F497267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 3257 | 1818 | 2190 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0001953|Ga0500568_0001953_4513_5127 |
| Length | 204 |
| Sequence | VNGEPALSAIHHFTIHHSQQFGKKETKMSRIGKKPVKVPAGVTASVDGQTVSAKGPKGELKFVVNDDVLVKMENGEIAVQPRDQTKTARSKWGMSRTQIVNILEGVTKGFEKKLEINGVGYRAAMQGKNLQLALGFSHDVIYETPHGITIAVPKPTEITVSGIDKQAVGQTAAEIREYRGPEPYKGKGVKYAGERIVRKEGKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 6 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 7 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 8 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 9 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 10 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 11 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 12 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 13 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 14 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 15 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 16 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 17 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 18 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 19 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 20 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 21 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 22 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 23 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 24 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 25 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 26 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 27 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 28 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 29 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 30 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 31 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 32 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 33 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 34 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 35 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 36 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 37 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 38 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 39 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 40 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 41 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 42 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 43 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 44 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 45 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 46 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 47 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 48 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 49 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 50 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 51 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 52 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 53 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 54 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 55 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 56 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 57 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 58 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 59 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 60 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 61 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 62 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 63 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 64 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 65 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 66 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 67 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 68 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 69 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 70 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 71 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 72 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 73 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 74 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 75 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 76 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 77 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 78 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 79 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 80 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 81 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 82 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 83 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 84 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 85 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 86 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 87 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 88 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 89 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 90 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 91 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 92 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 93 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 94 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 95 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 96 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 97 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 98 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 99 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 100 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 101 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 102 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 103 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 104 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 105 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 106 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 107 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 108 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 109 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 110 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 111 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 112 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 113 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 114 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 115 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 116 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 117 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 118 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 119 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 120 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 121 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 122 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 123 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 124 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 125 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 126 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 127 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 128 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 129 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 130 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 131 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 132 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 133 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 134 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 135 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 136 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 137 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 138 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 139 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 140 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 141 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 142 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 143 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 144 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 145 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 146 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 147 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 148 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 149 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 150 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 151 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 152 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 153 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 154 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 155 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 156 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 157 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 158 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 159 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 160 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 161 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 162 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 163 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 164 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 165 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 166 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 167 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 168 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 169 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 170 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 171 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 172 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 173 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 174 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 175 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 176 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 177 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 178 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 179 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 180 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 181 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 182 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 183 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 184 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 185 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 186 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 187 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 188 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 189 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 190 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 191 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 192 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 193 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 194 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 195 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 196 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 197 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 198 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 199 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 200 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 201 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 202 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 203 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 204 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 205 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 206 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 207 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 208 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 209 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 210 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 211 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 212 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 213 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 214 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 215 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 216 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 217 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 218 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 219 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 220 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 221 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 222 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 223 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 224 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 225 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 226 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 227 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 228 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 229 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 230 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 231 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 232 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 233 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 234 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 235 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 236 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 237 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 238 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 239 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 240 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 241 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 242 | 2791355199 | |||
