteria 6936
2301 Ga0501039_0036471 3300049575 Bacteria 3794
2302 Ga0501039_0092756 3300049575 Bacteria 2353
2303 Ga0501039_0114166 3300049575 Bacteria 2113
2304 Ga0501039_0402118 3300049575 Bacteria 1075
2305 Ga0501039_0562446 3300049575 Bacteria 895
2306 Ga0501039_0861448 3300049575 Bacteria 706
2307 Ga0501039_1260615 3300049575 Bacteria 571
2308 Ga0501040_0003883 3300049576 Bacteria 9696
2309 Ga0501040_0004013 3300049576 Bacteria 9562
2310 Ga0501040_0004087 3300049576 Bacteria 9485
2311 Ga0501040_0017211 3300049576 Bacteria 4798
2312 Ga0501040_0086869 3300049576 Bacteria 2171
2313 Ga0501040_0135205 3300049576 Bacteria 1735
2314 Ga0501040_0139756 3300049576 Bacteria 1705
2315 Ga0501040_0762860 3300049576 Bacteria 700
2316 Ga0501040_0841735 3300049576 Bacteria 664
2317 Ga0501040_1343896 3300049576 Bacteria 519
2318 Ga0501041_0002036 3300049577 Bacteria 11375
2319 Ga0501041_0002812 3300049577 Bacteria 9942
2320 Ga0501041_0012286 3300049577 Bacteria 5072
2321 Ga0501041_0013840 3300049577 Bacteria 4782
2322 Ga0501041_0027308 3300049577 Bacteria 3440
2323 Ga0501041_0053243 3300049577 Bacteria 2468
2324 Ga0501041_0092694 3300049577 Bacteria 1865
2325 Ga0501041_0279341 3300049577 Bacteria 1051
2326 Ga0501041_0559733 3300049577 Bacteria 729
2327 Ga0501041_0702023 3300049577 Bacteria 647
2328 Ga0501041_0795733 3300049577 Bacteria 606
2329 Ga0501041_0796979 3300049577 Bacteria 606
2330 Ga0501041_0882559 3300049577 Bacteria 574
2331 Ga0501042_0000491 3300049578 Bacteria 20534
2332 Ga0501042_0023215 3300049578 Bacteria 4338
2333 Ga0501042_0030315 3300049578 Bacteria 3819
2334 Ga0501042_0042530 3300049578 Bacteria 3234
2335 Ga0501042_0077334 3300049578 Bacteria 2382
2336 Ga0501042_0108394 3300049578 Bacteria 1999
2337 Ga0501042_0179999 3300049578 Bacteria 1525
2338 Ga0501042_0211274 3300049578 Bacteria 1400
2339 Ga0501042_0259829 3300049578 Bacteria 1253
2340 Ga0501042_0559412 3300049578 Bacteria 831
2341 Ga0501042_1174110 3300049578 Bacteria 560
2342 Ga0501043_0037819 3300049579 Bacteria 3796
2343 Ga0501043_0075258 3300049579 Bacteria 2652
2344 Ga0501043_0090272 3300049579 Bacteria 2409
2345 Ga0501043_0117940 3300049579 Bacteria 2082
2346 Ga0501043_0318192 3300049579 Bacteria 1187
2347 Ga0501043_0575609 3300049579 Bacteria 834
2348 Ga0501043_0755394 3300049579 Bacteria 707
2349 Ga0501046_0004387 3300049580 Bacteria 12824
2350 Ga0501046_0010738 3300049580 Bacteria 7854
2351 Ga0501046_0050338 3300049580 Bacteria 3291
2352 Ga0501046_0062650 3300049580 Bacteria 2905
2353 Ga0501046_0142377 3300049580 Bacteria 1814
2354 Ga0501046_0385865 3300049580 Bacteria 1013
2355 Ga0501047_0005455 3300049581 Bacteria 11968
2356 Ga0501047_0097203 3300049581 Bacteria 2823
2357 Ga0501047_1084720 3300049581 Bacteria 614
2358 Ga0501048_0005257 3300049582 Bacteria 9858
2359 Ga0501048_0005618 3300049582 Bacteria 9536
2360 Ga0501048_0108406 3300049582 Bacteria 1960
2361 Ga0501048_0134802 3300049582 Bacteria 1745
2362 Ga0501048_0155335 3300049582 Bacteria 1618
2363 Ga0501048_0161078 3300049582 Bacteria 1588
2364 Ga0501048_0319138 3300049582 Bacteria 1107
2365 Ga0501048_0350349 3300049582 Bacteria 1053
2366 Ga0501048_0460396 3300049582 Bacteria 911
2367 Ga0501048_0722132 3300049582 Bacteria 716
2368 Ga0501048_0876236 3300049582 Bacteria 645
2369 Ga0501048_1415042 3300049582 Bacteria 500
2370 Ga0501067_0156592 3300049583 Bacteria 1269
2371 Ga0501067_0251051 3300049583 Bacteria 985
2372 Ga0501067_0501092 3300049583 Bacteria 679
2373 Ga0501068_0005830 3300049584 Bacteria 6758
2374 Ga0501068_0007083 3300049584 Bacteria 6209
2375 Ga0501068_0040449 3300049584 Bacteria 2799
2376 Ga0501068_0041107 3300049584 Bacteria 2778
2377 Ga0501068_0050899 3300049584 Bacteria 2505
2378 Ga0501068_0115100 3300049584 Bacteria 1674
2379 Ga0501068_0162703 3300049584 Bacteria 1407
2380 Ga0501068_0468805 3300049584 Bacteria 815
2381 Ga0501068_1058466 3300049584 Bacteria 536
2382 Ga0501069_0001064 3300049585 Bacteria 13167
2383 Ga0501069_0014693 3300049585 Bacteria 4188
2384 Ga0501069_0058555 3300049585 Bacteria 2149
2385 Ga0501069_0085758 3300049585 Bacteria 1777
2386 Ga0501069_0903013 3300049585 Bacteria 537
2387 Ga0501070_0001356 3300049586 Bacteria 21938
2388 Ga0501070_0020406 3300049586 Bacteria 5559
2389 Ga0501070_0150693 3300049586 Bacteria 1919
2390 Ga0501070_0222094 3300049586 Bacteria 1549
2391 Ga0501070_0246087 3300049586 Bacteria 1463
2392 Ga0501070_0284566 3300049586 Bacteria 1348
2393 Ga0501070_0533573 3300049586 Bacteria 941
2394 Ga0501071_0005588 3300049587 Bacteria 8101
2395 Ga0501071_0028630 3300049587 Bacteria 3927
2396 Ga0501071_0058821 3300049587 Bacteria 2779
2397 Ga0501071_0096926 3300049587 Bacteria 2171
2398 Ga0501071_0110259 3300049587 Bacteria 2033
2399 Ga0501071_0471834 3300049587 Bacteria 961
2400 Ga0501071_0716712 3300049587 Bacteria 770
2401 Ga0501071_0817238 3300049587 Bacteria 719
2402 Ga0501071_0875499 3300049587 Bacteria 693
2403 Ga0501071_0894430 3300049587 Bacteria 685
2404 Ga0501072_0000447 3300049588 Bacteria 29642
2405 Ga0501072_0004161 3300049588 Bacteria 10950
2406 Ga0501072_0087912 3300049588 Bacteria 2466
2407 Ga0501072_0131421 3300049588 Bacteria 1995
2408 Ga0501072_0179037 3300049588 Bacteria 1691
2409 Ga0501072_0205390 3300049588 Bacteria 1570
2410 Ga0501072_0282476 3300049588 Bacteria 1320
2411 Ga0501072_0300624 3300049588 Bacteria 1276
2412 Ga0501072_0338578 3300049588 Bacteria 1195
2413 Ga0501072_0688715 3300049588 Bacteria 804
2414 Ga0501072_0708451 3300049588 Bacteria 791
2415 Ga0501073_0000321 3300049589 Bacteria 32033
2416 Ga0501073_0008056 3300049589 Bacteria 7819
2417 Ga0501073_0068857 3300049589 Bacteria 2466
2418 Ga0501073_0137277 3300049589 Bacteria 1695
2419 Ga0501073_0226840 3300049589 Bacteria 1290
2420 Ga0501073_0295551 3300049589 Bacteria 1117
2421 Ga0501073_0971685 3300049589 Bacteria 584
2422 Ga0501074_0000097 3300049590 Bacteria 42311
2423 Ga0501074_0000625 3300049590 Bacteria 21967
2424 Ga0501074_0005165 3300049590 Bacteria 9387
2425 Ga0501074_0010151 3300049590 Bacteria 6837
2426 Ga0501074_0018872 3300049590 Bacteria 5009
2427 Ga0501074_0079136 3300049590 Bacteria 2359
2428 Ga0501074_0178663 3300049590 Bacteria 1514
2429 Ga0501074_0484197 3300049590 Bacteria 877
2430 Ga0501074_0643167 3300049590 Bacteria 749
2431 Ga0501074_0753258 3300049590 Bacteria 687
2432 Ga0501074_0808074 3300049590 Bacteria 661
2433 Ga0501074_0982782 3300049590 Bacteria 594
2434 Ga0501074_1037351 3300049590 Bacteria 576
2435 Ga0501075_0001554 3300049591 Bacteria 14969
2436 Ga0501075_0006363 3300049591 Bacteria 8125
2437 Ga0501075_0032416 3300049591 Bacteria 3881
2438 Ga0501075_0034574 3300049591 Bacteria 3764
2439 Ga0501075_0090332 3300049591 Bacteria 2323
2440 Ga0501075_0210983 3300049591 Bacteria 1481
2441 Ga0501075_0265881 3300049591 Bacteria 1307
2442 Ga0501075_0269701 3300049591 Bacteria 1297
2443 Ga0501075_0556566 3300049591 Bacteria 875
2444 Ga0501075_0594614 3300049591 Bacteria 844
2445 Ga0501075_0789660 3300049591 Bacteria 723
2446 Ga0501075_1401130 3300049591 Bacteria 529
2447 Ga0501075_1508267 3300049591 Bacteria 509
2448 Ga0501076_0000287 3300049592 Bacteria 31492
2449 Ga0501076_0014920 3300049592 Bacteria 5863
2450 Ga0501076_0016016 3300049592 Bacteria 5675
2451 Ga0501076_0052305 3300049592 Bacteria 3235
2452 Ga0501076_0069881 3300049592 Bacteria 2807
2453 Ga0501076_0158512 3300049592 Bacteria 1843
2454 Ga0501076_0199011 3300049592 Bacteria 1635
2455 Ga0501076_0482753 3300049592 Bacteria 1021
2456 Ga0501076_0643878 3300049592 Bacteria 875
2457 Ga0501076_0779435 3300049592 Bacteria 789
2458 Ga0501076_1254919 3300049592 Bacteria 610
2459 Ga0501077_0000810 3300049593 Bacteria 18971
2460 Ga0501077_0008753 3300049593 Bacteria 6280
2461 Ga0501077_0038122 3300049593 Bacteria 3059
2462 Ga0501077_0064675 3300049593 Bacteria 2320
2463 Ga0501077_0135243 3300049593 Bacteria 1563
2464 Ga0501077_0356113 3300049593 Bacteria 934
2465 Ga0501077_0376641 3300049593 Bacteria 907
2466 Ga0501077_0769230 3300049593 Bacteria 619
2467 Ga0501077_0952905 3300049593 Bacteria 552
2468 Ga0501198_157168 3300049649 Bacteria 505
2469 Ga0501199_000906 3300049650 Bacteria 2638
2470 Ga0501201_033369 3300049651 Bacteria 594
2471 Ga0501201_043591 3300049651 Bacteria 544
2472 Ga0501201_048538 3300049651 Bacteria 525
2473 Ga0501202_029076 3300049652 Bacteria 1144
2474 Ga0501202_077910 3300049652 Bacteria 774
2475 Ga0501202_218670 3300049652 Bacteria 527
2476 Ga0501202_222485 3300049652 Bacteria 523
2477 Ga0501206_010086 3300049653 Bacteria 1261
2478 Ga0501207_004146 3300049654 Bacteria 1963
2479 Ga0501207_143338 3300049654 Bacteria 510
2480 Ga0501208_056531 3300049655 Bacteria 760
2481 Ga0501208_138080 3300049655 Bacteria 548
2482 Ga0501208_157231 3300049655 Bacteria 517
2483 Ga0501209_098165 3300049656 Bacteria 857
2484 Ga0501211_000022 3300049658 Bacteria 11753
2485 Ga0501216_002220 3300049660 Bacteria 2730
2486 Ga0501216_032892 3300049660 Bacteria 965
2487 Ga0501216_048054 3300049660 Bacteria 833
2488 Ga0501217_018150 3300049661 Bacteria 1630
2489 Ga0501217_026572 3300049661 Bacteria 1400
2490 Ga0501217_080564 3300049661 Bacteria 900
2491 Ga0501217_174573 3300049661 Bacteria 656
2492 Ga0501217_205678 3300049661 Bacteria 615
2493 Ga0501217_326063 3300049661 Bacteria 512
2494 Ga0501217_335102 3300049661 Bacteria 506
2495 Ga0501222_000792 3300049662 Bacteria 4559
2496 Ga0501223_008047 3300049663 Bacteria 2151
2497 Ga0501223_013439 3300049663 Bacteria 1631
2498 Ga0501223_147983 3300049663 Bacteria 508
2499 Ga0501224_044578 3300049664 Bacteria 674
2500 Ga0501227_000308 3300049665 Bacteria 10150
2501 Ga0501227_023959 3300049665 Bacteria 1421
2502 Ga0501227_026217 3300049665 Bacteria 1372
2503 Ga0501228_018786 3300049666 Bacteria 764
2504 Ga0501230_000507 3300049667 Bacteria 3931
2505 Ga0501230_041652 3300049667 Bacteria 891
2506 Ga0501230_098989 3300049667 Bacteria 627
2507 Ga0501230_142283 3300049667 Bacteria 541
2508 Ga0501230_143163 3300049667 Bacteria 540
2509 Ga0501233_000911 3300049668 Bacteria 4997
2510 Ga0501233_007577 3300049668 Bacteria 2070
2511 Ga0501233_109476 3300049668 Bacteria 738
2512 Ga0501233_190429 3300049668 Bacteria 592
2513 Ga0501233_264835 3300049668 Bacteria 521
2514 Ga0501235_006253 3300049669 Bacteria 2594
2515 Ga0501235_183044 3300049669 Bacteria 559
2516 Ga0501235_219979 3300049669 Bacteria 521
2517 Ga0501236_001774 3300049670 Bacteria 2467
2518 Ga0501238_008105 3300049671 Bacteria 1375
2519 Ga0501238_051298 3300049671 Bacteria 619
2520 Ga0501239_029215 3300049672 Bacteria 716
2521 Ga0501240_063850 3300049673 Bacteria 655
2522 Ga0501242_018679 3300049674 Bacteria 882
2523 Ga0501243_109870 3300049675 Bacteria 564
2524 Ga0501248_019262 3300049678 Bacteria 692
2525 Ga0501249_007802 3300049679 Bacteria 2218
2526 Ga0501249_116152 3300049679 Bacteria 650
2527 Ga0501249_125905 3300049679 Bacteria 629
2528 Ga0501249_130213 3300049679 Bacteria 620
2529 Ga0501253_000109 3300049683 Bacteria 5987
2530 Ga0501255_001366 3300049684 Bacteria 1953
2531 Ga0501257_025502 3300049686 Bacteria 1407
2532 Ga0501257_142355 3300049686 Bacteria 656
2533 Ga0501257_216507 3300049686 Bacteria 556
2534 Ga0501257_229181 3300049686 Bacteria 544
2535 Ga0501257_230888 3300049686 Bacteria 542
2536 Ga0501258_000164 3300049687 Bacteria 3782
2537 Ga0501259_111178 3300049688 Bacteria 641
2538 Ga0501261_037486 3300049690 Bacteria 754
2539 Ga0501261_083927 3300049690 Bacteria 581
2540 Ga0501221_000628 3300049704 Bacteria 5661
2541 Ga0501221_116513 3300049704 Bacteria 678
2542 Ga0501221_146733 3300049704 Bacteria 622
2543 Ga0501221_148980 3300049704 Bacteria 619
2544 Ga0501221_221802 3300049704 Bacteria 533
2545 Ga0501225_0018091 3300049705 Bacteria 1955
2546 Ga0501225_0130916 3300049705 Bacteria 752
2547 Ga0501225_0140998 3300049705 Bacteria 729
2548 Ga0501229_000825 3300049706 Bacteria 3512
2549 Ga0501234_002259 3300049707 Bacteria 3045
2550 Ga0501234_038269 3300049707 Bacteria 782
2551 Ga0501234_103911 3300049707 Bacteria 518
2552 Ga0501245_064873 3300049708 Bacteria 675
2553 Ga0501079_0001116 3300049741 Bacteria 18680
2554 Ga0501079_0001911 3300049741 Bacteria 14934
2555 Ga0501079_0010889 3300049741 Bacteria 6926
2556 Ga0501079_0069448 3300049741 Bacteria 2719
2557 Ga0501079_0081483 3300049741 Bacteria 2502
2558 Ga0501079_0233712 3300049741 Bacteria 1436
2559 Ga0501079_0470258 3300049741 Bacteria 988
2560 Ga0501079_0544006 3300049741 Bacteria 913
2561 Ga0501080_0001428 3300049742 Bacteria 20060
2562 Ga0501080_0011166 3300049742 Bacteria 8223
2563 Ga0501080_0013538 3300049742 Bacteria 7508
2564 Ga0501080_0071785 3300049742 Bacteria 3220
2565 Ga0501080_0145080 3300049742 Bacteria 2194
2566 Ga0501080_0181826 3300049742 Bacteria 1934
2567 Ga0501080_0481692 3300049742 Bacteria 1110
2568 Ga0501080_0506012 3300049742 Bacteria 1079
2569 Ga0501080_0901782 3300049742 Bacteria 770
2570 Ga0501080_1010477 3300049742 Bacteria 721
2571 Ga0501080_1413094 3300049742 Bacteria 593
2572 Ga0501080_1888629 3300049742 Bacteria 500
2573 Ga0501081_0000747 3300049743 Bacteria 19029
2574 Ga0501081_0010955 3300049743 Bacteria 5925
2575 Ga0501081_0060366 3300049743 Bacteria 2626
2576 Ga0501081_0069932 3300049743 Bacteria 2446
2577 Ga0501081_0078596 3300049743 Bacteria 2306
2578 Ga0501081_0496902 3300049743 Bacteria 909
2579 Ga0501081_1252810 3300049743 Bacteria 562
2580 Ga0501081_1265142 3300049743 Bacteria 559
2581 Ga0501081_1496644 3300049743 Bacteria 513
2582 Ga0501083_0021423 3300049744 Bacteria 4492
2583 Ga0501083_0046415 3300049744 Bacteria 2937
2584 Ga0501083_0161733 3300049744 Bacteria 1465
2585 Ga0501083_0488703 3300049744 Bacteria 801
2586 Ga0501232_004664 3300049757 Bacteria 1323
2587 Ga0501241_104593 3300049758 Bacteria 613
2588 Ga0501241_150783 3300049758 Bacteria 536
2589 Ga0501262_000495 3300049759 Bacteria 4689
2590 Ga0501262_008715 3300049759 Bacteria 1243
2591 Ga0501263_018734 3300049760 Bacteria 918
2592 Ga0501263_039272 3300049760 Bacteria 691
2593 Ga0501263_095170 3300049760 Bacteria 507
2594 Ga0501264_004736 3300049761 Bacteria 1233
2595 Ga0501267_000154 3300049764 Bacteria 4538
2596 Ga0501268_055455 3300049765 Bacteria 776
2597 Ga0501268_151997 3300049765 Bacteria 535
2598 Ga0501269_001636 3300049766 Bacteria 2882
2599 Ga0501270_151052 3300049767 Bacteria 529
2600 Ga0501271_007555 3300049768 Bacteria 1098
2601 Ga0501272_000140 3300049769 Bacteria 5782
2602 Ga0501273_031752 3300049770 Bacteria 754
2603 Ga0501273_077873 3300049770 Bacteria 547
2604 Ga0501273_080690 3300049770 Bacteria 540
2605 Ga0501275_013446 3300049772 Bacteria 917
2606 Ga0501275_015903 3300049772 Bacteria 871
2607 Ga0501276_041527 3300049773 Bacteria 514
2608 Ga0501278_034571 3300049774 Bacteria 527
2609 Ga0501282_002545 3300049778 Bacteria 1976
2610 Ga0501283_115724 3300049779 Bacteria 533
2611 Ga0501035_0019439 3300049822 Bacteria 6246
2612 Ga0501035_0025187 3300049822 Bacteria 5454
2613 Ga0501035_0029961 3300049822 Bacteria 4964
2614 Ga0501035_0107219 3300049822 Bacteria 2449
2615 Ga0501035_0112235 3300049822 Bacteria 2388
2616 Ga0501035_0749213 3300049822 Bacteria 784
2617 Ga0501044_0003799 3300049823 Bacteria 16954
2618 Ga0501044_0047472 3300049823 Bacteria 4441
2619 Ga0501044_0112546 3300049823 Bacteria 2729
2620 Ga0501044_0193735 3300049823 Bacteria 1994
2621 Ga0501044_0216888 3300049823 Bacteria 1865
2622 Ga0501044_0310710 3300049823 Bacteria 1503
2623 Ga0501044_1136798 3300049823 Bacteria 650
2624 Ga0501044_1567492 3300049823 Bacteria 524
2625 Ga0501045_0000836 3300049824 Bacteria 19929
2626 Ga0501045_0002784 3300049824 Bacteria 11951
2627 Ga0501045_0007683 3300049824 Bacteria 7499
2628 Ga0501045_0034871 3300049824 Bacteria 3652
2629 Ga0501045_0044853 3300049824 Bacteria 3220
2630 Ga0501045_0068374 3300049824 Bacteria 2610
2631 Ga0501045_0381791 3300049824 Bacteria 1049
2632 Ga0501045_0401599 3300049824 Bacteria 1020
2633 Ga0501045_0604494 3300049824 Bacteria 812
2634 Ga0501045_1166359 3300049824 Bacteria 562
2635 Ga0501212_064053 3300049851 Bacteria 641
2636 Ga0501226_003427 3300049853 Bacteria 1877
2637 Ga0501226_020727 3300049853 Bacteria 727
2638 Ga0501226_025307 3300049853 Bacteria 665
2639 nmdc:mga03683_164332_c1 3300050489 Bacteria 1007
2640 nmdc:mga03683_172234_c2 3300050489 Bacteria 634
2641 nmdc:mga03683_192150_c1 3300050489 Bacteria 934
2642 nmdc:mga03683_217898_c1 3300050489 Bacteria 880
2643 nmdc:mga03683_299413_c1 3300050489 Bacteria 754
2644 nmdc:mga03683_339070_c1 3300050489 Bacteria 710
2645 nmdc:mga03683_373841_c1 3300050489 Bacteria 677
2646 nmdc:mga03683_452846_c1 3300050489 Bacteria 618
2647 nmdc:mga03683_530872_c1 3300050489 Bacteria 572
2648 nmdc:mga03683_617013_c1 3300050489 Bacteria 532
2649 nmdc:mga03n38_270545_c1 3300050490 Bacteria 904
2650 nmdc:mga03n38_414560_c1 3300050490 Bacteria 744
2651 nmdc:mga03n38_428401_c1 3300050490 Bacteria 733
2652 nmdc:mga03n38_440786_c1 3300050490 Bacteria 723
2653 nmdc:mga03n38_591180_c1 3300050490 Bacteria 631
2654 nmdc:mga03n38_741998_c1 3300050490 Bacteria 568
2655 nmdc:mga03n38_957648_c1 3300050490 Bacteria 505
2656 nmdc:mga00v17_255611_c1 3300050491 Bacteria 1136
2657 nmdc:mga00v17_378252_c1 3300050491 Bacteria 921
2658 nmdc:mga00v17_387755_c1 3300050491 Bacteria 908
2659 nmdc:mga00v17_412094_c1 3300050491 Bacteria 878
2660 nmdc:mga00v17_459182_c1 3300050491 Bacteria 827
2661 nmdc:mga00v17_5329_c1 3300050491 Bacteria 6775
2662 nmdc:mga00v17_621583_c1 3300050491 Bacteria 696
2663 nmdc:mga00v17_957524_c1 3300050491 Bacteria 540
2664 nmdc:mga0yw44_437550_c1 3300050492 Bacteria 886
2665 nmdc:mga0yw44_54422_c1 3300050492 Bacteria 2432
2666 nmdc:mga0k408_102789_c1 3300050493 Bacteria 1686
2667 nmdc:mga0k408_112245_c1 3300050493 Bacteria 1612
2668 nmdc:mga0k408_130862_c1 3300050493 Bacteria 1490
2669 nmdc:mga0k408_144065_c1 3300050493 Bacteria 1418
2670 nmdc:mga0k408_14579_c1 3300050493 Bacteria 4335
2671 nmdc:mga0k408_179446_c1 3300050493 Bacteria 1263
2672 nmdc:mga0k408_181405_c1 3300050493 Bacteria 1256
2673 nmdc:mga0k408_18596_c1 3300050493 Bacteria 3880
2674 nmdc:mga0k408_18793_c1 3300050493 Bacteria 3859
2675 nmdc:mga0k408_197808_c1 3300050493 Bacteria 1200
2676 nmdc:mga0k408_216118_c1 3300050493 Bacteria 1145
2677 nmdc:mga0k408_244052_c1 3300050493 Bacteria 1073
2678 nmdc:mga0k408_31223_c1 3300050493 Bacteria 3041
2679 nmdc:mga0k408_32503_c2 3300050493 Bacteria 2525
2680 nmdc:mga0k408_40677_c1 3300050493 Bacteria 2676
2681 nmdc:mga0k408_612620_c1 3300050493 Bacteria 642
2682 nmdc:mga0k408_675062_c1 3300050493 Bacteria 606
2683 nmdc:mga0k408_742632_c1 3300050493 Bacteria 574
2684 nmdc:mga0k408_782322_c1 3300050493 Bacteria 557
2685 nmdc:mga0k408_803724_c1 3300050493 Bacteria 548
2686 nmdc:mga06z11_360800_c1 3300050494 Bacteria 871
2687 nmdc:mga06z11_68127_c1 3300050494 Bacteria 1875
2688 nmdc:mga07m45_136322_c1 3300050496 Bacteria 1421
2689 nmdc:mga07m45_15177_c1 3300050496 Bacteria 4113
2690 nmdc:mga07m45_19266_c1 3300050496 Bacteria 3696
2691 nmdc:mga07m45_416268_c1 3300050496 Bacteria 780
2692 nmdc:mga07m45_489810_c1 3300050496 Bacteria 712
2693 nmdc:mga07m45_56127_c1 3300050496 Bacteria 2226
2694 nmdc:mga07m45_70220_c1 3300050496 Bacteria 1992
2695 nmdc:mga07m45_82480_c1 3300050496 Bacteria 1836
2696 nmdc:mga07m45_95598_c1 3300050496 Bacteria 1704
2697 nmdc:mga07m45_98495_c1 3300050496 Bacteria 1679
2698 nmdc:mga05p37_10502_c1 3300050507 Bacteria 10983
2699 nmdc:mga05p37_1110236_c1 3300050507 Bacteria 827
2700 nmdc:mga05p37_137660_c1 3300050507 Bacteria 2993
2701 nmdc:mga05p37_15191_c1 3300050507 Bacteria 9247
2702 nmdc:mga05p37_1596132_c1 3300050507 Bacteria 643
2703 nmdc:mga05p37_168066_c1 3300050507 Bacteria 2676
2704 nmdc:mga05p37_511646_c1 3300050507 Bacteria 1375
2705 nmdc:mga05p37_612852_c1 3300050507 Bacteria 1226
2706 nmdc:mga05p37_942744_c1 3300050507 Bacteria 925
2707 nmdc:mga05p37_99540_c1 3300050507 Bacteria 3581
2708 nmdc:mga09592_1345632_c1 3300050508 Bacteria 586
2709 nmdc:mga09592_174566_c1 3300050508 Bacteria 1859
2710 nmdc:mga09592_505226_c1 3300050508 Bacteria 1041
2711 nmdc:mga09592_599588_c1 3300050508 Bacteria 944
2712 nmdc:mga09592_65110_c1 3300050508 Bacteria 3087
2713 nmdc:mga09592_6576_c1 3300050508 Bacteria 9465
2714 nmdc:mga09592_774667_c1 3300050508 Bacteria 813
2715 nmdc:mga0qj67_1458_c1 3300050509 Bacteria 16584
2716 nmdc:mga0qj67_223257_c1 3300050509 Bacteria 1529
2717 nmdc:mga0qj67_226932_c1 3300050509 Bacteria 1516
2718 nmdc:mga0qj67_333342_c1 3300050509 Bacteria 1228
2719 nmdc:mga0qj67_380874_c1 3300050509 Bacteria 1139
2720 nmdc:mga0qj67_49005_c1 3300050509 Bacteria 3339
2721 nmdc:mga0qj67_544055_c1 3300050509 Bacteria 932
2722 nmdc:mga0qj67_717543_c1 3300050509 Bacteria 795
2723 nmdc:mga0qj67_924893_c1 3300050509 Bacteria 686
2724 nmdc:mga06r32_19542_c1 3300050510 Bacteria 6220
2725 nmdc:mga06r32_22687_c1 3300050510 Bacteria 5805
2726 nmdc:mga06r32_230776_c1 3300050510 Bacteria 1839
2727 nmdc:mga06r32_318529_c1 3300050510 Bacteria 1541
2728 nmdc:mga06r32_486344_c1 3300050510 Bacteria 1212
2729 nmdc:mga06r32_487621_c1 3300050510 Bacteria 1210
2730 nmdc:mga06r32_49740_c1 3300050510 Bacteria 4010
2731 nmdc:mga06r32_585579_c1 3300050510 Bacteria 1088
2732 nmdc:mga06r32_75350_c1 3300050510 Bacteria 3274
2733 nmdc:mga06r32_816563_c1 3300050510 Bacteria 892
2734 nmdc:mga08y16_1113444_c1 3300050511 Bacteria 764
2735 nmdc:mga08y16_121600_c1 3300050511 Bacteria 2717
2736 nmdc:mga08y16_1921788_c1 3300050511 Bacteria 542
2737 nmdc:mga08y16_200927_c1 3300050511 Bacteria 2066
2738 nmdc:mga08y16_337388_c1 3300050511 Bacteria 1550
2739 nmdc:mga08y16_3559_c1 3300050511 Bacteria 16171
2740 nmdc:mga08y16_463065_c1 3300050511 Bacteria 1292
2741 nmdc:mga08y16_66308_c1 3300050511 Bacteria 3768
2742 nmdc:mga08y16_6658_c1 3300050511 Bacteria 12115
2743 nmdc:mga08y16_861244_c1 3300050511 Bacteria 895
2744 nmdc:mga0n895_1164963_c1 3300050512 Bacteria 746
2745 nmdc:mga0n895_18871_c2 3300050512 Bacteria 3913
2746 nmdc:mga0n895_2021126_c1 3300050512 Bacteria 534
2747 nmdc:mga0n895_211578_c1 3300050512 Bacteria 1969
2748 nmdc:mga0n895_53959_c1 3300050512 Bacteria 3951
2749 nmdc:mga0n895_570_c1 3300050512 Bacteria 25297
2750 nmdc:mga0n895_680962_c1 3300050512 Bacteria 1025
2751 nmdc:mga0n895_827768_c1 3300050512 Bacteria 915
2752 nmdc:mga0rr50_128934_c1 3300050513 Bacteria 2023
2753 nmdc:mga0rr50_36559_c1 3300050513 Bacteria 3538
2754 nmdc:mga0rr50_45018_c1 3300050513 Bacteria 3241
2755 nmdc:mga0rr50_478204_c1 3300050513 Bacteria 1058
2756 nmdc:mga0rr50_500656_c1 3300050513 Bacteria 1033
2757 nmdc:mga0rr50_51411_c1 3300050513 Bacteria 3057
2758 nmdc:mga0rr50_646971_c1 3300050513 Bacteria 902
2759 nmdc:mga0rr50_82143_c1 3300050513 Bacteria 2488
2760 nmdc:mga0rr50_848009_c1 3300050513 Bacteria 779
2761 nmdc:mga0rr50_90141_c1 3300050513 Bacteria 2385
2762 nmdc:mga08x19_103532_c1 3300050514 Bacteria 1891
2763 nmdc:mga08x19_1115185_c1 3300050514 Bacteria 560
2764 nmdc:mga08x19_186756_c1 3300050514 Bacteria 1417
2765 nmdc:mga08x19_20089_c1 3300050514 Bacteria 4111
2766 nmdc:mga08x19_313271_c1 3300050514 Bacteria 1091
2767 nmdc:mga08x19_319527_c1 3300050514 Bacteria 1080
2768 nmdc:mga08x19_41428_c1 3300050514 Bacteria 2933
2769 nmdc:mga08x19_505528_c1 3300050514 Bacteria 853
2770 nmdc:mga08x19_8733_c1 3300050514 Bacteria 6043
2771 nmdc:mga08x19_945_c1 3300050514 Bacteria 18277
2772 nmdc:mga0a205_11320_c1 3300050515 Bacteria 8211
2773 nmdc:mga0a205_1205460_c1 3300050515 Bacteria 605
2774 nmdc:mga0a205_20420_c1 3300050515 Bacteria 6248
2775 nmdc:mga0a205_24282_c1 3300050515 Bacteria 5762
2776 nmdc:mga0a205_611098_c1 3300050515 Bacteria 943
2777 nmdc:mga0a205_62728_c1 3300050515 Bacteria 3591
2778 nmdc:mga0a205_794755_c1 3300050515 Bacteria 794
2779 nmdc:mga0a205_827865_c1 3300050515 Bacteria 773
2780 nmdc:mga0sz30_1133_c1 3300050516 Bacteria 9551
2781 nmdc:mga0sz30_115736_c2 3300050516 Bacteria 605
2782 nmdc:mga0sz30_344392_c1 3300050516 Bacteria 666
2783 Ga0495601_0054478 3300053077 Bacteria 2530
2784 Ga0495601_0184569 3300053077 Bacteria 1363
2785 Ga0495612_0117998 3300053078 Bacteria 1140
2786 Ga0495612_0613271 3300053078 Bacteria 503
2787 Ga0500610_0019906 3300053079 Bacteria 3268
2788 Ga0495655_0131228 3300053083 Bacteria 772
2789 Ga0495595_0125973 3300053084 Bacteria 1250
2790 Ga0495619_0195212 3300053085 Bacteria 1401
2791 Ga0495619_0252911 3300053085 Bacteria 1221
2792 Ga0495619_0314441 3300053085 Bacteria 1084
2793 Ga0495619_0334817 3300053085 Bacteria 1048
2794 Ga0500578_0254795 3300053086 Bacteria 1056
2795 Ga0500643_012219 3300053087 Bacteria 3083
2796 Ga0500646_0015555 3300053090 Bacteria 1982
2797 Ga0500647_0353156 3300053091 Bacteria 611
2798 Ga0500583_0053735 3300053092 Bacteria 1879
2799 Ga0500651_0000298 3300053093 Bacteria 28626
2800 Ga0500651_0269774 3300053093 Bacteria 984
2801 Ga0500651_0422459 3300053093 Bacteria 746
2802 Ga0500566_0000391 3300053094 Bacteria 24277
2803 Ga0500566_0034411 3300053094 Bacteria 2948
2804 Ga0500566_0049404 3300053094 Bacteria 2410
2805 Ga0500640_007951 3300053095 Bacteria 4165
2806 Ga0500641_0093582 3300053096 Bacteria 1284
2807 Ga0500654_085228 3300053099 Bacteria 1444
2808 Ga0500554_000753 3300053102 Bacteria 6518
2809 Ga0500554_042131 3300053102 Bacteria 1405
2810 Ga0500562_029231 3300053108 Bacteria 1450
2811 Ga0500562_068143 3300053108 Bacteria 959
2812 Ga0500571_000095 3300053110 Bacteria 28943
2813 Ga0500572_001626 3300053111 Bacteria 5912
2814 Ga0500592_040479 3300053116 Bacteria 754
2815 Ga0500593_000205 3300053117 Bacteria 24092
2816 Ga0500594_0315707 3300053118 Bacteria 525
2817 Ga0500595_001095 3300053119 Bacteria 15031
2818 Ga0500595_118352 3300053119 Bacteria 750
2819 Ga0500597_009296 3300053120 Bacteria 3449
2820 Ga0500607_088153 3300053121 Bacteria 1567
2821 Ga0500608_131686 3300053122 Bacteria 1120
2822 Ga0500614_004590 3300053123 Bacteria 2911
2823 Ga0500614_017561 3300053123 Bacteria 1618
2824 Ga0500617_184322 3300053124 Bacteria 785
2825 Ga0500617_279762 3300053124 Bacteria 540
2826 Ga0500618_023413 3300053125 Bacteria 1496
2827 Ga0500618_081667 3300053125 Bacteria 725
2828 Ga0500628_009468 3300053129 Bacteria 1719
2829 Ga0500642_0030738 3300053130 Bacteria 2237
2830 Ga0500658_0048769 3300053134 Bacteria 1723
2831 Ga0500658_0228046 3300053134 Bacteria 854
2832 Ga0500658_0351059 3300053134 Bacteria 677
2833 Ga0500658_0559902 3300053134 Bacteria 514
2834 Ga0500559_0034370 3300053136 Bacteria 2186
2835 Ga0500564_264590 3300053138 Bacteria 675
2836 Ga0500568_0000029 3300053139 Bacteria 159927
2837 Ga0500568_0002630 3300053139 Bacteria 10437
2838 Ga0500573_0562668 3300053140 Bacteria 502
2839 Ga0500574_000607 3300053141 Bacteria 4638
2840 Ga0500577_0166617 3300053142 Bacteria 941
2841 Ga0500585_258308 3300053144 Bacteria 549
2842 Ga0500588_0097839 3300053146 Bacteria 1007
2843 Ga0500603_018543 3300053150 Bacteria 1677
2844 Ga0500603_096591 3300053150 Bacteria 873
2845 Ga0500616_0015780 3300053153 Bacteria 4312
2846 Ga0500619_095150 3300053154 Bacteria 1008
2847 Ga0500622_0000002 3300053156 Bacteria 646442
2848 Ga0500622_0141039 3300053156 Bacteria 1149
2849 Ga0500622_0231076 3300053156 Bacteria 823
2850 Ga0500627_0002287 3300053158 Bacteria 5631
2851 Ga0500630_193628 3300053159 Bacteria 801
2852 Ga0500634_0030126 3300053161 Bacteria 2957
2853 Ga0500638_045153 3300053162 Bacteria 2138
2854 Ga0500638_085698 3300053162 Bacteria 1491
2855 Ga0500639_117334 3300053163 Bacteria 1284
2856 Ga0500639_213226 3300053163 Bacteria 815
2857 Ga0500639_272732 3300053163 Bacteria 659
2858 Ga0500636_0212815 3300053177 Bacteria 1013
2859 Ga0500637_0076142 3300053178 Bacteria 1935
2860 Ga0500645_086765 3300053730 Bacteria 890
2861 Ga0500599_021093 3300053736 Bacteria 925
2862 Ga0500601_018475 3300053737 Bacteria 801
2863 Ga0500587_014103 3300053739 Bacteria 1012
2864 Ga0501084_0001896 3300054114 Bacteria 16697
2865 Ga0501084_0006534 3300054114 Bacteria 9581
2866 Ga0501084_0009091 3300054114 Bacteria 8221
2867 Ga0501084_0015092 3300054114 Bacteria 6407
2868 Ga0501084_0087583 3300054114 Bacteria 2614
2869 Ga0501084_0140599 3300054114 Bacteria 2033
2870 Ga0501084_0152220 3300054114 Bacteria 1950
2871 Ga0501084_0253230 3300054114 Bacteria 1486
2872 Ga0501084_0330227 3300054114 Bacteria 1288
2873 Ga0501084_0466466 3300054114 Bacteria 1067
2874 Ga0501084_0980853 3300054114 Bacteria 710
2875 Ga0501084_1444502 3300054114 Bacteria 576
2876 Ga0501084_1659645 3300054114 Bacteria 534
2877 Ga0501084_1667893 3300054114 Bacteria 533
2878 Ga0500661_026451 3300055283 Bacteria 1025
2879 Ga0590071_004545 3300059421 Bacteria 3364
2880 Ga0590071_044030 3300059421 Bacteria 1076
2881 Ga0590074_015430 3300059423 Bacteria 1297
2882 Ga0590074_020206 3300059423 Bacteria 1145
2883 Ga0590075_007808 3300059424 Bacteria 2548
2884 Ga0590075_020657 3300059424 Bacteria 1639
2885 Ga0590075_041917 3300059424 Bacteria 1170
2886 Ga0590075_179655 3300059424 Bacteria 559
2887 Ga0590075_212447 3300059424 Bacteria 512
2888 Ga0590077_006725 3300059426 Bacteria 2353
2889 Ga0590077_033240 3300059426 Bacteria 1131
2890 Ga0590077_034038 3300059426 Bacteria 1119
2891 Ga0590077_043462 3300059426 Bacteria 1002
2892 Ga0590077_054962 3300059426 Bacteria 897
2893 Ga0590077_063614 3300059426 Bacteria 838
2894 Ga0590077_114283 3300059426 Bacteria 636
2895 Ga0590077_156575 3300059426 Bacteria 546
2896 Ga0590077_172799 3300059426 Bacteria 520
2897 Ga0587084_000161 3300059477 Bacteria 4157
2898 Ga0587084_001741 3300059477 Bacteria 2129
2899 Ga0587084_009007 3300059477 Bacteria 1278
2900 Ga0587084_019013 3300059477 Bacteria 1008
2901 Ga0587084_049557 3300059477 Bacteria 739
2902 Ga0587084_068553 3300059477 Bacteria 665
2903 Ga0587084_103573 3300059477 Bacteria 580
2904 Ga0587084_132798 3300059477 Bacteria 533
2905 Ga0587084_152710 3300059477 Bacteria 509
2906 Ga0587093_008880 3300059478 Bacteria 1156
2907 Ga0587093_093938 3300059478 Bacteria 533
2908 Ga0587093_113132 3300059478 Bacteria 501
2909 Ga0587066_024706 3300059490 Bacteria 1024
2910 Ga0587066_062291 3300059490 Bacteria 765
2911 Ga0587066_064142 3300059490 Bacteria 757
2912 Ga0587066_074443 3300059490 Bacteria 722
2913 Ga0587066_180578 3300059490 Bacteria 543
2914 Ga0587070_053366 3300059491 Bacteria 814
2915 Ga0587070_141697 3300059491 Bacteria 594
2916 Ga0587070_199034 3300059491 Bacteria 531
2917 Ga0587073_0058786 3300059492 Bacteria 895
2918 Ga0587077_035994 3300059493 Bacteria 970
2919 Ga0587077_117818 3300059493 Bacteria 659
2920 Ga0587077_162892 3300059493 Bacteria 591
2921 Ga0587080_069064 3300059503 Bacteria 703
2922 Ga0587080_069810 3300059503 Bacteria 701
2923 Ga0587082_000645 3300059504 Bacteria 3091
2924 Ga0587082_116204 3300059504 Bacteria 600
2925 Ga0587082_160520 3300059504 Bacteria 538
2926 Ga0587083_0077134 3300059505 Bacteria 786
2927 Ga0587083_0134322 3300059505 Bacteria 653
2928 Ga0587085_013639 3300059506 Bacteria 1134
2929 Ga0587085_034481 3300059506 Bacteria 850
2930 Ga0587085_041699 3300059506 Bacteria 802
2931 Ga0587085_130901 3300059506 Bacteria 561
2932 Ga0587086_033097 3300059507 Bacteria 770
2933 Ga0587088_006618 3300059508 Bacteria 1572
2934 Ga0587088_099672 3300059508 Bacteria 647
2935 Ga0587089_081718 3300059509 Bacteria 563
2936 Ga0587090_092103 3300059510 Bacteria 622
2937 Ga0587090_126952 3300059510 Bacteria 558
2938 Ga0587091_000801 3300059511 Bacteria 3020
2939 Ga0587091_061138 3300059511 Bacteria 800
2940 Ga0587092_001078 3300059512 Bacteria 2535
2941 Ga0587092_011517 3300059512 Bacteria 1231
2942 Ga0587092_074410 3300059512 Bacteria 660
2943 Ga0587094_019427 3300059513 Bacteria 975
2944 Ga0587094_082582 3300059513 Bacteria 596
2945 Ga0587095_016667 3300059514 Bacteria 675
2946 Ga0587106_002397 3300059605 Bacteria 1834
2947 Ga0587106_030007 3300059605 Bacteria 867
2948 Ga0587125_020989 3300059607 Bacteria 771
2949 Ga0587129_005732 3300059608 Bacteria 856
2950 Ga0587101_145111 3300059623 Bacteria 510
2951 Ga0587109_091585 3300059624 Bacteria 687
2952 Ga0587115_019223 3300059626 Bacteria 938
2953 Ga0587117_027714 3300059627 Bacteria 835
2954 Ga0587117_033489 3300059627 Bacteria 786
2955 Ga0587117_069501 3300059627 Bacteria 621
2956 Ga0587127_014044 3300059629 Bacteria 657
2957 Ga0587128_007998 3300059630 Bacteria 1355
2958 Ga0587062_012302 3300059639 Bacteria 1095
2959 Ga0587062_023751 3300059639 Bacteria 891
2960 Ga0587062_026618 3300059639 Bacteria 859
2961 Ga0587062_038138 3300059639 Bacteria 768
2962 Ga0587062_089816 3300059639 Bacteria 583
2963 Ga0587067_015945 3300059640 Bacteria 1227
2964 Ga0587067_116587 3300059640 Bacteria 636
2965 Ga0587067_236728 3300059640 Bacteria 501
2966 Ga0587068_000361 3300059641 Bacteria 3930
2967 Ga0587068_018235 3300059641 Bacteria 1128
2968 Ga0587068_033966 3300059641 Bacteria 897
2969 Ga0587068_040802 3300059641 Bacteria 839
2970 Ga0587068_074190 3300059641 Bacteria 676
2971 Ga0587068_079454 3300059641 Bacteria 660
2972 Ga0587069_000480 3300059642 Bacteria 3014
2973 Ga0587069_097465 3300059642 Bacteria 596
2974 Ga0587072_000788 3300059643 Bacteria 3516
2975 Ga0587072_024225 3300059643 Bacteria 1096
2976 Ga0587072_084013 3300059643 Bacteria 692
2977 Ga0587072_125235 3300059643 Bacteria 600
2978 Ga0587072_164771 3300059643 Bacteria 544
2979 Ga0587075_006827 3300059644 Bacteria 1414
2980 Ga0587075_033035 3300059644 Bacteria 833
2981 Ga0587076_001015 3300059645 Bacteria 2694
2982 Ga0587076_003303 3300059645 Bacteria 1909
2983 Ga0587076_031006 3300059645 Bacteria 948
2984 Ga0587078_006516 3300059646 Bacteria 1270
2985 Ga0587079_022809 3300059647 Bacteria 1140
2986 Ga0587079_050815 3300059647 Bacteria 870
2987 Ga0587079_180102 3300059647 Bacteria 565
2988 Ga0587100_014434 3300059648 Bacteria 713
2989 Ga0587102_008595 3300059649 Bacteria 974
2990 Ga0587105_001518 3300059651 Bacteria 1218
2991 Ga0587107_096365 3300059652 Bacteria 579
2992 Ga0587107_118980 3300059652 Bacteria 543
2993 Ga0587108_010747 3300059653 Bacteria 772
2994 Ga0587108_016596 3300059653 Bacteria 671
2995 Ga0587110_019615 3300059654 Bacteria 756
2996 Ga0587114_042649 3300059655 Bacteria 741
2997 Ga0587119_045000 3300059658 Bacteria 644
2998 Ga0587124_006196 3300059660 Bacteria 978
2999 Ga0587124_036621 3300059660 Bacteria 560
3000 Ga0587071_002635 3300060344 Bacteria 2463
3001 Ga0587071_085026 3300060344 Bacteria 710
3002 Ga0587111_0024867 3300060346 Bacteria 1182
3003 Ga0587111_0044425 3300060346 Bacteria 959
3004 Ga0501082_0005309 3300060353 Bacteria 11201
3005 Ga0501082_0008495 3300060353 Bacteria 8853
3006 Ga0501082_0010286 3300060353 Bacteria 8053
3007 Ga0501082_0013509 3300060353 Bacteria 7016
3008 Ga0501082_0091105 3300060353 Bacteria 2632
3009 Ga0501082_0099513 3300060353 Bacteria 2514
3010 Ga0501082_0262125 3300060353 Bacteria 1503
3011 Ga0501082_0364110 3300060353 Bacteria 1261
3012 Ga0501082_0428740 3300060353 Bacteria 1155
3013 Ga0501082_0513137 3300060353 Bacteria 1048
3014 Ga0501082_0537131 3300060353 Bacteria 1022
3015 Ga0501082_1676951 3300060353 Bacteria 555
3016 Ga0466962_0050034 3300061719 Bacteria 1998
3017 Ga0466962_0380437 3300061719 Bacteria 705
3018 Ga0530510_0001993 3300061734 Bacteria 13997
3019 Ga0530510_0003175 3300061734 Bacteria 11294
3020 Ga0530510_0017434 3300061734 Bacteria 5090
3021 Ga0530510_1337646 3300061734 Bacteria 549

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886007 SwRhRL2b_contig_287973 SwRhRL2b_0074.00005980 37
2 3300000545 CNXas_1006948 CNXas_10069482 37
3 3300000549 LJQas_1042220 LJQas_10422202 37
4 3300001915 JGI24741J21665_1053947 JGI24741J21665_10539472 37
5 3300001979 JGI24740J21852_10000716 JGI24740J21852_1000071614 37
6 3300001989 JGI24739J22299_10069704 JGI24739J22299_100697042 37
7 3300001990 JGI24737J22298_10138299 JGI24737J22298_101382992 37
8 3300001991 JGI24743J22301_10132512 JGI24743J22301_101325122 37
9 3300002067 JGI24735J21928_10144632 JGI24735J21928_101446322 37
10 3300002075 JGI24738J21930_10028464 JGI24738J21930_100284643 37
11 3300002077 JGI24744J21845_10053506 JGI24744J21845_100535063 37
12 3300002077 JGI24744J21845_10104736 JGI24744J21845_101047362 37
13 3300002244 JGI24742J22300_10113280 JGI24742J22300_101132802 37
14 3300002773 JGI25152J39213_1009630 JGI25152J39213_10096304 37
15 3300003781 Ga0055536_1020445 Ga0055536_10204454 37
16 3300005543 Ga0070672_100003683 Ga0070672_10000368310 37
17 3300005543 Ga0070672_100023592 Ga0070672_1000235925 37
18 3300005543 Ga0070672_100041046 Ga0070672_1000410467 37
19 3300005543 Ga0070672_100112769 Ga0070672_1001127692 37
20 3300005543 Ga0070672_100283416 Ga0070672_1002834162 37
21 3300005543 Ga0070672_100322446 Ga0070672_1003224463 37
22 3300005543 Ga0070672_100362257 Ga0070672_1003622571 37
23 3300005543 Ga0070672_100734821 Ga0070672_1007348212 37
24 3300005543 Ga0070672_102002158 Ga0070672_1020021582 37
25 3300005548 Ga0070665_100068159 Ga0070665_1000681595 37
26 3300005548 Ga0070665_100118186 Ga0070665_1001181865 37
27 3300005548 Ga0070665_100287403 Ga0070665_1002874034 37
28 3300005548 Ga0070665_100315432 Ga0070665_1003154323 37
29 3300005548 Ga0070665_100610812 Ga0070665_1006108123 37
30 3300005548 Ga0070665_100823033 Ga0070665_1008230333 37
31 3300005548 Ga0070665_101212002 Ga0070665_1012120022 37
32 3300005548 Ga0070665_101533186 Ga0070665_1015331862 37
33 3300005548 Ga0070665_101681409 Ga0070665_1016814091 37
34 3300005548 Ga0070665_102079534 Ga0070665_1020795342 37
35 3300005563 Ga0068855_100029685 Ga0068855_1000296853 37
36 3300005563 Ga0068855_100195427 Ga0068855_1001954273 37
37 3300005563 Ga0068855_100684797 Ga0068855_1006847973 37
38 3300005563 Ga0068855_101019909 Ga0068855_1010199092 37
39 3300005563 Ga0068855_101952326 Ga0068855_1019523262 37
40 3300005564 Ga0070664_100024806 Ga0070664_1000248066 37
41 3300005564 Ga0070664_100452049 Ga0070664_1004520492 37
42 3300005564 Ga0070664_100459657 Ga0070664_1004596573 37
43 3300005564 Ga0070664_100693074 Ga0070664_1006930742 37
44 3300005564 Ga0070664_100733603 Ga0070664_1007336033 37
45 3300005564 Ga0070664_102096079 Ga0070664_1020960791 37
46 3300005564 Ga0070664_102386365 Ga0070664_1023863652 37
47 3300005577 Ga0068857_100216057 Ga0068857_1002160573 37
48 3300005577 Ga0068857_100259181 Ga0068857_1002591813 37
49 3300005577 Ga0068857_100288431 Ga0068857_1002884311 37
50 3300005577 Ga0068857_101293324 Ga0068857_1012933242 37
51 3300005577 Ga0068857_101723776 Ga0068857_1017237762 37
52 3300005577 Ga0068857_102096970 Ga0068857_1020969702 37
53 3300005578 Ga0068854_100140881 Ga0068854_1001408813 37
54 3300005578 Ga0068854_100368170 Ga0068854_1003681703 37
55 3300005578 Ga0068854_100429063 Ga0068854_1004290633 37
56 3300005578 Ga0068854_100590982 Ga0068854_1005909822 37
57 3300005578 Ga0068854_100617081 Ga0068854_1006170813 37
58 3300005578 Ga0068854_100880655 Ga0068854_1008806552 37
59 3300005614 Ga0068856_100086907 Ga0068856_1000869074 37
60 3300005614 Ga0068856_100141771 Ga0068856_1001417713 37
61 3300005614 Ga0068856_100295656 Ga0068856_1002956564 37
62 3300005614 Ga0068856_100573527 Ga0068856_1005735272 37
63 3300005614 Ga0068856_102167337 Ga0068856_1021673372 37
64 3300005616 Ga0068852_100048973 Ga0068852_1000489735 37
65 3300005616 Ga0068852_100053334 Ga0068852_1000533344 37
66 3300005616 Ga0068852_100547214 Ga0068852_1005472142 37
67 3300005616 Ga0068852_100635919 Ga0068852_1006359192 37
68 3300005616 Ga0068852_100720434 Ga0068852_1007204342 37
69 3300005616 Ga0068852_101014778 Ga0068852_1010147782 37
70 3300005616 Ga0068852_101026076 Ga0068852_1010260762 37
71 3300005616 Ga0068852_101055706 Ga0068852_1010557062 37
72 3300005616 Ga0068852_101912590 Ga0068852_1019125901 37
73 3300005616 Ga0068852_102240510 Ga0068852_1022405101 37
74 3300005616 Ga0068852_102622828 Ga0068852_1026228283 37
75 3300005617 Ga0068859_100054995 Ga0068859_1000549954 37
76 3300005617 Ga0068859_100106010 Ga0068859_1001060102 37
77 3300005617 Ga0068859_100150198 Ga0068859_1001501983 37
78 3300005617 Ga0068859_100150725 Ga0068859_1001507255 37
79 3300005617 Ga0068859_100602529 Ga0068859_1006025292 37
80 3300005617 Ga0068859_101001328 Ga0068859_1010013282 37
81 3300005617 Ga0068859_101200518 Ga0068859_1012005182 37
82 3300005617 Ga0068859_101395572 Ga0068859_1013955722 37
83 3300005618 Ga0068864_100141584 Ga0068864_1001415844 37
84 3300005618 Ga0068864_100182246 Ga0068864_1001822464 37
85 3300005618 Ga0068864_100261472 Ga0068864_1002614724 37
86 3300005618 Ga0068864_100288439 Ga0068864_1002884393 37
87 3300005618 Ga0068864_100495663 Ga0068864_1004956632 37
88 3300005618 Ga0068864_101664840 Ga0068864_1016648402 37
89 3300005618 Ga0068864_102248185 Ga0068864_1022481851 37
90 3300005618 Ga0068864_102652304 Ga0068864_1026523042 37
91 3300005718 Ga0068866_10014361 Ga0068866_100143615 37
92 3300005718 Ga0068866_10201130 Ga0068866_102011301 37
93 3300005718 Ga0068866_10707755 Ga0068866_107077552 37
94 3300005718 Ga0068866_11166789 Ga0068866_111667892 37
95 3300005718 Ga0068866_11337687 Ga0068866_113376871 37
96 3300005719 Ga0068861_100003605 Ga0068861_1000036058 37
97 3300005719 Ga0068861_100103054 Ga0068861_1001030544 37
98 3300005719 Ga0068861_100332721 Ga0068861_1003327213 37
99 3300005719 Ga0068861_100361602 Ga0068861_1003616023 37
100 3300005719 Ga0068861_100416154 Ga0068861_1004161543 37
101 3300005719 Ga0068861_100941778 Ga0068861_1009417783 37
102 3300005719 Ga0068861_101305807 Ga0068861_1013058072 37
103 3300005719 Ga0068861_101779292 Ga0068861_1017792922 37
104 3300005719 Ga0068861_102357148 Ga0068861_1023571482 37
105 3300005834 Ga0068851_10006696 Ga0068851_1000669610 37
106 3300005834 Ga0068851_10212893 Ga0068851_102128933 37
107 3300005834 Ga0068851_10290361 Ga0068851_102903613 37
108 3300005834 Ga0068851_10325794 Ga0068851_103257942 37
109 3300005834 Ga0068851_10433219 Ga0068851_104332192 37
110 3300005834 Ga0068851_10444447 Ga0068851_104444472 37
111 3300005840 Ga0068870_10096798 Ga0068870_100967984 37
112 3300005840 Ga0068870_10284713 Ga0068870_102847133 37
113 3300005840 Ga0068870_10309766 Ga0068870_103097662 37
114 3300005840 Ga0068870_10457309 Ga0068870_104573093 37
115 3300005840 Ga0068870_10609962 Ga0068870_106099621 37
116 3300005840 Ga0068870_10740636 Ga0068870_107406362 37
117 3300005840 Ga0068870_10803275 Ga0068870_108032752 37
118 3300005841 Ga0068863_100072268 Ga0068863_1000722684 37
119 3300005841 Ga0068863_100191371 Ga0068863_1001913714 37
120 3300005841 Ga0068863_100443854 Ga0068863_1004438542 37
121 3300005841 Ga0068863_100461014 Ga0068863_1004610143 37
122 3300005841 Ga0068863_100491575 Ga0068863_1004915752 37
123 3300005841 Ga0068863_100579236 Ga0068863_1005792362 37
124 3300005841 Ga0068863_100638359 Ga0068863_1006383593 37
125 3300005841 Ga0068863_100955103 Ga0068863_1009551031 37
126 3300005841 Ga0068863_101303020 Ga0068863_1013030202 37
127 3300005841 Ga0068863_101700214 Ga0068863_1017002142 37
128 3300005841 Ga0068863_102025927 Ga0068863_1020259272 37
129 3300005841 Ga0068863_102697235 Ga0068863_1026972352 37
130 3300005842 Ga0068858_100056557 Ga0068858_1000565573 37
131 3300005842 Ga0068858_100097783 Ga0068858_1000977835 37
132 3300005842 Ga0068858_100226683 Ga0068858_1002266833 37
133 3300005842 Ga0068858_100279175 Ga0068858_1002791753 37
134 3300005842 Ga0068858_100369244 Ga0068858_1003692442 37
135 3300005842 Ga0068858_100429630 Ga0068858_1004296303 37
136 3300005842 Ga0068858_100632183 Ga0068858_1006321833 37
137 3300005842 Ga0068858_100651233 Ga0068858_1006512332 37
138 3300005842 Ga0068858_100673327 Ga0068858_1006733271 37
139 3300005842 Ga0068858_100868225 Ga0068858_1008682253 37
140 3300005842 Ga0068858_101587003 Ga0068858_1015870032 37
141 3300005843 Ga0068860_100060890 Ga0068860_1000608905 37
142 3300005843 Ga0068860_100181183 Ga0068860_1001811833 37
143 3300005843 Ga0068860_100236076 Ga0068860_1002360763 37
144 3300005843 Ga0068860_100464512 Ga0068860_1004645122 37
145 3300005843 Ga0068860_100510103 Ga0068860_1005101033 37
146 3300005843 Ga0068860_100927180 Ga0068860_1009271802 37
147 3300005843 Ga0068860_101561868 Ga0068860_1015618682 37
148 3300005844 Ga0068862_100018644 Ga0068862_1000186448 37
149 3300005844 Ga0068862_100548369 Ga0068862_1005483692 37
150 3300005844 Ga0068862_100637367 Ga0068862_1006373672 37
151 3300005844 Ga0068862_100993517 Ga0068862_1009935173 37
152 3300005844 Ga0068862_101053379 Ga0068862_1010533792 37
153 3300005844 Ga0068862_101162947 Ga0068862_1011629471 37
154 3300005844 Ga0068862_101525407 Ga0068862_1015254072 37
155 3300005844 Ga0068862_101682817 Ga0068862_1016828172 37
156 3300005844 Ga0068862_102250380 Ga0068862_1022503802 37
157 3300005844 Ga0068862_102768703 Ga0068862_1027687032 37
158 3300005937 Ga0081455_10035348 Ga0081455_100353484 37
159 3300005937 Ga0081455_10044632 Ga0081455_100446325 37
160 3300005937 Ga0081455_10074572 Ga0081455_100745722 37
161 3300005937 Ga0081455_10112518 Ga0081455_101125183 37
162 3300005937 Ga0081455_10564665 Ga0081455_105646652 37
163 3300005981 Ga0081538_10003017 Ga0081538_1000301714 37
164 3300005981 Ga0081538_10127098 Ga0081538_101270982 37
165 3300005981 Ga0081538_10162889 Ga0081538_101628893 37
166 3300005983 Ga0081540_1007975 Ga0081540_10079753 37
167 3300005985 Ga0081539_10000233 Ga0081539_100002339 37
168 3300005985 Ga0081539_10000660 Ga0081539_1000066027 37
169 3300005985 Ga0081539_10000689 Ga0081539_100006896 37
170 3300005985 Ga0081539_10007364 Ga0081539_1000736411 37
171 3300005985 Ga0081539_10008891 Ga0081539_1000889116 37
172 3300005985 Ga0081539_10038073 Ga0081539_100380735 37
173 3300005985 Ga0081539_10044882 Ga0081539_100448822 37
174 3300005985 Ga0081539_10045884 Ga0081539_100458844 37
175 3300005985 Ga0081539_10248487 Ga0081539_102484872 37
176 3300005985 Ga0081539_10433120 Ga0081539_104331202 37
177 3300006028 Ga0070717_10038245 Ga0070717_100382454 37
178 3300006028 Ga0070717_10383457 Ga0070717_103834573 37
179 3300006028 Ga0070717_11475442 Ga0070717_114754422 37
180 3300006038 Ga0075365_10426932 Ga0075365_104269322 37
181 3300006038 Ga0075365_10632726 Ga0075365_106327261 37
182 3300006038 Ga0075365_10665684 Ga0075365_106656842 37
183 3300006042 Ga0075368_10164915 Ga0075368_101649151 37
184 3300006048 Ga0075363_100080318 Ga0075363_1000803182 37
185 3300006048 Ga0075363_100099362 Ga0075363_1000993623 37
186 3300006048 Ga0075363_100434498 Ga0075363_1004344982 37
187 3300006048 Ga0075363_100453680 Ga0075363_1004536803 37
188 3300006048 Ga0075363_100559258 Ga0075363_1005592583 37
189 3300006048 Ga0075363_100829093 Ga0075363_1008290932 37
190 3300006051 Ga0075364_10020130 Ga0075364_100201306 37
191 3300006051 Ga0075364_10075343 Ga0075364_100753434 37
192 3300006051 Ga0075364_10340956 Ga0075364_103409561 37
193 3300006051 Ga0075364_10525841 Ga0075364_105258412 37
194 3300006051 Ga0075364_10538228 Ga0075364_105382283 37
195 3300006051 Ga0075364_11005909 Ga0075364_110059091 37
196 3300006051 Ga0075364_11028086 Ga0075364_110280863 37
197 3300006051 Ga0075364_11182459 Ga0075364_111824592 37
198 3300006051 Ga0075364_11256183 Ga0075364_112561832 37
199 3300006058 Ga0075432_10008199 Ga0075432_100081992 37
200 3300006058 Ga0075432_10106938 Ga0075432_101069382 37
201 3300006058 Ga0075432_10459022 Ga0075432_104590221 37
202 3300006163 Ga0070715_10010443 Ga0070715_100104435 37
203 3300006163 Ga0070715_10087349 Ga0070715_100873494 37
204 3300006173 Ga0070716_100013911 Ga0070716_1000139111 37
205 3300006173 Ga0070716_100461060 Ga0070716_1004610601 37
206 3300006173 Ga0070716_100507418 Ga0070716_1005074182 37
207 3300006175 Ga0070712_100075701 Ga0070712_1000757014 37
208 3300006175 Ga0070712_100392285 Ga0070712_1003922853 37
209 3300006175 Ga0070712_100584654 Ga0070712_1005846543 37
210 3300006177 Ga0075362_10040120 Ga0075362_100401203 37
211 3300006177 Ga0075362_10073691 Ga0075362_100736914 37
212 3300006177 Ga0075362_10114477 Ga0075362_101144772 37
213 3300006177 Ga0075362_10158752 Ga0075362_101587522 37
214 3300006177 Ga0075362_10185337 Ga0075362_101853372 37
215 3300006177 Ga0075362_10220573 Ga0075362_102205731 37
216 3300006177 Ga0075362_10335164 Ga0075362_103351643 37
217 3300006177 Ga0075362_10488436 Ga0075362_104884363 37
218 3300006178 Ga0075367_10197995 Ga0075367_101979953 37
219 3300006178 Ga0075367_10341519 Ga0075367_103415193 37
220 3300006178 Ga0075367_10469700 Ga0075367_104697003 37
221 3300006178 Ga0075367_10578563 Ga0075367_105785633 37
222 3300006186 Ga0075369_10038643 Ga0075369_100386432 37
223 3300006186 Ga0075369_10071586 Ga0075369_100715863 37
224 3300006186 Ga0075369_10158293 Ga0075369_101582932 37
225 3300006195 Ga0075366_10000795 Ga0075366_1000079513 37
226 3300006195 Ga0075366_10014659 Ga0075366_100146596 37
227 3300006195 Ga0075366_10028911 Ga0075366_100289113 37
228 3300006195 Ga0075366_10042212 Ga0075366_100422124 37
229 3300006195 Ga0075366_10054314 Ga0075366_100543144 37
230 3300006195 Ga0075366_10054872 Ga0075366_100548724 37
231 3300006195 Ga0075366_10075085 Ga0075366_100750855 37
232 3300006195 Ga0075366_10078756 Ga0075366_100787564 37
233 3300006195 Ga0075366_10193988 Ga0075366_101939882 37
234 3300006195 Ga0075366_10225150 Ga0075366_102251503 37
235 3300006195 Ga0075366_10239297 Ga0075366_102392973 37
236 3300006195 Ga0075366_10341476 Ga0075366_103414762 37
237 3300006195 Ga0075366_10574303 Ga0075366_105743032 37
238 3300006195 Ga0075366_10587875 Ga0075366_105878752 37
239 3300006195 Ga0075366_10776954 Ga0075366_107769542 37
240 3300006195 Ga0075366_10848667 Ga0075366_108486672 37
241 3300006195 Ga0075366_10951417 Ga0075366_109514172 37
242 3300006237 Ga0097621_100001348 Ga0097621_1000013489 37
243 3300006237 Ga0097621_100024717 Ga0097621_1000247173 37
244 3300006237 Ga0097621_100096448 Ga0097621_1000964482 37
245 3300006237 Ga0097621_100124757 Ga0097621_1001247574 37
246 3300006237 Ga0097621_100207019 Ga0097621_1002070194 37
247 3300006237 Ga0097621_100208978 Ga0097621_1002089782 37
248 3300006237 Ga0097621_100366457 Ga0097621_1003664573 37
249 3300006237 Ga0097621_100610857 Ga0097621_1006108572 37
250 3300006237 Ga0097621_100669172 Ga0097621_1006691722 37
251 3300006237 Ga0097621_100743523 Ga0097621_1007435233 37
252 3300006237 Ga0097621_100751208 Ga0097621_1007512082 37
253 3300006237 Ga0097621_101553071 Ga0097621_1015530712 37
254 3300006237 Ga0097621_101782504 Ga0097621_1017825042 37
255 3300006237 Ga0097621_102135520 Ga0097621_1021355201 37
256 3300006237 Ga0097621_102198545 Ga0097621_1021985452 37
257 3300006237 Ga0097621_102293204 Ga0097621_1022932042 37
258 3300006353 Ga0075370_10007567 Ga0075370_100075673 37
259 3300006353 Ga0075370_10011014 Ga0075370_100110142 37
260 3300006353 Ga0075370_10017764 Ga0075370_100177646 37
261 3300006353 Ga0075370_10092179 Ga0075370_100921793 37
262 3300006353 Ga0075370_10109456 Ga0075370_101094562 37
263 3300006353 Ga0075370_10113192 Ga0075370_101131924 37
264 3300006353 Ga0075370_10116063 Ga0075370_101160633 37
265 3300006353 Ga0075370_10332946 Ga0075370_103329463 37
266 3300006353 Ga0075370_10437230 Ga0075370_104372302 37
267 3300006353 Ga0075370_10527626 Ga0075370_105276263 37
268 3300006353 Ga0075370_10602466 Ga0075370_106024662 37
269 3300006353 Ga0075370_10653001 Ga0075370_106530012 37
270 3300006358 Ga0068871_100000763 Ga0068871_10000076323 37
271 3300006358 Ga0068871_100088427 Ga0068871_1000884272 37
272 3300006358 Ga0068871_100113535 Ga0068871_1001135353 37
273 3300006358 Ga0068871_100182341 Ga0068871_1001823413 37
274 3300006358 Ga0068871_100222248 Ga0068871_1002222483 37
275 3300006358 Ga0068871_100225065 Ga0068871_1002250653 37
276 3300006358 Ga0068871_100278445 Ga0068871_1002784453 37
277 3300006358 Ga0068871_100309390 Ga0068871_1003093903 37
278 3300006358 Ga0068871_100450337 Ga0068871_1004503373 37
279 3300006358 Ga0068871_101389404 Ga0068871_1013894041 37
280 3300006358 Ga0068871_101583364 Ga0068871_1015833642 37
281 3300006358 Ga0068871_101659950 Ga0068871_1016599502 37
282 3300006358 Ga0068871_101728194 Ga0068871_1017281942 37
283 3300006358 Ga0068871_101985762 Ga0068871_1019857622 37
284 3300006358 Ga0068871_102005629 Ga0068871_1020056292 37
285 3300006844 Ga0075428_100087301 Ga0075428_1000873013 37
286 3300006844 Ga0075428_100097922 Ga0075428_1000979224 37
287 3300006844 Ga0075428_100124570 Ga0075428_1001245702 37
288 3300006844 Ga0075428_100282280 Ga0075428_1002822803 37
289 3300006844 Ga0075428_100368653 Ga0075428_1003686532 37
290 3300006844 Ga0075428_101323128 Ga0075428_1013231282 37
291 3300006846 Ga0075430_100000579 Ga0075430_10000057925 37
292 3300006846 Ga0075430_100032221 Ga0075430_1000322216 37
293 3300006846 Ga0075430_100082925 Ga0075430_1000829252 37
294 3300006846 Ga0075430_100116646 Ga0075430_1001166463 37
295 3300006846 Ga0075430_100240174 Ga0075430_1002401741 37
296 3300006846 Ga0075430_100338621 Ga0075430_1003386212 37
297 3300006846 Ga0075430_100523350 Ga0075430_1005233503 37
298 3300006846 Ga0075430_100632489 Ga0075430_1006324891 37
299 3300006847 Ga0075431_100004619 Ga0075431_1000046198 37
300 3300006847 Ga0075431_100033449 Ga0075431_10003344911 37
301 3300006847 Ga0075431_100039016 Ga0075431_1000390168 37
302 3300006847 Ga0075431_100048983 Ga0075431_1000489836 37
303 3300006847 Ga0075431_100135194 Ga0075431_1001351943 37
304 3300006847 Ga0075431_100529656 Ga0075431_1005296563 37
305 3300006847 Ga0075431_100570676 Ga0075431_1005706764 37
306 3300006847 Ga0075431_100740948 Ga0075431_1007409482 37
307 3300006847 Ga0075431_100966651 Ga0075431_1009666512 37
308 3300006847 Ga0075431_101972812 Ga0075431_1019728121 37
309 3300006852 Ga0075433_10051780 Ga0075433_100517804 37
310 3300006852 Ga0075433_10059655 Ga0075433_100596556 37
311 3300006852 Ga0075433_10069107 Ga0075433_100691072 37
312 3300006852 Ga0075433_11244275 Ga0075433_112442752 37
313 3300006871 Ga0075434_100000895 Ga0075434_10000089514 37
314 3300006871 Ga0075434_100154481 Ga0075434_1001544814 37
315 3300006871 Ga0075434_100307744 Ga0075434_1003077442 37
316 3300006871 Ga0075434_100490516 Ga0075434_1004905162 37
317 3300006871 Ga0075434_100742653 Ga0075434_1007426532 37
318 3300006871 Ga0075434_101186336 Ga0075434_1011863363 37
319 3300006871 Ga0075434_101704716 Ga0075434_1017047162 37
320 3300006880 Ga0075429_100005626 Ga0075429_1000056263 37
321 3300006880 Ga0075429_100096242 Ga0075429_1000962424 37
322 3300006880 Ga0075429_100169669 Ga0075429_1001696692 37
323 3300006880 Ga0075429_100762692 Ga0075429_1007626922 37
324 3300006880 Ga0075429_100811117 Ga0075429_1008111172 37
325 3300006880 Ga0075429_100834561 Ga0075429_1008345613 37
326 3300006880 Ga0075429_101708931 Ga0075429_1017089312 37
327 3300006881 Ga0068865_100025006 Ga0068865_1000250062 37
328 3300006881 Ga0068865_100171827 Ga0068865_1001718273 37
329 3300006881 Ga0068865_100546122 Ga0068865_1005461223 37
330 3300006881 Ga0068865_100859042 Ga0068865_1008590422 37
331 3300006881 Ga0068865_101116693 Ga0068865_1011166932 37
332 3300006914 Ga0075436_100000458 Ga0075436_10000045818 37
333 3300006914 Ga0075436_100000862 Ga0075436_1000008627 37
334 3300006914 Ga0075436_100021757 Ga0075436_1000217576 37
335 3300006914 Ga0075436_100131466 Ga0075436_1001314662 37
336 3300006914 Ga0075436_100224062 Ga0075436_1002240623 37
337 3300006914 Ga0075436_100327852 Ga0075436_1003278522 37
338 3300006914 Ga0075436_100439590 Ga0075436_1004395903 37
339 3300006914 Ga0075436_101017769 Ga0075436_1010177692 37
340 3300006914 Ga0075436_101273876 Ga0075436_1012738762 37
341 3300006931 Ga0097620_100054995 Ga0097620_1000549956 37
342 3300006931 Ga0097620_100106014 Ga0097620_1001060142 37
343 3300006931 Ga0097620_100150202 Ga0097620_1001502023 37
344 3300006931 Ga0097620_100150720 Ga0097620_1001507205 37
345 3300006931 Ga0097620_100179650 Ga0097620_1001796503 37
346 3300006931 Ga0097620_100602512 Ga0097620_1006025122 37
347 3300006931 Ga0097620_101001383 Ga0097620_1010013832 37
348 3300006931 Ga0097620_101200512 Ga0097620_1012005122 37