| 243 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 244 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 245 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 246 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 247 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 248 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 249 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 250 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 251 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 252 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 253 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 254 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 255 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 256 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 257 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 258 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 259 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 260 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 261 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 262 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 263 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 264 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 265 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 266 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 267 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 268 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 269 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 270 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 271 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 272 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 273 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 274 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 275 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 276 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 277 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 278 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 279 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 280 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 281 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 282 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 283 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 284 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 285 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 286 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 287 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 288 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 289 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 290 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 291 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 292 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 293 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 294 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 295 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 296 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 297 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 298 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 299 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 300 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 301 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 302 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 303 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 304 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 305 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 306 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 307 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 308 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 309 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 310 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 311 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 312 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 313 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 314 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 315 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 316 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 317 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 318 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 319 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 320 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 321 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 322 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 323 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 324 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 325 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 326 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 327 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 328 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 329 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 330 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 331 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 332 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 333 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 334 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 335 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 336 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 337 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 338 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 339 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 340 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 341 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 342 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 343 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 344 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 345 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 346 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 347 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 348 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 349 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 350 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 351 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 352 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 353 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 354 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 355 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 356 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 357 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 358 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 359 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 360 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 361 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 362 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 363 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 364 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 365 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 366 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 367 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 368 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 369 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 370 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 371 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 372 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 373 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 374 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 375 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 376 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 377 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 378 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 379 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 380 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 381 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 382 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 383 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 384 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 385 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 386 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 387 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 388 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 389 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 390 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 391 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 392 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 393 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 394 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 395 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 396 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 397 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 398 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 399 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 400 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 401 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 402 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 403 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 404 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 405 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 406 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 407 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 408 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 409 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 410 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 411 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 412 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 413 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 414 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 415 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 416 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 417 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 418 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 419 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 420 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 421 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 422 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 423 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 424 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 425 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 426 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 427 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 428 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 429 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 430 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 431 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 432 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 433 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 434 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 435 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 436 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 437 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 438 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 439 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 440 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 441 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 442 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 443 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 444 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 445 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 446 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 447 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 448 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 449 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 450 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 451 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 452 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 453 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 454 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 455 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 456 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 457 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 458 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 459 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 460 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 461 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 462 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 463 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 464 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 465 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 466 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 467 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 468 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 469 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 470 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 471 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 472 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 473 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 474 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 475 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 476 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 477 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 478 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 479 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 480 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 481 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 482 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 483 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 484 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 485 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 486 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 487 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 488 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 489 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 490 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 491 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 492 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 493 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 494 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 495 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 496 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 497 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 498 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 499 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 500 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 501 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 502 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 503 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 504 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 505 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 506 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 507 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 508 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 509 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 510 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 511 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 512 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 513 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 514 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 515 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 516 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 517 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 518 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 519 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 520 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 521 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 522 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 523 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 524 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 525 | 2904699407 | |||
| 526 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 527 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 528 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 529 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 530 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 531 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 532 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 533 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 534 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 535 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 536 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 537 | 2906610324 | |||