349 3300006931 Ga0097620_101395558 Ga0097620_1013955582 37
350 3300006931 Ga0097620_102326491 Ga0097620_1023264911 37
351 3300006931 Ga0097620_102756194 Ga0097620_1027561942 37
352 3300006946 Ga0079104_1012935 Ga0079104_10129352 37
353 3300006948 Ga0099826_10043156 Ga0099826_100431562 37
354 3300007076 Ga0075435_100015133 Ga0075435_1000151334 37
355 3300007076 Ga0075435_100054944 Ga0075435_1000549445 37
356 3300007076 Ga0075435_100055171 Ga0075435_1000551714 37
357 3300007076 Ga0075435_100070767 Ga0075435_1000707674 37
358 3300007076 Ga0075435_100076334 Ga0075435_1000763343 37
359 3300007076 Ga0075435_100393409 Ga0075435_1003934092 37
360 3300007076 Ga0075435_100399085 Ga0075435_1003990851 37
361 3300007076 Ga0075435_100546858 Ga0075435_1005468581 37
362 3300007076 Ga0075435_100612268 Ga0075435_1006122682 37
363 3300007076 Ga0075435_100682889 Ga0075435_1006828892 37
364 3300007076 Ga0075435_100748354 Ga0075435_1007483542 37
365 3300007076 Ga0075435_101044973 Ga0075435_1010449732 37
366 3300007265 Ga0099794_10210147 Ga0099794_102101473 37
367 3300007265 Ga0099794_10596485 Ga0099794_105964852 37
368 3300009036 Ga0105244_10148436 Ga0105244_101484362 37
369 3300009093 Ga0105240_10018079 Ga0105240_100180794 37
370 3300009093 Ga0105240_10188805 Ga0105240_101888053 37
371 3300009093 Ga0105240_10249436 Ga0105240_102494362 37
372 3300009093 Ga0105240_12359451 Ga0105240_123594512 37
373 3300009093 Ga0105240_12387206 Ga0105240_123872061 37
374 3300009094 Ga0111539_10005656 Ga0111539_1000565624 37
375 3300009094 Ga0111539_10006016 Ga0111539_100060166 37
376 3300009094 Ga0111539_10019122 Ga0111539_1001912210 37
377 3300009094 Ga0111539_10079597 Ga0111539_100795975 37
378 3300009094 Ga0111539_10131868 Ga0111539_101318683 37
379 3300009094 Ga0111539_10256134 Ga0111539_102561345 37
380 3300009094 Ga0111539_11025035 Ga0111539_110250353 37
381 3300009094 Ga0111539_11598667 Ga0111539_115986672 37
382 3300009094 Ga0111539_11764982 Ga0111539_117649821 37
383 3300009094 Ga0111539_12495534 Ga0111539_124955342 37
384 3300009094 Ga0111539_12733018 Ga0111539_127330181 37
385 3300009094 Ga0111539_12900970 Ga0111539_129009702 37
386 3300009098 Ga0105245_10392784 Ga0105245_103927842 37
387 3300009098 Ga0105245_10673540 Ga0105245_106735402 37
388 3300009098 Ga0105245_10766643 Ga0105245_107666433 37
389 3300009098 Ga0105245_10913661 Ga0105245_109136613 37
390 3300009098 Ga0105245_12007432 Ga0105245_120074322 37
391 3300009098 Ga0105245_12212623 Ga0105245_122126232 37
392 3300009098 Ga0105245_12220271 Ga0105245_122202712 37
393 3300009098 Ga0105245_12334787 Ga0105245_123347871 37
394 3300009098 Ga0105245_12892527 Ga0105245_128925272 37
395 3300009101 Ga0105247_10136395 Ga0105247_101363954 37
396 3300009101 Ga0105247_10629098 Ga0105247_106290981 37
397 3300009101 Ga0105247_10718569 Ga0105247_107185691 37
398 3300009101 Ga0105247_10756847 Ga0105247_107568473 37
399 3300009101 Ga0105247_11569819 Ga0105247_115698192 37
400 3300009101 Ga0105247_11824737 Ga0105247_118247372 37
401 3300009147 Ga0114129_10013928 Ga0114129_1001392811 37
402 3300009147 Ga0114129_10195739 Ga0114129_101957393 37
403 3300009147 Ga0114129_10203927 Ga0114129_102039276 37
404 3300009147 Ga0114129_11140783 Ga0114129_111407833 37
405 3300009147 Ga0114129_11375899 Ga0114129_113758992 37
406 3300009147 Ga0114129_11496916 Ga0114129_114969162 37
407 3300009147 Ga0114129_12012902 Ga0114129_120129022 37
408 3300009147 Ga0114129_12851616 Ga0114129_128516162 37
409 3300009147 Ga0114129_12989345 Ga0114129_129893452 37
410 3300009147 Ga0114129_13337358 Ga0114129_133373582 37
411 3300009148 Ga0105243_10010767 Ga0105243_100107672 37
412 3300009148 Ga0105243_10137487 Ga0105243_101374873 37
413 3300009148 Ga0105243_10311217 Ga0105243_103112172 37
414 3300009148 Ga0105243_10333269 Ga0105243_103332693 37
415 3300009148 Ga0105243_10462093 Ga0105243_104620931 37
416 3300009148 Ga0105243_10643911 Ga0105243_106439113 37
417 3300009148 Ga0105243_10770123 Ga0105243_107701232 37
418 3300009148 Ga0105243_10924901 Ga0105243_109249013 37
419 3300009148 Ga0105243_11213624 Ga0105243_112136242 37
420 3300009148 Ga0105243_11247047 Ga0105243_112470472 37
421 3300009148 Ga0105243_12935356 Ga0105243_129353562 37
422 3300009174 Ga0105241_10162367 Ga0105241_101623673 37
423 3300009174 Ga0105241_10272185 Ga0105241_102721853 37
424 3300009174 Ga0105241_10298470 Ga0105241_102984703 37
425 3300009174 Ga0105241_10325869 Ga0105241_103258693 37
426 3300009174 Ga0105241_10370720 Ga0105241_103707202 37
427 3300009174 Ga0105241_10428996 Ga0105241_104289963 37
428 3300009174 Ga0105241_11357110 Ga0105241_113571103 37
429 3300009176 Ga0105242_10048621 Ga0105242_100486212 37
430 3300009176 Ga0105242_10072922 Ga0105242_100729222 37
431 3300009176 Ga0105242_10126169 Ga0105242_101261693 37
432 3300009176 Ga0105242_10138198 Ga0105242_101381984 37
433 3300009176 Ga0105242_10195673 Ga0105242_101956732 37
434 3300009176 Ga0105242_10267504 Ga0105242_102675043 37
435 3300009176 Ga0105242_10289121 Ga0105242_102891212 37
436 3300009176 Ga0105242_10440962 Ga0105242_104409623 37
437 3300009176 Ga0105242_10469397 Ga0105242_104693973 37
438 3300009176 Ga0105242_10627434 Ga0105242_106274342 37
439 3300009176 Ga0105242_10832377 Ga0105242_108323772 37
440 3300009176 Ga0105242_11000208 Ga0105242_110002082 37
441 3300009176 Ga0105242_11331164 Ga0105242_113311642 37
442 3300009176 Ga0105242_12441393 Ga0105242_124413932 37
443 3300009176 Ga0105242_12479014 Ga0105242_124790142 37
444 3300009176 Ga0105242_13299126 Ga0105242_132991262 37
445 3300009177 Ga0105248_10133714 Ga0105248_101337144 37
446 3300009177 Ga0105248_10419639 Ga0105248_104196393 37
447 3300009177 Ga0105248_10461064 Ga0105248_104610643 37
448 3300009177 Ga0105248_10529875 Ga0105248_105298752 37
449 3300009177 Ga0105248_10689668 Ga0105248_106896682 37
450 3300009177 Ga0105248_10798576 Ga0105248_107985763 37
451 3300009177 Ga0105248_11086134 Ga0105248_110861342 37
452 3300009177 Ga0105248_11316820 Ga0105248_113168202 37
453 3300009177 Ga0105248_11411911 Ga0105248_114119112 37
454 3300009177 Ga0105248_11564172 Ga0105248_115641722 37
455 3300009177 Ga0105248_12638725 Ga0105248_126387252 37
456 3300009177 Ga0105248_12697223 Ga0105248_126972232 37
457 3300009177 Ga0105248_12774179 Ga0105248_127741792 37
458 3300009177 Ga0105248_12993084 Ga0105248_129930842 37
459 3300009545 Ga0105237_10000668 Ga0105237_1000066837 37
460 3300009545 Ga0105237_10508405 Ga0105237_105084053 37
461 3300009545 Ga0105237_10852424 Ga0105237_108524243 37
462 3300009551 Ga0105238_10003926 Ga0105238_100039265 37
463 3300009551 Ga0105238_10150486 Ga0105238_101504864 37
464 3300009551 Ga0105238_10618909 Ga0105238_106189093 37
465 3300009551 Ga0105238_10668360 Ga0105238_106683602 37
466 3300009551 Ga0105238_10790415 Ga0105238_107904152 37
467 3300009551 Ga0105238_10845591 Ga0105238_108455912 37
468 3300009551 Ga0105238_11344769 Ga0105238_113447692 37
469 3300009551 Ga0105238_11503519 Ga0105238_115035192 37
470 3300009551 Ga0105238_11693268 Ga0105238_116932682 37
471 3300009551 Ga0105238_12026197 Ga0105238_120261972 37
472 3300009551 Ga0105238_12433131 Ga0105238_124331311 37
473 3300009551 Ga0105238_13051953 Ga0105238_130519532 37
474 3300009553 Ga0105249_10010299 Ga0105249_100102995 37
475 3300009553 Ga0105249_10027358 Ga0105249_100273586 37
476 3300009553 Ga0105249_10045286 Ga0105249_100452865 37
477 3300009553 Ga0105249_10752296 Ga0105249_107522963 37
478 3300009553 Ga0105249_11710414 Ga0105249_117104142 37
479 3300009553 Ga0105249_13403989 Ga0105249_134039892 37
480 3300010375 Ga0105239_10001255 Ga0105239_1000125525 37
481 3300010375 Ga0105239_10664913 Ga0105239_106649131 37
482 3300010375 Ga0105239_10700661 Ga0105239_107006613 37
483 3300010375 Ga0105239_12737696 Ga0105239_127376962 37
484 3300010375 Ga0105239_13286151 Ga0105239_132861511 37
485 3300010375 Ga0105239_13583782 Ga0105239_135837822 37
486 3300011119 Ga0105246_10011361 Ga0105246_100113613 37
487 3300011119 Ga0105246_10161171 Ga0105246_101611713 37
488 3300011119 Ga0105246_10211478 Ga0105246_102114783 37
489 3300011119 Ga0105246_10455178 Ga0105246_104551782 37
490 3300011119 Ga0105246_10752211 Ga0105246_107522111 37
491 3300011119 Ga0105246_10956253 Ga0105246_109562533 37
492 3300012483 Ga0157337_1031430 Ga0157337_10314302 37
493 3300012488 Ga0157343_1026992 Ga0157343_10269921 37
494 3300012490 Ga0157322_1000335 Ga0157322_10003352 37
495 3300012491 Ga0157329_1026328 Ga0157329_10263281 37
496 3300012492 Ga0157335_1015274 Ga0157335_10152742 37
497 3300012495 Ga0157323_1004958 Ga0157323_10049582 37
498 3300012497 Ga0157319_1024820 Ga0157319_10248202 37
499 3300012498 Ga0157345_1001596 Ga0157345_10015962 37
500 3300012502 Ga0157347_1007541 Ga0157347_10075412 37
501 3300012503 Ga0157313_1031806 Ga0157313_10318062 37
502 3300012505 Ga0157339_1001382 Ga0157339_10013822 37
503 3300012505 Ga0157339_1004914 Ga0157339_10049143 37
504 3300012505 Ga0157339_1014791 Ga0157339_10147913 37
505 3300012508 Ga0157315_1003945 Ga0157315_10039452 37
506 3300012510 Ga0157316_1017552 Ga0157316_10175522 37
507 3300012512 Ga0157327_1017780 Ga0157327_10177802 37
508 3300012512 Ga0157327_1024572 Ga0157327_10245722 37
509 3300013100 Ga0157373_10195615 Ga0157373_101956151 37
510 3300013100 Ga0157373_10597211 Ga0157373_105972112 37
511 3300013100 Ga0157373_10647448 Ga0157373_106474482 37
512 3300013100 Ga0157373_11344883 Ga0157373_113448831 37
513 3300013102 Ga0157371_10248073 Ga0157371_102480733 37
514 3300013102 Ga0157371_10489763 Ga0157371_104897632 37
515 3300013102 Ga0157371_10789486 Ga0157371_107894863 37
516 3300013104 Ga0157370_10640531 Ga0157370_106405312 37
517 3300013104 Ga0157370_10865376 Ga0157370_108653762 37
518 3300013104 Ga0157370_11070726 Ga0157370_110707262 37
519 3300013104 Ga0157370_11426723 Ga0157370_114267231 37
520 3300013105 Ga0157369_10006334 Ga0157369_1000633424 37
521 3300013105 Ga0157369_10018025 Ga0157369_100180254 37
522 3300013105 Ga0157369_10345919 Ga0157369_103459193 37
523 3300013105 Ga0157369_10711853 Ga0157369_107118533 37
524 3300013105 Ga0157369_11329350 Ga0157369_113293502 37
525 3300013296 Ga0157374_10300435 Ga0157374_103004354 37
526 3300013296 Ga0157374_10633120 Ga0157374_106331203 37
527 3300013296 Ga0157374_11076256 Ga0157374_110762563 37
528 3300013296 Ga0157374_11379308 Ga0157374_113793083 37
529 3300013297 Ga0157378_10557092 Ga0157378_105570922 37
530 3300013297 Ga0157378_10944100 Ga0157378_109441002 37
531 3300013297 Ga0157378_10979509 Ga0157378_109795092 37
532 3300013297 Ga0157378_11424863 Ga0157378_114248632 37
533 3300013297 Ga0157378_11448689 Ga0157378_114486892 37
534 3300013297 Ga0157378_11710054 Ga0157378_117100542 37
535 3300013297 Ga0157378_11727807 Ga0157378_117278072 37
536 3300013297 Ga0157378_12015437 Ga0157378_120154373 37
537 3300013297 Ga0157378_12178604 Ga0157378_121786042 37
538 3300013297 Ga0157378_12191731 Ga0157378_121917312 37
539 3300013297 Ga0157378_12593783 Ga0157378_125937833 37
540 3300013297 Ga0157378_12671924 Ga0157378_126719242 37
541 3300013306 Ga0163162_10041519 Ga0163162_100415194 37
542 3300013306 Ga0163162_10100821 Ga0163162_101008214 37
543 3300013306 Ga0163162_10104771 Ga0163162_101047715 37
544 3300013306 Ga0163162_10136837 Ga0163162_101368373 37
545 3300013306 Ga0163162_10250633 Ga0163162_102506332 37
546 3300013306 Ga0163162_10380564 Ga0163162_103805641 37
547 3300013306 Ga0163162_10601059 Ga0163162_106010592 37
548 3300013306 Ga0163162_10774452 Ga0163162_107744522 37
549 3300013306 Ga0163162_11667155 Ga0163162_116671553 37
550 3300013306 Ga0163162_12199402 Ga0163162_121994022 37
551 3300013307 Ga0157372_10117437 Ga0157372_101174373 37
552 3300013307 Ga0157372_10336659 Ga0157372_103366594 37
553 3300013307 Ga0157372_10712653 Ga0157372_107126532 37
554 3300013307 Ga0157372_11157752 Ga0157372_111577522 37
555 3300013307 Ga0157372_11384338 Ga0157372_113843382 37
556 3300013307 Ga0157372_11975283 Ga0157372_119752832 37
557 3300013308 Ga0157375_10104130 Ga0157375_101041305 37
558 3300013308 Ga0157375_10445054 Ga0157375_104450543 37
559 3300013308 Ga0157375_10552720 Ga0157375_105527203 37
560 3300013308 Ga0157375_10788794 Ga0157375_107887943 37
561 3300014325 Ga0163163_10449795 Ga0163163_104497952 37
562 3300014325 Ga0163163_10605557 Ga0163163_106055574 37
563 3300014325 Ga0163163_10735633 Ga0163163_107356332 37
564 3300014325 Ga0163163_12066351 Ga0163163_120663513 37
565 3300014325 Ga0163163_12089854 Ga0163163_120898542 37
566 3300014326 Ga0157380_10019638 Ga0157380_100196388 37
567 3300014326 Ga0157380_10067462 Ga0157380_100674625 37
568 3300014326 Ga0157380_10394181 Ga0157380_103941813 37
569 3300014326 Ga0157380_11208815 Ga0157380_112088153 37
570 3300014326 Ga0157380_12101027 Ga0157380_121010272 37
571 3300014326 Ga0157380_12403644 Ga0157380_124036442 37
572 3300014326 Ga0157380_12967283 Ga0157380_129672832 37
573 3300014326 Ga0157380_13092981 Ga0157380_130929812 37
574 3300014497 Ga0182008_10036650 Ga0182008_100366504 37
575 3300014497 Ga0182008_10104535 Ga0182008_101045352 37
576 3300014497 Ga0182008_10293293 Ga0182008_102932932 37
577 3300014745 Ga0157377_10351102 Ga0157377_103511022 37
578 3300014745 Ga0157377_10578573 Ga0157377_105785732 37
579 3300014745 Ga0157377_11265991 Ga0157377_112659912 37
580 3300014968 Ga0157379_10000101 Ga0157379_1000010127 37
581 3300014968 Ga0157379_10063009 Ga0157379_100630096 37
582 3300014968 Ga0157379_10241188 Ga0157379_102411884 37
583 3300014968 Ga0157379_10565510 Ga0157379_105655103 37
584 3300014968 Ga0157379_10898922 Ga0157379_108989221 37
585 3300014968 Ga0157379_10927398 Ga0157379_109273982 37
586 3300014968 Ga0157379_10940404 Ga0157379_109404042 37
587 3300014968 Ga0157379_11113536 Ga0157379_111135362 37
588 3300014968 Ga0157379_11441036 Ga0157379_114410362 37
589 3300014969 Ga0157376_10019067 Ga0157376_1001906711 37
590 3300014969 Ga0157376_10073537 Ga0157376_100735375 37
591 3300014969 Ga0157376_10268618 Ga0157376_102686184 37
592 3300014969 Ga0157376_10357888 Ga0157376_103578883 37
593 3300014969 Ga0157376_10930518 Ga0157376_109305182 37
594 3300014969 Ga0157376_11162778 Ga0157376_111627782 37
595 3300014969 Ga0157376_11410533 Ga0157376_114105332 37
596 3300014969 Ga0157376_11702857 Ga0157376_117028572 37
597 3300015261 Ga0182006_1102890 Ga0182006_11028903 37
598 3300015261 Ga0182006_1187079 Ga0182006_11870792 37
599 3300015262 Ga0182007_10001322 Ga0182007_1000132215 37
600 3300015262 Ga0182007_10001550 Ga0182007_1000155013 37
601 3300015262 Ga0182007_10058101 Ga0182007_100581013 37
602 3300015262 Ga0182007_10367484 Ga0182007_103674842 37
603 3300015265 Ga0182005_1009589 Ga0182005_10095894 37
604 3300015265 Ga0182005_1064358 Ga0182005_10643582 37
605 3300015265 Ga0182005_1271275 Ga0182005_12712751 37
606 3300015683 Ga0183362_10007 Ga0183362_1000771 37
607 3300017792 Ga0163161_10026626 Ga0163161_100266266 37
608 3300017792 Ga0163161_10214289 Ga0163161_102142893 37
609 3300017792 Ga0163161_10396318 Ga0163161_103963181 37
610 3300017792 Ga0163161_10647602 Ga0163161_106476022 37
611 3300017792 Ga0163161_10742940 Ga0163161_107429402 37
612 3300017792 Ga0163161_10798380 Ga0163161_107983802 37
613 3300017792 Ga0163161_11385843 Ga0163161_113858432 37
614 3300017792 Ga0163161_11956107 Ga0163161_119561072 37
615 3300020069 Ga0197907_10798252 Ga0197907_107982522 37
616 3300020070 Ga0206356_10186274 Ga0206356_101862743 37
617 3300020070 Ga0206356_11548496 Ga0206356_115484962 37
618 3300020077 Ga0206351_10317039 Ga0206351_103170391 37
619 3300020078 Ga0206352_10522260 Ga0206352_105222601 37
620 3300020080 Ga0206350_10797579 Ga0206350_107975794 37
621 3300020081 Ga0206354_11296228 Ga0206354_112962281 37
622 3300021361 Ga0213872_10002765 Ga0213872_100027652 37
623 3300021361 Ga0213872_10008389 Ga0213872_100083897 37
624 3300021361 Ga0213872_10042043 Ga0213872_100420435 37
625 3300021384 Ga0213876_10005471 Ga0213876_1000547110 37
626 3300021384 Ga0213876_10214522 Ga0213876_102145222 37
627 3300021388 Ga0213875_10001291 Ga0213875_1000129118 37
628 3300022467 Ga0224712_10011440 Ga0224712_100114401 37
629 3300022467 Ga0224712_10056145 Ga0224712_100561454 37
630 3300023309 Ga0256744_136494 Ga0256744_1364941 37
631 3300025208 Ga0209436_110262 Ga0209436_1102622 37
632 3300025226 Ga0209674_119133 Ga0209674_1191332 37
633 3300025228 Ga0209672_100460 Ga0209672_10046014 37
634 3300025229 Ga0209147_101704 Ga0209147_10170410 37
635 3300025230 Ga0209563_100088 Ga0209563_10008867 37
636 3300025242 Ga0209258_100015 Ga0209258_100015176 37
637 3300025245 Ga0207425_1000229 Ga0207425_100022942 37
638 3300025254 Ga0209148_1000028 Ga0209148_1000028492 37
639 3300025256 Ga0209759_1040955 Ga0209759_10409552 37
640 3300025258 Ga0209129_1000049 Ga0209129_1000049181 37
641 3300025263 Ga0209565_1000259 Ga0209565_100025923 37
642 3300025263 Ga0209565_1006420 Ga0209565_10064205 37
643 3300025273 Ga0209673_1000193 Ga0209673_100019365 37
644 3300025273 Ga0209673_1013086 Ga0209673_10130863 37
645 3300025273 Ga0209673_1020554 Ga0209673_10205542 37
646 3300025284 Ga0209130_1011183 Ga0209130_10111834 37
647 3300025284 Ga0209130_1024374 Ga0209130_10243742 37
648 3300025291 Ga0209675_1000220 Ga0209675_100022065 37
649 3300025291 Ga0209675_1000683 Ga0209675_100068326 37
650 3300025291 Ga0209675_1018718 Ga0209675_10187184 37
651 3300025292 Ga0209676_1000137 Ga0209676_10001372 37
652 3300025292 Ga0209676_1004019 Ga0209676_10040196 37
653 3300025292 Ga0209676_1066453 Ga0209676_10664533 37
654 3300025294 Ga0209025_1000283 Ga0209025_10002834 37
655 3300025294 Ga0209025_1000707 Ga0209025_10007074 37
656 3300025294 Ga0209025_1072346 Ga0209025_10723462 37
657 3300025294 Ga0209025_1107843 Ga0209025_11078432 37
658 3300025295 Ga0209564_1023191 Ga0209564_10231912 37
659 3300025295 Ga0209564_1059620 Ga0209564_10596203 37
660 3300025297 Ga0209758_1000500 Ga0209758_10005001 37
661 3300025297 Ga0209758_1006862 Ga0209758_10068626 37
662 3300025298 Ga0209050_1000015 Ga0209050_1000015178 37
663 3300025298 Ga0209050_1004273 Ga0209050_10042733 37
664 3300025298 Ga0209050_1033028 Ga0209050_10330283 37
665 3300025298 Ga0209050_1059391 Ga0209050_10593913 37
666 3300025299 Ga0209256_1059387 Ga0209256_10593872 37
667 3300025299 Ga0209256_1062403 Ga0209256_10624032 37
668 3300025302 Ga0207426_1014799 Ga0207426_10147994 37
669 3300025302 Ga0207426_1014800 Ga0207426_10148004 37
670 3300025302 Ga0207426_1137638 Ga0207426_11376382 37
671 3300025303 Ga0209051_1000010 Ga0209051_1000010178 37
672 3300025303 Ga0209051_1002546 Ga0209051_10025465 37
673 3300025303 Ga0209051_1005321 Ga0209051_100532114 37
674 3300025303 Ga0209051_1035165 Ga0209051_10351652 37
675 3300025304 Ga0209257_1000026 Ga0209257_1000026500 37
676 3300025304 Ga0209257_1000047 Ga0209257_1000047391 37
677 3300025304 Ga0209257_1000205 Ga0209257_1000205143 37
678 3300025304 Ga0209257_1009149 Ga0209257_10091495 37
679 3300025315 Ga0207697_10138206 Ga0207697_101382063 37
680 3300025315 Ga0207697_10261195 Ga0207697_102611952 37
681 3300025321 Ga0207656_10001500 Ga0207656_100015006 37
682 3300025321 Ga0207656_10134788 Ga0207656_101347883 37
683 3300025321 Ga0207656_10136591 Ga0207656_101365914 37
684 3300025728 Ga0207655_1000800 Ga0207655_10008005 37
685 3300025885 Ga0207653_10000020 Ga0207653_1000002026 37
686 3300025885 Ga0207653_10196802 Ga0207653_101968022 37
687 3300025893 Ga0207682_10036976 Ga0207682_100369763 37
688 3300025893 Ga0207682_10057146 Ga0207682_100571463 37
689 3300025893 Ga0207682_10361686 Ga0207682_103616862 37
690 3300025898 Ga0207692_10258030 Ga0207692_102580302 37
691 3300025898 Ga0207692_10367816 Ga0207692_103678161 37
692 3300025898 Ga0207692_10569605 Ga0207692_105696052 37
693 3300025898 Ga0207692_10582552 Ga0207692_105825521 37
694 3300025899 Ga0207642_10006867 Ga0207642_100068675 37
695 3300025899 Ga0207642_10169807 Ga0207642_101698072 37
696 3300025899 Ga0207642_10229628 Ga0207642_102296282 37
697 3300025899 Ga0207642_10352100 Ga0207642_103521002 37
698 3300025899 Ga0207642_10366049 Ga0207642_103660493 37
699 3300025899 Ga0207642_10650750 Ga0207642_106507502 37
700 3300025900 Ga0207710_10136098 Ga0207710_101360983 37
701 3300025901 Ga0207688_10015650 Ga0207688_100156506 37
702 3300025901 Ga0207688_10091919 Ga0207688_100919191 37
703 3300025901 Ga0207688_10264511 Ga0207688_102645113 37
704 3300025901 Ga0207688_10736514 Ga0207688_107365142 37
705 3300025901 Ga0207688_11074528 Ga0207688_110745282 37
706 3300025903 Ga0207680_10099361 Ga0207680_100993612 37
707 3300025903 Ga0207680_10423180 Ga0207680_104231802 37
708 3300025903 Ga0207680_10641590 Ga0207680_106415903 37
709 3300025904 Ga0207647_10086749 Ga0207647_100867494 37
710 3300025905 Ga0207685_10079282 Ga0207685_100792823 37
711 3300025905 Ga0207685_10209134 Ga0207685_102091343 37
712 3300025905 Ga0207685_10644930 Ga0207685_106449302 37
713 3300025906 Ga0207699_10054989 Ga0207699_100549893 37
714 3300025906 Ga0207699_10497569 Ga0207699_104975692 37
715 3300025907 Ga0207645_10045061 Ga0207645_100450615 37
716 3300025907 Ga0207645_10080085 Ga0207645_100800853 37
717 3300025907 Ga0207645_10136871 Ga0207645_101368713 37
718 3300025907 Ga0207645_10216041 Ga0207645_102160411 37
719 3300025907 Ga0207645_10380941 Ga0207645_103809412 37
720 3300025907 Ga0207645_11122351 Ga0207645_111223513 37
721 3300025908 Ga0207643_10070404 Ga0207643_100704044 37
722 3300025908 Ga0207643_10091032 Ga0207643_100910323 37
723 3300025908 Ga0207643_10319370 Ga0207643_103193702 37
724 3300025908 Ga0207643_10427435 Ga0207643_104274353 37
725 3300025908 Ga0207643_10561315 Ga0207643_105613153 37
726 3300025909 Ga0207705_10055659 Ga0207705_100556595 37
727 3300025909 Ga0207705_10078320 Ga0207705_100783203 37
728 3300025909 Ga0207705_10198578 Ga0207705_101985783 37
729 3300025909 Ga0207705_10529913 Ga0207705_105299131 37
730 3300025909 Ga0207705_11372026 Ga0207705_113720262 37
731 3300025910 Ga0207684_10032043 Ga0207684_100320436 37
732 3300025910 Ga0207684_10063333 Ga0207684_100633333 37
733 3300025910 Ga0207684_10089019 Ga0207684_100890193 37
734 3300025910 Ga0207684_10110116 Ga0207684_101101164 37
735 3300025910 Ga0207684_10170187 Ga0207684_101701873 37
736 3300025910 Ga0207684_10447333 Ga0207684_104473332 37
737 3300025910 Ga0207684_10517264 Ga0207684_105172643 37
738 3300025911 Ga0207654_10164286 Ga0207654_101642862 37
739 3300025911 Ga0207654_10170325 Ga0207654_101703253 37
740 3300025911 Ga0207654_10669833 Ga0207654_106698333 37
741 3300025911 Ga0207654_11204590 Ga0207654_112045902 37
742 3300025912 Ga0207707_10094896 Ga0207707_100948965 37
743 3300025912 Ga0207707_10305552 Ga0207707_103055522 37
744 3300025912 Ga0207707_10692209 Ga0207707_106922092 37
745 3300025913 Ga0207695_10010589 Ga0207695_100105896 37
746 3300025913 Ga0207695_10031032 Ga0207695_100310329 37
747 3300025913 Ga0207695_10191445 Ga0207695_101914452 37
748 3300025913 Ga0207695_10194094 Ga0207695_101940944 37
749 3300025913 Ga0207695_10224933 Ga0207695_102249332 37
750 3300025913 Ga0207695_11579154 Ga0207695_115791542 37
751 3300025914 Ga0207671_10004670 Ga0207671_100046703 37
752 3300025914 Ga0207671_10033433 Ga0207671_100334332 37
753 3300025915 Ga0207693_10058810 Ga0207693_100588105 37
754 3300025915 Ga0207693_10214708 Ga0207693_102147081 37
755 3300025915 Ga0207693_10523755 Ga0207693_105237552 37
756 3300025916 Ga0207663_10052476 Ga0207663_100524765 37
757 3300025916 Ga0207663_10492107 Ga0207663_104921071 37
758 3300025916 Ga0207663_10606871 Ga0207663_106068713 37
759 3300025916 Ga0207663_10912922 Ga0207663_109129222 37
760 3300025917 Ga0207660_10085454 Ga0207660_100854543 37
761 3300025917 Ga0207660_10511041 Ga0207660_105110412 37
762 3300025917 Ga0207660_11166019 Ga0207660_111660192 37
763 3300025917 Ga0207660_11437934 Ga0207660_114379342 37
764 3300025918 Ga0207662_10391807 Ga0207662_103918071 37
765 3300025918 Ga0207662_10445885 Ga0207662_104458852 37
766 3300025918 Ga0207662_10493437 Ga0207662_104934373 37
767 3300025918 Ga0207662_10598259 Ga0207662_105982592 37
768 3300025918 Ga0207662_10978211 Ga0207662_109782112 37
769 3300025918 Ga0207662_11162020 Ga0207662_111620202 37
770 3300025919 Ga0207657_10046891 Ga0207657_100468914 37
771 3300025919 Ga0207657_10127672 Ga0207657_101276724 37
772 3300025919 Ga0207657_10604487 Ga0207657_106044873 37
773 3300025919 Ga0207657_11125717 Ga0207657_111257172 37
774 3300025919 Ga0207657_11190498 Ga0207657_111904982 37
775 3300025920 Ga0207649_10075169 Ga0207649_100751694 37
776 3300025920 Ga0207649_10193924 Ga0207649_101939243 37
777 3300025921 Ga0207652_10109570 Ga0207652_101095705 37
778 3300025921 Ga0207652_10454216 Ga0207652_104542163 37
779 3300025921 Ga0207652_10749152 Ga0207652_107491523 37
780 3300025921 Ga0207652_10917699 Ga0207652_109176991 37
781 3300025922 Ga0207646_10192300 Ga0207646_101923003 37
782 3300025922 Ga0207646_10438908 Ga0207646_104389083 37
783 3300025922 Ga0207646_10742236 Ga0207646_107422362 37
784 3300025922 Ga0207646_11187118 Ga0207646_111871182 37
785 3300025923 Ga0207681_10000785 Ga0207681_100007853 37
786 3300025923 Ga0207681_10067424 Ga0207681_100674242 37
787 3300025923 Ga0207681_10197294 Ga0207681_101972942 37
788 3300025923 Ga0207681_10293628 Ga0207681_102936283 37
789 3300025923 Ga0207681_10435952 Ga0207681_104359523 37
790 3300025923 Ga0207681_10709818 Ga0207681_107098183 37
791 3300025923 Ga0207681_10906203 Ga0207681_109062032 37
792 3300025923 Ga0207681_11241736 Ga0207681_112417362 37
793 3300025924 Ga0207694_10004619 Ga0207694_1000461914 37
794 3300025924 Ga0207694_10015938 Ga0207694_100159385 37
795 3300025924 Ga0207694_10041314 Ga0207694_100413145 37
796 3300025924 Ga0207694_10503493 Ga0207694_105034933 37
797 3300025924 Ga0207694_10530285 Ga0207694_105302853 37
798 3300025924 Ga0207694_11312918 Ga0207694_113129181 37
799 3300025924 Ga0207694_11354556 Ga0207694_113545562 37
800 3300025925 Ga0207650_10623767 Ga0207650_106237672 37
801 3300025925 Ga0207650_10808755 Ga0207650_108087552 37
802 3300025925 Ga0207650_11687123 Ga0207650_116871233 37
803 3300025926 Ga0207659_10001704 Ga0207659_1000170424 37
804 3300025926 Ga0207659_10172515 Ga0207659_101725153 37
805 3300025926 Ga0207659_10626768 Ga0207659_106267683 37
806 3300025926 Ga0207659_11052261 Ga0207659_110522612 37
807 3300025926 Ga0207659_11450268 Ga0207659_114502682 37
808 3300025927 Ga0207687_10004768 Ga0207687_1000476810 37
809 3300025927 Ga0207687_10032731 Ga0207687_100327312 37
810 3300025927 Ga0207687_10170724 Ga0207687_101707244 37
811 3300025927 Ga0207687_10207843 Ga0207687_102078433 37
812 3300025927 Ga0207687_10248241 Ga0207687_102482413 37
813 3300025927 Ga0207687_10447809 Ga0207687_104478093 37
814 3300025927 Ga0207687_11350790 Ga0207687_113507902 37
815 3300025927 Ga0207687_11863969 Ga0207687_118639691 37
816 3300025928 Ga0207700_10014025 Ga0207700_100140258 37
817 3300025928 Ga0207700_10024523 Ga0207700_100245235 37
818 3300025928 Ga0207700_11128191 Ga0207700_111281912 37
819 3300025928 Ga0207700_11215145 Ga0207700_112151452 37
820 3300025929 Ga0207664_10035462 Ga0207664_100354623 37
821 3300025929 Ga0207664_10527664 Ga0207664_105276643 37
822 3300025931 Ga0207644_10443852 Ga0207644_104438522 37
823 3300025932 Ga0207690_10073593 Ga0207690_100735932 37
824 3300025932 Ga0207690_10429285 Ga0207690_104292852 37
825 3300025932 Ga0207690_10430837 Ga0207690_104308372 37
826 3300025932 Ga0207690_10670154 Ga0207690_106701541 37
827 3300025933 Ga0207706_10018751 Ga0207706_100187516 37
828 3300025933 Ga0207706_10055825 Ga0207706_100558254 37
829 3300025933 Ga0207706_10400034 Ga0207706_104000344 37
830 3300025933 Ga0207706_10718337 Ga0207706_107183373 37
831 3300025934 Ga0207686_10009661 Ga0207686_100096619 37
832 3300025934 Ga0207686_10018299 Ga0207686_100182998 37
833 3300025934 Ga0207686_10039279 Ga0207686_100392793 37
834 3300025934 Ga0207686_10145174 Ga0207686_101451743 37