| 538 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 539 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 540 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 541 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 542 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 543 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 544 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 545 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 546 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 547 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 548 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 549 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 550 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 551 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 552 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 553 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 554 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 555 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 556 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 557 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 558 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 559 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 560 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 561 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 562 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 563 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 564 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 565 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 566 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 567 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 568 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 569 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 570 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 571 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 572 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 573 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 574 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 575 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 576 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 577 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 578 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 579 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 580 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 581 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 582 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 583 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 584 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 585 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 586 | 2922368715 | |||
| 587 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 588 | 2922425934 | |||
| 589 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 590 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 591 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 592 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 593 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 594 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 595 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 596 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 597 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 598 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 599 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 600 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 601 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 602 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 603 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 604 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 605 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 606 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 607 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 608 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 609 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 610 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 611 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 612 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 613 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 614 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 615 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 616 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 617 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 618 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 619 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 620 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 621 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 622 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 623 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 624 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 625 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 626 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 627 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 628 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 629 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 630 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 631 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 632 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 633 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 634 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 635 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 636 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 637 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 638 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 639 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 640 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 641 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 642 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 643 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 644 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 645 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 646 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 647 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 648 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 649 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 650 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 651 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 652 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 653 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 654 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 655 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 656 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 657 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 658 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 659 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 660 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 661 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 662 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 663 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 664 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 665 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 666 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 667 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 668 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 669 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 670 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 671 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 672 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 673 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 674 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 675 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 676 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 677 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 678 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 679 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 680 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 681 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 682 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 683 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 684 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 685 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 686 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 687 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 688 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 689 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 690 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 691 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 692 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 693 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 694 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 695 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 696 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 697 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 698 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 699 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 700 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 701 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 702 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 703 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 704 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 705 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 706 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 707 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 708 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 709 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 710 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 711 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 712 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 713 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 714 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 715 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 716 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 717 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 718 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 719 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 720 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 721 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 722 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 723 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 724 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 725 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 726 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 727 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 728 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 729 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 730 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 731 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 732 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 733 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 734 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 735 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 736 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 737 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 738 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 739 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 740 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 741 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 742 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 743 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 744 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 745 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 746 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 747 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 748 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 749 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 750 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 751 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 752 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 753 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 754 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 755 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 756 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 757 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 758 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 759 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 760 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 761 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 762 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 763 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 764 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 765 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 766 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 767 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 768 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 769 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 770 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 771 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 772 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 773 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 774 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 775 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 776 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 777 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 778 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 779 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 780 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 781 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 782 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 783 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 784 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 785 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 786 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 787 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 788 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 789 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 790 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 791 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 792 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 793 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 794 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 795 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 796 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 797 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 798 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 799 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 800 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 801 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 802 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 803 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 804 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 805 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 806 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 807 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 808 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 809 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 810 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 811 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 812 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 813 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 814 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 815 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 816 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 817 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 818 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 819 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 820 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 821 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 822 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 823 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 824 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 825 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 826 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 827 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 828 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 829 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 830 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 831 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 832 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 833 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 834 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 835 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 836 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 837 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 838 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 839 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 840 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 841 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 842 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 843 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 844 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 845 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 846 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 847 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 848 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 849 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 850 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 851 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 852 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 853 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 854 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 855 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 856 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 857 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 858 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 859 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 860 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 861 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 862 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 863 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 864 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 865 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 866 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 867 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 868 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 869 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 870 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 871 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 872 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 873 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 874 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 875 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 876 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 877 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 878 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 879 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 880 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 881 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 882 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 883 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 884 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 885 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 886 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 887 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 888 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 889 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 890 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 891 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 892 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 893 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 894 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 895 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 896 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 897 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 898 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 899 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 900 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 901 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 902 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 903 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 904 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 905 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 906 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 907 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 908 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 909 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 910 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 911 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 912 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 913 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 914 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 915 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 916 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 917 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 918 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 919 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 920 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 921 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 922 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 923 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 924 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 925 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 926 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 927 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 928 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 929 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 930 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 931 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 932 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 933 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 934 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 935 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 936 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 937 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 938 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 939 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 940 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 941 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 942 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 943 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 944 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 945 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 946 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 947 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 948 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 949 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 950 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 951 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 952 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 953 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 954 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 955 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 956 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 957 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 958 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 959 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 960 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 961 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 962 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 963 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 964 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 965 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 966 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 967 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 968 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 969 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 970 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 971 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 972 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 973 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 974 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 975 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 976 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 977 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 978 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 979 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 980 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 981 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 982 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 983 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 984 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 985 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 986 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 987 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 988 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 989 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 990 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 991 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 992 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 993 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 994 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 995 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 996 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 997 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 998 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 999 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 1000 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 1001 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 1002 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 1003 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 1004 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 1005 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 1006 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 1007 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 1008 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 1009 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 1010 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 1011 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 1012 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 1013 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 1014 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 1015 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 1016 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 1017 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 1018 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 1019 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 1020 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 1021 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 1022 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 1023 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 1024 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 1025 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 1026 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 1027 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 1028 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 1029 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 1030 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 1031 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 1032 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 1033 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 1034 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 1035 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 1036 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 1037 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 1038 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 1039 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 1040 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 1041 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 1042 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 1043 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 1044 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 1045 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 1046 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 1047 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 1048 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 1049 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 1050 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 1051 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 1052 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 1053 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 1054 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 1055 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 1056 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 1057 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 1058 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 1059 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 1060 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 1061 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 1062 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 1063 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 1064 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 1065 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 1066 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 1067 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 1068 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 1069 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 1070 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 1071 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 1072 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 1073 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 1074 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 1075 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 1076 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 1077 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 1078 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 1079 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1080 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 1081 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 1082 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 