835 3300025934 Ga0207686_10471253 Ga0207686_104712533 37
836 3300025934 Ga0207686_10615186 Ga0207686_106151862 37
837 3300025934 Ga0207686_10684122 Ga0207686_106841223 37
838 3300025934 Ga0207686_11078408 Ga0207686_110784082 37
839 3300025934 Ga0207686_11812223 Ga0207686_118122232 37
840 3300025935 Ga0207709_10012807 Ga0207709_100128078 37
841 3300025935 Ga0207709_10062560 Ga0207709_100625604 37
842 3300025935 Ga0207709_10087410 Ga0207709_100874104 37
843 3300025935 Ga0207709_10105358 Ga0207709_101053583 37
844 3300025935 Ga0207709_10304916 Ga0207709_103049162 37
845 3300025935 Ga0207709_10483853 Ga0207709_104838532 37
846 3300025935 Ga0207709_10727804 Ga0207709_107278042 37
847 3300025935 Ga0207709_10832672 Ga0207709_108326722 37
848 3300025935 Ga0207709_11385368 Ga0207709_113853682 37
849 3300025936 Ga0207670_10035507 Ga0207670_100355073 37
850 3300025936 Ga0207670_10089232 Ga0207670_100892323 37
851 3300025936 Ga0207670_10188169 Ga0207670_101881693 37
852 3300025936 Ga0207670_10250173 Ga0207670_102501733 37
853 3300025936 Ga0207670_10284676 Ga0207670_102846763 37
854 3300025936 Ga0207670_10287894 Ga0207670_102878944 37
855 3300025936 Ga0207670_11039009 Ga0207670_110390093 37
856 3300025936 Ga0207670_11770552 Ga0207670_117705522 37
857 3300025936 Ga0207670_11830110 Ga0207670_118301102 37
858 3300025936 Ga0207670_11872237 Ga0207670_118722372 37
859 3300025937 Ga0207669_10027248 Ga0207669_100272483 37
860 3300025937 Ga0207669_10039538 Ga0207669_100395385 37
861 3300025937 Ga0207669_10129626 Ga0207669_101296263 37
862 3300025937 Ga0207669_10333699 Ga0207669_103336991 37
863 3300025937 Ga0207669_10348904 Ga0207669_103489043 37
864 3300025937 Ga0207669_10463595 Ga0207669_104635953 37
865 3300025937 Ga0207669_10573908 Ga0207669_105739083 37
866 3300025937 Ga0207669_10817083 Ga0207669_108170832 37
867 3300025937 Ga0207669_11012854 Ga0207669_110128542 37
868 3300025937 Ga0207669_11935649 Ga0207669_119356491 37
869 3300025938 Ga0207704_10003227 Ga0207704_1000322711 37
870 3300025938 Ga0207704_10072779 Ga0207704_100727792 37
871 3300025938 Ga0207704_10942707 Ga0207704_109427072 37
872 3300025938 Ga0207704_10992688 Ga0207704_109926882 37
873 3300025939 Ga0207665_10177665 Ga0207665_101776652 37
874 3300025939 Ga0207665_10334877 Ga0207665_103348773 37
875 3300025939 Ga0207665_10765157 Ga0207665_107651571 37
876 3300025940 Ga0207691_10008862 Ga0207691_100088625 37
877 3300025940 Ga0207691_10028424 Ga0207691_100284244 37
878 3300025940 Ga0207691_10128652 Ga0207691_101286522 37
879 3300025940 Ga0207691_10138045 Ga0207691_101380453 37
880 3300025940 Ga0207691_10662958 Ga0207691_106629583 37
881 3300025940 Ga0207691_11472453 Ga0207691_114724531 37
882 3300025940 Ga0207691_11546157 Ga0207691_115461572 37
883 3300025941 Ga0207711_10272442 Ga0207711_102724423 37
884 3300025941 Ga0207711_10498744 Ga0207711_104987442 37
885 3300025941 Ga0207711_10794937 Ga0207711_107949373 37
886 3300025941 Ga0207711_10819348 Ga0207711_108193482 37
887 3300025942 Ga0207689_10054363 Ga0207689_100543636 37
888 3300025942 Ga0207689_10091170 Ga0207689_100911702 37
889 3300025942 Ga0207689_10115140 Ga0207689_101151403 37
890 3300025942 Ga0207689_10306061 Ga0207689_103060613 37
891 3300025942 Ga0207689_10343160 Ga0207689_103431604 37
892 3300025942 Ga0207689_10514894 Ga0207689_105148942 37
893 3300025942 Ga0207689_10548047 Ga0207689_105480472 37
894 3300025942 Ga0207689_10754787 Ga0207689_107547872 37
895 3300025942 Ga0207689_10994608 Ga0207689_109946082 37
896 3300025942 Ga0207689_11483960 Ga0207689_114839601 37
897 3300025942 Ga0207689_11668841 Ga0207689_116688412 37
898 3300025944 Ga0207661_10462622 Ga0207661_104626222 37
899 3300025944 Ga0207661_10906469 Ga0207661_109064692 37
900 3300025944 Ga0207661_10958265 Ga0207661_109582652 37
901 3300025945 Ga0207679_10005962 Ga0207679_100059622 37
902 3300025945 Ga0207679_10559371 Ga0207679_105593713 37
903 3300025945 Ga0207679_10821037 Ga0207679_108210373 37
904 3300025945 Ga0207679_10879886 Ga0207679_108798862 37
905 3300025949 Ga0207667_10046002 Ga0207667_100460026 37
906 3300025949 Ga0207667_10047925 Ga0207667_100479255 37
907 3300025949 Ga0207667_10092748 Ga0207667_100927484 37
908 3300025949 Ga0207667_10133891 Ga0207667_101338913 37
909 3300025949 Ga0207667_10195905 Ga0207667_101959053 37
910 3300025949 Ga0207667_10309845 Ga0207667_103098452 37
911 3300025960 Ga0207651_10151455 Ga0207651_101514554 37
912 3300025960 Ga0207651_10218411 Ga0207651_102184112 37
913 3300025960 Ga0207651_10325699 Ga0207651_103256993 37
914 3300025960 Ga0207651_10442753 Ga0207651_104427533 37
915 3300025960 Ga0207651_10473773 Ga0207651_104737732 37
916 3300025960 Ga0207651_10802727 Ga0207651_108027272 37
917 3300025960 Ga0207651_10931374 Ga0207651_109313741 37
918 3300025960 Ga0207651_11245381 Ga0207651_112453812 37
919 3300025960 Ga0207651_11475399 Ga0207651_114753992 37
920 3300025960 Ga0207651_11739325 Ga0207651_117393251 37
921 3300025960 Ga0207651_11873094 Ga0207651_118730941 37
922 3300025961 Ga0207712_10007287 Ga0207712_1000728713 37
923 3300025961 Ga0207712_10043169 Ga0207712_100431693 37
924 3300025961 Ga0207712_10050066 Ga0207712_100500665 37
925 3300025961 Ga0207712_10434653 Ga0207712_104346533 37
926 3300025961 Ga0207712_10688908 Ga0207712_106889081 37
927 3300025961 Ga0207712_11435301 Ga0207712_114353012 37
928 3300025972 Ga0207668_10104561 Ga0207668_101045614 37
929 3300025972 Ga0207668_10336682 Ga0207668_103366823 37
930 3300025972 Ga0207668_10739809 Ga0207668_107398093 37
931 3300025972 Ga0207668_11915350 Ga0207668_119153502 37
932 3300025981 Ga0207640_10407536 Ga0207640_104075363 37
933 3300025981 Ga0207640_10447474 Ga0207640_104474743 37
934 3300025981 Ga0207640_10580346 Ga0207640_105803462 37
935 3300025981 Ga0207640_10599106 Ga0207640_105991062 37
936 3300025981 Ga0207640_10670369 Ga0207640_106703693 37
937 3300025981 Ga0207640_10929399 Ga0207640_109293993 37
938 3300025986 Ga0207658_10473860 Ga0207658_104738601 37
939 3300025986 Ga0207658_10739760 Ga0207658_107397602 37
940 3300025986 Ga0207658_11137935 Ga0207658_111379352 37
941 3300025986 Ga0207658_12067139 Ga0207658_120671392 37
942 3300026023 Ga0207677_10165523 Ga0207677_101655234 37
943 3300026023 Ga0207677_10218695 Ga0207677_102186952 37
944 3300026023 Ga0207677_10382837 Ga0207677_103828373 37
945 3300026023 Ga0207677_10572303 Ga0207677_105723033 37
946 3300026023 Ga0207677_10658594 Ga0207677_106585943 37
947 3300026023 Ga0207677_10890763 Ga0207677_108907632 37
948 3300026023 Ga0207677_10939758 Ga0207677_109397582 37
949 3300026023 Ga0207677_11302172 Ga0207677_113021722 37
950 3300026023 Ga0207677_11722339 Ga0207677_117223392 37
951 3300026023 Ga0207677_12254367 Ga0207677_122543671 37
952 3300026035 Ga0207703_10014366 Ga0207703_100143666 37
953 3300026035 Ga0207703_10197682 Ga0207703_101976823 37
954 3300026035 Ga0207703_10335896 Ga0207703_103358964 37
955 3300026035 Ga0207703_10360566 Ga0207703_103605663 37
956 3300026035 Ga0207703_10966532 Ga0207703_109665322 37
957 3300026035 Ga0207703_11354912 Ga0207703_113549121 37
958 3300026035 Ga0207703_11692243 Ga0207703_116922432 37
959 3300026041 Ga0207639_10064481 Ga0207639_100644813 37
960 3300026041 Ga0207639_10127866 Ga0207639_101278663 37
961 3300026041 Ga0207639_10474076 Ga0207639_104740762 37
962 3300026041 Ga0207639_10564527 Ga0207639_105645272 37
963 3300026041 Ga0207639_10595836 Ga0207639_105958363 37
964 3300026041 Ga0207639_10603803 Ga0207639_106038032 37
965 3300026041 Ga0207639_11132795 Ga0207639_111327952 37
966 3300026041 Ga0207639_11142698 Ga0207639_111426982 37
967 3300026067 Ga0207678_10108665 Ga0207678_101086653 37
968 3300026067 Ga0207678_10547203 Ga0207678_105472033 37
969 3300026067 Ga0207678_11217370 Ga0207678_112173703 37
970 3300026067 Ga0207678_11480312 Ga0207678_114803123 37
971 3300026067 Ga0207678_11991798 Ga0207678_119917982 37
972 3300026075 Ga0207708_10030248 Ga0207708_100302486 37
973 3300026075 Ga0207708_10079820 Ga0207708_100798204 37
974 3300026075 Ga0207708_10084014 Ga0207708_100840144 37
975 3300026075 Ga0207708_10087579 Ga0207708_100875792 37
976 3300026075 Ga0207708_10137712 Ga0207708_101377124 37
977 3300026075 Ga0207708_10227552 Ga0207708_102275522 37
978 3300026075 Ga0207708_10303308 Ga0207708_103033083 37
979 3300026075 Ga0207708_10342839 Ga0207708_103428393 37
980 3300026075 Ga0207708_10360158 Ga0207708_103601582 37
981 3300026075 Ga0207708_10874775 Ga0207708_108747753 37
982 3300026075 Ga0207708_11318304 Ga0207708_113183042 37
983 3300026078 Ga0207702_10015403 Ga0207702_100154037 37
984 3300026078 Ga0207702_10502798 Ga0207702_105027982 37
985 3300026078 Ga0207702_10599666 Ga0207702_105996661 37
986 3300026078 Ga0207702_10649164 Ga0207702_106491642 37
987 3300026078 Ga0207702_11230634 Ga0207702_112306342 37
988 3300026078 Ga0207702_11822738 Ga0207702_118227382 37
989 3300026088 Ga0207641_10072790 Ga0207641_100727904 37
990 3300026088 Ga0207641_10166673 Ga0207641_101666733 37
991 3300026088 Ga0207641_10723489 Ga0207641_107234892 37
992 3300026088 Ga0207641_10728995 Ga0207641_107289953 37
993 3300026088 Ga0207641_11032001 Ga0207641_110320012 37
994 3300026088 Ga0207641_11290623 Ga0207641_112906233 37
995 3300026088 Ga0207641_12296676 Ga0207641_122966762 37
996 3300026089 Ga0207648_10009151 Ga0207648_1000915113 37
997 3300026089 Ga0207648_10092725 Ga0207648_100927255 37
998 3300026089 Ga0207648_10127764 Ga0207648_101277644 37
999 3300026089 Ga0207648_10302886 Ga0207648_103028863 37
1000 3300026089 Ga0207648_10392158 Ga0207648_103921582 37
1001 3300026089 Ga0207648_10599212 Ga0207648_105992121 37
1002 3300026089 Ga0207648_10605048 Ga0207648_106050482 37
1003 3300026089 Ga0207648_10903364 Ga0207648_109033641 37
1004 3300026089 Ga0207648_10922235 Ga0207648_109222352 37
1005 3300026089 Ga0207648_10927209 Ga0207648_109272092 37
1006 3300026089 Ga0207648_11043824 Ga0207648_110438242 37
1007 3300026089 Ga0207648_11224338 Ga0207648_112243382 37
1008 3300026089 Ga0207648_11242745 Ga0207648_112427452 37
1009 3300026089 Ga0207648_11274291 Ga0207648_112742913 37
1010 3300026095 Ga0207676_10170652 Ga0207676_101706524 37
1011 3300026095 Ga0207676_10192165 Ga0207676_101921653 37
1012 3300026095 Ga0207676_10266504 Ga0207676_102665044 37
1013 3300026095 Ga0207676_10544544 Ga0207676_105445443 37
1014 3300026095 Ga0207676_10691733 Ga0207676_106917331 37
1015 3300026095 Ga0207676_11770366 Ga0207676_117703663 37
1016 3300026116 Ga0207674_10081802 Ga0207674_100818025 37
1017 3300026116 Ga0207674_10181919 Ga0207674_101819193 37
1018 3300026116 Ga0207674_10233904 Ga0207674_102339043 37
1019 3300026116 Ga0207674_10349749 Ga0207674_103497493 37
1020 3300026116 Ga0207674_10718629 Ga0207674_107186292 37
1021 3300026116 Ga0207674_11320704 Ga0207674_113207042 37
1022 3300026116 Ga0207674_11344578 Ga0207674_113445782 37
1023 3300026116 Ga0207674_11722504 Ga0207674_117225041 37
1024 3300026118 Ga0207675_100004342 Ga0207675_10000434211 37
1025 3300026118 Ga0207675_100007445 Ga0207675_1000074454 37
1026 3300026118 Ga0207675_100125517 Ga0207675_1001255173 37
1027 3300026118 Ga0207675_100270227 Ga0207675_1002702272 37
1028 3300026118 Ga0207675_100289319 Ga0207675_1002893193 37
1029 3300026118 Ga0207675_100310188 Ga0207675_1003101883 37
1030 3300026118 Ga0207675_100356262 Ga0207675_1003562623 37
1031 3300026118 Ga0207675_100438797 Ga0207675_1004387972 37
1032 3300026118 Ga0207675_100483903 Ga0207675_1004839032 37
1033 3300026118 Ga0207675_100984356 Ga0207675_1009843563 37
1034 3300026118 Ga0207675_101857178 Ga0207675_1018571782 37
1035 3300026118 Ga0207675_102015076 Ga0207675_1020150762 37
1036 3300026121 Ga0207683_10073724 Ga0207683_100737242 37
1037 3300026121 Ga0207683_10201151 Ga0207683_102011513 37
1038 3300026121 Ga0207683_10203504 Ga0207683_102035042 37
1039 3300026121 Ga0207683_10207138 Ga0207683_102071383 37
1040 3300026121 Ga0207683_10390371 Ga0207683_103903712 37
1041 3300026121 Ga0207683_10652062 Ga0207683_106520623 37
1042 3300026121 Ga0207683_10712385 Ga0207683_107123851 37
1043 3300026121 Ga0207683_10944875 Ga0207683_109448751 37
1044 3300026121 Ga0207683_11245053 Ga0207683_112450532 37
1045 3300026142 Ga0207698_10010326 Ga0207698_100103265 37
1046 3300026142 Ga0207698_10018098 Ga0207698_100180989 37
1047 3300026142 Ga0207698_10062007 Ga0207698_100620074 37
1048 3300026142 Ga0207698_10075692 Ga0207698_100756923 37
1049 3300026142 Ga0207698_10429314 Ga0207698_104293142 37
1050 3300026142 Ga0207698_10497375 Ga0207698_104973753 37
1051 3300026142 Ga0207698_11031683 Ga0207698_110316833 37
1052 3300026142 Ga0207698_11615260 Ga0207698_116152602 37
1053 3300026142 Ga0207698_12612653 Ga0207698_126126531 37
1054 3300026142 Ga0207698_12701767 Ga0207698_127017673 37
1055 3300027111 Ga0209281_1014758 Ga0209281_10147584 37
1056 3300027360 Ga0209969_1002421 Ga0209969_10024213 37
1057 3300027360 Ga0209969_1006837 Ga0209969_10068374 37
1058 3300027360 Ga0209969_1034742 Ga0209969_10347422 37
1059 3300027364 Ga0209967_1001225 Ga0209967_10012256 37
1060 3300027364 Ga0209967_1002282 Ga0209967_10022823 37
1061 3300027364 Ga0209967_1004157 Ga0209967_10041574 37
1062 3300027378 Ga0209981_1000466 Ga0209981_10004668 37
1063 3300027378 Ga0209981_1020369 Ga0209981_10203692 37
1064 3300027395 Ga0209996_1001407 Ga0209996_10014075 37
1065 3300027395 Ga0209996_1005695 Ga0209996_10056953 37
1066 3300027395 Ga0209996_1012092 Ga0209996_10120922 37
1067 3300027395 Ga0209996_1014406 Ga0209996_10144063 37
1068 3300027395 Ga0209996_1029306 Ga0209996_10293061 37
1069 3300027424 Ga0209984_1010118 Ga0209984_10101183 37
1070 3300027462 Ga0210000_1001028 Ga0210000_10010283 37
1071 3300027462 Ga0210000_1001983 Ga0210000_10019834 37
1072 3300027462 Ga0210000_1002069 Ga0210000_10020695 37
1073 3300027462 Ga0210000_1003904 Ga0210000_10039043 37
1074 3300027462 Ga0210000_1054430 Ga0210000_10544303 37
1075 3300027471 Ga0209995_1001957 Ga0209995_10019573 37
1076 3300027471 Ga0209995_1003526 Ga0209995_10035265 37
1077 3300027471 Ga0209995_1006615 Ga0209995_10066153 37
1078 3300027471 Ga0209995_1012179 Ga0209995_10121791 37
1079 3300027471 Ga0209995_1017528 Ga0209995_10175283 37
1080 3300027526 Ga0209968_1012084 Ga0209968_10120843 37
1081 3300027526 Ga0209968_1058196 Ga0209968_10581963 37
1082 3300027526 Ga0209968_1088030 Ga0209968_10880303 37
1083 3300027543 Ga0209999_1004058 Ga0209999_10040585 37
1084 3300027543 Ga0209999_1007091 Ga0209999_10070914 37
1085 3300027543 Ga0209999_1007290 Ga0209999_10072903 37
1086 3300027543 Ga0209999_1012353 Ga0209999_10123533 37
1087 3300027543 Ga0209999_1026964 Ga0209999_10269643 37
1088 3300027552 Ga0209982_1015872 Ga0209982_10158723 37
1089 3300027614 Ga0209970_1019672 Ga0209970_10196723 37
1090 3300027665 Ga0209983_1005142 Ga0209983_10051425 37
1091 3300027665 Ga0209983_1007490 Ga0209983_10074904 37
1092 3300027665 Ga0209983_1019317 Ga0209983_10193173 37
1093 3300027666 Ga0209282_1003491 Ga0209282_100349113 37
1094 3300027682 Ga0209971_1000807 Ga0209971_10008072 37
1095 3300027682 Ga0209971_1012773 Ga0209971_10127734 37
1096 3300027682 Ga0209971_1028260 Ga0209971_10282603 37
1097 3300027695 Ga0209966_1005332 Ga0209966_10053323 37
1098 3300027695 Ga0209966_1011832 Ga0209966_10118323 37
1099 3300027717 Ga0209998_10026248 Ga0209998_100262483 37
1100 3300027866 Ga0209813_10087573 Ga0209813_100875731 37
1101 3300027876 Ga0209974_10001043 Ga0209974_100010436 37
1102 3300027876 Ga0209974_10002476 Ga0209974_1000247611 37
1103 3300027876 Ga0209974_10026410 Ga0209974_100264102 37
1104 3300027876 Ga0209974_10449305 Ga0209974_104493052 37
1105 3300027907 Ga0207428_10000940 Ga0207428_1000094012 37
1106 3300027907 Ga0207428_10005462 Ga0207428_100054624 37
1107 3300027907 Ga0207428_10007467 Ga0207428_100074677 37
1108 3300027907 Ga0207428_10030784 Ga0207428_100307846 37
1109 3300027907 Ga0207428_10494052 Ga0207428_104940522 37
1110 3300027907 Ga0207428_10638880 Ga0207428_106388801 37
1111 3300028379 Ga0268266_10012447 Ga0268266_100124475 37
1112 3300028379 Ga0268266_10024735 Ga0268266_100247355 37
1113 3300028379 Ga0268266_10114832 Ga0268266_101148324 37
1114 3300028379 Ga0268266_10135307 Ga0268266_101353074 37
1115 3300028379 Ga0268266_10774232 Ga0268266_107742322 37
1116 3300028379 Ga0268266_10900485 Ga0268266_109004852 37
1117 3300028379 Ga0268266_10953273 Ga0268266_109532731 37
1118 3300028380 Ga0268265_10000858 Ga0268265_1000085813 37
1119 3300028380 Ga0268265_10146043 Ga0268265_101460432 37
1120 3300028380 Ga0268265_10596469 Ga0268265_105964693 37
1121 3300028380 Ga0268265_10696899 Ga0268265_106968993 37
1122 3300028380 Ga0268265_11013953 Ga0268265_110139532 37
1123 3300028380 Ga0268265_11555381 Ga0268265_115553812 37
1124 3300028381 Ga0268264_10202065 Ga0268264_102020652 37
1125 3300028381 Ga0268264_10409275 Ga0268264_104092753 37
1126 3300028381 Ga0268264_10437381 Ga0268264_104373812 37
1127 3300028381 Ga0268264_10441794 Ga0268264_104417943 37
1128 3300028381 Ga0268264_10617353 Ga0268264_106173532 37
1129 3300028381 Ga0268264_10868462 Ga0268264_108684623 37
1130 3300028381 Ga0268264_11727172 Ga0268264_117271721 37
1131 3300028381 Ga0268264_12639375 Ga0268264_126393752 37
1132 3300028556 Ga0265337_1002965 Ga0265337_10029659 37
1133 3300028558 Ga0265326_10003019 Ga0265326_100030197 37
1134 3300028563 Ga0265319_1000335 Ga0265319_100033522 37
1135 3300028563 Ga0265319_1002743 Ga0265319_100274311 37
1136 3300028573 Ga0265334_10008628 Ga0265334_100086285 37
1137 3300028577 Ga0265318_10001647 Ga0265318_100016477 37
1138 3300028577 Ga0265318_10035150 Ga0265318_100351503 37
1139 3300028786 Ga0307517_10047808 Ga0307517_100478086 37
1140 3300028786 Ga0307517_10142364 Ga0307517_101423644 37
1141 3300028794 Ga0307515_10000063 Ga0307515_1000006387 37
1142 3300028794 Ga0307515_10184880 Ga0307515_101848803 37
1143 3300028794 Ga0307515_10232392 Ga0307515_102323923 37
1144 3300028794 Ga0307515_10450121 Ga0307515_104501213 37
1145 3300028794 Ga0307515_10640127 Ga0307515_106401271 37
1146 3300028800 Ga0265338_10010133 Ga0265338_1001013316 37
1147 3300028800 Ga0265338_10186135 Ga0265338_101861354 37
1148 3300028800 Ga0265338_10267468 Ga0265338_102674683 37
1149 3300029957 Ga0265324_10059771 Ga0265324_100597713 37
1150 3300030521 Ga0307511_10051346 Ga0307511_100513465 37
1151 3300030522 Ga0307512_10192432 Ga0307512_101924321 37
1152 3300030731 Ga0316177_1103656 Ga0316177_11036563 37
1153 3300030731 Ga0316177_1125670 Ga0316177_11256702 37
1154 3300030732 Ga0316176_1019930 Ga0316176_10199302 37
1155 3300030732 Ga0316176_1194562 Ga0316176_11945622 37
1156 3300030733 Ga0314311_1156198 Ga0314311_11561989 37
1157 3300030734 Ga0316179_1006797 Ga0316179_10067974 37
1158 3300030735 Ga0316178_1027803 Ga0316178_10278032 37
1159 3300030735 Ga0316178_1139668 Ga0316178_11396682 37
1160 3300030736 Ga0316180_1000180 Ga0316180_10001801 37
1161 3300030742 Ga0316183_1001783 Ga0316183_10017832 37
1162 3300030742 Ga0316183_1157921 Ga0316183_11579212 37
1163 3300030744 Ga0316181_1020929 Ga0316181_10209292 37
1164 3300030744 Ga0316181_1124463 Ga0316181_11244633 37
1165 3300030744 Ga0316181_1241336 Ga0316181_12413362 37
1166 3300030745 Ga0316182_1165347 Ga0316182_11653472 37
1167 3300030745 Ga0316182_1311139 Ga0316182_13111392 37
1168 3300030863 Ga0265766_1000364 Ga0265766_10003644 37
1169 3300030863 Ga0265766_1015755 Ga0265766_10157552 37
1170 3300030888 Ga0265769_101131 Ga0265769_1011312 37
1171 3300030889 Ga0265761_100256 Ga0265761_1002562 37
1172 3300031238 Ga0265332_10007637 Ga0265332_100076372 37
1173 3300031238 Ga0265332_10043520 Ga0265332_100435203 37
1174 3300031239 Ga0265328_10036159 Ga0265328_100361593 37
1175 3300031241 Ga0265325_10200569 Ga0265325_102005693 37
1176 3300031242 Ga0265329_10290740 Ga0265329_102907402 37
1177 3300031247 Ga0265340_10187097 Ga0265340_101870973 37
1178 3300031249 Ga0265339_10005033 Ga0265339_100050334 37
1179 3300031249 Ga0265339_10033962 Ga0265339_100339623 37
1180 3300031250 Ga0265331_10005659 Ga0265331_1000565910 37
1181 3300031250 Ga0265331_10048424 Ga0265331_100484242 37
1182 3300031250 Ga0265331_10217564 Ga0265331_102175643 37
1183 3300031251 Ga0265327_10000020 Ga0265327_10000020390 37
1184 3300031251 Ga0265327_10003591 Ga0265327_100035917 37
1185 3300031251 Ga0265327_10041542 Ga0265327_100415422 37
1186 3300031251 Ga0265327_10196534 Ga0265327_101965342 37
1187 3300031344 Ga0265316_10008237 Ga0265316_1000823718 37
1188 3300031456 Ga0307513_10140544 Ga0307513_101405445 37
1189 3300031456 Ga0307513_10157577 Ga0307513_101575773 37
1190 3300031456 Ga0307513_10169430 Ga0307513_101694301 37
1191 3300031456 Ga0307513_10379773 Ga0307513_103797733 37
1192 3300031456 Ga0307513_10468000 Ga0307513_104680003 37
1193 3300031507 Ga0307509_10000112 Ga0307509_10000112106 37
1194 3300031507 Ga0307509_10037446 Ga0307509_100374466 37
1195 3300031507 Ga0307509_10087935 Ga0307509_100879353 37
1196 3300031507 Ga0307509_10595177 Ga0307509_105951773 37
1197 3300031548 Ga0307408_100000089 Ga0307408_10000008940 37
1198 3300031548 Ga0307408_100075173 Ga0307408_1000751733 37
1199 3300031548 Ga0307408_100084789 Ga0307408_1000847893 37
1200 3300031548 Ga0307408_100192376 Ga0307408_1001923764 37
1201 3300031548 Ga0307408_100273652 Ga0307408_1002736523 37
1202 3300031548 Ga0307408_100373293 Ga0307408_1003732932 37
1203 3300031548 Ga0307408_100620275 Ga0307408_1006202753 37
1204 3300031548 Ga0307408_100693067 Ga0307408_1006930672 37
1205 3300031548 Ga0307408_100952078 Ga0307408_1009520781 37
1206 3300031548 Ga0307408_101097420 Ga0307408_1010974202 37
1207 3300031548 Ga0307408_101175379 Ga0307408_1011753792 37
1208 3300031548 Ga0307408_101175787 Ga0307408_1011757872 37
1209 3300031548 Ga0307408_101177700 Ga0307408_1011777002 37
1210 3300031548 Ga0307408_101190085 Ga0307408_1011900853 37
1211 3300031548 Ga0307408_101368431 Ga0307408_1013684312 37
1212 3300031548 Ga0307408_101508877 Ga0307408_1015088772 37
1213 3300031548 Ga0307408_101679124 Ga0307408_1016791242 37
1214 3300031548 Ga0307408_101729312 Ga0307408_1017293122 37
1215 3300031548 Ga0307408_101786530 Ga0307408_1017865302 37
1216 3300031548 Ga0307408_101860347 Ga0307408_1018603471 37
1217 3300031548 Ga0307408_102068129 Ga0307408_1020681292 37
1218 3300031548 Ga0307408_102361451 Ga0307408_1023614511 37
1219 3300031616 Ga0307508_10561599 Ga0307508_105615992 37
1220 3300031616 Ga0307508_10741990 Ga0307508_107419902 37
1221 3300031649 Ga0307514_10187898 Ga0307514_101878982 37
1222 3300031665 Ga0316575_10303861 Ga0316575_103038612 37
1223 3300031691 Ga0316579_10013752 Ga0316579_100137525 37
1224 3300031711 Ga0265314_10000003 Ga0265314_100000031195 37
1225 3300031711 Ga0265314_10205869 Ga0265314_102058693 37
1226 3300031712 Ga0265342_10470648 Ga0265342_104706482 37
1227 3300031728 Ga0316578_10133551 Ga0316578_101335512 37
1228 3300031730 Ga0307516_10643464 Ga0307516_106434642 37
1229 3300031730 Ga0307516_10752227 Ga0307516_107522272 37
1230 3300031731 Ga0307405_10034470 Ga0307405_100344704 37
1231 3300031731 Ga0307405_10059631 Ga0307405_100596312 37
1232 3300031731 Ga0307405_10181873 Ga0307405_101818732 37
1233 3300031731 Ga0307405_10187482 Ga0307405_101874823 37
1234 3300031731 Ga0307405_10268782 Ga0307405_102687823 37
1235 3300031731 Ga0307405_10433230 Ga0307405_104332301 37
1236 3300031731 Ga0307405_10478385 Ga0307405_104783852 37
1237 3300031731 Ga0307405_10580545 Ga0307405_105805453 37
1238 3300031731 Ga0307405_10678691 Ga0307405_106786913 37
1239 3300031731 Ga0307405_10800585 Ga0307405_108005852 37
1240 3300031731 Ga0307405_11139521 Ga0307405_111395212 37
1241 3300031731 Ga0307405_11266726 Ga0307405_112667261 37
1242 3300031731 Ga0307405_11438765 Ga0307405_114387651 37
1243 3300031731 Ga0307405_11677162 Ga0307405_116771622 37
1244 3300031731 Ga0307405_11694976 Ga0307405_116949762 37
1245 3300031824 Ga0307413_10140657 Ga0307413_101406572 37
1246 3300031824 Ga0307413_10531930 Ga0307413_105319302 37
1247 3300031824 Ga0307413_10582678 Ga0307413_105826783 37
1248 3300031824 Ga0307413_10607990 Ga0307413_106079903 37
1249 3300031824 Ga0307413_10762008 Ga0307413_107620083 37
1250 3300031824 Ga0307413_11060588 Ga0307413_110605883 37
1251 3300031824 Ga0307413_11280941 Ga0307413_112809412 37
1252 3300031824 Ga0307413_11392416 Ga0307413_113924162 37
1253 3300031824 Ga0307413_11404745 Ga0307413_114047452 37
1254 3300031852 Ga0307410_10114676 Ga0307410_101146763 37
1255 3300031852 Ga0307410_10118959 Ga0307410_101189594 37
1256 3300031852 Ga0307410_10146382 Ga0307410_101463822 37
1257 3300031852 Ga0307410_10394541 Ga0307410_103945412 37
1258 3300031852 Ga0307410_10420906 Ga0307410_104209063 37
1259 3300031852 Ga0307410_10839694 Ga0307410_108396942 37
1260 3300031852 Ga0307410_10879874 Ga0307410_108798742 37
1261 3300031852 Ga0307410_10997715 Ga0307410_109977151 37
1262 3300031852 Ga0307410_11025201 Ga0307410_110252012 37
1263 3300031852 Ga0307410_11802766 Ga0307410_118027661 37
1264 3300031852 Ga0307410_11941269 Ga0307410_119412692 37
1265 3300031889 Ga0326468_10006373 Ga0326468_100063732 37
1266 3300031889 Ga0326468_10049428 Ga0326468_100494282 37
1267 3300031901 Ga0307406_10000446 Ga0307406_100004467 37
1268 3300031901 Ga0307406_10216114 Ga0307406_102161144 37
1269 3300031901 Ga0307406_10257870 Ga0307406_102578701 37
1270 3300031901 Ga0307406_10267651 Ga0307406_102676511 37
1271 3300031901 Ga0307406_10441573 Ga0307406_104415732 37
1272 3300031901 Ga0307406_10505835 Ga0307406_105058352 37
1273 3300031901 Ga0307406_11250646 Ga0307406_112506462 37
1274 3300031901 Ga0307406_11368337 Ga0307406_113683371 37
1275 3300031901 Ga0307406_11774360 Ga0307406_117743602 37
1276 3300031903 Ga0307407_10006277 Ga0307407_100062778 37
1277 3300031903 Ga0307407_10059301 Ga0307407_100593014 37
1278 3300031903 Ga0307407_10169771 Ga0307407_101697714 37
1279 3300031903 Ga0307407_10309219 Ga0307407_103092193 37
1280 3300031903 Ga0307407_10339649 Ga0307407_103396493 37
1281 3300031903 Ga0307407_10746486 Ga0307407_107464862 37
1282 3300031903 Ga0307407_10876376 Ga0307407_108763762 37
1283 3300031903 Ga0307407_11060367 Ga0307407_110603672 37
1284 3300031903 Ga0307407_11188289 Ga0307407_111882891 37
1285 3300031911 Ga0307412_10041129 Ga0307412_100411293 37
1286 3300031911 Ga0307412_10074591 Ga0307412_100745915 37
1287 3300031911 Ga0307412_10113968 Ga0307412_101139684 37
1288 3300031911 Ga0307412_10227322 Ga0307412_102273224 37
1289 3300031911 Ga0307412_10271374 Ga0307412_102713743 37
1290 3300031911 Ga0307412_10334708 Ga0307412_103347082 37
1291 3300031911 Ga0307412_10347870 Ga0307412_103478702 37
1292 3300031911 Ga0307412_10437975 Ga0307412_104379753 37
1293 3300031911 Ga0307412_10505041 Ga0307412_105050413 37
1294 3300031911 Ga0307412_10873002 Ga0307412_108730022 37
1295 3300031911 Ga0307412_10907900 Ga0307412_109079002 37
1296 3300031911 Ga0307412_10997147 Ga0307412_109971472 37
1297 3300031911 Ga0307412_11050911 Ga0307412_110509112 37
1298 3300031911 Ga0307412_11102643 Ga0307412_111026432 37
1299 3300031911 Ga0307412_11294049 Ga0307412_112940492 37
1300 3300031911 Ga0307412_12069760 Ga0307412_120697602 37
1301 3300031995 Ga0307409_100004038 Ga0307409_10000403811 37
1302 3300031995 Ga0307409_100022307 Ga0307409_1000223077 37
1303 3300031995 Ga0307409_100047745 Ga0307409_1000477455 37
1304 3300031995 Ga0307409_100107020 Ga0307409_1001070202 37
1305 3300031995 Ga0307409_100271293 Ga0307409_1002712932 37
1306 3300031995 Ga0307409_100282355 Ga0307409_1002823552 37
1307 3300031995 Ga0307409_100283224 Ga0307409_1002832241 37
1308 3300031995 Ga0307409_100504930 Ga0307409_1005049303 37
1309 3300031995 Ga0307409_100753800 Ga0307409_1007538003 37
1310 3300031995 Ga0307409_101811647 Ga0307409_1018116471 37
1311 3300032002 Ga0307416_100159497 Ga0307416_1001594972 37
1312 3300032002 Ga0307416_100172377 Ga0307416_1001723773 37
1313 3300032002 Ga0307416_100179915 Ga0307416_1001799153 37