1083 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 1084 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 1085 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1086 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 1087 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 1088 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 1089 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 1090 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 1091 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 1092 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 1093 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 1094 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 1095 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1096 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 1097 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 1098 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 1099 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 1100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 1101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 1102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 1103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 1104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 1105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 1106 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 1107 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 1108 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 1109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 1110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 1111 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 1112 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 1113 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 1114 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 1115 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 1116 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 1117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 1118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 1119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 1120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 1121 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 1122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 1123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 1124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 1125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 1126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 1127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 1128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 1129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 1130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 1131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 1132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 1133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 1134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 1135 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 1136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 1137 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 1138 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 1139 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 1140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 1141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 1142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 1143 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 1144 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 1145 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 1146 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 1147 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 1148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 1150 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 1151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 1152 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 1153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 1154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1155 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 1157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 1158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 1159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1161 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1163 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1164 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 1165 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 1167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 1169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 1171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 1172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1177 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1185 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1190 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1191 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1201 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1206 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1207 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1208 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1237 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 1238 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1239 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1240 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1241 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1242 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1243 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1244 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1245 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 1246 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1250 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 1251 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 1252 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 1253 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 1254 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 1255 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 1256 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 1257 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1258 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 1259 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 1260 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 1261 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 1262 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1263 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 1264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 1265 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 1266 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 1267 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 1268 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 1269 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 1271 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1272 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 1273 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 1274 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 1275 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 1276 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 1277 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 1278 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 1280 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1281 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1282 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 1283 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1284 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1285 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1287 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1288 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 1289 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1290 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 1291 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 1292 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1293 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 1294 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1295 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1296 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 1297 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 1298 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 1299 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 1300 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 1301 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 1302 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 1303 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 1304 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 1305 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1306 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1307 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 1308 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 1309 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 1310 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 1311 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 1312 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 1313 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 1314 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 1315 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 1316 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 1317 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 1318 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 1319 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1320 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1321 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 1322 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1323 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 1324 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1325 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 1326 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1327 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1328 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1329 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1330 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1331 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1332 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1333 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1334 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1335 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1336 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1337 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 1338 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 1339 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1340 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 1341 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 1342 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 1343 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 1344 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 1345 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 1346 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 1347 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 1348 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 1349 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 1350 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1351 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1352 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 1353 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 1354 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1355 | 3300041500 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT | Metatranscriptome | Unclassified |
| 1356 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 1357 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 1358 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1359 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 1360 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 1361 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1362 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1363 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 1364 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1365 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1366 | 3300041909 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1367 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 1368 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 1369 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 1370 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1371 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 1372 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 1373 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 1374 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 1375 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 1376 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 1377 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 1378 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 1379 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 1380 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 1381 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 1382 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 1383 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 1384 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1385 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 1386 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 1387 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1388 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 1389 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1390 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1391 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1392 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1393 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1394 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1395 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 1396 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 1397 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1398 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1399 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1400 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 1401 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1402 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1403 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 1404 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1405 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1406 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1407 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 1408 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 1409 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1410 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1411 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1412 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1413 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1414 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 1415 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 1416 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1417 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1418 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1419 