1314 3300032002 Ga0307416_100206239 Ga0307416_1002062393 37
1315 3300032002 Ga0307416_100263458 Ga0307416_1002634584 37
1316 3300032002 Ga0307416_100285096 Ga0307416_1002850963 37
1317 3300032002 Ga0307416_100310299 Ga0307416_1003102992 37
1318 3300032002 Ga0307416_100388138 Ga0307416_1003881382 37
1319 3300032002 Ga0307416_100395584 Ga0307416_1003955842 37
1320 3300032002 Ga0307416_100406416 Ga0307416_1004064162 37
1321 3300032002 Ga0307416_100408653 Ga0307416_1004086533 37
1322 3300032002 Ga0307416_100444070 Ga0307416_1004440702 37
1323 3300032002 Ga0307416_100487170 Ga0307416_1004871703 37
1324 3300032002 Ga0307416_100561991 Ga0307416_1005619912 37
1325 3300032002 Ga0307416_100732161 Ga0307416_1007321613 37
1326 3300032002 Ga0307416_100798019 Ga0307416_1007980193 37
1327 3300032002 Ga0307416_100834906 Ga0307416_1008349063 37
1328 3300032002 Ga0307416_100976618 Ga0307416_1009766183 37
1329 3300032002 Ga0307416_101273798 Ga0307416_1012737982 37
1330 3300032002 Ga0307416_101300071 Ga0307416_1013000712 37
1331 3300032002 Ga0307416_101485092 Ga0307416_1014850922 37
1332 3300032002 Ga0307416_101576500 Ga0307416_1015765002 37
1333 3300032002 Ga0307416_101714541 Ga0307416_1017145412 37
1334 3300032002 Ga0307416_102123162 Ga0307416_1021231622 37
1335 3300032002 Ga0307416_102440668 Ga0307416_1024406682 37
1336 3300032002 Ga0307416_102522336 Ga0307416_1025223362 37
1337 3300032002 Ga0307416_102560500 Ga0307416_1025605002 37
1338 3300032002 Ga0307416_102797262 Ga0307416_1027972621 37
1339 3300032002 Ga0307416_103013416 Ga0307416_1030134162 37
1340 3300032002 Ga0307416_103146620 Ga0307416_1031466202 37
1341 3300032002 Ga0307416_103376906 Ga0307416_1033769062 37
1342 3300032004 Ga0307414_10128822 Ga0307414_101288222 37
1343 3300032004 Ga0307414_10278969 Ga0307414_102789693 37
1344 3300032004 Ga0307414_10343210 Ga0307414_103432103 37
1345 3300032004 Ga0307414_10509130 Ga0307414_105091303 37
1346 3300032004 Ga0307414_10886902 Ga0307414_108869023 37
1347 3300032004 Ga0307414_10941371 Ga0307414_109413712 37
1348 3300032004 Ga0307414_10942848 Ga0307414_109428483 37
1349 3300032004 Ga0307414_11043465 Ga0307414_110434652 37
1350 3300032004 Ga0307414_11141732 Ga0307414_111417321 37
1351 3300032004 Ga0307414_11523320 Ga0307414_115233202 37
1352 3300032005 Ga0307411_10000085 Ga0307411_1000008521 37
1353 3300032005 Ga0307411_10023560 Ga0307411_100235604 37
1354 3300032005 Ga0307411_10077886 Ga0307411_100778864 37
1355 3300032005 Ga0307411_10214230 Ga0307411_102142304 37
1356 3300032005 Ga0307411_10282426 Ga0307411_102824263 37
1357 3300032005 Ga0307411_10461116 Ga0307411_104611162 37
1358 3300032005 Ga0307411_10544620 Ga0307411_105446203 37
1359 3300032005 Ga0307411_10747773 Ga0307411_107477733 37
1360 3300032005 Ga0307411_11904285 Ga0307411_119042852 37
1361 3300032120 Ga0316053_117863 Ga0316053_1178632 37
1362 3300032126 Ga0307415_100098538 Ga0307415_1000985382 37
1363 3300032126 Ga0307415_100192606 Ga0307415_1001926062 37
1364 3300032126 Ga0307415_100202159 Ga0307415_1002021594 37
1365 3300032126 Ga0307415_100247231 Ga0307415_1002472312 37
1366 3300032126 Ga0307415_100347606 Ga0307415_1003476062 37
1367 3300032126 Ga0307415_100686236 Ga0307415_1006862363 37
1368 3300032126 Ga0307415_100758746 Ga0307415_1007587462 37
1369 3300032126 Ga0307415_100944812 Ga0307415_1009448123 37
1370 3300032126 Ga0307415_101004782 Ga0307415_1010047823 37
1371 3300032126 Ga0307415_101023079 Ga0307415_1010230792 37
1372 3300032126 Ga0307415_101165381 Ga0307415_1011653813 37
1373 3300032126 Ga0307415_101228415 Ga0307415_1012284153 37
1374 3300032126 Ga0307415_101618725 Ga0307415_1016187252 37
1375 3300032133 Ga0316583_10002208 Ga0316583_1000220812 37
1376 3300032133 Ga0316583_10040468 Ga0316583_100404684 37
1377 3300032168 Ga0316593_10000192 Ga0316593_100001926 37
1378 3300032168 Ga0316593_10000748 Ga0316593_100007482 37
1379 3300032168 Ga0316593_10005016 Ga0316593_100050165 37
1380 3300033179 Ga0307507_10181557 Ga0307507_101815573 37
1381 3300033180 Ga0307510_10329758 Ga0307510_103297583 37
1382 3300033529 Ga0316587_1083879 Ga0316587_10838791 37
1383 3300033541 Ga0316596_1000625 Ga0316596_10006254 37
1384 3300034816 Ga0373930_0115603 Ga0373930_0115603_351_464 37
1385 3300034817 Ga0373948_0043328 Ga0373948_0043328_130_243 37
1386 3300034817 Ga0373948_0171472 Ga0373948_0171472_208_321 37
1387 3300034818 Ga0373950_0048562 Ga0373950_0048562_673_786 37
1388 3300034819 Ga0373958_0020371 Ga0373958_0020371_726_839 37
1389 3300034819 Ga0373958_0038056 Ga0373958_0038056_601_714 37
1390 3300034819 Ga0373958_0132797 Ga0373958_0132797_467_580 37
1391 3300034957 Ga0373938_0002317 Ga0373938_0002317_517_630 37
1392 3300034957 Ga0373938_0045689 Ga0373938_0045689_344_457 37
1393 3300034957 Ga0373938_0196010 Ga0373938_0196010_272_385 37
1394 3300035083 Ga0373926_0022817 Ga0373926_0022817_847_960 37
1395 3300035083 Ga0373926_0043937 Ga0373926_0043937_937_1050 37
1396 3300035083 Ga0373926_0440314 Ga0373926_0440314_119_232 37
1397 3300035084 Ga0373928_0022540 Ga0373928_0022540_592_705 37
1398 3300035084 Ga0373928_0129486 Ga0373928_0129486_374_487 37
1399 3300035084 Ga0373928_0241186 Ga0373928_0241186_202_315 37
1400 3300035085 Ga0373929_0052229 Ga0373929_0052229_36_149 37
1401 3300035085 Ga0373929_0081359 Ga0373929_0081359_278_391 37
1402 3300035086 Ga0373934_0064489 Ga0373934_0064489_317_430 37
1403 3300035086 Ga0373934_0078177 Ga0373934_0078177_460_573 37
1404 3300035088 Ga0373940_0177462 Ga0373940_0177462_17_130 37
1405 3300035088 Ga0373940_0228555 Ga0373940_0228555_156_269 37
1406 3300035090 Ga0373949_0000042 Ga0373949_0000042_8921_9034 37
1407 3300035090 Ga0373949_0278301 Ga0373949_0278301_52_165 37
1408 3300035091 Ga0373951_0027911 Ga0373951_0027911_958_1071 37
1409 3300035092 Ga0373952_0094913 Ga0373952_0094913_250_363 37
1410 3300035092 Ga0373952_0187743 Ga0373952_0187743_246_359 37
1411 3300035111 Ga0373923_0141498 Ga0373923_0141498_288_401 37
1412 3300035111 Ga0373923_0174750 Ga0373923_0174750_44_157 37
1413 3300035111 Ga0373923_0229677 Ga0373923_0229677_11_124 37
1414 3300035111 Ga0373923_0461279 Ga0373923_0461279_234_347 37
1415 3300035112 Ga0373932_0035988 Ga0373932_0035988_997_1110 37
1416 3300035112 Ga0373932_0105692 Ga0373932_0105692_31_144 37
1417 3300035113 Ga0373936_0036639 Ga0373936_0036639_697_810 37
1418 3300035113 Ga0373936_0043210 Ga0373936_0043210_638_751 37
1419 3300035113 Ga0373936_0190634 Ga0373936_0190634_120_233 37
1420 3300035113 Ga0373936_0237969 Ga0373936_0237969_155_268 37
1421 3300035114 Ga0373939_0006647 Ga0373939_0006647_516_629 37
1422 3300035114 Ga0373939_0030675 Ga0373939_0030675_784_897 37
1423 3300035114 Ga0373939_0188546 Ga0373939_0188546_273_386 37
1424 3300035115 Ga0373941_0047797 Ga0373941_0047797_317_430 37
1425 3300035115 Ga0373941_0152546 Ga0373941_0152546_606_719 37
1426 3300035115 Ga0373941_0206407 Ga0373941_0206407_506_619 37
1427 3300035117 Ga0373953_0013114 Ga0373953_0013114_205_318 37
1428 3300035117 Ga0373953_0178677 Ga0373953_0178677_62_175 37
1429 3300035118 Ga0373954_0000068 Ga0373954_0000068_25370_25483 37
1430 3300035118 Ga0373954_0274156 Ga0373954_0274156_234_347 37
1431 3300035118 Ga0373954_0699328 Ga0373954_0699328_28_141 37
1432 3300035119 Ga0373956_0090633 Ga0373956_0090633_616_729 37
1433 3300035119 Ga0373956_0093057 Ga0373956_0093057_112_225 37
1434 3300035119 Ga0373956_0143582 Ga0373956_0143582_707_820 37
1435 3300035120 Ga0373957_0014366 Ga0373957_0014366_2407_2520 37
1436 3300035120 Ga0373957_0044059 Ga0373957_0044059_1461_1574 37
1437 3300035120 Ga0373957_0083584 Ga0373957_0083584_695_808 37
1438 3300035120 Ga0373957_0110392 Ga0373957_0110392_455_568 37
1439 3300035121 Ga0373960_0000482 Ga0373960_0000482_3346_3459 37
1440 3300035121 Ga0373960_0010947 Ga0373960_0010947_1320_1433 37
1441 3300035121 Ga0373960_0215032 Ga0373960_0215032_137_250 37
1442 3300035121 Ga0373960_0223284 Ga0373960_0223284_41_154 37
1443 3300035121 Ga0373960_0346646 Ga0373960_0346646_372_485 37
1444 3300035121 Ga0373960_0424301 Ga0373960_0424301_266_379 37
1445 3300035170 Ga0373943_0229005 Ga0373943_0229005_823_936 37
1446 3300035170 Ga0373943_0533144 Ga0373943_0533144_480_593 37
1447 3300035170 Ga0373943_0791117 Ga0373943_0791117_347_460 37
1448 3300035171 Ga0373946_0069230 Ga0373946_0069230_1008_1121 37
1449 3300035171 Ga0373946_0288710 Ga0373946_0288710_224_337 37
1450 3300035171 Ga0373946_0402204 Ga0373946_0402204_327_440 37
1451 3300035172 Ga0373955_0002904 Ga0373955_0002904_1053_1166 37
1452 3300035172 Ga0373955_0046924 Ga0373955_0046924_1378_1491 37
1453 3300035172 Ga0373955_0080448 Ga0373955_0080448_694_807 37
1454 3300035207 Ga0373942_0011667 Ga0373942_0011667_503_616 37
1455 3300035207 Ga0373942_0182146 Ga0373942_0182146_511_624 37
1456 3300035207 Ga0373942_0227585 Ga0373942_0227585_171_284 37
1457 3300035241 Ga0373961_0000015 Ga0373961_0000015_99780_99893 37
1458 3300035241 Ga0373961_0161440 Ga0373961_0161440_230_343 37
1459 3300035242 Ga0373962_0188300 Ga0373962_0188300_372_485 37
1460 3300035242 Ga0373962_0269618 Ga0373962_0269618_165_278 37
1461 3300035242 Ga0373962_0377766 Ga0373962_0377766_40_153 37
1462 3300035410 Ga0373924_0002538 Ga0373924_0002538_4939_5052 37
1463 3300035410 Ga0373924_0003908 Ga0373924_0003908_3795_3908 37
1464 3300035410 Ga0373924_0301185 Ga0373924_0301185_417_530 37
1465 3300035410 Ga0373924_0421001 Ga0373924_0421001_454_567 37
1466 3300035691 Ga0373931_0000535 Ga0373931_0000535_7497_7610 37
1467 3300035691 Ga0373931_0094413 Ga0373931_0094413_1527_1640 37
1468 3300035691 Ga0373931_0176172 Ga0373931_0176172_299_412 37
1469 3300035691 Ga0373931_0295302 Ga0373931_0295302_29_142 37
1470 3300035691 Ga0373931_1209819 Ga0373931_1209819_152_265 37
1471 3300035692 Ga0373935_0021499 Ga0373935_0021499_2463_2576 37
1472 3300035692 Ga0373935_0102161 Ga0373935_0102161_462_575 37
1473 3300035692 Ga0373935_0257402 Ga0373935_0257402_286_399 37
1474 3300035692 Ga0373935_0275973 Ga0373935_0275973_697_810 37
1475 3300035692 Ga0373935_0295391 Ga0373935_0295391_390_503 37
1476 3300035692 Ga0373935_0485400 Ga0373935_0485400_165_278 37
1477 3300035692 Ga0373935_0769220 Ga0373935_0769220_193_306 37
1478 3300035695 Ga0373927_0046371 Ga0373927_0046371_2077_2190 37
1479 3300035695 Ga0373927_0461278 Ga0373927_0461278_273_386 37
1480 3300035695 Ga0373927_0489670 Ga0373927_0489670_113_226 37
1481 3300035724 Ga0373933_0063556 Ga0373933_0063556_457_570 37
1482 3300035724 Ga0373933_0070222 Ga0373933_0070222_1178_1291 37
1483 3300035724 Ga0373933_0302728 Ga0373933_0302728_754_867 37
1484 3300035724 Ga0373933_0737190 Ga0373933_0737190_502_615 37
1485 3300035724 Ga0373933_0755737 Ga0373933_0755737_289_402 37
1486 3300035725 Ga0373947_0009447 Ga0373947_0009447_1586_1699 37
1487 3300035725 Ga0373947_0043014 Ga0373947_0043014_701_814 37
1488 3300035725 Ga0373947_0281708 Ga0373947_0281708_969_1082 37
1489 3300035725 Ga0373947_0345173 Ga0373947_0345173_372_485 37
1490 3300035725 Ga0373947_0695344 Ga0373947_0695344_163_276 37
1491 3300035725 Ga0373947_0984656 Ga0373947_0984656_87_200 37
1492 3300036401 Ga0373937_0002051 Ga0373937_0002051_7363_7476 37
1493 3300036401 Ga0373937_0002498 Ga0373937_0002498_11116_11229 37
1494 3300036401 Ga0373937_0160684 Ga0373937_0160684_807_920 37
1495 3300036401 Ga0373937_0300334 Ga0373937_0300334_822_935 37
1496 3300036401 Ga0373937_0382862 Ga0373937_0382862_336_449 37
1497 3300036401 Ga0373937_1858827 Ga0373937_1858827_196_309 37
1498 3300036457 Ga0265778_007130 Ga0265778_007130_828_941 37
1499 3300037068 Ga0373925_0008267 Ga0373925_0008267_2384_2497 37
1500 3300037068 Ga0373925_0019406 Ga0373925_0019406_1888_2001 37
1501 3300037068 Ga0373925_0582410 Ga0373925_0582410_571_684 37
1502 3300037068 Ga0373925_0624969 Ga0373925_0624969_737_850 37
1503 3300037068 Ga0373925_0850483 Ga0373925_0850483_319_432 37
1504 3300037068 Ga0373925_1782202 Ga0373925_1782202_103_216 37
1505 3300037312 Ga0395899_0158389 Ga0395899_0158389_606_719 37
1506 3300037312 Ga0395899_0274789 Ga0395899_0274789_586_699 37
1507 3300037418 Ga0395900_0094973 Ga0395900_0094973_503_616 37
1508 3300037418 Ga0395900_0227961 Ga0395900_0227961_1692_1805 37
1509 3300037418 Ga0395900_0260958 Ga0395900_0260958_144_257 37
1510 3300037418 Ga0395900_0388831 Ga0395900_0388831_810_923 37
1511 3300037418 Ga0395900_0554082 Ga0395900_0554082_554_667 37
1512 3300037418 Ga0395900_1584946 Ga0395900_1584946_362_475 37
1513 3300037418 Ga0395900_1668003 Ga0395900_1668003_90_203 37
1514 3300037418 Ga0395900_1727168 Ga0395900_1727168_365_478 37
1515 3300037466 Ga0395898_0091988 Ga0395898_0091988_1225_1338 37
1516 3300037466 Ga0395898_1199351 Ga0395898_1199351_278_391 37
1517 3300037466 Ga0395898_1702328 Ga0395898_1702328_414_527 37
1518 3300037466 Ga0395898_1794233 Ga0395898_1794233_285_398 37
1519 3300037466 Ga0395898_1946063 Ga0395898_1946063_68_181 37
1520 3300037471 Ga0395905_0002424 Ga0395905_0002424_5974_6087 37
1521 3300037471 Ga0395905_0002507 Ga0395905_0002507_7928_8041 37
1522 3300037471 Ga0395905_0204218 Ga0395905_0204218_1060_1173 37
1523 3300037471 Ga0395905_0482283 Ga0395905_0482283_995_1108 37
1524 3300037471 Ga0395905_0560750 Ga0395905_0560750_639_752 37
1525 3300037471 Ga0395905_0866380 Ga0395905_0866380_144_257 37
1526 3300037471 Ga0395905_1793181 Ga0395905_1793181_110_223 37
1527 3300037471 Ga0395905_1904515 Ga0395905_1904515_78_191 37
1528 3300037853 Ga0436364_1234629 Ga0436364_1234629_93_206 37
1529 3300038443 Ga0395901_0066674 Ga0395901_0066674_2857_2970 37
1530 3300038443 Ga0395901_0075954 Ga0395901_0075954_969_1082 37
1531 3300038443 Ga0395901_0231361 Ga0395901_0231361_1228_1341 37
1532 3300038443 Ga0395901_0907926 Ga0395901_0907926_643_756 37
1533 3300038443 Ga0395901_1009562 Ga0395901_1009562_560_673 37
1534 3300038726 Ga0400490_03371 Ga0400490_03371_10992_11105 37
1535 3300039437 Ga0436365_0331513 Ga0436365_0331513_50_163 37
1536 3300039437 Ga0436365_0493876 Ga0436365_0493876_600_713 37
1537 3300039437 Ga0436365_0511742 Ga0436365_0511742_107_220 37
1538 3300039437 Ga0436365_0646920 Ga0436365_0646920_293_406 37
1539 3300039437 Ga0436365_0979522 Ga0436365_0979522_34_147 37
1540 3300039437 Ga0436365_0995968 Ga0436365_0995968_34_147 37
1541 3300039437 Ga0436365_1156689 Ga0436365_1156689_125_238 37
1542 3300039437 Ga0436365_1393832 Ga0436365_1393832_1476_1589 37
1543 3300039437 Ga0436365_1829024 Ga0436365_1829024_766_879 37
1544 3300039437 Ga0436365_1864317 Ga0436365_1864317_23_136 37
1545 3300039438 Ga0436360_0879567 Ga0436360_0879567_832_945 37
1546 3300039447 Ga0436361_0148596 Ga0436361_0148596_2871_2984 37
1547 3300039447 Ga0436361_0182699 Ga0436361_0182699_137_250 37
1548 3300039447 Ga0436361_0275583 Ga0436361_0275583_356_469 37
1549 3300039447 Ga0436361_0405071 Ga0436361_0405071_3046_3159 37
1550 3300039447 Ga0436361_0421532 Ga0436361_0421532_318_431 37
1551 3300039447 Ga0436361_0472363 Ga0436361_0472363_331_444 37
1552 3300039447 Ga0436361_0509304 Ga0436361_0509304_53_166 37
1553 3300039447 Ga0436361_0776332 Ga0436361_0776332_1902_2015 37
1554 3300039450 Ga0436363_0107511 Ga0436363_0107511_195_308 37
1555 3300039450 Ga0436363_0673704 Ga0436363_0673704_168_281 37
1556 3300039450 Ga0436363_1011320 Ga0436363_1011320_359_472 37
1557 3300039450 Ga0436363_1161920 Ga0436363_1161920_787_900 37
1558 3300039450 Ga0436363_1362656 Ga0436363_1362656_166_279 37
1559 3300039450 Ga0436363_1398290 Ga0436363_1398290_412_525 37
1560 3300039450 Ga0436363_1622102 Ga0436363_1622102_451_564 37
1561 3300039450 Ga0436363_1658820 Ga0436363_1658820_220_333 37
1562 3300039453 Ga0436362_0406983 Ga0436362_0406983_65_178 37
1563 3300039453 Ga0436362_0539891 Ga0436362_0539891_508_621 37
1564 3300039453 Ga0436362_0851522 Ga0436362_0851522_111_224 37
1565 3300039453 Ga0436362_1277522 Ga0436362_1277522_38_151 37
1566 3300041404 Ga0439436_0023910 Ga0439436_0023910_1087_1200 37
1567 3300041404 Ga0439436_0070581 Ga0439436_0070581_173_286 37
1568 3300041405 Ga0439438_055651 Ga0439438_055651_854_967 37
1569 3300041405 Ga0439438_081680 Ga0439438_081680_331_444 37
1570 3300041406 Ga0439439_0025226 Ga0439439_0025226_621_734 37
1571 3300041406 Ga0439439_0028319 Ga0439439_0028319_1161_1274 37
1572 3300041406 Ga0439439_0244616 Ga0439439_0244616_162_275 37
1573 3300041406 Ga0439439_0251774 Ga0439439_0251774_360_473 37
1574 3300041407 Ga0439447_058768 Ga0439447_058768_132_245 37
1575 3300041407 Ga0439447_080608 Ga0439447_080608_572_685 37
1576 3300041407 Ga0439447_096082 Ga0439447_096082_548_661 37
1577 3300041408 Ga0439453_0000163 Ga0439453_0000163_5087_5200 37
1578 3300041408 Ga0439453_0029432 Ga0439453_0029432_279_392 37
1579 3300041408 Ga0439453_0057961 Ga0439453_0057961_634_747 37
1580 3300041408 Ga0439453_0123802 Ga0439453_0123802_334_447 37
1581 3300041408 Ga0439453_0127455 Ga0439453_0127455_338_451 37
1582 3300041410 Ga0439461_0015712 Ga0439461_0015712_1066_1179 37
1583 3300041410 Ga0439461_0090344 Ga0439461_0090344_186_299 37
1584 3300041410 Ga0439461_0153396 Ga0439461_0153396_457_570 37
1585 3300041410 Ga0439461_0164631 Ga0439461_0164631_371_484 37
1586 3300041411 Ga0439466_0013514 Ga0439466_0013514_713_826 37
1587 3300041411 Ga0439466_0016489 Ga0439466_0016489_2002_2115 37
1588 3300041411 Ga0439466_0251595 Ga0439466_0251595_77_190 37
1589 3300041413 Ga0439465_0001025 Ga0439465_0001025_146_259 37
1590 3300041441 Ga0451787_234705 Ga0451787_234705_148_261 37
1591 3300041441 Ga0451787_543246 Ga0451787_543246_652_765 37
1592 3300041443 Ga0451789_0296371 Ga0451789_0296371_147_260 37
1593 3300041443 Ga0451789_0338698 Ga0451789_0338698_164_277 37
1594 3300041446 Ga0451794_19623 Ga0451794_19623_69_182 37
1595 3300041446 Ga0451794_34026 Ga0451794_34026_395_508 37
1596 3300041451 Ga0451791_1018582 Ga0451791_1018582_175_288 37
1597 3300041451 Ga0451791_1152850 Ga0451791_1152850_847_960 37
1598 3300041451 Ga0451791_1828290 Ga0451791_1828290_158_271 37
1599 3300041452 Ga0451793_0272307 Ga0451793_0272307_367_480 37
1600 3300041452 Ga0451793_1858884 Ga0451793_1858884_95_208 37
1601 3300041453 Ga0451797_0027218 Ga0451797_0027218_388_501 37
1602 3300041453 Ga0451797_0610734 Ga0451797_0610734_52_165 37
1603 3300041453 Ga0451797_0810762 Ga0451797_0810762_550_663 37
1604 3300041453 Ga0451797_1029164 Ga0451797_1029164_115_228 37
1605 3300041453 Ga0451797_1237319 Ga0451797_1237319_331_444 37
1606 3300041454 Ga0451799_15134 Ga0451799_15134_304_417 37
1607 3300041455 Ga0451801_28156 Ga0451801_28156_407_520 37
1608 3300041457 Ga0451803_03900 Ga0451803_03900_248_361 37
1609 3300041459 Ga0451800_0428694 Ga0451800_0428694_303_416 37
1610 3300041459 Ga0451800_1055116 Ga0451800_1055116_69_182 37
1611 3300041459 Ga0451800_1067832 Ga0451800_1067832_916_1029 37
1612 3300041460 Ga0451802_0337526 Ga0451802_0337526_274_387 37
1613 3300041460 Ga0451802_1235073 Ga0451802_1235073_532_645 37
1614 3300041460 Ga0451802_1546900 Ga0451802_1546900_167_280 37
1615 3300041461 Ga0451805_010711 Ga0451805_010711_328_441 37
1616 3300041461 Ga0451805_026922 Ga0451805_026922_342_455 37
1617 3300041461 Ga0451805_054753 Ga0451805_054753_345_458 37
1618 3300041463 Ga0451804_0032116 Ga0451804_0032116_312_425 37
1619 3300041463 Ga0451804_0958318 Ga0451804_0958318_191_304 37
1620 3300041463 Ga0451804_0961676 Ga0451804_0961676_250_363 37
1621 3300041486 Ga0451807_0112616 Ga0451807_0112616_391_504 37
1622 3300041486 Ga0451807_1729784 Ga0451807_1729784_127_240 37
1623 3300041486 Ga0451807_1867510 Ga0451807_1867510_192_305 37
1624 3300041486 Ga0451807_2039794 Ga0451807_2039794_210_323 37
1625 3300041491 Ga0451833_0810760 Ga0451833_0810760_1027_1140 37
1626 3300041491 Ga0451833_1158611 Ga0451833_1158611_41_154 37
1627 3300041491 Ga0451833_1340573 Ga0451833_1340573_598_711 37
1628 3300041491 Ga0451833_1453880 Ga0451833_1453880_413_526 37
1629 3300041492 Ga0451835_1050461 Ga0451835_1050461_268_381 37
1630 3300041494 Ga0451837_0483972 Ga0451837_0483972_831_944 37
1631 3300041494 Ga0451837_1536618 Ga0451837_1536618_300_413 37
1632 3300041496 Ga0451839_0046429 Ga0451839_0046429_164_277 37
1633 3300041496 Ga0451839_0232015 Ga0451839_0232015_534_647 37
1634 3300041497 Ga0451840_24907 Ga0451840_24907_296_409 37
1635 3300041498 Ga0451841_1048641 Ga0451841_1048641_364_477 37
1636 3300041501 Ga0451845_0284123 Ga0451845_0284123_353_466 37
1637 3300041501 Ga0451845_0427097 Ga0451845_0427097_266_379 37
1638 3300041502 Ga0451846_03452 Ga0451846_03452_259_372 37
1639 3300041505 Ga0451849_0280464 Ga0451849_0280464_124_237 37
1640 3300041505 Ga0451849_0453990 Ga0451849_0453990_384_497 37
1641 3300041505 Ga0451849_1575111 Ga0451849_1575111_497_610 37
1642 3300041506 Ga0451850_36419 Ga0451850_36419_169_282 37
1643 3300041507 Ga0451851_1378734 Ga0451851_1378734_302_415 37
1644 3300041509 Ga0451843_1185394 Ga0451843_1185394_593_706 37
1645 3300041509 Ga0451843_1571034 Ga0451843_1571034_411_524 37
1646 3300041510 Ga0451854_20469 Ga0451854_20469_31_144 37
1647 3300041511 Ga0451855_1639300 Ga0451855_1639300_328_441 37
1648 3300041511 Ga0451855_1762118 Ga0451855_1762118_336_449 37
1649 3300041512 Ga0451853_0172883 Ga0451853_0172883_268_381 37
1650 3300041512 Ga0451853_1568238 Ga0451853_1568238_977_1090 37
1651 3300041512 Ga0451853_2494744 Ga0451853_2494744_572_685 37
1652 3300041512 Ga0451853_4070058 Ga0451853_4070058_718_831 37
1653 3300041997 Ga0439431_0002191 Ga0439431_0002191_316_429 37
1654 3300041997 Ga0439431_0125595 Ga0439431_0125595_40_153 37
1655 3300041997 Ga0439431_0177244 Ga0439431_0177244_202_315 37
1656 3300041997 Ga0439431_0251363 Ga0439431_0251363_395_508 37
1657 3300041999 Ga0439433_0000255 Ga0439433_0000255_6222_6335 37
1658 3300041999 Ga0439433_0002915 Ga0439433_0002915_2837_2950 37
1659 3300041999 Ga0439433_0065507 Ga0439433_0065507_376_489 37
1660 3300042000 Ga0439437_001351 Ga0439437_001351_1184_1297 37
1661 3300042001 Ga0439441_000152 Ga0439441_000152_2379_2492 37
1662 3300042001 Ga0439441_004072 Ga0439441_004072_722_835 37
1663 3300042001 Ga0439441_047045 Ga0439441_047045_562_675 37
1664 3300042001 Ga0439441_082830 Ga0439441_082830_31_144 37
1665 3300042002 Ga0439442_013403 Ga0439442_013403_1487_1600 37
1666 3300042002 Ga0439442_020364 Ga0439442_020364_352_465 37
1667 3300042002 Ga0439442_027840 Ga0439442_027840_292_405 37
1668 3300042003 Ga0439443_000105 Ga0439443_000105_3951_4064 37
1669 3300042003 Ga0439443_015521 Ga0439443_015521_650_763 37
1670 3300042003 Ga0439443_024891 Ga0439443_024891_513_626 37
1671 3300042004 Ga0439445_0005378 Ga0439445_0005378_2147_2260 37
1672 3300042004 Ga0439445_0044729 Ga0439445_0044729_946_1059 37
1673 3300042005 Ga0439448_0092707 Ga0439448_0092707_574_687 37
1674 3300042005 Ga0439448_0200999 Ga0439448_0200999_358_471 37
1675 3300042005 Ga0439448_0225862 Ga0439448_0225862_188_301 37
1676 3300042006 Ga0439432_001484 Ga0439432_001484_4580_4693 37
1677 3300042006 Ga0439432_148348 Ga0439432_148348_530_643 37
1678 3300042007 Ga0439449_0002613 Ga0439449_0002613_4804_4917 37
1679 3300042007 Ga0439449_0013168 Ga0439449_0013168_276_389 37
1680 3300042007 Ga0439449_0050038 Ga0439449_0050038_574_687 37
1681 3300042008 Ga0439450_003710 Ga0439450_003710_164_277 37
1682 3300042008 Ga0439450_042005 Ga0439450_042005_931_1044 37
1683 3300042009 Ga0439451_046775 Ga0439451_046775_464_577 37
1684 3300042010 Ga0439452_003623 Ga0439452_003623_3971_4084 37
1685 3300042010 Ga0439452_032621 Ga0439452_032621_527_640 37
1686 3300042010 Ga0439452_128748 Ga0439452_128748_267_380 37
1687 3300042011 Ga0439454_053826 Ga0439454_053826_329_442 37
1688 3300042012 Ga0439455_0004910 Ga0439455_0004910_2339_2452 37
1689 3300042012 Ga0439455_0051017 Ga0439455_0051017_605_718 37
1690 3300042012 Ga0439455_0195020 Ga0439455_0195020_398_511 37
1691 3300042014 Ga0439457_008883 Ga0439457_008883_1203_1316 37
1692 3300042015 Ga0439462_0007562 Ga0439462_0007562_2452_2565 37
1693 3300042016 Ga0439463_170397 Ga0439463_170397_90_203 37
1694 3300042016 Ga0439463_192461 Ga0439463_192461_280_393 37
1695 3300042115 Ga0450911_024388 Ga0450911_024388_266_379 37
1696 3300042116 Ga0450912_003334 Ga0450912_003334_994_1107 37
1697 3300042116 Ga0450912_036266 Ga0450912_036266_157_270 37
1698 3300042117 Ga0450913_002200 Ga0450913_002200_21_134 37
1699 3300042118 Ga0450914_001729 Ga0450914_001729_350_463 37
1700 3300042119 Ga0450915_000125 Ga0450915_000125_1417_1530 37
1701 3300042119 Ga0450915_011765 Ga0450915_011765_493_606 37
1702 3300042120 Ga0450917_000001 Ga0450917_000001_8310_8423 37
1703 3300042120 Ga0450917_004112 Ga0450917_004112_858_971 37
1704 3300042121 Ga0450919_045514 Ga0450919_045514_115_228 37
1705 3300042122 Ga0450920_005861 Ga0450920_005861_743_856 37
1706 3300042122 Ga0450920_038422 Ga0450920_038422_397_510 37
1707 3300042123 Ga0450921_012190 Ga0450921_012190_62_175 37
1708 3300042124 Ga0450922_004876 Ga0450922_004876_553_666 37
1709 3300042124 Ga0450922_007146 Ga0450922_007146_520_633 37
1710 3300042125 Ga0450923_009190 Ga0450923_009190_1230_1343 37
1711 3300042125 Ga0450923_029699 Ga0450923_029699_68_181 37
1712 3300042125 Ga0450923_119583 Ga0450923_119583_261_374 37
1713 3300042126 Ga0450888_000155 Ga0450888_000155_4266_4379 37
1714 3300042127 Ga0450890_003431 Ga0450890_003431_1125_1238 37
1715 3300042127 Ga0450890_004058 Ga0450890_004058_652_765 37
1716 3300042127 Ga0450890_065840 Ga0450890_065840_295_408 37
1717 3300042128 Ga0450897_043455 Ga0450897_043455_145_258 37
1718 3300042129 Ga0450891_000655 Ga0450891_000655_1364_1477 37
1719 3300042130 Ga0450892_001248 Ga0450892_001248_337_450 37
1720 3300042131 Ga0450894_033389 Ga0450894_033389_236_349 37
1721 3300042132 Ga0450895_032903 Ga0450895_032903_20_133 37
1722 3300042133 Ga0450896_043484 Ga0450896_043484_455_568 37
1723 3300042133 Ga0450896_045205 Ga0450896_045205_244_357 37
1724 3300042134 Ga0450898_012656 Ga0450898_012656_173_286 37
1725 3300042134 Ga0450898_076991 Ga0450898_076991_235_348 37
1726 3300042134 Ga0450898_135599 Ga0450898_135599_124_237 37
1727 3300042135 Ga0450899_009309 Ga0450899_009309_246_359 37
1728 3300042135 Ga0450899_039060 Ga0450899_039060_37_150 37
1729 3300042136 Ga0450900_001889 Ga0450900_001889_919_1032 37
1730 3300042136 Ga0450900_038916 Ga0450900_038916_460_573 37
1731 3300042137 Ga0450902_029292 Ga0450902_029292_121_234 37
1732 3300042137 Ga0450902_039131 Ga0450902_039131_338_451 37
1733 3300042138 Ga0450903_009902 Ga0450903_009902_774_887 37
1734 3300042139 Ga0450904_007953 Ga0450904_007953_902_1015 37
1735 3300042139 Ga0450904_009530 Ga0450904_009530_626_739 37
1736 3300042142 Ga0450905_028497 Ga0450905_028497_139_252 37
1737 3300042142 Ga0450905_036462 Ga0450905_036462_475_588 37
1738 3300042142 Ga0450905_101678 Ga0450905_101678_239_352 37
1739 3300042144 Ga0450889_000161 Ga0450889_000161_1560_1673 37
1740 3300042144 Ga0450889_012411 Ga0450889_012411_644_757 37
1741 3300042145 Ga0450906_011839 Ga0450906_011839_1145_1258 37
1742 3300042145 Ga0450906_060039 Ga0450906_060039_181_294 37
1743 3300042146 Ga0450907_071118 Ga0450907_071118_45_158 37
1744 3300042147 Ga0450910_002285 Ga0450910_002285_451_564 37
1745 3300042147 Ga0450910_002869 Ga0450910_002869_1644_1757 37
1746 3300042147 Ga0450910_013115 Ga0450910_013115_719_832 37
1747 3300042147 Ga0450910_089493 Ga0450910_089493_71_184 37
1748 3300042156 Ga0439446_0001588 Ga0439446_0001588_2192_2305 37
1749 3300042156 Ga0439446_0130157 Ga0439446_0130157_186_299 37
1750 3300042156 Ga0439446_0250787 Ga0439446_0250787_58_171 37
1751 3300042156 Ga0439446_0357333 Ga0439446_0357333_374_487 37
1752 3300042156 Ga0439446_0366148 Ga0439446_0366148_360_473 37
1753 3300042157 Ga0439458_0038859 Ga0439458_0038859_966_1079 37
1754 3300042184 Ga0450908_010556 Ga0450908_010556_1127_1240 37
1755 3300042185 Ga0450909_009901 Ga0450909_009901_587_700 37
1756 3300042435 Ga0439434_0000888 Ga0439434_0000888_3205_3318 37
1757 3300042435 Ga0439434_0006911 Ga0439434_0006911_2926_3039 37
1758 3300042435 Ga0439434_0015416 Ga0439434_0015416_1740_1853 37
1759 3300042435 Ga0439434_0153075 Ga0439434_0153075_35_148 37
1760 3300042435 Ga0439434_0197385 Ga0439434_0197385_227_340 37
1761 3300042436 Ga0439435_0000151 Ga0439435_0000151_6882_6995 37
1762 3300042436 Ga0439435_0000450 Ga0439435_0000450_3506_3619 37
1763 3300042436 Ga0439435_0017909 Ga0439435_0017909_599_712 37
1764 3300042436 Ga0439435_0185457 Ga0439435_0185457_422_535 37
1765 3300042437 Ga0439444_0000187 Ga0439444_0000187_2430_2543 37
1766 3300042437 Ga0439444_0123483 Ga0439444_0123483_321_434 37
1767 3300042437 Ga0439444_0127206 Ga0439444_0127206_152_265 37
1768 3300042438 Ga0439459_0022825 Ga0439459_0022825_280_393 37
1769 3300042438 Ga0439459_0059935 Ga0439459_0059935_23_136 37
1770 3300042438 Ga0439459_0114950 Ga0439459_0114950_328_441 37
1771 3300042439 Ga0439464_0007633 Ga0439464_0007633_304_417 37
1772 3300042439 Ga0439464_0098794 Ga0439464_0098794_704_817 37
1773 3300042461 Ga0439460_0002368 Ga0439460_0002368_235_348 37
1774 3300042461 Ga0439460_0002790 Ga0439460_0002790_3633_3746 37
1775 3300042461 Ga0439460_0016114 Ga0439460_0016114_1812_1925 37
1776 3300042461 Ga0439460_0020551 Ga0439460_0020551_442_555 37
1777 3300042530 Ga0450916_013181 Ga0450916_013181_434_547 37
1778 3300042530 Ga0450916_016454 Ga0450916_016454_251_364 37
1779 3300042531 Ga0450918_000550 Ga0450918_000550_4310_4423 37
1780 3300042531 Ga0450918_132676 Ga0450918_132676_181_294 37
1781 3300042532 Ga0450893_0000283 Ga0450893_0000283_859_972 37
1782 3300042532 Ga0450893_0024570 Ga0450893_0024570_603_716 37
1783 3300042532 Ga0450893_0040669 Ga0450893_0040669_271_384 37
1784 3300042533 Ga0450901_036481 Ga0450901_036481_191_304 37
1785 3300042876 Ga0451577_0001340 Ga0451577_0001340_19009_19122 37
1786 3300042876 Ga0451577_0016336 Ga0451577_0016336_4225_4338 37
1787 3300042876 Ga0451577_0376588 Ga0451577_0376588_1124_1237 37
1788 3300042876 Ga0451577_0397740 Ga0451577_0397740_18_131 37
1789 3300042876 Ga0451577_0873900 Ga0451577_0873900_80_193 37
1790 3300042876 Ga0451577_1704663 Ga0451577_1704663_59_172 37
1791 3300042993 Ga0439440_0001395 Ga0439440_0001395_3323_3436 37
1792 3300044656 Ga0466969_0495359 Ga0466969_0495359_92_205 37
1793 3300044673 Ga0453683_0030645 Ga0453683_0030645_2294_2407 37
1794 3300044673 Ga0453683_0736736 Ga0453683_0736736_234_347 37
1795 3300044673 Ga0453683_0743117 Ga0453683_0743117_295_408 37
1796 3300044673 Ga0453683_0902762 Ga0453683_0902762_291_404 37
1797 3300044683 Ga0466965_0113116 Ga0466965_0113116_1195_1308 37
1798 3300044683 Ga0466965_0450366 Ga0466965_0450366_22_135 37
1799 3300044683 Ga0466965_0677095 Ga0466965_0677095_409_522 37
1800 3300044683 Ga0466965_0749720 Ga0466965_0749720_71_184 37
1801 3300044684 Ga0466966_0151478 Ga0466966_0151478_435_548 37
1802 3300044694 Ga0466963_0764695 Ga0466963_0764695_440_553 37
1803 3300044706 Ga0466964_0116873 Ga0466964_0116873_588_701 37
1804 3300044712 Ga0453684_0002255 Ga0453684_0002255_4447_4560 37
1805 3300044712 Ga0453684_0017342 Ga0453684_0017342_3691_3804 37
1806 3300044712 Ga0453684_0040166 Ga0453684_0040166_3982_4095 37
1807 3300044712 Ga0453684_0050212 Ga0453684_0050212_4414_4527 37
1808 3300044712 Ga0453684_0302399 Ga0453684_0302399_634_747 37
1809 3300044712 Ga0453684_1691731 Ga0453684_1691731_231_344 37
1810 3300044712 Ga0453684_2299735 Ga0453684_2299735_238_351 37
1811 3300044735 Ga0466968_0158872 Ga0466968_0158872_568_681 37
1812 3300044842 Ga0466957_0004472 Ga0466957_0004472_4290_4403 37
1813 3300044842 Ga0466957_0656389 Ga0466957_0656389_362_475 37
1814 3300044901 Ga0466960_0142993 Ga0466960_0142993_814_927 37
1815 3300044901 Ga0466960_0589374 Ga0466960_0589374_170_283 37
1816 3300045049 Ga0466959_0160421 Ga0466959_0160421_535_648 37
1817 3300045051 Ga0451576_0018146 Ga0451576_0018146_766_879 37
1818 3300045051 Ga0451576_0031258 Ga0451576_0031258_2650_2763 37
1819 3300045051 Ga0451576_0179381 Ga0451576_0179381_908_1021 37
1820 3300045051 Ga0451576_0194615 Ga0451576_0194615_1862_1975 37
1821 3300045051 Ga0451576_0515031 Ga0451576_0515031_879_992 37
1822 3300045051 Ga0451576_0882059 Ga0451576_0882059_473_586 37
1823 3300045051 Ga0451576_0885161 Ga0451576_0885161_355_468 37
1824 3300045051 Ga0451576_0923863 Ga0451576_0923863_333_446 37
1825 3300045051 Ga0451576_1083525 Ga0451576_1083525_590_703 37
1826 3300045051 Ga0451576_1158584 Ga0451576_1158584_428_541 37
1827 3300045051 Ga0451576_2413382 Ga0451576_2413382_407_520 37
1828 3300045836 Ga0466958_0019624 Ga0466958_0019624_2034_2147 37
1829 3300045836 Ga0466958_0922738 Ga0466958_0922738_131_244 37
1830 3300045976 Ga0466967_0004582 Ga0466967_0004582_619_732 37
1831 3300045976 Ga0466967_0119707 Ga0466967_0119707_1393_1506 37
1832 3300045976 Ga0466967_1562794 Ga0466967_1562794_403_516 37
1833 3300045976 Ga0466967_2527583 Ga0466967_2527583_357_470 37
1834 3300046453 Ga0495627_011372 Ga0495627_011372_1903_2016 37
1835 3300046454 Ga0495592_0002591 Ga0495592_0002591_1894_2007 37
1836 3300046454 Ga0495592_0431085 Ga0495592_0431085_419_532 37
1837 3300046455 Ga0495603_0156829 Ga0495603_0156829_506_619 37
1838 3300046455 Ga0495603_0319980 Ga0495603_0319980_373_486 37
1839 3300046455 Ga0495603_0571582 Ga0495603_0571582_312_425 37
1840 3300046455 Ga0495603_0679674 Ga0495603_0679674_292_405 37
1841 3300046457 Ga0495590_0121607 Ga0495590_0121607_373_486 37
1842 3300046458 Ga0495591_153809 Ga0495591_153809_363_476 37
1843 3300046459 Ga0495629_0555901 Ga0495629_0555901_243_356 37
1844 3300046460 Ga0495638_0089863 Ga0495638_0089863_423_536 37
1845 3300046460 Ga0495638_0134393 Ga0495638_0134393_176_289 37
1846 3300046462 Ga0495651_0828662 Ga0495651_0828662_148_261 37
1847 3300046463 Ga0495653_0040102 Ga0495653_0040102_1694_1807 37
1848 3300046463 Ga0495653_0046670 Ga0495653_0046670_2987_3100 37
1849 3300046463 Ga0495653_0233793 Ga0495653_0233793_537_650 37
1850 3300046472 Ga0495580_0002023 Ga0495580_0002023_5323_5436 37
1851 3300046473 Ga0495582_0345531 Ga0495582_0345531_41_154 37
1852 3300046473 Ga0495582_0709286 Ga0495582_0709286_168_281 37
1853 3300046474 Ga0495605_0204714 Ga0495605_0204714_13_126 37
1854 3300046474 Ga0495605_0225301 Ga0495605_0225301_613_726 37
1855 3300046475 Ga0495639_0019706 Ga0495639_0019706_1795_1908 37
1856 3300046475 Ga0495639_0076571 Ga0495639_0076571_198_311 37
1857 3300046477 Ga0495664_0558176 Ga0495664_0558176_550_663 37
1858 3300046491 Ga0495584_0064668 Ga0495584_0064668_1686_1799 37
1859 3300046491 Ga0495584_0275074 Ga0495584_0275074_603_716 37
1860 3300046492 Ga0495585_0099260 Ga0495585_0099260_1306_1419 37
1861 3300046500 Ga0495596_0025431 Ga0495596_0025431_2144_2257 37
1862 3300046500 Ga0495596_0399102 Ga0495596_0399102_225_338 37
1863 3300046501 Ga0495607_0048033 Ga0495607_0048033_574_687 37
1864 3300046506 Ga0495583_0000510 Ga0495583_0000510_18658_18771 37
1865 3300046506 Ga0495583_0032023 Ga0495583_0032023_10_123 37
1866 3300046511 Ga0495608_0023140 Ga0495608_0023140_1464_1577 37
1867 3300046511 Ga0495608_0207182 Ga0495608_0207182_896_1009 37
1868 3300046511 Ga0495608_0500806 Ga0495608_0500806_590_703 37
1869 3300046512 Ga0495610_0006839 Ga0495610_0006839_3960_4073 37
1870 3300046513 Ga0495616_0013153 Ga0495616_0013153_342_455 37
1871 3300046513 Ga0495616_0165692 Ga0495616_0165692_289_402 37
1872 3300046514 Ga0495618_0405347 Ga0495618_0405347_518_631 37
1873 3300046515 Ga0495620_0025718 Ga0495620_0025718_2073_2186 37
1874 3300046515 Ga0495620_0131573 Ga0495620_0131573_244_357 37
1875 3300046516 Ga0495628_0294638 Ga0495628_0294638_44_157 37
1876 3300046516 Ga0495628_1030200 Ga0495628_1030200_310_423 37
1877 3300046517 Ga0495630_0180697 Ga0495630_0180697_1063_1176 37
1878 3300046517 Ga0495630_0489604 Ga0495630_0489604_707_820 37
1879 3300046517 Ga0495630_0831643 Ga0495630_0831643_456_569 37
1880 3300046518 Ga0495631_0000456 Ga0495631_0000456_23668_23781 37
1881 3300046518 Ga0495631_0081452 Ga0495631_0081452_863_976 37
1882 3300046519 Ga0495632_0381640 Ga0495632_0381640_125_238 37
1883 3300046519 Ga0495632_0392465 Ga0495632_0392465_281_394 37
1884 3300046520 Ga0495637_0001023 Ga0495637_0001023_5915_6028 37
1885 3300046522 Ga0495643_0118456 Ga0495643_0118456_555_668 37
1886 3300046523 Ga0495644_0098268 Ga0495644_0098268_171_284 37
1887 3300046523 Ga0495644_0183484 Ga0495644_0183484_606_719 37
1888 3300046525 Ga0495663_0003486 Ga0495663_0003486_1139_1252 37
1889 3300046525 Ga0495663_0032130 Ga0495663_0032130_254_367 37
1890 3300046525 Ga0495663_0049439 Ga0495663_0049439_347_460 37
1891 3300046525 Ga0495663_0132327 Ga0495663_0132327_197_316 37
1892 3300046528 Ga0495642_0050101 Ga0495642_0050101_690_803 37
1893 3300046528 Ga0495642_0069793 Ga0495642_0069793_136_249 37
1894 3300046528 Ga0495642_0111575 Ga0495642_0111575_877_990 37
1895 3300046529 Ga0495652_0016132 Ga0495652_0016132_3875_3988 37
1896 3300046529 Ga0495652_0224633 Ga0495652_0224633_639_752 37
1897 3300046530 Ga0495654_0061232 Ga0495654_0061232_1653_1766 37
1898 3300046530 Ga0495654_0151793 Ga0495654_0151793_830_943 37
1899 3300046533 Ga0495640_0418822 Ga0495640_0418822_468_581 37
1900 3300046533 Ga0495640_0854966 Ga0495640_0854966_338_451 37
1901 3300046535 Ga0495586_0210692 Ga0495586_0210692_560_673 37
1902 3300046536 Ga0495587_0006957 Ga0495587_0006957_577_690 37
1903 3300046536 Ga0495587_0159793 Ga0495587_0159793_400_513 37
1904 3300046537 Ga0495598_0009757 Ga0495598_0009757_1932_2045 37
1905 3300046537 Ga0495598_0021669 Ga0495598_0021669_70_183 37
1906 3300046537 Ga0495598_0126136 Ga0495598_0126136_478_591 37
1907 3300046537 Ga0495598_0128955 Ga0495598_0128955_329_442 37
1908 3300046537 Ga0495598_0247784 Ga0495598_0247784_131_250 37
1909 3300046537 Ga0495598_0448057 Ga0495598_0448057_64_177 37
1910 3300046538 Ga0495609_0065953 Ga0495609_0065953_373_486 37
1911 3300046538 Ga0495609_0119522 Ga0495609_0119522_992_1111 37
1912 3300046539 Ga0495621_0015191 Ga0495621_0015191_1330_1443 37
1913 3300046539 Ga0495621_0042108 Ga0495621_0042108_1130_1243 37
1914 3300046539 Ga0495621_0089786 Ga0495621_0089786_412_525 37
1915 3300046539 Ga0495621_0472234 Ga0495621_0472234_333_446 37
1916 3300046539 Ga0495621_0517594 Ga0495621_0517594_364_477 37
1917 3300046542 Ga0495597_0356769 Ga0495597_0356769_193_306 37
1918 3300046543 Ga0495645_0020802 Ga0495645_0020802_1768_1881 37
1919 3300046543 Ga0495645_0672548 Ga0495645_0672548_454_567 37
1920 3300046557 Ga0495622_0124830 Ga0495622_0124830_323_436 37
1921 3300046557 Ga0495622_0142635 Ga0495622_0142635_724_837 37
1922 3300046557 Ga0495622_0372839 Ga0495622_0372839_419_532 37
1923 3300046558 Ga0495633_0072659 Ga0495633_0072659_336_449 37
1924 3300046558 Ga0495633_0140210 Ga0495633_0140210_106_219 37
1925 3300046559 Ga0495667_0020109 Ga0495667_0020109_3381_3494 37
1926 3300046559 Ga0495667_0349366 Ga0495667_0349366_721_834 37
1927 3300046615 Ga0495656_0018788 Ga0495656_0018788_1346_1459 37
1928 3300046615 Ga0495656_0145910 Ga0495656_0145910_139_252 37
1929 3300046615 Ga0495656_0241536 Ga0495656_0241536_421_534 37
1930 3300046615 Ga0495656_0377610 Ga0495656_0377610_327_440 37
1931 3300046615 Ga0495656_0383828 Ga0495656_0383828_142_255 37
1932 3300046616 Ga0495668_0051941 Ga0495668_0051941_158_271 37
1933 3300046616 Ga0495668_0073920 Ga0495668_0073920_250_363 37
1934 3300046642 Ga0495634_0217770 Ga0495634_0217770_681_794 37
1935 3300046642 Ga0495634_0627490 Ga0495634_0627490_427_540 37
1936 3300046642 Ga0495634_0664206 Ga0495634_0664206_432_545 37
1937 3300046642 Ga0495634_0764301 Ga0495634_0764301_350_463 37
1938 3300046648 Ga0495611_0042850 Ga0495611_0042850_449_562 37
1939 3300046648 Ga0495611_0497706 Ga0495611_0497706_334_447 37
1940 3300046660 Ga0495625_0054960 Ga0495625_0054960_836_949 37
1941 3300046663 Ga0495635_0082296 Ga0495635_0082296_1070_1183 37
1942 3300046663 Ga0495635_0149128 Ga0495635_0149128_890_1003 37
1943 3300046663 Ga0495635_0510182 Ga0495635_0510182_456_569 37
1944 3300046664 Ga0495659_0070333 Ga0495659_0070333_907_1020 37
1945 3300046664 Ga0495659_0084897 Ga0495659_0084897_676_789 37
1946 3300046664 Ga0495659_0373677 Ga0495659_0373677_137_250 37
1947 3300046665 Ga0495661_0028969 Ga0495661_0028969_2751_2864 37
1948 3300046665 Ga0495661_0031733 Ga0495661_0031733_2130_2243 37
1949 3300046674 Ga0495588_0071551 Ga0495588_0071551_401_514 37
1950 3300046674 Ga0495588_0170051 Ga0495588_0170051_96_209 37
1951 3300046675 Ga0495657_0076887 Ga0495657_0076887_1582_1695 37
1952 3300046675 Ga0495657_0256580 Ga0495657_0256580_676_789 37
1953 3300046675 Ga0495657_0489003 Ga0495657_0489003_452_565 37
1954 3300046678 Ga0495599_0009248 Ga0495599_0009248_2229_2342 37
1955 3300046679 Ga0495623_0006008 Ga0495623_0006008_5894_6007 37
1956 3300046680 Ga0495646_0071331 Ga0495646_0071331_848_961 37
1957 3300046681 Ga0495647_0158405 Ga0495647_0158405_666_779 37
1958 3300046683 Ga0495658_0005887 Ga0495658_0005887_1348_1461 37
1959 3300046683 Ga0495658_0154697 Ga0495658_0154697_13_126 37
1960 3300046683 Ga0495658_0157238 Ga0495658_0157238_779_892 37
1961 3300046683 Ga0495658_1036411 Ga0495658_1036411_114_227 37
1962 3300046684 Ga0495669_0005007 Ga0495669_0005007_2010_2123 37
1963 3300046684 Ga0495669_0190130 Ga0495669_0190130_608_721 37
1964 3300046684 Ga0495669_0304048 Ga0495669_0304048_594_707 37
1965 3300046684 Ga0495669_0610377 Ga0495669_0610377_126_239 37
1966 3300046690 Ga0495624_0208455 Ga0495624_0208455_224_337 37
1967 3300046690 Ga0495624_0846490 Ga0495624_0846490_131_244 37
1968 3300046690 Ga0495624_0900497 Ga0495624_0900497_329_442 37
1969 3300046691 Ga0495670_0040622 Ga0495670_0040622_631_744 37
1970 3300046691 Ga0495670_0193245 Ga0495670_0193245_421_534 37
1971 3300046691 Ga0495670_0258159 Ga0495670_0258159_190_303 37
1972 3300046692 Ga0495671_0010918 Ga0495671_0010918_2175_2288 37
1973 3300046692 Ga0495671_0164555 Ga0495671_0164555_247_360 37
1974 3300046692 Ga0495671_0446039 Ga0495671_0446039_199_312 37
1975 3300046692 Ga0495671_0517842 Ga0495671_0517842_183_296 37
1976 3300046694 Ga0495649_0000961 Ga0495649_0000961_20395_20508 37
1977 3300046694 Ga0495649_0017328 Ga0495649_0017328_1760_1873 37
1978 3300046794 Ga0495589_0004694 Ga0495589_0004694_2395_2508 37
1979 3300046794 Ga0495589_0119262 Ga0495589_0119262_254_367 37
1980 3300046794 Ga0495589_0402924 Ga0495589_0402924_17_130 37
1981 3300046809 Ga0495600_0063519 Ga0495600_0063519_1198_1311 37
1982 3300046809 Ga0495600_0284804 Ga0495600_0284804_545_658 37
1983 3300046809 Ga0495600_0654504 Ga0495600_0654504_11_124 37
1984 3300046810 Ga0495660_0049677 Ga0495660_0049677_1784_1897 37
1985 3300046810 Ga0495660_0311485 Ga0495660_0311485_416_529 37
1986 3300047315 Ga0495581_0831116 Ga0495581_0831116_258_371 37
1987 3300047317 Ga0495604_0273991 Ga0495604_0273991_403_516 37
1988 3300047317 Ga0495604_0281279 Ga0495604_0281279_614_727 37
1989 3300047317 Ga0495604_0536407 Ga0495604_0536407_191_304 37
1990 3300047317 Ga0495604_0615397 Ga0495604_0615397_395_508 37
1991 3300047318 Ga0495636_0019553 Ga0495636_0019553_1033_1146 37
1992 3300047318 Ga0495636_0022968 Ga0495636_0022968_490_606 37
1993 3300047318 Ga0495636_0125797 Ga0495636_0125797_165_278 37
1994 3300047318 Ga0495636_0196122 Ga0495636_0196122_100_213 37
1995 3300047318 Ga0495636_0244271 Ga0495636_0244271_636_749 37
1996 3300047320 Ga0495672_0501133 Ga0495672_0501133_103_216 37
1997 3300047321 Ga0495676_0006299 Ga0495676_0006299_6516_6629 37
1998 3300047322 Ga0495680_0056613 Ga0495680_0056613_481_594 37
1999 3300047322 Ga0495680_0136376 Ga0495680_0136376_1167_1280 37
2000 3300047322 Ga0495680_0809622 Ga0495680_0809622_250_363 37
2001 3300047444 Ga0495675_0199142 Ga0495675_0199142_574_687 37
2002 3300047444 Ga0495675_0334372 Ga0495675_0334372_768_881 37
2003 3300047445 Ga0495677_0104061 Ga0495677_0104061_487_600 37
2004 3300047445 Ga0495677_0309710 Ga0495677_0309710_268_381 37
2005 3300047447 Ga0495685_203691 Ga0495685_203691_329_442 37
2006 3300047447 Ga0495685_217113 Ga0495685_217113_176_289 37
2007 3300047470 Ga0495681_0020260 Ga0495681_0020260_3328_3441 37
2008 3300047470 Ga0495681_0087097 Ga0495681_0087097_833_946 37
2009 3300047471 Ga0495684_0097665 Ga0495684_0097665_1220_1333 37
2010 3300047471 Ga0495684_0107824 Ga0495684_0107824_1365_1478 37
2011 3300047471 Ga0495684_0109620 Ga0495684_0109620_936_1049 37
2012 3300047472 Ga0495686_0108812 Ga0495686_0108812_594_707 37
2013 3300047472 Ga0495686_0696001 Ga0495686_0696001_327_440 37
2014 3300047673 Ga0495593_0003632 Ga0495593_0003632_928_1041 37
2015 3300047673 Ga0495593_0233207 Ga0495593_0233207_465_578 37
2016 3300048088 Ga0495602_0149764 Ga0495602_0149764_41_154 37
2017 3300048088 Ga0495602_0816339 Ga0495602_0816339_493_606 37
2018 3300048089 Ga0495614_0008776 Ga0495614_0008776_4240_4353 37
2019 3300048090 Ga0495615_0027964 Ga0495615_0027964_151_264 37
2020 3300048090 Ga0495615_0054768 Ga0495615_0054768_265_378 37
2021 3300048090 Ga0495615_0060106 Ga0495615_0060106_473_586 37
2022 3300048090 Ga0495615_0163551 Ga0495615_0163551_235_348 37
2023 3300048090 Ga0495615_0253264 Ga0495615_0253264_206_319 37
2024 3300048091 Ga0495626_0343219 Ga0495626_0343219_373_486 37
2025 3300048903 Ga0496100_0027093 Ga0496100_0027093_2250_2363 37
2026 3300048904 Ga0496101_0007848 Ga0496101_0007848_3971_4084 37
2027 3300048904 Ga0496101_0028824 Ga0496101_0028824_2783_2896 37
2028 3300048904 Ga0496101_0100394 Ga0496101_0100394_1901_2014 37
2029 3300048905 Ga0496102_0007579 Ga0496102_0007579_7948_8061 37
2030 3300048906 Ga0496103_0118117 Ga0496103_0118117_215_328 37
2031 3300048907 Ga0496104_0008378 Ga0496104_0008378_3755_3868 37
2032 3300048907 Ga0496104_0081990 Ga0496104_0081990_2570_2683 37
2033 3300048907 Ga0496104_0168941 Ga0496104_0168941_1184_1297 37
2034 3300048908 Ga0496105_0009457 Ga0496105_0009457_4011_4124 37
2035 3300048908 Ga0496105_0061638 Ga0496105_0061638_405_518 37
2036 3300048908 Ga0496105_0545719 Ga0496105_0545719_62_175 37
2037 3300048909 Ga0496106_0019165 Ga0496106_0019165_3046_3159 37
2038 3300048909 Ga0496106_0745513 Ga0496106_0745513_130_243 37
2039 3300048909 Ga0496106_1324859 Ga0496106_1324859_126_239 37
2040 3300048910 Ga0496107_0175168 Ga0496107_0175168_1345_1458 37
2041 3300048910 Ga0496107_0433633 Ga0496107_0433633_441_554 37
2042 3300048910 Ga0496107_1275245 Ga0496107_1275245_215_328 37
2043 3300048911 Ga0496108_0085225 Ga0496108_0085225_1567_1680 37
2044 3300048911 Ga0496108_0300557 Ga0496108_0300557_803_916 37
2045 3300048911 Ga0496108_0767644 Ga0496108_0767644_562_675 37
2046 3300048911 Ga0496108_1147680 Ga0496108_1147680_533_646 37
2047 3300048912 Ga0496109_0029780 Ga0496109_0029780_4252_4365 37
2048 3300048912 Ga0496109_0033215 Ga0496109_0033215_3947_4060 37
2049 3300048912 Ga0496109_0061852 Ga0496109_0061852_2320_2433 37
2050 3300048912 Ga0496109_0184417 Ga0496109_0184417_510_623 37
2051 3300048912 Ga0496109_0789501 Ga0496109_0789501_473_586 37
2052 3300048912 Ga0496109_0945569 Ga0496109_0945569_18_131 37
2053 3300048912 Ga0496109_1894963 Ga0496109_1894963_139_252 37
2054 3300048913 Ga0496110_0121293 Ga0496110_0121293_1835_1948 37
2055 3300048913 Ga0496110_0400325 Ga0496110_0400325_594_707 37
2056 3300048913 Ga0496110_0679555 Ga0496110_0679555_307_420 37
2057 3300048913 Ga0496110_0914324 Ga0496110_0914324_293_406 37
2058 3300048914 Ga0496111_0004330 Ga0496111_0004330_6540_6653 37
2059 3300048914 Ga0496111_0159024 Ga0496111_0159024_636_749 37
2060 3300048914 Ga0496111_1215265 Ga0496111_1215265_327_440 37
2061 3300048914 Ga0496111_1215531 Ga0496111_1215531_160_273 37
2062 3300048915 Ga0496112_0144099 Ga0496112_0144099_140_253 37
2063 3300048915 Ga0496112_1066555 Ga0496112_1066555_317_430 37
2064 3300048916 Ga0496113_0078179 Ga0496113_0078179_241_354 37
2065 3300048916 Ga0496113_1599523 Ga0496113_1599523_262_375 37
2066 3300048917 Ga0496114_0109050 Ga0496114_0109050_698_811 37
2067 3300048917 Ga0496114_0934371 Ga0496114_0934371_389_502 37
2068 3300048917 Ga0496114_1188405 Ga0496114_1188405_115_228 37
2069 3300048918 Ga0496115_0025679 Ga0496115_0025679_2541_2654 37
2070 3300048918 Ga0496115_0069392 Ga0496115_0069392_1634_1747 37
2071 3300048918 Ga0496115_0813320 Ga0496115_0813320_34_147 37
2072 3300048921 Ga0496118_0175469 Ga0496118_0175469_183_296 37
2073 3300048921 Ga0496118_0177124 Ga0496118_0177124_942_1055 37
2074 3300048924 Ga0496121_0057197 Ga0496121_0057197_2843_2956 37
2075 3300048924 Ga0496121_0059866 Ga0496121_0059866_1700_1813 37
2076 3300048925 Ga0496122_0000317 Ga0496122_0000317_8134_8247 37
2077 3300048925 Ga0496122_0144833 Ga0496122_0144833_869_982 37
2078 3300048925 Ga0496122_0265638 Ga0496122_0265638_260_373 37
2079 3300048926 Ga0496123_0000264 Ga0496123_0000264_62890_63003 37
2080 3300048926 Ga0496123_0280093 Ga0496123_0280093_147_260 37
2081 3300048927 Ga0496124_0001830 Ga0496124_0001830_17469_17582 37
2082 3300048927 Ga0496124_0018476 Ga0496124_0018476_3953_4066 37
2083 3300048927 Ga0496124_0385587 Ga0496124_0385587_749_862 37
2084 3300048928 Ga0496125_0013937 Ga0496125_0013937_6001_6114 37
2085 3300048928 Ga0496125_0142135 Ga0496125_0142135_636_749 37
2086 3300048929 Ga0496126_0064442 Ga0496126_0064442_1914_2027 37
2087 3300049127 Ga0501306_000065 Ga0501306_000065_2310_2423 37
2088 3300049127 Ga0501306_000344 Ga0501306_000344_748_861 37
2089 3300049127 Ga0501306_010759 Ga0501306_010759_461_574 37
2090 3300049127 Ga0501306_035075 Ga0501306_035075_185_298 37
2091 3300049127 Ga0501306_045711 Ga0501306_045711_504_617 37
2092 3300049127 Ga0501306_061479 Ga0501306_061479_61_174 37
2093 3300049128 Ga0501308_000024 Ga0501308_000024_3465_3578 37
2094 3300049129 Ga0501309_000014 Ga0501309_000014_1847_1960 37
2095 3300049129 Ga0501309_005473 Ga0501309_005473_1199_1312 37
2096 3300049129 Ga0501309_016010 Ga0501309_016010_462_575 37
2097 3300049129 Ga0501309_053940 Ga0501309_053940_27_140 37
2098 3300049129 Ga0501309_082019 Ga0501309_082019_259_372 37
2099 3300049130 Ga0501310_000059 Ga0501310_000059_2829_2942 37
2100 3300049130 Ga0501310_000843 Ga0501310_000843_1199_1312 37
2101 3300049130 Ga0501310_004173 Ga0501310_004173_173_286 37
2102 3300049130 Ga0501310_010340 Ga0501310_010340_625_738 37
2103 3300049130 Ga0501310_012592 Ga0501310_012592_683_796 37
2104 3300049130 Ga0501310_020385 Ga0501310_020385_577_690 37
2105 3300049130 Ga0501310_025346 Ga0501310_025346_463_576 37
2106 3300049130 Ga0501310_077457 Ga0501310_077457_183_296 37
2107 3300049131 Ga0501341_01338 Ga0501341_01338_753_866 37
2108 3300049131 Ga0501341_03585 Ga0501341_03585_371_484 37
2109 3300049132 Ga0501343_017449 Ga0501343_017449_447_560 37
2110 3300049133 Ga0501344_02207 Ga0501344_02207_296_409 37
2111 3300049160 Ga0501304_000014 Ga0501304_000014_6076_6189 37
2112 3300049160 Ga0501304_005307 Ga0501304_005307_153_266 37
2113 3300049161 Ga0501305_000004 Ga0501305_000004_9772_9885 37
2114 3300049161 Ga0501305_006260 Ga0501305_006260_794_907 37
2115 3300049161 Ga0501305_011644 Ga0501305_011644_866_979 37
2116 3300049161 Ga0501305_025965 Ga0501305_025965_136_249 37
2117 3300049161 Ga0501305_030417 Ga0501305_030417_398_511 37
2118 3300049161 Ga0501305_032285 Ga0501305_032285_53_166 37
2119 3300049161 Ga0501305_058491 Ga0501305_058491_398_511 37
2120 3300049161 Ga0501305_077712 Ga0501305_077712_61_174 37
2121 3300049162 Ga0501307_000035 Ga0501307_000035_2267_2380 37
2122 3300049162 Ga0501307_021704 Ga0501307_021704_590_703 37
2123 3300049162 Ga0501307_051652 Ga0501307_051652_204_317 37
2124 3300049162 Ga0501307_069140 Ga0501307_069140_288_401 37
2125 3300049162 Ga0501307_078072 Ga0501307_078072_39_152 37
2126 3300049513 Ga0501290_030526 Ga0501290_030526_349_462 37
2127 3300049513 Ga0501290_032393 Ga0501290_032393_137_250 37
2128 3300049513 Ga0501290_076177 Ga0501290_076177_102_215 37
2129 3300049514 Ga0501291_002523 Ga0501291_002523_1202_1315 37
2130 3300049514 Ga0501291_004079 Ga0501291_004079_80_193 37
2131 3300049514 Ga0501291_089829 Ga0501291_089829_56_169 37
2132 3300049515 Ga0501292_059248 Ga0501292_059248_567_680 37
2133 3300049515 Ga0501292_119718 Ga0501292_119718_360_473 37
2134 3300049516 Ga0501293_012170 Ga0501293_012170_352_465 37
2135 3300049517 Ga0501294_006275 Ga0501294_006275_862_975 37
2136 3300049518 Ga0501295_059225 Ga0501295_059225_190_303 37
2137 3300049518 Ga0501295_113620 Ga0501295_113620_440_553 37
2138 3300049518 Ga0501295_182030 Ga0501295_182030_228_341 37
2139 3300049519 Ga0501296_003536 Ga0501296_003536_1390_1503 37
2140 3300049520 Ga0501297_004866 Ga0501297_004866_970_1083 37
2141 3300049521 Ga0501298_022143 Ga0501298_022143_1039_1152 37
2142 3300049521 Ga0501298_023940 Ga0501298_023940_1026_1139 37
2143 3300049521 Ga0501298_032703 Ga0501298_032703_840_953 37
2144 3300049521 Ga0501298_049969 Ga0501298_049969_316_429 37
2145 3300049521 Ga0501298_078916 Ga0501298_078916_455_568 37
2146 3300049521 Ga0501298_103997 Ga0501298_103997_296_409 37
2147 3300049521 Ga0501298_108353 Ga0501298_108353_20_133 37
2148 3300049521 Ga0501298_115749 Ga0501298_115749_313_426 37
2149 3300049522 Ga0501299_001676 Ga0501299_001676_1232_1345 37
2150 3300049522 Ga0501299_054034 Ga0501299_054034_545_658 37
2151 3300049523 Ga0501300_000354 Ga0501300_000354_4668_4781 37
2152 3300049523 Ga0501300_052618 Ga0501300_052618_280_393 37
2153 3300049523 Ga0501300_073203 Ga0501300_073203_149_262 37
2154 3300049523 Ga0501300_074091 Ga0501300_074091_90_203 37
2155 3300049524 Ga0501301_004205 Ga0501301_004205_422_535 37
2156 3300049526 Ga0501303_008735 Ga0501303_008735_129_242 37
2157 3300049526 Ga0501303_016431 Ga0501303_016431_522_635 37
2158 3300049527 Ga0501311_000245 Ga0501311_000245_1255_1368 37
2159 3300049527 Ga0501311_063586 Ga0501311_063586_143_256 37
2160 3300049527 Ga0501311_090636 Ga0501311_090636_200_313 37
2161 3300049527 Ga0501311_095971 Ga0501311_095971_80_196 37
2162 3300049528 Ga0501312_000016 Ga0501312_000016_3543_3656 37
2163 3300049528 Ga0501312_019873 Ga0501312_019873_341_454 37
2164 3300049528 Ga0501312_021089 Ga0501312_021089_460_573 37
2165 3300049528 Ga0501312_050631 Ga0501312_050631_245_358 37
2166 3300049528 Ga0501312_095696 Ga0501312_095696_213_326 37
2167 3300049529 Ga0501313_000738 Ga0501313_000738_1856_1969 37
2168 3300049529 Ga0501313_022356 Ga0501313_022356_294_407 37
2169 3300049530 Ga0501314_000017 Ga0501314_000017_2677_2790 37
2170 3300049530 Ga0501314_000466 Ga0501314_000466_135_248 37
2171 3300049530 Ga0501314_008758 Ga0501314_008758_680_793 37
2172 3300049530 Ga0501314_015344 Ga0501314_015344_476_589 37
2173 3300049530 Ga0501314_035658 Ga0501314_035658_176_289 37
2174 3300049531 Ga0501315_000518 Ga0501315_000518_1712_1825 37
2175 3300049531 Ga0501315_022980 Ga0501315_022980_586_699 37
2176 3300049531 Ga0501315_028681 Ga0501315_028681_219_332 37
2177 3300049531 Ga0501315_030611 Ga0501315_030611_148_261 37
2178 3300049531 Ga0501315_041738 Ga0501315_041738_94_207 37
2179 3300049531 Ga0501315_045279 Ga0501315_045279_70_183 37
2180 3300049531 Ga0501315_104445 Ga0501315_104445_239_352 37
2181 3300049532 Ga0501316_000284 Ga0501316_000284_274_387 37
2182 3300049532 Ga0501316_002193 Ga0501316_002193_1165_1278 37
2183 3300049532 Ga0501316_013435 Ga0501316_013435_523_636 37
2184 3300049532 Ga0501316_019513 Ga0501316_019513_539_652 37
2185 3300049533 Ga0501317_000411 Ga0501317_000411_1714_1827 37
2186 3300049533 Ga0501317_013033 Ga0501317_013033_607_720 37
2187 3300049533 Ga0501317_014492 Ga0501317_014492_541_654 37
2188 3300049533 Ga0501317_045653 Ga0501317_045653_457_570 37
2189 3300049533 Ga0501317_048941 Ga0501317_048941_171_284 37
2190 3300049533 Ga0501317_066544 Ga0501317_066544_334_447 37
2191 3300049533 Ga0501317_079695 Ga0501317_079695_221_334 37
2192 3300049533 Ga0501317_085243 Ga0501317_085243_241_354 37
2193 3300049534 Ga0501318_000081 Ga0501318_000081_1117_1230 37
2194 3300049534 Ga0501318_000274 Ga0501318_000274_2061_2174 37
2195 3300049534 Ga0501318_009035 Ga0501318_009035_165_278 37
2196 3300049534 Ga0501318_026184 Ga0501318_026184_88_201 37