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 1420 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1421 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1422 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1423 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1424 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1425 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1426 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1427 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1428 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1429 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1430 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 1431 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1432 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 1433 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 1434 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1435 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1436 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 1437 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1438 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 1439 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1440 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 1441 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1442 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 1443 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1444 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1445 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1446 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1447 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1448 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1449 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1450 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1451 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1452 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1453 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1454 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 1455 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1456 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1457 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1458 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1459 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1460 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1461 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 1462 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1463 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1464 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1465 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1466 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1467 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1468 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1469 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1470 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1471 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1472 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1473 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1474 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1475 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1476 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1477 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1478 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1479 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1480 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1481 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1482 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 1483 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1484 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1485 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1486 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1487 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1488 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1489 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1490 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 1491 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1492 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1493 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1494 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1495 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1496 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1497 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1498 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1499 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1500 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1501 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1502 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1503 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1504 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1505 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1506 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1507 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1508 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1509 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1510 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1511 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1512 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1513 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1514 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1515 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1516 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1517 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1518 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1519 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1520 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1521 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1522 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1523 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1524 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1525 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1526 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1527 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 1528 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1529 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1530 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1531 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1532 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1533 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1534 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1535 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1536 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1537 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1538 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1539 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1540 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1541 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1542 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1543 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1544 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1545 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1546 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1547 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1548 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1549 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1550 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1551 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1552 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1553 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1554 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1555 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1556 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1557 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1558 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1559 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1560 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1561 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1562 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1563 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1564 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1565 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1566 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 1567 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 1568 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1569 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1570 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1571 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1572 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 1573 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1574 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1575 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1576 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1577 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 1578 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1579 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1580 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1581 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1582 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1583 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1584 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1585 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1586 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1587 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1588 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1589 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1590 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1591 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1592 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1593 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1594 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1595 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1596 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1597 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1598 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1599 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1600 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1601 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 1602 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1603 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 1604 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 1605 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1606 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 1607 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 1608 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1609 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 1610 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 1611 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 1612 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 1613 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1614 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1615 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1616 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1617 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1618 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1619 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1620 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1621 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 1622 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1623 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 1624 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1625 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 1626 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 1627 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1628 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 1629 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 1630 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1631 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1632 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 1633 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1634 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1635 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1636 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 1637 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1638 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 1639 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1640 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 1641 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1642 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1643 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 1644 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1645 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1646 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1647 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1648 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 1649 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1650 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1651 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 1652 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 1653 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1654 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1655 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 1656 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1657 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1658 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 1659 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 1660 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 1661 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 1662 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1663 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1664 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1665 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1666 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1667 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1668 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1669 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1670 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1671 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1672 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1673 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1674 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1675 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1676 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1677 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1678 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1679 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1680 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1681 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1682 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1683 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1684 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1685 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1686 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1687 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1688 