2197 3300049534 Ga0501318_029938 Ga0501318_029938_149_262 37
2198 3300049534 Ga0501318_035258 Ga0501318_035258_31_144 37
2199 3300049534 Ga0501318_036088 Ga0501318_036088_241_354 37
2200 3300049534 Ga0501318_059874 Ga0501318_059874_69_182 37
2201 3300049535 Ga0501319_002629 Ga0501319_002629_233_346 37
2202 3300049535 Ga0501319_032051 Ga0501319_032051_248_361 37
2203 3300049536 Ga0501320_000232 Ga0501320_000232_1147_1260 37
2204 3300049536 Ga0501320_002008 Ga0501320_002008_670_783 37
2205 3300049536 Ga0501320_016177 Ga0501320_016177_136_249 37
2206 3300049536 Ga0501320_060991 Ga0501320_060991_265_378 37
2207 3300049537 Ga0501321_001908 Ga0501321_001908_961_1074 37
2208 3300049537 Ga0501321_016273 Ga0501321_016273_134_247 37
2209 3300049537 Ga0501321_033817 Ga0501321_033817_300_413 37
2210 3300049537 Ga0501321_057224 Ga0501321_057224_48_161 37
2211 3300049537 Ga0501321_081143 Ga0501321_081143_118_231 37
2212 3300049538 Ga0501322_000238 Ga0501322_000238_502_615 37
2213 3300049539 Ga0501323_000147 Ga0501323_000147_1658_1771 37
2214 3300049539 Ga0501323_017097 Ga0501323_017097_245_358 37
2215 3300049539 Ga0501323_020130 Ga0501323_020130_637_750 37
2216 3300049539 Ga0501323_023138 Ga0501323_023138_55_168 37
2217 3300049539 Ga0501323_025424 Ga0501323_025424_172_285 37
2218 3300049539 Ga0501323_060295 Ga0501323_060295_40_153 37
2219 3300049540 Ga0501324_002476 Ga0501324_002476_1007_1120 37
2220 3300049540 Ga0501324_002605 Ga0501324_002605_104_217 37
2221 3300049540 Ga0501324_009867 Ga0501324_009867_456_569 37
2222 3300049540 Ga0501324_012248 Ga0501324_012248_182_295 37
2223 3300049541 Ga0501325_000417 Ga0501325_000417_693_806 37
2224 3300049541 Ga0501325_004818 Ga0501325_004818_574_687 37
2225 3300049541 Ga0501325_009085 Ga0501325_009085_592_705 37
2226 3300049541 Ga0501325_040662 Ga0501325_040662_211_324 37
2227 3300049541 Ga0501325_056453 Ga0501325_056453_58_171 37
2228 3300049542 Ga0501326_11671 Ga0501326_11671_355_468 37
2229 3300049544 Ga0501328_00193 Ga0501328_00193_1102_1215 37
2230 3300049547 Ga0501331_02849 Ga0501331_02849_451_564 37
2231 3300049548 Ga0501332_04973 Ga0501332_04973_346_459 37
2232 3300049548 Ga0501332_13741 Ga0501332_13741_316_429 37
2233 3300049549 Ga0501333_005747 Ga0501333_005747_164_277 37
2234 3300049550 Ga0501334_09783 Ga0501334_09783_227_340 37
2235 3300049550 Ga0501334_09792 Ga0501334_09792_239_352 37
2236 3300049551 Ga0501335_003108 Ga0501335_003108_357_470 37
2237 3300049551 Ga0501335_033625 Ga0501335_033625_311_424 37
2238 3300049551 Ga0501335_036454 Ga0501335_036454_419_532 37
2239 3300049551 Ga0501335_045084 Ga0501335_045084_354_467 37
2240 3300049552 Ga0501336_004018 Ga0501336_004018_874_987 37
2241 3300049552 Ga0501336_022061 Ga0501336_022061_131_244 37
2242 3300049556 Ga0501340_011592 Ga0501340_011592_262_375 37
2243 3300049556 Ga0501340_021732 Ga0501340_021732_237_350 37
2244 3300049568 Ga0501031_0000096 Ga0501031_0000096_17269_17382 37
2245 3300049568 Ga0501031_0004257 Ga0501031_0004257_8288_8401 37
2246 3300049568 Ga0501031_0054391 Ga0501031_0054391_1433_1546 37
2247 3300049568 Ga0501031_0236056 Ga0501031_0236056_594_707 37
2248 3300049568 Ga0501031_0279182 Ga0501031_0279182_372_485 37
2249 3300049568 Ga0501031_0384592 Ga0501031_0384592_355_468 37
2250 3300049568 Ga0501031_0606794 Ga0501031_0606794_212_325 37
2251 3300049568 Ga0501031_0631876 Ga0501031_0631876_285_398 37
2252 3300049569 Ga0501032_0048499 Ga0501032_0048499_1062_1175 37
2253 3300049569 Ga0501032_0061106 Ga0501032_0061106_1402_1515 37
2254 3300049569 Ga0501032_0624887 Ga0501032_0624887_157_270 37
2255 3300049569 Ga0501032_0841583 Ga0501032_0841583_41_154 37
2256 3300049570 Ga0501033_0000586 Ga0501033_0000586_25141_25254 37
2257 3300049570 Ga0501033_0007474 Ga0501033_0007474_7091_7204 37
2258 3300049570 Ga0501033_0051102 Ga0501033_0051102_1226_1339 37
2259 3300049570 Ga0501033_0074606 Ga0501033_0074606_1393_1506 37
2260 3300049570 Ga0501033_0257346 Ga0501033_0257346_831_944 37
2261 3300049570 Ga0501033_1150643 Ga0501033_1150643_80_193 37
2262 3300049571 Ga0501034_0310274 Ga0501034_0310274_780_893 37
2263 3300049571 Ga0501034_0715454 Ga0501034_0715454_342_455 37
2264 3300049571 Ga0501034_0747781 Ga0501034_0747781_147_260 37
2265 3300049571 Ga0501034_1407050 Ga0501034_1407050_367_480 37
2266 3300049571 Ga0501034_1584473 Ga0501034_1584473_30_143 37
2267 3300049572 Ga0501036_0004359 Ga0501036_0004359_9335_9448 37
2268 3300049572 Ga0501036_0004445 Ga0501036_0004445_3441_3554 37
2269 3300049572 Ga0501036_0027052 Ga0501036_0027052_4168_4281 37
2270 3300049572 Ga0501036_0056409 Ga0501036_0056409_1968_2081 37
2271 3300049572 Ga0501036_0072626 Ga0501036_0072626_1510_1623 37
2272 3300049572 Ga0501036_0101926 Ga0501036_0101926_1124_1237 37
2273 3300049572 Ga0501036_0123171 Ga0501036_0123171_851_964 37
2274 3300049572 Ga0501036_0274233 Ga0501036_0274233_1031_1144 37
2275 3300049572 Ga0501036_0285955 Ga0501036_0285955_1217_1330 37
2276 3300049572 Ga0501036_0329692 Ga0501036_0329692_834_947 37
2277 3300049572 Ga0501036_0334209 Ga0501036_0334209_432_545 37
2278 3300049572 Ga0501036_0505141 Ga0501036_0505141_71_184 37
2279 3300049572 Ga0501036_1189594 Ga0501036_1189594_253_366 37
2280 3300049572 Ga0501036_1735921 Ga0501036_1735921_210_323 37
2281 3300049573 Ga0501037_0005636 Ga0501037_0005636_6571_6684 37
2282 3300049573 Ga0501037_0019086 Ga0501037_0019086_1963_2076 37
2283 3300049573 Ga0501037_0036167 Ga0501037_0036167_298_411 37
2284 3300049573 Ga0501037_0041509 Ga0501037_0041509_1296_1409 37
2285 3300049573 Ga0501037_0146917 Ga0501037_0146917_1398_1511 37
2286 3300049573 Ga0501037_0469548 Ga0501037_0469548_85_198 37
2287 3300049573 Ga0501037_0645281 Ga0501037_0645281_208_321 37
2288 3300049573 Ga0501037_0875992 Ga0501037_0875992_203_316 37
2289 3300049574 Ga0501038_0000891 Ga0501038_0000891_17080_17193 37
2290 3300049574 Ga0501038_0012346 Ga0501038_0012346_7506_7619 37
2291 3300049574 Ga0501038_0026095 Ga0501038_0026095_4721_4834 37
2292 3300049574 Ga0501038_0085121 Ga0501038_0085121_1402_1515 37
2293 3300049574 Ga0501038_0141371 Ga0501038_0141371_1440_1553 37
2294 3300049574 Ga0501038_0198085 Ga0501038_0198085_277_390 37
2295 3300049574 Ga0501038_0391808 Ga0501038_0391808_102_215 37
2296 3300049574 Ga0501038_0452183 Ga0501038_0452183_740_853 37
2297 3300049574 Ga0501038_0914425 Ga0501038_0914425_84_197 37
2298 3300049574 Ga0501038_1383655 Ga0501038_1383655_129_242 37
2299 3300049575 Ga0501039_0005177 Ga0501039_0005177_2590_2703 37
2300 3300049575 Ga0501039_0010874 Ga0501039_0010874_1240_1353 37
2301 3300049575 Ga0501039_0036471 Ga0501039_0036471_1610_1723 37
2302 3300049575 Ga0501039_0092756 Ga0501039_0092756_1928_2041 37
2303 3300049575 Ga0501039_0114166 Ga0501039_0114166_1445_1558 37
2304 3300049575 Ga0501039_0402118 Ga0501039_0402118_494_607 37
2305 3300049575 Ga0501039_0562446 Ga0501039_0562446_156_269 37
2306 3300049575 Ga0501039_0861448 Ga0501039_0861448_225_338 37
2307 3300049575 Ga0501039_1260615 Ga0501039_1260615_349_462 37
2308 3300049576 Ga0501040_0003883 Ga0501040_0003883_9290_9403 37
2309 3300049576 Ga0501040_0004013 Ga0501040_0004013_1747_1860 37
2310 3300049576 Ga0501040_0004087 Ga0501040_0004087_5308_5421 37
2311 3300049576 Ga0501040_0017211 Ga0501040_0017211_1462_1575 37
2312 3300049576 Ga0501040_0086869 Ga0501040_0086869_294_407 37
2313 3300049576 Ga0501040_0135205 Ga0501040_0135205_701_814 37
2314 3300049576 Ga0501040_0139756 Ga0501040_0139756_1082_1195 37
2315 3300049576 Ga0501040_0762860 Ga0501040_0762860_407_520 37
2316 3300049576 Ga0501040_0841735 Ga0501040_0841735_448_561 37
2317 3300049576 Ga0501040_1343896 Ga0501040_1343896_184_297 37
2318 3300049577 Ga0501041_0002036 Ga0501041_0002036_7822_7935 37
2319 3300049577 Ga0501041_0002812 Ga0501041_0002812_7462_7575 37
2320 3300049577 Ga0501041_0012286 Ga0501041_0012286_3762_3875 37
2321 3300049577 Ga0501041_0013840 Ga0501041_0013840_2257_2370 37
2322 3300049577 Ga0501041_0027308 Ga0501041_0027308_3312_3425 37
2323 3300049577 Ga0501041_0053243 Ga0501041_0053243_836_949 37
2324 3300049577 Ga0501041_0092694 Ga0501041_0092694_1402_1515 37
2325 3300049577 Ga0501041_0279341 Ga0501041_0279341_766_879 37
2326 3300049577 Ga0501041_0559733 Ga0501041_0559733_359_472 37
2327 3300049577 Ga0501041_0702023 Ga0501041_0702023_361_474 37
2328 3300049577 Ga0501041_0795733 Ga0501041_0795733_11_124 37
2329 3300049577 Ga0501041_0796979 Ga0501041_0796979_371_484 37
2330 3300049577 Ga0501041_0882559 Ga0501041_0882559_11_124 37
2331 3300049578 Ga0501042_0000491 Ga0501042_0000491_18455_18568 37
2332 3300049578 Ga0501042_0023215 Ga0501042_0023215_2348_2461 37
2333 3300049578 Ga0501042_0030315 Ga0501042_0030315_3352_3465 37
2334 3300049578 Ga0501042_0042530 Ga0501042_0042530_1210_1323 37
2335 3300049578 Ga0501042_0077334 Ga0501042_0077334_1506_1619 37
2336 3300049578 Ga0501042_0108394 Ga0501042_0108394_120_233 37
2337 3300049578 Ga0501042_0179999 Ga0501042_0179999_799_912 37
2338 3300049578 Ga0501042_0211274 Ga0501042_0211274_954_1067 37
2339 3300049578 Ga0501042_0259829 Ga0501042_0259829_526_639 37
2340 3300049578 Ga0501042_0559412 Ga0501042_0559412_394_507 37
2341 3300049578 Ga0501042_1174110 Ga0501042_1174110_248_361 37
2342 3300049579 Ga0501043_0037819 Ga0501043_0037819_2150_2263 37
2343 3300049579 Ga0501043_0075258 Ga0501043_0075258_534_647 37
2344 3300049579 Ga0501043_0090272 Ga0501043_0090272_2248_2361 37
2345 3300049579 Ga0501043_0117940 Ga0501043_0117940_1582_1695 37
2346 3300049579 Ga0501043_0318192 Ga0501043_0318192_1021_1134 37
2347 3300049579 Ga0501043_0575609 Ga0501043_0575609_663_776 37
2348 3300049579 Ga0501043_0755394 Ga0501043_0755394_508_621 37
2349 3300049580 Ga0501046_0004387 Ga0501046_0004387_2301_2414 37
2350 3300049580 Ga0501046_0010738 Ga0501046_0010738_1546_1659 37
2351 3300049580 Ga0501046_0050338 Ga0501046_0050338_1220_1333 37
2352 3300049580 Ga0501046_0062650 Ga0501046_0062650_2340_2453 37
2353 3300049580 Ga0501046_0142377 Ga0501046_0142377_1391_1504 37
2354 3300049580 Ga0501046_0385865 Ga0501046_0385865_510_623 37
2355 3300049581 Ga0501047_0005455 Ga0501047_0005455_2501_2614 37
2356 3300049581 Ga0501047_0097203 Ga0501047_0097203_1153_1266 37
2357 3300049581 Ga0501047_1084720 Ga0501047_1084720_443_556 37
2358 3300049582 Ga0501048_0005257 Ga0501048_0005257_9452_9565 37
2359 3300049582 Ga0501048_0005618 Ga0501048_0005618_2270_2383 37
2360 3300049582 Ga0501048_0108406 Ga0501048_0108406_1098_1211 37
2361 3300049582 Ga0501048_0134802 Ga0501048_0134802_1498_1611 37
2362 3300049582 Ga0501048_0155335 Ga0501048_0155335_294_407 37
2363 3300049582 Ga0501048_0161078 Ga0501048_0161078_885_998 37
2364 3300049582 Ga0501048_0319138 Ga0501048_0319138_870_983 37
2365 3300049582 Ga0501048_0350349 Ga0501048_0350349_620_733 37
2366 3300049582 Ga0501048_0460396 Ga0501048_0460396_734_847 37
2367 3300049582 Ga0501048_0722132 Ga0501048_0722132_211_324 37
2368 3300049582 Ga0501048_0876236 Ga0501048_0876236_330_443 37
2369 3300049582 Ga0501048_1415042 Ga0501048_1415042_73_186 37
2370 3300049583 Ga0501067_0156592 Ga0501067_0156592_1066_1179 37
2371 3300049583 Ga0501067_0251051 Ga0501067_0251051_587_700 37
2372 3300049583 Ga0501067_0501092 Ga0501067_0501092_293_406 37
2373 3300049584 Ga0501068_0005830 Ga0501068_0005830_2392_2505 37
2374 3300049584 Ga0501068_0007083 Ga0501068_0007083_5938_6051 37
2375 3300049584 Ga0501068_0040449 Ga0501068_0040449_1425_1538 37
2376 3300049584 Ga0501068_0041107 Ga0501068_0041107_2337_2450 37
2377 3300049584 Ga0501068_0050899 Ga0501068_0050899_934_1047 37
2378 3300049584 Ga0501068_0115100 Ga0501068_0115100_1059_1172 37
2379 3300049584 Ga0501068_0162703 Ga0501068_0162703_238_351 37
2380 3300049584 Ga0501068_0468805 Ga0501068_0468805_452_565 37
2381 3300049584 Ga0501068_1058466 Ga0501068_1058466_66_179 37
2382 3300049585 Ga0501069_0001064 Ga0501069_0001064_5903_6016 37
2383 3300049585 Ga0501069_0014693 Ga0501069_0014693_980_1093 37
2384 3300049585 Ga0501069_0058555 Ga0501069_0058555_186_299 37
2385 3300049585 Ga0501069_0085758 Ga0501069_0085758_619_732 37
2386 3300049585 Ga0501069_0903013 Ga0501069_0903013_279_392 37
2387 3300049586 Ga0501070_0001356 Ga0501070_0001356_10367_10480 37
2388 3300049586 Ga0501070_0020406 Ga0501070_0020406_2728_2841 37
2389 3300049586 Ga0501070_0150693 Ga0501070_0150693_169_282 37
2390 3300049586 Ga0501070_0222094 Ga0501070_0222094_1287_1400 37
2391 3300049586 Ga0501070_0246087 Ga0501070_0246087_153_266 37
2392 3300049586 Ga0501070_0284566 Ga0501070_0284566_994_1107 37
2393 3300049586 Ga0501070_0533573 Ga0501070_0533573_286_399 37
2394 3300049587 Ga0501071_0005588 Ga0501071_0005588_4472_4585 37
2395 3300049587 Ga0501071_0028630 Ga0501071_0028630_396_509 37
2396 3300049587 Ga0501071_0058821 Ga0501071_0058821_353_466 37
2397 3300049587 Ga0501071_0096926 Ga0501071_0096926_619_732 37
2398 3300049587 Ga0501071_0110259 Ga0501071_0110259_884_997 37
2399 3300049587 Ga0501071_0471834 Ga0501071_0471834_347_460 37
2400 3300049587 Ga0501071_0716712 Ga0501071_0716712_177_290 37
2401 3300049587 Ga0501071_0817238 Ga0501071_0817238_304_417 37
2402 3300049587 Ga0501071_0875499 Ga0501071_0875499_316_429 37
2403 3300049587 Ga0501071_0894430 Ga0501071_0894430_526_639 37
2404 3300049588 Ga0501072_0000447 Ga0501072_0000447_11354_11467 37
2405 3300049588 Ga0501072_0004161 Ga0501072_0004161_1548_1661 37
2406 3300049588 Ga0501072_0087912 Ga0501072_0087912_2208_2321 37
2407 3300049588 Ga0501072_0131421 Ga0501072_0131421_1167_1280 37
2408 3300049588 Ga0501072_0179037 Ga0501072_0179037_1464_1577 37
2409 3300049588 Ga0501072_0205390 Ga0501072_0205390_1009_1122 37
2410 3300049588 Ga0501072_0282476 Ga0501072_0282476_921_1034 37
2411 3300049588 Ga0501072_0300624 Ga0501072_0300624_968_1081 37
2412 3300049588 Ga0501072_0338578 Ga0501072_0338578_443_556 37
2413 3300049588 Ga0501072_0688715 Ga0501072_0688715_138_251 37
2414 3300049588 Ga0501072_0708451 Ga0501072_0708451_668_781 37
2415 3300049589 Ga0501073_0000321 Ga0501073_0000321_20576_20689 37
2416 3300049589 Ga0501073_0008056 Ga0501073_0008056_869_982 37
2417 3300049589 Ga0501073_0068857 Ga0501073_0068857_919_1032 37
2418 3300049589 Ga0501073_0137277 Ga0501073_0137277_955_1068 37
2419 3300049589 Ga0501073_0226840 Ga0501073_0226840_805_918 37
2420 3300049589 Ga0501073_0295551 Ga0501073_0295551_661_774 37
2421 3300049589 Ga0501073_0971685 Ga0501073_0971685_61_174 37
2422 3300049590 Ga0501074_0000097 Ga0501074_0000097_30723_30836 37
2423 3300049590 Ga0501074_0000625 Ga0501074_0000625_1247_1360 37
2424 3300049590 Ga0501074_0005165 Ga0501074_0005165_3781_3894 37
2425 3300049590 Ga0501074_0010151 Ga0501074_0010151_2948_3061 37
2426 3300049590 Ga0501074_0018872 Ga0501074_0018872_2804_2917 37
2427 3300049590 Ga0501074_0079136 Ga0501074_0079136_1446_1559 37
2428 3300049590 Ga0501074_0178663 Ga0501074_0178663_1366_1479 37
2429 3300049590 Ga0501074_0484197 Ga0501074_0484197_588_701 37
2430 3300049590 Ga0501074_0643167 Ga0501074_0643167_590_703 37
2431 3300049590 Ga0501074_0753258 Ga0501074_0753258_130_243 37
2432 3300049590 Ga0501074_0808074 Ga0501074_0808074_387_500 37
2433 3300049590 Ga0501074_0982782 Ga0501074_0982782_431_544 37
2434 3300049590 Ga0501074_1037351 Ga0501074_1037351_84_197 37
2435 3300049591 Ga0501075_0001554 Ga0501075_0001554_11257_11370 37
2436 3300049591 Ga0501075_0006363 Ga0501075_0006363_3151_3264 37
2437 3300049591 Ga0501075_0032416 Ga0501075_0032416_1826_1939 37
2438 3300049591 Ga0501075_0034574 Ga0501075_0034574_1283_1396 37
2439 3300049591 Ga0501075_0090332 Ga0501075_0090332_642_755 37
2440 3300049591 Ga0501075_0210983 Ga0501075_0210983_735_848 37
2441 3300049591 Ga0501075_0265881 Ga0501075_0265881_567_680 37
2442 3300049591 Ga0501075_0269701 Ga0501075_0269701_337_450 37
2443 3300049591 Ga0501075_0556566 Ga0501075_0556566_226_339 37
2444 3300049591 Ga0501075_0594614 Ga0501075_0594614_461_574 37
2445 3300049591 Ga0501075_0789660 Ga0501075_0789660_210_323 37
2446 3300049591 Ga0501075_1401130 Ga0501075_1401130_194_307 37
2447 3300049591 Ga0501075_1508267 Ga0501075_1508267_55_168 37
2448 3300049592 Ga0501076_0000287 Ga0501076_0000287_23783_23896 37
2449 3300049592 Ga0501076_0014920 Ga0501076_0014920_2393_2506 37
2450 3300049592 Ga0501076_0016016 Ga0501076_0016016_3696_3809 37
2451 3300049592 Ga0501076_0052305 Ga0501076_0052305_760_873 37
2452 3300049592 Ga0501076_0069881 Ga0501076_0069881_2352_2465 37
2453 3300049592 Ga0501076_0158512 Ga0501076_0158512_1643_1756 37
2454 3300049592 Ga0501076_0199011 Ga0501076_0199011_294_407 37
2455 3300049592 Ga0501076_0482753 Ga0501076_0482753_641_754 37
2456 3300049592 Ga0501076_0643878 Ga0501076_0643878_559_672 37
2457 3300049592 Ga0501076_0779435 Ga0501076_0779435_420_533 37
2458 3300049592 Ga0501076_1254919 Ga0501076_1254919_327_440 37
2459 3300049593 Ga0501077_0000810 Ga0501077_0000810_9864_9977 37
2460 3300049593 Ga0501077_0008753 Ga0501077_0008753_5187_5300 37
2461 3300049593 Ga0501077_0038122 Ga0501077_0038122_766_879 37
2462 3300049593 Ga0501077_0064675 Ga0501077_0064675_1734_1847 37
2463 3300049593 Ga0501077_0135243 Ga0501077_0135243_1239_1352 37
2464 3300049593 Ga0501077_0356113 Ga0501077_0356113_181_294 37
2465 3300049593 Ga0501077_0376641 Ga0501077_0376641_609_722 37
2466 3300049593 Ga0501077_0769230 Ga0501077_0769230_336_449 37
2467 3300049593 Ga0501077_0952905 Ga0501077_0952905_33_146 37
2468 3300049649 Ga0501198_157168 Ga0501198_157168_320_433 37
2469 3300049650 Ga0501199_000906 Ga0501199_000906_1225_1338 37
2470 3300049651 Ga0501201_033369 Ga0501201_033369_193_306 37
2471 3300049651 Ga0501201_043591 Ga0501201_043591_251_364 37
2472 3300049651 Ga0501201_048538 Ga0501201_048538_43_156 37
2473 3300049652 Ga0501202_029076 Ga0501202_029076_849_962 37
2474 3300049652 Ga0501202_077910 Ga0501202_077910_340_453 37
2475 3300049652 Ga0501202_218670 Ga0501202_218670_345_458 37
2476 3300049652 Ga0501202_222485 Ga0501202_222485_393_506 37
2477 3300049653 Ga0501206_010086 Ga0501206_010086_925_1038 37
2478 3300049654 Ga0501207_004146 Ga0501207_004146_1112_1225 37
2479 3300049654 Ga0501207_143338 Ga0501207_143338_143_256 37
2480 3300049655 Ga0501208_056531 Ga0501208_056531_464_577 37
2481 3300049655 Ga0501208_138080 Ga0501208_138080_255_368 37
2482 3300049655 Ga0501208_157231 Ga0501208_157231_385_498 37
2483 3300049656 Ga0501209_098165 Ga0501209_098165_199_312 37
2484 3300049658 Ga0501211_000022 Ga0501211_000022_8824_8937 37
2485 3300049660 Ga0501216_002220 Ga0501216_002220_1923_2036 37
2486 3300049660 Ga0501216_032892 Ga0501216_032892_672_785 37
2487 3300049660 Ga0501216_048054 Ga0501216_048054_664_777 37
2488 3300049661 Ga0501217_018150 Ga0501217_018150_1268_1381 37
2489 3300049661 Ga0501217_026572 Ga0501217_026572_375_488 37
2490 3300049661 Ga0501217_080564 Ga0501217_080564_248_361 37
2491 3300049661 Ga0501217_174573 Ga0501217_174573_148_261 37
2492 3300049661 Ga0501217_205678 Ga0501217_205678_309_422 37
2493 3300049661 Ga0501217_326063 Ga0501217_326063_218_331 37
2494 3300049661 Ga0501217_335102 Ga0501217_335102_68_181 37
2495 3300049662 Ga0501222_000792 Ga0501222_000792_849_962 37
2496 3300049663 Ga0501223_008047 Ga0501223_008047_674_787 37
2497 3300049663 Ga0501223_013439 Ga0501223_013439_947_1060 37
2498 3300049663 Ga0501223_147983 Ga0501223_147983_224_337 37
2499 3300049664 Ga0501224_044578 Ga0501224_044578_298_411 37
2500 3300049665 Ga0501227_000308 Ga0501227_000308_8640_8753 37
2501 3300049665 Ga0501227_023959 Ga0501227_023959_1109_1222 37
2502 3300049665 Ga0501227_026217 Ga0501227_026217_233_346 37
2503 3300049666 Ga0501228_018786 Ga0501228_018786_355_468 37
2504 3300049667 Ga0501230_000507 Ga0501230_000507_2286_2399 37
2505 3300049667 Ga0501230_041652 Ga0501230_041652_46_159 37
2506 3300049667 Ga0501230_098989 Ga0501230_098989_496_609 37
2507 3300049667 Ga0501230_142283 Ga0501230_142283_291_404 37
2508 3300049667 Ga0501230_143163 Ga0501230_143163_164_277 37
2509 3300049668 Ga0501233_000911 Ga0501233_000911_1263_1376 37
2510 3300049668 Ga0501233_007577 Ga0501233_007577_1048_1161 37
2511 3300049668 Ga0501233_109476 Ga0501233_109476_230_343 37
2512 3300049668 Ga0501233_190429 Ga0501233_190429_122_235 37
2513 3300049668 Ga0501233_264835 Ga0501233_264835_122_235 37
2514 3300049669 Ga0501235_006253 Ga0501235_006253_1723_1836 37
2515 3300049669 Ga0501235_183044 Ga0501235_183044_35_148 37
2516 3300049669 Ga0501235_219979 Ga0501235_219979_224_337 37
2517 3300049670 Ga0501236_001774 Ga0501236_001774_864_977 37
2518 3300049671 Ga0501238_008105 Ga0501238_008105_1174_1287 37
2519 3300049671 Ga0501238_051298 Ga0501238_051298_27_140 37
2520 3300049672 Ga0501239_029215 Ga0501239_029215_17_130 37
2521 3300049673 Ga0501240_063850 Ga0501240_063850_489_602 37
2522 3300049674 Ga0501242_018679 Ga0501242_018679_674_787 37
2523 3300049675 Ga0501243_109870 Ga0501243_109870_38_151 37
2524 3300049678 Ga0501248_019262 Ga0501248_019262_252_365 37
2525 3300049679 Ga0501249_007802 Ga0501249_007802_1868_1981 37
2526 3300049679 Ga0501249_116152 Ga0501249_116152_206_319 37
2527 3300049679 Ga0501249_125905 Ga0501249_125905_136_249 37
2528 3300049679 Ga0501249_130213 Ga0501249_130213_474_587 37
2529 3300049683 Ga0501253_000109 Ga0501253_000109_1309_1422 37
2530 3300049684 Ga0501255_001366 Ga0501255_001366_622_735 37
2531 3300049686 Ga0501257_025502 Ga0501257_025502_1047_1160 37
2532 3300049686 Ga0501257_142355 Ga0501257_142355_56_169 37
2533 3300049686 Ga0501257_216507 Ga0501257_216507_168_281 37
2534 3300049686 Ga0501257_229181 Ga0501257_229181_203_316 37
2535 3300049686 Ga0501257_230888 Ga0501257_230888_41_154 37
2536 3300049687 Ga0501258_000164 Ga0501258_000164_3047_3160 37
2537 3300049688 Ga0501259_111178 Ga0501259_111178_506_619 37
2538 3300049690 Ga0501261_037486 Ga0501261_037486_92_205 37
2539 3300049690 Ga0501261_083927 Ga0501261_083927_328_441 37
2540 3300049704 Ga0501221_000628 Ga0501221_000628_3728_3841 37
2541 3300049704 Ga0501221_116513 Ga0501221_116513_312_425 37
2542 3300049704 Ga0501221_146733 Ga0501221_146733_268_381 37
2543 3300049704 Ga0501221_148980 Ga0501221_148980_239_352 37
2544 3300049704 Ga0501221_221802 Ga0501221_221802_343_456 37
2545 3300049705 Ga0501225_0018091 Ga0501225_0018091_607_720 37
2546 3300049705 Ga0501225_0130916 Ga0501225_0130916_615_728 37
2547 3300049705 Ga0501225_0140998 Ga0501225_0140998_295_408 37
2548 3300049706 Ga0501229_000825 Ga0501229_000825_2171_2284 37
2549 3300049707 Ga0501234_002259 Ga0501234_002259_531_644 37
2550 3300049707 Ga0501234_038269 Ga0501234_038269_603_716 37
2551 3300049707 Ga0501234_103911 Ga0501234_103911_339_452 37
2552 3300049708 Ga0501245_064873 Ga0501245_064873_114_227 37
2553 3300049741 Ga0501079_0001116 Ga0501079_0001116_1461_1574 37
2554 3300049741 Ga0501079_0001911 Ga0501079_0001911_14656_14769 37
2555 3300049741 Ga0501079_0010889 Ga0501079_0010889_260_373 37
2556 3300049741 Ga0501079_0069448 Ga0501079_0069448_839_952 37
2557 3300049741 Ga0501079_0081483 Ga0501079_0081483_1748_1861 37
2558 3300049741 Ga0501079_0233712 Ga0501079_0233712_1195_1308 37
2559 3300049741 Ga0501079_0470258 Ga0501079_0470258_562_675 37
2560 3300049741 Ga0501079_0544006 Ga0501079_0544006_394_507 37
2561 3300049742 Ga0501080_0001428 Ga0501080_0001428_12226_12339 37
2562 3300049742 Ga0501080_0011166 Ga0501080_0011166_6829_6942 37
2563 3300049742 Ga0501080_0013538 Ga0501080_0013538_5433_5546 37
2564 3300049742 Ga0501080_0071785 Ga0501080_0071785_1521_1634 37
2565 3300049742 Ga0501080_0145080 Ga0501080_0145080_1356_1469 37
2566 3300049742 Ga0501080_0181826 Ga0501080_0181826_915_1028 37
2567 3300049742 Ga0501080_0481692 Ga0501080_0481692_571_684 37
2568 3300049742 Ga0501080_0506012 Ga0501080_0506012_361_474 37
2569 3300049742 Ga0501080_0901782 Ga0501080_0901782_52_165 37
2570 3300049742 Ga0501080_1010477 Ga0501080_1010477_119_232 37
2571 3300049742 Ga0501080_1413094 Ga0501080_1413094_220_333 37
2572 3300049742 Ga0501080_1888629 Ga0501080_1888629_360_473 37
2573 3300049743 Ga0501081_0000747 Ga0501081_0000747_11312_11425 37
2574 3300049743 Ga0501081_0010955 Ga0501081_0010955_1628_1741 37
2575 3300049743 Ga0501081_0060366 Ga0501081_0060366_2419_2532 37
2576 3300049743 Ga0501081_0069932 Ga0501081_0069932_2203_2316 37
2577 3300049743 Ga0501081_0078596 Ga0501081_0078596_1881_1994 37
2578 3300049743 Ga0501081_0496902 Ga0501081_0496902_40_153 37
2579 3300049743 Ga0501081_1252810 Ga0501081_1252810_345_458 37
2580 3300049743 Ga0501081_1265142 Ga0501081_1265142_407_520 37
2581 3300049743 Ga0501081_1496644 Ga0501081_1496644_389_502 37
2582 3300049744 Ga0501083_0021423 Ga0501083_0021423_1467_1580 37
2583 3300049744 Ga0501083_0046415 Ga0501083_0046415_1998_2111 37
2584 3300049744 Ga0501083_0161733 Ga0501083_0161733_479_592 37
2585 3300049744 Ga0501083_0488703 Ga0501083_0488703_315_428 37
2586 3300049757 Ga0501232_004664 Ga0501232_004664_605_718 37
2587 3300049758 Ga0501241_104593 Ga0501241_104593_272_385 37
2588 3300049758 Ga0501241_150783 Ga0501241_150783_406_519 37
2589 3300049759 Ga0501262_000495 Ga0501262_000495_4343_4456 37
2590 3300049759 Ga0501262_008715 Ga0501262_008715_750_863 37
2591 3300049760 Ga0501263_018734 Ga0501263_018734_441_554 37
2592 3300049760 Ga0501263_039272 Ga0501263_039272_201_314 37
2593 3300049760 Ga0501263_095170 Ga0501263_095170_191_304 37
2594 3300049761 Ga0501264_004736 Ga0501264_004736_1035_1148 37
2595 3300049764 Ga0501267_000154 Ga0501267_000154_1769_1882 37
2596 3300049765 Ga0501268_055455 Ga0501268_055455_580_693 37
2597 3300049765 Ga0501268_151997 Ga0501268_151997_191_304 37
2598 3300049766 Ga0501269_001636 Ga0501269_001636_2035_2148 37
2599 3300049767 Ga0501270_151052 Ga0501270_151052_342_455 37
2600 3300049768 Ga0501271_007555 Ga0501271_007555_436_549 37
2601 3300049769 Ga0501272_000140 Ga0501272_000140_5181_5294 37
2602 3300049770 Ga0501273_031752 Ga0501273_031752_207_320 37
2603 3300049770 Ga0501273_077873 Ga0501273_077873_154_267 37
2604 3300049770 Ga0501273_080690 Ga0501273_080690_399_512 37
2605 3300049772 Ga0501275_013446 Ga0501275_013446_684_797 37
2606 3300049772 Ga0501275_015903 Ga0501275_015903_234_347 37
2607 3300049773 Ga0501276_041527 Ga0501276_041527_79_192 37
2608 3300049774 Ga0501278_034571 Ga0501278_034571_375_488 37
2609 3300049778 Ga0501282_002545 Ga0501282_002545_1556_1669 37
2610 3300049779 Ga0501283_115724 Ga0501283_115724_367_480 37
2611 3300049822 Ga0501035_0019439 Ga0501035_0019439_3822_3935 37
2612 3300049822 Ga0501035_0025187 Ga0501035_0025187_4664_4777 37
2613 3300049822 Ga0501035_0029961 Ga0501035_0029961_2056_2169 37
2614 3300049822 Ga0501035_0107219 Ga0501035_0107219_619_732 37
2615 3300049822 Ga0501035_0112235 Ga0501035_0112235_282_395 37
2616 3300049822 Ga0501035_0749213 Ga0501035_0749213_145_258 37
2617 3300049823 Ga0501044_0003799 Ga0501044_0003799_7876_7989 37
2618 3300049823 Ga0501044_0047472 Ga0501044_0047472_2025_2138 37
2619 3300049823 Ga0501044_0112546 Ga0501044_0112546_1875_1988 37
2620 3300049823 Ga0501044_0193735 Ga0501044_0193735_819_932 37
2621 3300049823 Ga0501044_0216888 Ga0501044_0216888_1571_1684 37
2622 3300049823 Ga0501044_0310710 Ga0501044_0310710_1259_1372 37
2623 3300049823 Ga0501044_1136798 Ga0501044_1136798_446_559 37
2624 3300049823 Ga0501044_1567492 Ga0501044_1567492_228_341 37
2625 3300049824 Ga0501045_0000836 Ga0501045_0000836_7542_7655 37
2626 3300049824 Ga0501045_0002784 Ga0501045_0002784_11354_11467 37
2627 3300049824 Ga0501045_0007683 Ga0501045_0007683_3978_4091 37
2628 3300049824 Ga0501045_0034871 Ga0501045_0034871_2381_2494 37
2629 3300049824 Ga0501045_0044853 Ga0501045_0044853_1152_1265 37
2630 3300049824 Ga0501045_0068374 Ga0501045_0068374_592_705 37
2631 3300049824 Ga0501045_0381791 Ga0501045_0381791_752_865 37
2632 3300049824 Ga0501045_0401599 Ga0501045_0401599_871_984 37
2633 3300049824 Ga0501045_0604494 Ga0501045_0604494_502_615 37
2634 3300049824 Ga0501045_1166359 Ga0501045_1166359_425_538 37