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1689 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1690 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1691 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1692 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1693 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1694 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1695 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1696 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1697 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1698 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1699 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1700 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1701 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1702 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1703 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1704 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1705 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1706 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1707 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1708 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1709 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1710 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1711 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1712 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1713 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1714 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1715 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1716 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1717 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1718 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1719 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1720 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1721 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1722 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1723 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1724 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1725 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1726 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1727 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1728 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1729 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1730 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1731 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1732 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1733 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1734 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1735 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1736 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1737 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1738 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1739 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1740 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1741 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1742 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1743 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1744 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1745 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1746 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1747 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1748 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1749 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1750 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1751 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1752 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1753 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1754 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1755 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1756 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1757 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1758 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 1759 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 1760 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 1761 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 1762 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 1763 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 1764 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1765 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1766 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 1767 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 1768 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 1769 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1770 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1771 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1772 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 1773 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1774 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 1775 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1776 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1777 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1778 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1779 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1780 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1781 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1782 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1783 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 1784 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1785 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1786 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 1787 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 1788 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1789 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 1790 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1791 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1792 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 1793 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1794 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1795 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1796 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 1797 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1798 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 1799 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 1800 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1801 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1802 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1803 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1804 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1805 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1806 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1807 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1808 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1809 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1810 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1811 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1812 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1813 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 1814 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 1815 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1816 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1817 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1818 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.76 |
| Metatranscriptomes | 6.58 |
| Isolates | 32.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 14.28 |
| Nodule | 25.61 |
| Rhizoplane | 3.1 |
| Rhizosphere | 45.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1019970 | 3300000546 | Bacteria | 715 |
| 2 | JGI24746J21847_1014539 | 3300001977 | Bacteria | 1137 |
| 3 | JGI24740J21852_10005876 | 3300001979 | Bacteria | 5144 |
| 4 | JGI24740J21852_10038834 | 3300001979 | Bacteria | 1457 |
| 5 | JGI24739J22299_10023100 | 3300001989 | Bacteria | 2200 |
| 6 | JGI24737J22298_10014566 | 3300001990 | Bacteria | 2551 |
| 7 | JGI24735J21928_10008865 | 3300002067 | Bacteria | 3244 |
| 8 | JGI24750J21931_1002476 | 3300002070 | Bacteria | 2226 |
| 9 | JGI24748J21848_1006619 | 3300002074 | Bacteria | 1351 |
| 10 | JGI24744J21845_10011648 | 3300002077 | Bacteria | 1796 |
| 11 | JGI24742J22300_10008938 | 3300002244 | Bacteria | 1653 |
| 12 | JGI25155J39150_1000061 | 3300002704 | Bacteria | 71144 |
| 13 | JGI25156J39149_1001959 | 3300002705 | Bacteria | 7933 |
| 14 | JGI25162J39368_1009004 | 3300002737 | Bacteria | 1372 |
| 15 | JGI25162J39368_1009005 | 3300002737 | Bacteria | 1372 |
| 16 | JGI25154J39366_1002042 | 3300002738 | Bacteria | 5800 |
| 17 | JGI25158J39367_1002239 | 3300002739 | Bacteria | 3210 |
| 18 | JGI25157J39369_1000106 | 3300002741 | Bacteria | 71144 |
| 19 | JGI25157J39369_1002241 | 3300002741 | Bacteria | 5220 |
| 20 | JGI25152J39213_1035375 | 3300002773 | Bacteria | 738 |
| 21 | JGI25152J39213_1043016 | 3300002773 | Bacteria | 623 |
| 22 | JGI25152J39213_1043464 | 3300002773 | Bacteria | 617 |
| 23 | JGI25152J39213_1047518 | 3300002773 | Bacteria | 572 |
| 24 | JGI25150J39212_1009762 | 3300002774 | Bacteria | 1813 |
| 25 | JGI25150J39212_1014332 | 3300002774 | Bacteria | 1349 |
| 26 | JGI25150J39212_1018199 | 3300002774 | Bacteria | 1121 |
| 27 | JGI25150J39212_1041666 | 3300002774 | Bacteria | 591 |
| 28 | JGI25159J45721_1001742 | 3300002987 | Bacteria | 8761 |
| 29 | JGI25159J45721_1001758 | 3300002987 | Bacteria | 8715 |
| 30 | JGI25159J45721_1001854 | 3300002987 | Bacteria | 8451 |
| 31 | Ga0006778J45830_1043587 | 3300003162 | Bacteria | 3758 |
| 32 | Ga0006778J45830_1078890 | 3300003162 | Bacteria | 1068 |
| 33 | JGI25151J46595_10033134 | 3300003187 | Bacteria | 1994 |
| 34 | JGI25151J46595_10051541 | 3300003187 | Bacteria | 1392 |
| 35 | JGI25151J46595_10094552 | 3300003187 | Bacteria | 822 |
| 36 | JGI25151J46595_10095923 | 3300003187 | Bacteria | 812 |
| 37 | JGI25151J46595_10097329 | 3300003187 | Bacteria | 802 |
| 38 | JGI25406J46586_10001918 | 3300003203 | Bacteria | 9806 |
| 39 | JGI25165J46597_1001303 | 3300003214 | Bacteria | 14268 |
| 40 | JGI25165J46597_1008576 | 3300003214 | Bacteria | 1593 |
| 41 | JGI25165J46597_1009987 | 3300003214 | Bacteria | 1399 |
| 42 | JGI25153J46596_10001601 | 3300003215 | Bacteria | 13411 |
| 43 | JGI25153J46596_10013209 | 3300003215 | Bacteria | 3507 |
| 44 | JGI25153J46596_10022281 | 3300003215 | Bacteria | 2340 |
| 45 | JGI25153J46596_10080670 | 3300003215 | Bacteria | 812 |
| 46 | JGI25153J46596_10086554 | 3300003215 | Bacteria | 767 |
| 47 | JGI25153J46596_10114136 | 3300003215 | Bacteria | 617 |
| 48 | JGI25153J46596_10127048 | 3300003215 | Bacteria | 568 |
| 49 | Ga0006758J48902_1009309 | 3300003300 | Bacteria | 6323 |
| 50 | rootH2_10008940 | 3300003320 | Bacteria | 20037 |
| 51 | rootL2_10037314 | 3300003322 | Bacteria | 2608 |
| 52 | JGI25160J50197_1000711 | 3300003354 | Bacteria | 18324 |
| 53 | JGI25160J50197_1002401 | 3300003354 | Bacteria | 8731 |
| 54 | JGI25160J50197_1010180 | 3300003354 | Bacteria | 3420 |
| 55 | JGI25160J50197_1020369 | 3300003354 | Bacteria | 2003 |
| 56 | JGI25160J50197_1023262 | 3300003354 | Bacteria | 1793 |
| 57 | JGI25160J50197_1062080 | 3300003354 | Bacteria | 742 |
| 58 | JGI25160J50197_1065297 | 3300003354 | Bacteria | 712 |
| 59 | JGI25161J50226_1001504 | 3300003374 | Bacteria | 6915 |
| 60 | JGI25161J50226_1005101 | 3300003374 | Bacteria | 2617 |
| 61 | JGI25161J50226_1005181 | 3300003374 | Bacteria | 2581 |
| 62 | Ga0007417J51691_1064787 | 3300003544 | Bacteria | 932 |
| 63 | Ga0007427J51700_119959 | 3300003559 | Bacteria | 667 |
| 64 | Ga0007409J51694_1066553 | 3300003575 | Bacteria | 1490 |
| 65 | Ga0006562J51391_1040260 | 3300003578 | Bacteria | 2118 |
| 66 | Ga0007429J51699_1060640 | 3300003579 | Bacteria | 1671 |
| 67 | Ga0007429J51699_1080175 | 3300003579 | Bacteria | 1406 |
| 68 | Ga0032354_1024703 | 3300003693 | Bacteria | 11216 |
| 69 | Ga0055539_1004785 | 3300003752 | Bacteria | 1788 |
| 70 | Ga0055542_1001882 | 3300003762 | Bacteria | 8351 |
| 71 | Ga0055542_1002921 | 3300003762 | Bacteria | 5036 |
| 72 | Ga0055529_1004418 | 3300003763 | Bacteria | 2143 |
| 73 | Ga0055526_1003723 | 3300003771 | Bacteria | 9520 |
| 74 | Ga0055526_1035691 | 3300003771 | Bacteria | 1334 |
| 75 | Ga0055526_1064369 | 3300003771 | Bacteria | 767 |
| 76 | Ga0055524_1036623 | 3300003775 | Bacteria | 1315 |
| 77 | Ga0055524_1044107 | 3300003775 | Bacteria | 1088 |
| 78 | Ga0055524_1050093 | 3300003775 | Bacteria | 956 |
| 79 | Ga0055524_1066669 | 3300003775 | Bacteria | 714 |
| 80 | Ga0055536_1001886 | 3300003781 | Bacteria | 12178 |
| 81 | Ga0055536_1002273 | 3300003781 | Bacteria | 10907 |
| 82 | Ga0055536_1006942 | 3300003781 | Bacteria | 5160 |
| 83 | Ga0055528_1021587 | 3300003790 | Bacteria | 2036 |
| 84 | Ga0055528_1056056 | 3300003790 | Bacteria | 767 |
| 85 | Ga0055528_1076269 | 3300003790 | Bacteria | 596 |
| 86 | Ga0055528_1076384 | 3300003790 | Bacteria | 596 |
| 87 | Ga0055530_10009225 | 3300003791 | Bacteria | 3825 |
| 88 | Ga0055530_10024067 | 3300003791 | Bacteria | 1736 |
| 89 | Ga0055540_1004614 | 3300003792 | Bacteria | 6119 |
| 90 | Ga0055540_1064046 | 3300003792 | Bacteria | 729 |
| 91 | Ga0055540_1065134 | 3300003792 | Bacteria | 721 |
| 92 | Ga0055540_1077922 | 3300003792 | Bacteria | 639 |
| 93 | Ga0055540_1085533 | 3300003792 | Bacteria | 600 |
| 94 | Ga0055531_10006947 | 3300003794 | Bacteria | 6302 |
| 95 | Ga0055531_10017723 | 3300003794 | Bacteria | 2987 |
| 96 | Ga0055531_10080310 | 3300003794 | Bacteria | 720 |
| 97 | Ga0055543_1000156 | 3300004625 | Bacteria | 57199 |
| 98 | Ga0055543_1000856 | 3300004625 | Bacteria | 14666 |
| 99 | Ga0055543_1000880 | 3300004625 | Bacteria | 14315 |
| 100 | Ga0055543_1001602 | 3300004625 | Bacteria | 8686 |
| 101 | Ga0058859_11714120 | 3300004798 | Bacteria | 715 |
| 102 | Ga0058860_10018536 | 3300004801 | Bacteria | 1559 |
| 103 | Ga0058860_11771056 | 3300004801 | Bacteria | 1188 |
| 104 | Ga0065165_1002620 | 3300005262 | Bacteria | 14666 |
| 105 | Ga0065165_1002688 | 3300005262 | Bacteria | 14315 |
| 106 | Ga0065165_1008206 | 3300005262 | Bacteria | 4947 |
| 107 | Ga0065165_1014496 | 3300005262 | Bacteria | 3057 |
| 108 | Ga0065165_1019265 | 3300005262 | Bacteria | 2444 |
| 109 | Ga0065165_1020288 | 3300005262 | Bacteria | 2344 |
| 110 | Ga0065704_10166257 | 3300005289 | Bacteria | 1320 |
| 111 | Ga0065707_10012753 | 3300005295 | Bacteria | 1674 |
| 112 | Ga0070658_10092435 | 3300005327 | Bacteria | 2494 |
| 113 | Ga0070658_10129002 | 3300005327 | Bacteria | 2106 |
| 114 | Ga0070676_10175790 | 3300005328 | Bacteria | 1388 |
| 115 | Ga0070676_10812915 | 3300005328 | Bacteria | 690 |
| 116 | Ga0070670_100003237 | 3300005331 | Bacteria | 13450 |
| 117 | Ga0070670_100139598 | 3300005331 | Bacteria | 2095 |
| 118 | Ga0070666_10353481 | 3300005335 | Bacteria | 1052 |
| 119 | Ga0070666_10461003 | 3300005335 | Bacteria | 918 |
| 120 | Ga0070666_10739099 | 3300005335 | Bacteria | 723 |
| 121 | Ga0070666_10788376 | 3300005335 | Bacteria | 699 |
| 122 | Ga0070682_100060292 | 3300005337 | Bacteria | 2399 |
| 123 | Ga0070682_100106402 | 3300005337 | Bacteria | 1861 |
| 124 | Ga0070682_100644370 | 3300005337 | Bacteria | 842 |
| 125 | Ga0070682_101449987 | 3300005337 | Bacteria | 588 |
| 126 | Ga0070660_100228895 | 3300005339 | Bacteria | 1512 |
| 127 | Ga0070660_100286912 | 3300005339 | Bacteria | 1347 |
| 128 | Ga0070689_100395279 | 3300005340 | Bacteria | 1167 |
| 129 | Ga0070689_101175664 | 3300005340 | Bacteria | 688 |