2635 3300049851 Ga0501212_064053 Ga0501212_064053_38_151 37
2636 3300049853 Ga0501226_003427 Ga0501226_003427_1074_1187 37
2637 3300049853 Ga0501226_020727 Ga0501226_020727_229_342 37
2638 3300049853 Ga0501226_025307 Ga0501226_025307_360_473 37
2639 3300050489 nmdc:mga03683_164332_c1 nmdc:mga03683_164332_c1_669_782 37
2640 3300050489 nmdc:mga03683_172234_c2 nmdc:mga03683_172234_c2_262_375 37
2641 3300050489 nmdc:mga03683_192150_c1 nmdc:mga03683_192150_c1_41_154 37
2642 3300050489 nmdc:mga03683_217898_c1 nmdc:mga03683_217898_c1_400_513 37
2643 3300050489 nmdc:mga03683_299413_c1 nmdc:mga03683_299413_c1_611_724 37
2644 3300050489 nmdc:mga03683_339070_c1 nmdc:mga03683_339070_c1_258_371 37
2645 3300050489 nmdc:mga03683_373841_c1 nmdc:mga03683_373841_c1_43_156 37
2646 3300050489 nmdc:mga03683_452846_c1 nmdc:mga03683_452846_c1_473_586 37
2647 3300050489 nmdc:mga03683_530872_c1 nmdc:mga03683_530872_c1_377_490 37
2648 3300050489 nmdc:mga03683_617013_c1 nmdc:mga03683_617013_c1_160_273 37
2649 3300050490 nmdc:mga03n38_270545_c1 nmdc:mga03n38_270545_c1_295_408 37
2650 3300050490 nmdc:mga03n38_414560_c1 nmdc:mga03n38_414560_c1_298_411 37
2651 3300050490 nmdc:mga03n38_428401_c1 nmdc:mga03n38_428401_c1_578_691 37
2652 3300050490 nmdc:mga03n38_440786_c1 nmdc:mga03n38_440786_c1_352_465 37
2653 3300050490 nmdc:mga03n38_591180_c1 nmdc:mga03n38_591180_c1_17_130 37
2654 3300050490 nmdc:mga03n38_741998_c1 nmdc:mga03n38_741998_c1_60_173 37
2655 3300050490 nmdc:mga03n38_957648_c1 nmdc:mga03n38_957648_c1_328_441 37
2656 3300050491 nmdc:mga00v17_255611_c1 nmdc:mga00v17_255611_c1_872_985 37
2657 3300050491 nmdc:mga00v17_378252_c1 nmdc:mga00v17_378252_c1_633_746 37
2658 3300050491 nmdc:mga00v17_387755_c1 nmdc:mga00v17_387755_c1_113_226 37
2659 3300050491 nmdc:mga00v17_412094_c1 nmdc:mga00v17_412094_c1_129_242 37
2660 3300050491 nmdc:mga00v17_459182_c1 nmdc:mga00v17_459182_c1_134_247 37
2661 3300050491 nmdc:mga00v17_5329_c1 nmdc:mga00v17_5329_c1_382_495 37
2662 3300050491 nmdc:mga00v17_621583_c1 nmdc:mga00v17_621583_c1_133_246 37
2663 3300050491 nmdc:mga00v17_957524_c1 nmdc:mga00v17_957524_c1_384_497 37
2664 3300050492 nmdc:mga0yw44_437550_c1 nmdc:mga0yw44_437550_c1_626_739 37
2665 3300050492 nmdc:mga0yw44_54422_c1 nmdc:mga0yw44_54422_c1_43_156 37
2666 3300050493 nmdc:mga0k408_102789_c1 nmdc:mga0k408_102789_c1_1440_1553 37
2667 3300050493 nmdc:mga0k408_112245_c1 nmdc:mga0k408_112245_c1_990_1103 37
2668 3300050493 nmdc:mga0k408_130862_c1 nmdc:mga0k408_130862_c1_183_296 37
2669 3300050493 nmdc:mga0k408_144065_c1 nmdc:mga0k408_144065_c1_519_632 37
2670 3300050493 nmdc:mga0k408_14579_c1 nmdc:mga0k408_14579_c1_133_246 37
2671 3300050493 nmdc:mga0k408_179446_c1 nmdc:mga0k408_179446_c1_126_239 37
2672 3300050493 nmdc:mga0k408_181405_c1 nmdc:mga0k408_181405_c1_93_206 37
2673 3300050493 nmdc:mga0k408_18596_c1 nmdc:mga0k408_18596_c1_131_244 37
2674 3300050493 nmdc:mga0k408_18793_c1 nmdc:mga0k408_18793_c1_3210_3323 37
2675 3300050493 nmdc:mga0k408_197808_c1 nmdc:mga0k408_197808_c1_219_332 37
2676 3300050493 nmdc:mga0k408_216118_c1 nmdc:mga0k408_216118_c1_369_482 37
2677 3300050493 nmdc:mga0k408_244052_c1 nmdc:mga0k408_244052_c1_447_560 37
2678 3300050493 nmdc:mga0k408_31223_c1 nmdc:mga0k408_31223_c1_875_988 37
2679 3300050493 nmdc:mga0k408_32503_c2 nmdc:mga0k408_32503_c2_723_836 37
2680 3300050493 nmdc:mga0k408_40677_c1 nmdc:mga0k408_40677_c1_1781_1894 37
2681 3300050493 nmdc:mga0k408_612620_c1 nmdc:mga0k408_612620_c1_77_190 37
2682 3300050493 nmdc:mga0k408_675062_c1 nmdc:mga0k408_675062_c1_200_313 37
2683 3300050493 nmdc:mga0k408_742632_c1 nmdc:mga0k408_742632_c1_201_314 37
2684 3300050493 nmdc:mga0k408_782322_c1 nmdc:mga0k408_782322_c1_403_516 37
2685 3300050493 nmdc:mga0k408_803724_c1 nmdc:mga0k408_803724_c1_292_405 37
2686 3300050494 nmdc:mga06z11_360800_c1 nmdc:mga06z11_360800_c1_747_860 37
2687 3300050494 nmdc:mga06z11_68127_c1 nmdc:mga06z11_68127_c1_869_982 37
2688 3300050496 nmdc:mga07m45_136322_c1 nmdc:mga07m45_136322_c1_1246_1359 37
2689 3300050496 nmdc:mga07m45_15177_c1 nmdc:mga07m45_15177_c1_2431_2544 37
2690 3300050496 nmdc:mga07m45_19266_c1 nmdc:mga07m45_19266_c1_259_372 37
2691 3300050496 nmdc:mga07m45_416268_c1 nmdc:mga07m45_416268_c1_251_364 37
2692 3300050496 nmdc:mga07m45_489810_c1 nmdc:mga07m45_489810_c1_241_354 37
2693 3300050496 nmdc:mga07m45_56127_c1 nmdc:mga07m45_56127_c1_1828_1941 37
2694 3300050496 nmdc:mga07m45_70220_c1 nmdc:mga07m45_70220_c1_1377_1490 37
2695 3300050496 nmdc:mga07m45_82480_c1 nmdc:mga07m45_82480_c1_1464_1577 37
2696 3300050496 nmdc:mga07m45_95598_c1 nmdc:mga07m45_95598_c1_1224_1337 37
2697 3300050496 nmdc:mga07m45_98495_c1 nmdc:mga07m45_98495_c1_399_512 37
2698 3300050507 nmdc:mga05p37_10502_c1 nmdc:mga05p37_10502_c1_2329_2442 37
2699 3300050507 nmdc:mga05p37_1110236_c1 nmdc:mga05p37_1110236_c1_159_272 37
2700 3300050507 nmdc:mga05p37_137660_c1 nmdc:mga05p37_137660_c1_1389_1502 37
2701 3300050507 nmdc:mga05p37_15191_c1 nmdc:mga05p37_15191_c1_5766_5879 37
2702 3300050507 nmdc:mga05p37_1596132_c1 nmdc:mga05p37_1596132_c1_483_596 37
2703 3300050507 nmdc:mga05p37_168066_c1 nmdc:mga05p37_168066_c1_2514_2627 37
2704 3300050507 nmdc:mga05p37_511646_c1 nmdc:mga05p37_511646_c1_350_463 37
2705 3300050507 nmdc:mga05p37_612852_c1 nmdc:mga05p37_612852_c1_908_1021 37
2706 3300050507 nmdc:mga05p37_942744_c1 nmdc:mga05p37_942744_c1_398_511 37
2707 3300050507 nmdc:mga05p37_99540_c1 nmdc:mga05p37_99540_c1_3388_3501 37
2708 3300050508 nmdc:mga09592_1345632_c1 nmdc:mga09592_1345632_c1_197_310 37
2709 3300050508 nmdc:mga09592_174566_c1 nmdc:mga09592_174566_c1_321_434 37
2710 3300050508 nmdc:mga09592_505226_c1 nmdc:mga09592_505226_c1_697_810 37
2711 3300050508 nmdc:mga09592_599588_c1 nmdc:mga09592_599588_c1_98_211 37
2712 3300050508 nmdc:mga09592_65110_c1 nmdc:mga09592_65110_c1_1344_1457 37
2713 3300050508 nmdc:mga09592_6576_c1 nmdc:mga09592_6576_c1_3234_3347 37
2714 3300050508 nmdc:mga09592_774667_c1 nmdc:mga09592_774667_c1_605_718 37
2715 3300050509 nmdc:mga0qj67_1458_c1 nmdc:mga0qj67_1458_c1_10026_10139 37
2716 3300050509 nmdc:mga0qj67_223257_c1 nmdc:mga0qj67_223257_c1_432_545 37
2717 3300050509 nmdc:mga0qj67_226932_c1 nmdc:mga0qj67_226932_c1_591_704 37
2718 3300050509 nmdc:mga0qj67_333342_c1 nmdc:mga0qj67_333342_c1_31_144 37
2719 3300050509 nmdc:mga0qj67_380874_c1 nmdc:mga0qj67_380874_c1_803_916 37
2720 3300050509 nmdc:mga0qj67_49005_c1 nmdc:mga0qj67_49005_c1_1247_1360 37
2721 3300050509 nmdc:mga0qj67_544055_c1 nmdc:mga0qj67_544055_c1_300_413 37
2722 3300050509 nmdc:mga0qj67_717543_c1 nmdc:mga0qj67_717543_c1_172_285 37
2723 3300050509 nmdc:mga0qj67_924893_c1 nmdc:mga0qj67_924893_c1_459_572 37
2724 3300050510 nmdc:mga06r32_19542_c1 nmdc:mga06r32_19542_c1_2042_2158 37
2725 3300050510 nmdc:mga06r32_22687_c1 nmdc:mga06r32_22687_c1_4629_4742 37
2726 3300050510 nmdc:mga06r32_230776_c1 nmdc:mga06r32_230776_c1_1085_1198 37
2727 3300050510 nmdc:mga06r32_318529_c1 nmdc:mga06r32_318529_c1_339_452 37
2728 3300050510 nmdc:mga06r32_486344_c1 nmdc:mga06r32_486344_c1_824_937 37
2729 3300050510 nmdc:mga06r32_487621_c1 nmdc:mga06r32_487621_c1_65_178 37
2730 3300050510 nmdc:mga06r32_49740_c1 nmdc:mga06r32_49740_c1_3669_3782 37
2731 3300050510 nmdc:mga06r32_585579_c1 nmdc:mga06r32_585579_c1_422_535 37
2732 3300050510 nmdc:mga06r32_75350_c1 nmdc:mga06r32_75350_c1_1766_1879 37
2733 3300050510 nmdc:mga06r32_816563_c1 nmdc:mga06r32_816563_c1_155_268 37
2734 3300050511 nmdc:mga08y16_1113444_c1 nmdc:mga08y16_1113444_c1_360_473 37
2735 3300050511 nmdc:mga08y16_121600_c1 nmdc:mga08y16_121600_c1_2172_2285 37
2736 3300050511 nmdc:mga08y16_1921788_c1 nmdc:mga08y16_1921788_c1_253_366 37
2737 3300050511 nmdc:mga08y16_200927_c1 nmdc:mga08y16_200927_c1_1299_1412 37
2738 3300050511 nmdc:mga08y16_337388_c1 nmdc:mga08y16_337388_c1_1009_1122 37
2739 3300050511 nmdc:mga08y16_3559_c1 nmdc:mga08y16_3559_c1_6611_6724 37
2740 3300050511 nmdc:mga08y16_463065_c1 nmdc:mga08y16_463065_c1_578_694 37
2741 3300050511 nmdc:mga08y16_66308_c1 nmdc:mga08y16_66308_c1_1253_1366 37
2742 3300050511 nmdc:mga08y16_6658_c1 nmdc:mga08y16_6658_c1_11812_11928 37
2743 3300050511 nmdc:mga08y16_861244_c1 nmdc:mga08y16_861244_c1_418_531 37
2744 3300050512 nmdc:mga0n895_1164963_c1 nmdc:mga0n895_1164963_c1_391_504 37
2745 3300050512 nmdc:mga0n895_18871_c2 nmdc:mga0n895_18871_c2_529_642 37
2746 3300050512 nmdc:mga0n895_2021126_c1 nmdc:mga0n895_2021126_c1_290_403 37
2747 3300050512 nmdc:mga0n895_211578_c1 nmdc:mga0n895_211578_c1_1149_1262 37
2748 3300050512 nmdc:mga0n895_53959_c1 nmdc:mga0n895_53959_c1_2241_2354 37
2749 3300050512 nmdc:mga0n895_570_c1 nmdc:mga0n895_570_c1_13763_13876 37
2750 3300050512 nmdc:mga0n895_680962_c1 nmdc:mga0n895_680962_c1_401_514 37
2751 3300050512 nmdc:mga0n895_827768_c1 nmdc:mga0n895_827768_c1_226_339 37
2752 3300050513 nmdc:mga0rr50_128934_c1 nmdc:mga0rr50_128934_c1_1229_1342 37
2753 3300050513 nmdc:mga0rr50_36559_c1 nmdc:mga0rr50_36559_c1_2253_2366 37
2754 3300050513 nmdc:mga0rr50_45018_c1 nmdc:mga0rr50_45018_c1_2378_2491 37
2755 3300050513 nmdc:mga0rr50_478204_c1 nmdc:mga0rr50_478204_c1_115_228 37
2756 3300050513 nmdc:mga0rr50_500656_c1 nmdc:mga0rr50_500656_c1_23_136 37
2757 3300050513 nmdc:mga0rr50_51411_c1 nmdc:mga0rr50_51411_c1_1740_1853 37
2758 3300050513 nmdc:mga0rr50_646971_c1 nmdc:mga0rr50_646971_c1_150_263 37
2759 3300050513 nmdc:mga0rr50_82143_c1 nmdc:mga0rr50_82143_c1_1802_1915 37
2760 3300050513 nmdc:mga0rr50_848009_c1 nmdc:mga0rr50_848009_c1_599_712 37
2761 3300050513 nmdc:mga0rr50_90141_c1 nmdc:mga0rr50_90141_c1_1164_1277 37
2762 3300050514 nmdc:mga08x19_103532_c1 nmdc:mga08x19_103532_c1_1700_1813 37
2763 3300050514 nmdc:mga08x19_1115185_c1 nmdc:mga08x19_1115185_c1_368_481 37
2764 3300050514 nmdc:mga08x19_186756_c1 nmdc:mga08x19_186756_c1_722_835 37
2765 3300050514 nmdc:mga08x19_20089_c1 nmdc:mga08x19_20089_c1_1661_1774 37
2766 3300050514 nmdc:mga08x19_313271_c1 nmdc:mga08x19_313271_c1_92_205 37
2767 3300050514 nmdc:mga08x19_319527_c1 nmdc:mga08x19_319527_c1_908_1021 37
2768 3300050514 nmdc:mga08x19_41428_c1 nmdc:mga08x19_41428_c1_1901_2014 37
2769 3300050514 nmdc:mga08x19_505528_c1 nmdc:mga08x19_505528_c1_308_421 37
2770 3300050514 nmdc:mga08x19_8733_c1 nmdc:mga08x19_8733_c1_5895_6008 37
2771 3300050514 nmdc:mga08x19_945_c1 nmdc:mga08x19_945_c1_11431_11544 37
2772 3300050515 nmdc:mga0a205_11320_c1 nmdc:mga0a205_11320_c1_635_748 37
2773 3300050515 nmdc:mga0a205_1205460_c1 nmdc:mga0a205_1205460_c1_192_305 37
2774 3300050515 nmdc:mga0a205_20420_c1 nmdc:mga0a205_20420_c1_1541_1654 37
2775 3300050515 nmdc:mga0a205_24282_c1 nmdc:mga0a205_24282_c1_1651_1764 37
2776 3300050515 nmdc:mga0a205_611098_c1 nmdc:mga0a205_611098_c1_786_899 37
2777 3300050515 nmdc:mga0a205_62728_c1 nmdc:mga0a205_62728_c1_245_358 37
2778 3300050515 nmdc:mga0a205_794755_c1 nmdc:mga0a205_794755_c1_634_747 37
2779 3300050515 nmdc:mga0a205_827865_c1 nmdc:mga0a205_827865_c1_425_538 37
2780 3300050516 nmdc:mga0sz30_1133_c1 nmdc:mga0sz30_1133_c1_8867_8980 37
2781 3300050516 nmdc:mga0sz30_115736_c2 nmdc:mga0sz30_115736_c2_275_388 37
2782 3300050516 nmdc:mga0sz30_344392_c1 nmdc:mga0sz30_344392_c1_145_258 37
2783 3300053077 Ga0495601_0054478 Ga0495601_0054478_1482_1595 37
2784 3300053077 Ga0495601_0184569 Ga0495601_0184569_592_705 37
2785 3300053078 Ga0495612_0117998 Ga0495612_0117998_577_690 37
2786 3300053078 Ga0495612_0613271 Ga0495612_0613271_241_354 37
2787 3300053079 Ga0500610_0019906 Ga0500610_0019906_1400_1513 37
2788 3300053083 Ga0495655_0131228 Ga0495655_0131228_432_545 37
2789 3300053084 Ga0495595_0125973 Ga0495595_0125973_324_437 37
2790 3300053085 Ga0495619_0195212 Ga0495619_0195212_1015_1128 37
2791 3300053085 Ga0495619_0252911 Ga0495619_0252911_466_579 37
2792 3300053085 Ga0495619_0314441 Ga0495619_0314441_336_449 37
2793 3300053085 Ga0495619_0334817 Ga0495619_0334817_221_334 37
2794 3300053086 Ga0500578_0254795 Ga0500578_0254795_259_372 37
2795 3300053087 Ga0500643_012219 Ga0500643_012219_1802_1915 37
2796 3300053090 Ga0500646_0015555 Ga0500646_0015555_895_1008 37
2797 3300053091 Ga0500647_0353156 Ga0500647_0353156_458_571 37
2798 3300053092 Ga0500583_0053735 Ga0500583_0053735_506_619 37
2799 3300053093 Ga0500651_0000298 Ga0500651_0000298_17484_17597 37
2800 3300053093 Ga0500651_0269774 Ga0500651_0269774_391_504 37
2801 3300053093 Ga0500651_0422459 Ga0500651_0422459_62_175 37
2802 3300053094 Ga0500566_0000391 Ga0500566_0000391_2926_3039 37
2803 3300053094 Ga0500566_0034411 Ga0500566_0034411_1730_1843 37
2804 3300053094 Ga0500566_0049404 Ga0500566_0049404_1154_1267 37
2805 3300053095 Ga0500640_007951 Ga0500640_007951_3122_3235 37
2806 3300053096 Ga0500641_0093582 Ga0500641_0093582_325_438 37
2807 3300053099 Ga0500654_085228 Ga0500654_085228_1033_1146 37
2808 3300053102 Ga0500554_000753 Ga0500554_000753_5433_5546 37
2809 3300053102 Ga0500554_042131 Ga0500554_042131_1180_1293 37
2810 3300053108 Ga0500562_029231 Ga0500562_029231_446_559 37
2811 3300053108 Ga0500562_068143 Ga0500562_068143_528_641 37
2812 3300053110 Ga0500571_000095 Ga0500571_000095_4061_4174 37
2813 3300053111 Ga0500572_001626 Ga0500572_001626_1596_1709 37
2814 3300053116 Ga0500592_040479 Ga0500592_040479_551_664 37
2815 3300053117 Ga0500593_000205 Ga0500593_000205_4356_4469 37
2816 3300053118 Ga0500594_0315707 Ga0500594_0315707_215_328 37
2817 3300053119 Ga0500595_001095 Ga0500595_001095_2491_2604 37
2818 3300053119 Ga0500595_118352 Ga0500595_118352_182_295 37
2819 3300053120 Ga0500597_009296 Ga0500597_009296_2164_2277 37
2820 3300053121 Ga0500607_088153 Ga0500607_088153_626_739 37
2821 3300053122 Ga0500608_131686 Ga0500608_131686_618_731 37
2822 3300053123 Ga0500614_004590 Ga0500614_004590_1082_1195 37
2823 3300053123 Ga0500614_017561 Ga0500614_017561_576_689 37
2824 3300053124 Ga0500617_184322 Ga0500617_184322_655_768 37
2825 3300053124 Ga0500617_279762 Ga0500617_279762_416_529 37
2826 3300053125 Ga0500618_023413 Ga0500618_023413_1027_1140 37
2827 3300053125 Ga0500618_081667 Ga0500618_081667_17_130 37
2828 3300053129 Ga0500628_009468 Ga0500628_009468_634_747 37
2829 3300053130 Ga0500642_0030738 Ga0500642_0030738_1671_1784 37
2830 3300053134 Ga0500658_0048769 Ga0500658_0048769_1095_1208 37
2831 3300053134 Ga0500658_0228046 Ga0500658_0228046_296_409 37
2832 3300053134 Ga0500658_0351059 Ga0500658_0351059_189_302 37
2833 3300053134 Ga0500658_0559902 Ga0500658_0559902_286_399 37
2834 3300053136 Ga0500559_0034370 Ga0500559_0034370_1436_1549 37
2835 3300053138 Ga0500564_264590 Ga0500564_264590_546_659 37
2836 3300053139 Ga0500568_0000029 Ga0500568_0000029_67320_67433 37
2837 3300053139 Ga0500568_0002630 Ga0500568_0002630_6804_6917 37
2838 3300053140 Ga0500573_0562668 Ga0500573_0562668_218_331 37
2839 3300053141 Ga0500574_000607 Ga0500574_000607_3286_3399 37
2840 3300053142 Ga0500577_0166617 Ga0500577_0166617_82_195 37
2841 3300053144 Ga0500585_258308 Ga0500585_258308_374_487 37
2842 3300053146 Ga0500588_0097839 Ga0500588_0097839_431_544 37
2843 3300053150 Ga0500603_018543 Ga0500603_018543_951_1064 37
2844 3300053150 Ga0500603_096591 Ga0500603_096591_124_237 37
2845 3300053153 Ga0500616_0015780 Ga0500616_0015780_2363_2476 37
2846 3300053154 Ga0500619_095150 Ga0500619_095150_111_224 37
2847 3300053156 Ga0500622_0000002 Ga0500622_0000002_11137_11250 37
2848 3300053156 Ga0500622_0141039 Ga0500622_0141039_440_553 37
2849 3300053156 Ga0500622_0231076 Ga0500622_0231076_577_690 37
2850 3300053158 Ga0500627_0002287 Ga0500627_0002287_3306_3419 37
2851 3300053159 Ga0500630_193628 Ga0500630_193628_607_720 37
2852 3300053161 Ga0500634_0030126 Ga0500634_0030126_1202_1315 37
2853 3300053162 Ga0500638_045153 Ga0500638_045153_459_572 37
2854 3300053162 Ga0500638_085698 Ga0500638_085698_1231_1344 37
2855 3300053163 Ga0500639_117334 Ga0500639_117334_128_241 37
2856 3300053163 Ga0500639_213226 Ga0500639_213226_612_725 37
2857 3300053163 Ga0500639_272732 Ga0500639_272732_490_603 37
2858 3300053177 Ga0500636_0212815 Ga0500636_0212815_409_522 37
2859 3300053178 Ga0500637_0076142 Ga0500637_0076142_223_336 37
2860 3300053730 Ga0500645_086765 Ga0500645_086765_267_380 37
2861 3300053736 Ga0500599_021093 Ga0500599_021093_104_217 37
2862 3300053737 Ga0500601_018475 Ga0500601_018475_261_374 37
2863 3300053739 Ga0500587_014103 Ga0500587_014103_817_930 37
2864 3300054114 Ga0501084_0001896 Ga0501084_0001896_1236_1349 37
2865 3300054114 Ga0501084_0006534 Ga0501084_0006534_6580_6693 37
2866 3300054114 Ga0501084_0009091 Ga0501084_0009091_7938_8051 37
2867 3300054114 Ga0501084_0015092 Ga0501084_0015092_539_652 37
2868 3300054114 Ga0501084_0087583 Ga0501084_0087583_294_407 37
2869 3300054114 Ga0501084_0140599 Ga0501084_0140599_1160_1273 37
2870 3300054114 Ga0501084_0152220 Ga0501084_0152220_1401_1514 37
2871 3300054114 Ga0501084_0253230 Ga0501084_0253230_205_318 37
2872 3300054114 Ga0501084_0330227 Ga0501084_0330227_483_596 37
2873 3300054114 Ga0501084_0466466 Ga0501084_0466466_313_426 37
2874 3300054114 Ga0501084_0980853 Ga0501084_0980853_385_498 37
2875 3300054114 Ga0501084_1444502 Ga0501084_1444502_140_253 37
2876 3300054114 Ga0501084_1659645 Ga0501084_1659645_327_440 37
2877 3300054114 Ga0501084_1667893 Ga0501084_1667893_69_182 37
2878 3300055283 Ga0500661_026451 Ga0500661_026451_498_611 37
2879 3300059421 Ga0590071_004545 Ga0590071_004545_2022_2135 37
2880 3300059421 Ga0590071_044030 Ga0590071_044030_324_437 37
2881 3300059423 Ga0590074_015430 Ga0590074_015430_430_543 37
2882 3300059423 Ga0590074_020206 Ga0590074_020206_889_1002 37
2883 3300059424 Ga0590075_007808 Ga0590075_007808_900_1013 37
2884 3300059424 Ga0590075_020657 Ga0590075_020657_567_680 37
2885 3300059424 Ga0590075_041917 Ga0590075_041917_629_742 37
2886 3300059424 Ga0590075_179655 Ga0590075_179655_314_427 37
2887 3300059424 Ga0590075_212447 Ga0590075_212447_349_462 37
2888 3300059426 Ga0590077_006725 Ga0590077_006725_1028_1141 37
2889 3300059426 Ga0590077_033240 Ga0590077_033240_312_425 37
2890 3300059426 Ga0590077_034038 Ga0590077_034038_787_900 37
2891 3300059426 Ga0590077_043462 Ga0590077_043462_779_892 37
2892 3300059426 Ga0590077_054962 Ga0590077_054962_226_339 37
2893 3300059426 Ga0590077_063614 Ga0590077_063614_575_688 37
2894 3300059426 Ga0590077_114283 Ga0590077_114283_234_347 37
2895 3300059426 Ga0590077_156575 Ga0590077_156575_384_497 37
2896 3300059426 Ga0590077_172799 Ga0590077_172799_294_407 37
2897 3300059477 Ga0587084_000161 Ga0587084_000161_3060_3173 37
2898 3300059477 Ga0587084_001741 Ga0587084_001741_1124_1237 37
2899 3300059477 Ga0587084_009007 Ga0587084_009007_530_643 37
2900 3300059477 Ga0587084_019013 Ga0587084_019013_311_427 37
2901 3300059477 Ga0587084_049557 Ga0587084_049557_348_461 37
2902 3300059477 Ga0587084_068553 Ga0587084_068553_223_339 37
2903 3300059477 Ga0587084_103573 Ga0587084_103573_93_206 37
2904 3300059477 Ga0587084_132798 Ga0587084_132798_90_203 37
2905 3300059477 Ga0587084_152710 Ga0587084_152710_70_186 37
2906 3300059478 Ga0587093_008880 Ga0587093_008880_54_167 37
2907 3300059478 Ga0587093_093938 Ga0587093_093938_59_172 37
2908 3300059478 Ga0587093_113132 Ga0587093_113132_70_183 37
2909 3300059490 Ga0587066_024706 Ga0587066_024706_539_652 37
2910 3300059490 Ga0587066_062291 Ga0587066_062291_376_489 37
2911 3300059490 Ga0587066_064142 Ga0587066_064142_336_449 37
2912 3300059490 Ga0587066_074443 Ga0587066_074443_329_442 37
2913 3300059490 Ga0587066_180578 Ga0587066_180578_380_493 37
2914 3300059491 Ga0587070_053366 Ga0587070_053366_284_397 37
2915 3300059491 Ga0587070_141697 Ga0587070_141697_200_313 37
2916 3300059491 Ga0587070_199034 Ga0587070_199034_231_344 37
2917 3300059492 Ga0587073_0058786 Ga0587073_0058786_493_606 37
2918 3300059493 Ga0587077_035994 Ga0587077_035994_537_650 37
2919 3300059493 Ga0587077_117818 Ga0587077_117818_358_471 37
2920 3300059493 Ga0587077_162892 Ga0587077_162892_208_321 37
2921 3300059503 Ga0587080_069064 Ga0587080_069064_117_233 37
2922 3300059503 Ga0587080_069810 Ga0587080_069810_358_471 37
2923 3300059504 Ga0587082_000645 Ga0587082_000645_2396_2509 37
2924 3300059504 Ga0587082_116204 Ga0587082_116204_138_251 37
2925 3300059504 Ga0587082_160520 Ga0587082_160520_311_424 37
2926 3300059505 Ga0587083_0077134 Ga0587083_0077134_371_484 37
2927 3300059505 Ga0587083_0134322 Ga0587083_0134322_77_190 37
2928 3300059506 Ga0587085_013639 Ga0587085_013639_783_899 37
2929 3300059506 Ga0587085_034481 Ga0587085_034481_521_634 37
2930 3300059506 Ga0587085_041699 Ga0587085_041699_371_484 37
2931 3300059506 Ga0587085_130901 Ga0587085_130901_133_246 37
2932 3300059507 Ga0587086_033097 Ga0587086_033097_130_243 37
2933 3300059508 Ga0587088_006618 Ga0587088_006618_198_311 37
2934 3300059508 Ga0587088_099672 Ga0587088_099672_432_545 37
2935 3300059509 Ga0587089_081718 Ga0587089_081718_278_391 37
2936 3300059510 Ga0587090_092103 Ga0587090_092103_414_527 37
2937 3300059510 Ga0587090_126952 Ga0587090_126952_145_258 37
2938 3300059511 Ga0587091_000801 Ga0587091_000801_2618_2731 37
2939 3300059511 Ga0587091_061138 Ga0587091_061138_319_432 37
2940 3300059512 Ga0587092_001078 Ga0587092_001078_2193_2306 37
2941 3300059512 Ga0587092_011517 Ga0587092_011517_539_655 37
2942 3300059512 Ga0587092_074410 Ga0587092_074410_344_457 37
2943 3300059513 Ga0587094_019427 Ga0587094_019427_336_449 37
2944 3300059513 Ga0587094_082582 Ga0587094_082582_218_331 37
2945 3300059514 Ga0587095_016667 Ga0587095_016667_368_481 37
2946 3300059605 Ga0587106_002397 Ga0587106_002397_1122_1235 37
2947 3300059605 Ga0587106_030007 Ga0587106_030007_539_652 37
2948 3300059607 Ga0587125_020989 Ga0587125_020989_290_403 37
2949 3300059608 Ga0587129_005732 Ga0587129_005732_384_497 37
2950 3300059623 Ga0587101_145111 Ga0587101_145111_242_355 37
2951 3300059624 Ga0587109_091585 Ga0587109_091585_370_483 37
2952 3300059626 Ga0587115_019223 Ga0587115_019223_333_446 37
2953 3300059627 Ga0587117_027714 Ga0587117_027714_366_482 37
2954 3300059627 Ga0587117_033489 Ga0587117_033489_216_329 37
2955 3300059627 Ga0587117_069501 Ga0587117_069501_265_378 37
2956 3300059629 Ga0587127_014044 Ga0587127_014044_262_375 37
2957 3300059630 Ga0587128_007998 Ga0587128_007998_291_404 37
2958 3300059639 Ga0587062_012302 Ga0587062_012302_546_662 37
2959 3300059639 Ga0587062_023751 Ga0587062_023751_492_605 37
2960 3300059639 Ga0587062_026618 Ga0587062_026618_336_452 37
2961 3300059639 Ga0587062_038138 Ga0587062_038138_190_303 37
2962 3300059639 Ga0587062_089816 Ga0587062_089816_211_324 37
2963 3300059640 Ga0587067_015945 Ga0587067_015945_198_311 37
2964 3300059640 Ga0587067_116587 Ga0587067_116587_368_481 37
2965 3300059640 Ga0587067_236728 Ga0587067_236728_64_177 37
2966 3300059641 Ga0587068_000361 Ga0587068_000361_766_879 37
2967 3300059641 Ga0587068_018235 Ga0587068_018235_389_502 37
2968 3300059641 Ga0587068_033966 Ga0587068_033966_541_654 37
2969 3300059641 Ga0587068_040802 Ga0587068_040802_416_529 37
2970 3300059641 Ga0587068_074190 Ga0587068_074190_74_187 37
2971 3300059641 Ga0587068_079454 Ga0587068_079454_391_504 37
2972 3300059642 Ga0587069_000480 Ga0587069_000480_195_308 37
2973 3300059642 Ga0587069_097465 Ga0587069_097465_376_489 37
2974 3300059643 Ga0587072_000788 Ga0587072_000788_1685_1798 37
2975 3300059643 Ga0587072_024225 Ga0587072_024225_415_528 37
2976 3300059643 Ga0587072_084013 Ga0587072_084013_172_285 37
2977 3300059643 Ga0587072_125235 Ga0587072_125235_101_214 37
2978 3300059643 Ga0587072_164771 Ga0587072_164771_227_340 37
2979 3300059644 Ga0587075_006827 Ga0587075_006827_640_753 37
2980 3300059644 Ga0587075_033035 Ga0587075_033035_376_489 37
2981 3300059645 Ga0587076_001015 Ga0587076_001015_848_961 37
2982 3300059645 Ga0587076_003303 Ga0587076_003303_1230_1343 37
2983 3300059645 Ga0587076_031006 Ga0587076_031006_305_418 37
2984 3300059646 Ga0587078_006516 Ga0587078_006516_619_732 37
2985 3300059647 Ga0587079_022809 Ga0587079_022809_338_451 37
2986 3300059647 Ga0587079_050815 Ga0587079_050815_485_598 37
2987 3300059647 Ga0587079_180102 Ga0587079_180102_290_403 37
2988 3300059648 Ga0587100_014434 Ga0587100_014434_257_370 37
2989 3300059649 Ga0587102_008595 Ga0587102_008595_546_659 37
2990 3300059651 Ga0587105_001518 Ga0587105_001518_552_665 37
2991 3300059652 Ga0587107_096365 Ga0587107_096365_436_549 37
2992 3300059652 Ga0587107_118980 Ga0587107_118980_276_389 37
2993 3300059653 Ga0587108_010747 Ga0587108_010747_513_626 37
2994 3300059653 Ga0587108_016596 Ga0587108_016596_216_329 37
2995 3300059654 Ga0587110_019615 Ga0587110_019615_350_463 37
2996 3300059655 Ga0587114_042649 Ga0587114_042649_347_460 37
2997 3300059658 Ga0587119_045000 Ga0587119_045000_267_380 37
2998 3300059660 Ga0587124_006196 Ga0587124_006196_337_450 37
2999 3300059660 Ga0587124_036621 Ga0587124_036621_307_420 37
3000 3300060344 Ga0587071_002635 Ga0587071_002635_2016_2129 37
3001 3300060344 Ga0587071_085026 Ga0587071_085026_267_380 37
3002 3300060346 Ga0587111_0024867 Ga0587111_0024867_205_318 37
3003 3300060346 Ga0587111_0044425 Ga0587111_0044425_312_428 37
3004 3300060353 Ga0501082_0005309 Ga0501082_0005309_1603_1716 37
3005 3300060353 Ga0501082_0008495 Ga0501082_0008495_1248_1361 37
3006 3300060353 Ga0501082_0010286 Ga0501082_0010286_6224_6337 37
3007 3300060353 Ga0501082_0013509 Ga0501082_0013509_5490_5603 37
3008 3300060353 Ga0501082_0091105 Ga0501082_0091105_2253_2366 37
3009 3300060353 Ga0501082_0099513 Ga0501082_0099513_1798_1911 37
3010 3300060353 Ga0501082_0262125 Ga0501082_0262125_529_642 37
3011 3300060353 Ga0501082_0364110 Ga0501082_0364110_582_695 37
3012 3300060353 Ga0501082_0428740 Ga0501082_0428740_409_522 37
3013 3300060353 Ga0501082_0513137 Ga0501082_0513137_854_967 37
3014 3300060353 Ga0501082_0537131 Ga0501082_0537131_736_849 37
3015 3300060353 Ga0501082_1676951 Ga0501082_1676951_366_479 37
3016 3300061719 Ga0466962_0050034 Ga0466962_0050034_805_918 37
3017 3300061719 Ga0466962_0380437 Ga0466962_0380437_73_186 37
3018 3300061734 Ga0530510_0001993 Ga0530510_0001993_2392_2505 37
3019 3300061734 Ga0530510_0003175 Ga0530510_0003175_9234_9347 37
3020 3300061734 Ga0530510_0017434 Ga0530510_0017434_705_818 37
3021 3300061734 Ga0530510_1337646 Ga0530510_1337646_10_123 37

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00444

Ribosomal_L36

Ribosomal protein L36

1

37

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_9 39s large subunit of the porcine mitochondrial ribosome 0.9278 7 36
8a63-assembly1.cif.gz_9 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9253 5 36
4v95-assembly2.cif.gz_D9 crystal structure of yaej bound to the 70s ribosome 0.9192 5 36
5j3c-assembly1.cif.gz_R9 thermus thermophilus 70s termination complex containing e. coli rf1 0.9159 5 37
4v8g-assembly1.cif.gz_B9 crystal structure of rmf bound to the 70s ribosome. 0.9141 5 37
ID Description Score Start End Superfamily
af_Q99N90_65_102_2.20.28.120 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8932 8 37 2.20.28.120
af_K7UPJ5_101_471_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7772 11 27 3.40.50.150
af_A5PEY3_852_1047_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.7709 11 25 1.10.150.20
3w6kB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7662 12 28 1.10.10.10
4h5yA02 Special;Helix non-globular;Helix Hairpins; 0.7494 12 28 6.10.140.2010
ID Description Score Start End GO Terms
AF-J7GSB4-F1-model_v4 50S ribosomal protein L36 0.9596 6 36 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1Y3VUD8-F1-model_v4 50S ribosomal protein L36 0.949 5 35 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-X0TT01-F1-model_v4 50S ribosomal protein L36 0.9397 6 37 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A0H4T5L3-F1-model_v4 Large ribosomal subunit protein bL36 0.9371 6 37 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A822IGQ8-F1-model_v4 deleted 0.9367 5 35

Feature Viewer

pLDDT pTM Quality
83.95 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map