| 130 | Ga0070687_100950748 | 3300005343 | Bacteria | 619 |
| 131 | Ga0070661_100490127 | 3300005344 | Bacteria | 983 |
| 132 | Ga0070692_10549122 | 3300005345 | Bacteria | 756 |
| 133 | Ga0070668_100162574 | 3300005347 | Bacteria | 1812 |
| 134 | Ga0070668_100167991 | 3300005347 | Bacteria | 1784 |
| 135 | Ga0070668_100231234 | 3300005347 | Bacteria | 1528 |
| 136 | Ga0070668_100334546 | 3300005347 | Bacteria | 1278 |
| 137 | Ga0070668_100927361 | 3300005347 | Bacteria | 779 |
| 138 | Ga0070669_100178786 | 3300005353 | Bacteria | 1658 |
| 139 | Ga0070669_100237958 | 3300005353 | Bacteria | 1445 |
| 140 | Ga0070669_100279858 | 3300005353 | Bacteria | 1336 |
| 141 | Ga0070669_100311739 | 3300005353 | Bacteria | 1268 |
| 142 | Ga0070669_100440199 | 3300005353 | Bacteria | 1073 |
| 143 | Ga0070675_100903392 | 3300005354 | Bacteria | 809 |
| 144 | Ga0070671_100016669 | 3300005355 | Bacteria | 5941 |
| 145 | Ga0070671_100177196 | 3300005355 | Bacteria | 1804 |
| 146 | Ga0070671_100329945 | 3300005355 | Bacteria | 1300 |
| 147 | Ga0070671_101149589 | 3300005355 | Bacteria | 682 |
| 148 | Ga0070671_101211801 | 3300005355 | Bacteria | 664 |
| 149 | Ga0070674_100224686 | 3300005356 | Bacteria | 1462 |
| 150 | Ga0070674_100422934 | 3300005356 | Bacteria | 1093 |
| 151 | Ga0070673_100870080 | 3300005364 | Bacteria | 835 |
| 152 | Ga0070688_100220798 | 3300005365 | Bacteria | 1335 |
| 153 | Ga0070688_100350601 | 3300005365 | Bacteria | 1080 |
| 154 | Ga0070659_100093075 | 3300005366 | Bacteria | 2418 |
| 155 | Ga0070659_100100837 | 3300005366 | Bacteria | 2323 |
| 156 | Ga0070667_100244954 | 3300005367 | Bacteria | 1601 |
| 157 | Ga0070667_100967783 | 3300005367 | Bacteria | 793 |
| 158 | Ga0070667_101192686 | 3300005367 | Bacteria | 712 |
| 159 | Ga0070667_101453121 | 3300005367 | Bacteria | 643 |
| 160 | Ga0070703_10123651 | 3300005406 | Bacteria | 942 |
| 161 | Ga0070709_10004324 | 3300005434 | Bacteria | 7659 |
| 162 | Ga0070709_10499759 | 3300005434 | Bacteria | 923 |
| 163 | Ga0070714_100059218 | 3300005435 | Bacteria | 3283 |
| 164 | Ga0070714_100112402 | 3300005435 | Bacteria | 2413 |
| 165 | Ga0070713_100027784 | 3300005436 | Bacteria | 4460 |
| 166 | Ga0070713_100030565 | 3300005436 | Bacteria | 4278 |
| 167 | Ga0070713_100187641 | 3300005436 | Bacteria | 1861 |
| 168 | Ga0070713_101186952 | 3300005436 | Bacteria | 739 |
| 169 | Ga0070713_101663701 | 3300005436 | Bacteria | 620 |
| 170 | Ga0070710_10003270 | 3300005437 | Bacteria | 7682 |
| 171 | Ga0070710_10033673 | 3300005437 | Bacteria | 2783 |
| 172 | Ga0070710_10211874 | 3300005437 | Bacteria | 1228 |
| 173 | Ga0070711_100007497 | 3300005439 | Bacteria | 6640 |
| 174 | Ga0070711_100123070 | 3300005439 | Bacteria | 1921 |
| 175 | Ga0070711_100126700 | 3300005439 | Bacteria | 1896 |
| 176 | Ga0070711_100201995 | 3300005439 | Bacteria | 1534 |
| 177 | Ga0070711_100357588 | 3300005439 | Bacteria | 1175 |
| 178 | Ga0070694_100180173 | 3300005444 | Bacteria | 1562 |
| 179 | Ga0070708_100035098 | 3300005445 | Bacteria | 4367 |
| 180 | Ga0070663_100146891 | 3300005455 | Bacteria | 1805 |
| 181 | Ga0070663_100254636 | 3300005455 | Bacteria | 1390 |
| 182 | Ga0070663_100816616 | 3300005455 | Bacteria | 800 |
| 183 | Ga0070678_100023343 | 3300005456 | Bacteria | 4120 |
| 184 | Ga0070662_100524098 | 3300005457 | Bacteria | 990 |
| 185 | Ga0070681_10018722 | 3300005458 | Bacteria | 6929 |
| 186 | Ga0070681_10068789 | 3300005458 | Bacteria | 3507 |
| 187 | Ga0070685_10472265 | 3300005466 | Bacteria | 882 |
| 188 | Ga0070685_10917889 | 3300005466 | Bacteria | 653 |
| 189 | Ga0070706_100045185 | 3300005467 | Bacteria | 4069 |
| 190 | Ga0070706_100246691 | 3300005467 | Bacteria | 1667 |
| 191 | Ga0070706_101013047 | 3300005467 | Bacteria | 766 |
| 192 | Ga0070707_100065254 | 3300005468 | Bacteria | 3497 |
| 193 | Ga0070698_100298640 | 3300005471 | Bacteria | 1541 |
| 194 | Ga0070698_100327715 | 3300005471 | Bacteria | 1462 |
| 195 | Ga0070698_101101846 | 3300005471 | Bacteria | 743 |
| 196 | Ga0070679_100237155 | 3300005530 | Bacteria | 1782 |
| 197 | Ga0070679_100305294 | 3300005530 | Bacteria | 1542 |
| 198 | Ga0070679_100329362 | 3300005530 | Bacteria | 1476 |
| 199 | Ga0070684_100792115 | 3300005535 | Bacteria | 886 |
| 200 | Ga0070684_100911036 | 3300005535 | Bacteria | 824 |
| 201 | Ga0070684_101120991 | 3300005535 | Bacteria | 739 |
| 202 | Ga0070697_100102676 | 3300005536 | Bacteria | 2376 |
| 203 | Ga0070697_100279312 | 3300005536 | Bacteria | 1432 |
| 204 | Ga0068853_100027914 | 3300005539 | Bacteria | 4746 |
| 205 | Ga0068853_100087278 | 3300005539 | Bacteria | 2737 |
| 206 | Ga0068853_100159771 | 3300005539 | Bacteria | 2033 |
| 207 | Ga0068853_100495158 | 3300005539 | Bacteria | 1153 |
| 208 | Ga0068853_101187741 | 3300005539 | Bacteria | 736 |
| 209 | Ga0068853_101444864 | 3300005539 | Bacteria | 665 |
| 210 | Ga0070672_100153802 | 3300005543 | Bacteria | 1904 |
| 211 | Ga0070672_100921346 | 3300005543 | Bacteria | 772 |
| 212 | Ga0070686_100291835 | 3300005544 | Bacteria | 1206 |
| 213 | Ga0070696_100105177 | 3300005546 | Bacteria | 2027 |
| 214 | Ga0070693_100556937 | 3300005547 | Bacteria | 821 |
| 215 | Ga0070665_100006166 | 3300005548 | Bacteria | 12264 |
| 216 | Ga0070665_100149739 | 3300005548 | Bacteria | 2336 |
| 217 | Ga0070665_100189603 | 3300005548 | Bacteria | 2057 |
| 218 | Ga0070665_100578965 | 3300005548 | Bacteria | 1135 |
| 219 | Ga0070665_100588727 | 3300005548 | Bacteria | 1125 |
| 220 | Ga0070665_100658220 | 3300005548 | Bacteria | 1060 |
| 221 | Ga0070704_100474375 | 3300005549 | Bacteria | 1081 |
| 222 | Ga0068855_100017220 | 3300005563 | Bacteria | 8696 |
| 223 | Ga0068855_100324040 | 3300005563 | Bacteria | 1702 |
| 224 | Ga0068855_100408666 | 3300005563 | Bacteria | 1487 |
| 225 | Ga0068855_100516500 | 3300005563 | Bacteria | 1296 |
| 226 | Ga0068855_100528959 | 3300005563 | Bacteria | 1278 |
| 227 | Ga0068855_100748333 | 3300005563 | Bacteria | 1042 |
| 228 | Ga0068855_100860885 | 3300005563 | Bacteria | 960 |
| 229 | Ga0068855_101690612 | 3300005563 | Bacteria | 646 |
| 230 | Ga0070664_100444593 | 3300005564 | Bacteria | 1189 |
| 231 | Ga0070664_101316078 | 3300005564 | Bacteria | 682 |
| 232 | Ga0068857_100250838 | 3300005577 | Bacteria | 1622 |
| 233 | Ga0068857_100788810 | 3300005577 | Bacteria | 907 |
| 234 | Ga0068854_100289438 | 3300005578 | Bacteria | 1321 |
| 235 | Ga0068854_100367640 | 3300005578 | Bacteria | 1182 |
| 236 | Ga0068854_100767970 | 3300005578 | Bacteria | 837 |
| 237 | Ga0068856_100055880 | 3300005614 | Bacteria | 3895 |
| 238 | Ga0068856_100137388 | 3300005614 | Bacteria | 2450 |
| 239 | Ga0068856_100156445 | 3300005614 | Bacteria | 2289 |
| 240 | Ga0068856_100489690 | 3300005614 | Bacteria | 1250 |
| 241 | Ga0068856_100700160 | 3300005614 | Bacteria | 1033 |
| 242 | Ga0068856_100817239 | 3300005614 | Bacteria | 951 |
| 243 | Ga0070702_100640463 | 3300005615 | Bacteria | 802 |
| 244 | Ga0068852_100626597 | 3300005616 | Bacteria | 1081 |
| 245 | Ga0068852_101350716 | 3300005616 | Bacteria | 734 |
| 246 | Ga0068852_101864462 | 3300005616 | Bacteria | 623 |
| 247 | Ga0068859_100087579 | 3300005617 | Bacteria | 3162 |
| 248 | Ga0068859_101045611 | 3300005617 | Bacteria | 897 |
| 249 | Ga0068864_100514273 | 3300005618 | Bacteria | 1153 |
| 250 | Ga0068864_101231776 | 3300005618 | Bacteria | 747 |
| 251 | Ga0068866_10315407 | 3300005718 | Bacteria | 981 |
| 252 | Ga0068861_100287874 | 3300005719 | Bacteria | 1417 |
| 253 | Ga0068851_10105812 | 3300005834 | Bacteria | 1498 |
| 254 | Ga0068851_10382695 | 3300005834 | Bacteria | 825 |
| 255 | Ga0068858_100044764 | 3300005842 | Bacteria | 4102 |
| 256 | Ga0068858_100281378 | 3300005842 | Bacteria | 1584 |
| 257 | Ga0068858_100401297 | 3300005842 | Bacteria | 1317 |
| 258 | Ga0068858_100622112 | 3300005842 | Bacteria | 1048 |
| 259 | Ga0068858_100653539 | 3300005842 | Bacteria | 1022 |
| 260 | Ga0068860_100078148 | 3300005843 | Bacteria | 3147 |
| 261 | Ga0068860_100138904 | 3300005843 | Bacteria | 2334 |
| 262 | Ga0068860_100671828 | 3300005843 | Bacteria | 1044 |
| 263 | Ga0068862_100434499 | 3300005844 | Bacteria | 1234 |
| 264 | Ga0081455_10011724 | 3300005937 | Bacteria | 8787 |
| 265 | Ga0081540_1002663 | 3300005983 | Bacteria | 14523 |
| 266 | Ga0081540_1014636 | 3300005983 | Bacteria | 5014 |
| 267 | Ga0081540_1072665 | 3300005983 | Bacteria | 1584 |
| 268 | Ga0081540_1186647 | 3300005983 | Bacteria | 769 |
| 269 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 270 | Ga0081539_10004419 | 3300005985 | Bacteria | 15563 |
| 271 | Ga0081539_10038639 | 3300005985 | Bacteria | 2826 |
| 272 | Ga0070717_10023212 | 3300006028 | Bacteria | 4912 |
| 273 | Ga0070717_10257030 | 3300006028 | Bacteria | 1545 |
| 274 | Ga0070717_11382128 | 3300006028 | Bacteria | 640 |
| 275 | Ga0075365_10004647 | 3300006038 | Bacteria | 7309 |
| 276 | Ga0075365_10027241 | 3300006038 | Bacteria | 3634 |
| 277 | Ga0075365_10057229 | 3300006038 | Bacteria | 2593 |
| 278 | Ga0075365_10062221 | 3300006038 | Bacteria | 2496 |
| 279 | Ga0075365_10089365 | 3300006038 | Bacteria | 2097 |
| 280 | Ga0075365_10121312 | 3300006038 | Bacteria | 1803 |
| 281 | Ga0075365_10168486 | 3300006038 | Bacteria | 1528 |
| 282 | Ga0075365_10206089 | 3300006038 | Bacteria | 1378 |
| 283 | Ga0075365_10235649 | 3300006038 | Bacteria | 1285 |
| 284 | Ga0075365_10255350 | 3300006038 | Bacteria | 1232 |
| 285 | Ga0075365_10264031 | 3300006038 | Bacteria | 1210 |
| 286 | Ga0075365_10626635 | 3300006038 | Bacteria | 760 |
| 287 | Ga0075365_10747840 | 3300006038 | Bacteria | 690 |
| 288 | Ga0075368_10085252 | 3300006042 | Bacteria | 1288 |
| 289 | Ga0075368_10106170 | 3300006042 | Bacteria | 1155 |
| 290 | Ga0075368_10117777 | 3300006042 | Bacteria | 1098 |
| 291 | Ga0075368_10127719 | 3300006042 | Bacteria | 1055 |
| 292 | Ga0075368_10203279 | 3300006042 | Bacteria | 838 |
| 293 | Ga0075368_10240025 | 3300006042 | Bacteria | 773 |
| 294 | Ga0075368_10410777 | 3300006042 | Bacteria | 595 |
| 295 | Ga0075363_100073492 | 3300006048 | Bacteria | 1860 |
| 296 | Ga0075363_100099958 | 3300006048 | Bacteria | 1604 |
| 297 | Ga0075363_100141538 | 3300006048 | Bacteria | 1354 |
| 298 | Ga0075363_100351063 | 3300006048 | Bacteria | 861 |
| 299 | Ga0075363_100776260 | 3300006048 | Bacteria | 582 |
| 300 | Ga0075364_10010552 | 3300006051 | Bacteria | 5585 |
| 301 | Ga0075364_10036710 | 3300006051 | Bacteria | 3169 |
| 302 | Ga0075364_10042063 | 3300006051 | Bacteria | 2968 |
| 303 | Ga0075364_10119377 | 3300006051 | Bacteria | 1764 |
| 304 | Ga0075364_10254910 | 3300006051 | Bacteria | 1192 |
| 305 | Ga0075364_10316047 | 3300006051 | Bacteria | 1063 |
| 306 | Ga0075364_10426515 | 3300006051 | Bacteria | 905 |
| 307 | Ga0075364_10447344 | 3300006051 | Bacteria | 882 |
| 308 | Ga0075364_10641372 | 3300006051 | Bacteria | 725 |
| 309 | Ga0070715_10001968 | 3300006163 | Bacteria | 6192 |
| 310 | Ga0070715_10011442 | 3300006163 | Bacteria | 3196 |
| 311 | Ga0070715_10330699 | 3300006163 | Bacteria | 825 |
| 312 | Ga0070716_100272909 | 3300006173 | Bacteria | 1163 |
| 313 | Ga0070716_100470612 | 3300006173 | Bacteria | 920 |
| 314 | Ga0070716_100473025 | 3300006173 | Bacteria | 918 |
| 315 | Ga0070712_100025062 | 3300006175 | Bacteria | 3960 |
| 316 | Ga0070712_100056366 | 3300006175 | Bacteria | 2756 |
| 317 | Ga0070712_100060765 | 3300006175 | Bacteria | 2666 |
| 318 | Ga0075362_10079775 | 3300006177 | Bacteria | 1507 |
| 319 | Ga0075362_10110162 | 3300006177 | Bacteria | 1295 |
| 320 | Ga0075362_10153066 | 3300006177 | Bacteria | 1107 |
| 321 | Ga0075367_10033189 | 3300006178 | Bacteria | 2974 |
| 322 | Ga0075367_10037524 | 3300006178 | Bacteria | 2816 |
| 323 | Ga0075367_10054062 | 3300006178 | Bacteria | 2380 |
| 324 | Ga0075367_10065439 | 3300006178 | Bacteria | 2177 |
| 325 | Ga0075367_10308575 | 3300006178 | Bacteria | 996 |
| 326 | Ga0075367_10586198 | 3300006178 | Bacteria | 708 |
| 327 | Ga0075367_10691774 | 3300006178 | Bacteria | 648 |
| 328 | Ga0075369_10014487 | 3300006186 | Bacteria | 3150 |
| 329 | Ga0075369_10020381 | 3300006186 | Bacteria | 2715 |
| 330 | Ga0075369_10037612 | 3300006186 | Bacteria | 2062 |
| 331 | Ga0075369_10307634 | 3300006186 | Bacteria | 740 |
| 332 | Ga0075369_10375803 | 3300006186 | Bacteria | 668 |
| 333 | Ga0075366_10131212 | 3300006195 | Bacteria | 1512 |
| 334 | Ga0075366_10138136 | 3300006195 | Bacteria | 1472 |
| 335 | Ga0075366_10174089 | 3300006195 | Bacteria | 1306 |
| 336 | Ga0075366_10355545 | 3300006195 | Bacteria | 899 |
| 337 | Ga0075366_10807706 | 3300006195 | Bacteria | 583 |
| 338 | Ga0097621_100292431 | 3300006237 | Bacteria | 1436 |
| 339 | Ga0097621_100639187 | 3300006237 | Bacteria | 975 |
| 340 | Ga0097621_101368845 | 3300006237 | Bacteria | 669 |
| 341 | Ga0075370_10039567 | 3300006353 | Bacteria | 2657 |
| 342 | Ga0075370_10062119 | 3300006353 | Bacteria | 2128 |
| 343 | Ga0075370_10122384 | 3300006353 | Bacteria | 1515 |
| 344 | Ga0075370_10161654 | 3300006353 | Bacteria | 1314 |
| 345 | Ga0075370_10179770 | 3300006353 | Bacteria | 1245 |
| 346 | Ga0075370_10187626 | 3300006353 | Bacteria | 1218 |
| 347 | Ga0075370_10347804 | 3300006353 | Bacteria | 885 |
| 348 | Ga0075370_10367753 | 3300006353 | Bacteria | 860 |
| 349 | Ga0075370_10371994 | 3300006353 | Bacteria | 855 |
| 350 | Ga0075370_10705560 | 3300006353 | Bacteria | 613 |
| 351 | Ga0068871_100185062 | 3300006358 | Bacteria | 1791 |
| 352 | Ga0068871_100308486 | 3300006358 | Bacteria | 1391 |
| 353 | Ga0068871_100474415 | 3300006358 | Bacteria | 1124 |
| 354 | Ga0075428_101573100 | 3300006844 | Bacteria | 688 |
| 355 | Ga0075430_100224662 | 3300006846 | Bacteria | 1557 |
| 356 | Ga0068865_101156479 | 3300006881 | Bacteria | 683 |
| 357 | Ga0097620_100087577 | 3300006931 | Bacteria | 3162 |
| 358 | Ga0097620_101045554 | 3300006931 | Bacteria | 897 |
| 359 | Ga0099824_1018607 | 3300006942 | Bacteria | 5652 |
| 360 | Ga0099824_1032925 | 3300006942 | Bacteria | 1803 |
| 361 | Ga0099822_1005414 | 3300006943 | Bacteria | 16662 |
| 362 | Ga0079104_1000547 | 3300006946 | Bacteria | 39191 |
| 363 | Ga0079104_1065570 | 3300006946 | Bacteria | 772 |
| 364 | Ga0079104_1065575 | 3300006946 | Bacteria | 772 |
| 365 | Ga0075435_100092843 | 3300007076 | Bacteria | 2493 |
| 366 | Ga0075435_100655224 | 3300007076 | Bacteria | 911 |
| 367 | Ga0099794_10106923 | 3300007265 | Bacteria | 1399 |
| 368 | Ga0099794_10477110 | 3300007265 | Bacteria | 655 |
| 369 | Ga0099794_10550597 | 3300007265 | Bacteria | 609 |
| 370 | Ga0099794_10556276 | 3300007265 | Bacteria | 606 |
| 371 | Ga0099795_10055043 | 3300007788 | Bacteria | 1460 |
| 372 | Ga0099795_10060930 | 3300007788 | Bacteria | 1400 |
| 373 | Ga0105244_10078483 | 3300009036 | Bacteria | 1637 |
| 374 | Ga0105250_10074943 | 3300009092 | Bacteria | 1369 |
| 375 | Ga0105250_10164015 | 3300009092 | Bacteria | 928 |
| 376 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 377 | Ga0105240_10015249 | 3300009093 | Bacteria | 10455 |
| 378 | Ga0105240_10349884 | 3300009093 | Bacteria | 1677 |
| 379 | Ga0105240_10398679 | 3300009093 | Bacteria | 1550 |
| 380 | Ga0105240_10501863 | 3300009093 | Bacteria | 1349 |
| 381 | Ga0105240_10788852 | 3300009093 | Bacteria | 1030 |
| 382 | Ga0105240_11016121 | 3300009093 | Bacteria | 886 |
| 383 | Ga0105240_12181467 | 3300009093 | Bacteria | 574 |
| 384 | Ga0111539_11432011 | 3300009094 | Bacteria | 801 |
| 385 | Ga0105245_10811286 | 3300009098 | Bacteria | 974 |
| 386 | Ga0105247_10042031 | 3300009101 | Bacteria | 2797 |
| 387 | Ga0105247_10158943 | 3300009101 | Bacteria | 1495 |
| 388 | Ga0105247_10183825 | 3300009101 | Bacteria | 1396 |
| 389 | Ga0105247_10641537 | 3300009101 | Bacteria | 792 |
| 390 | Ga0105247_10651234 | 3300009101 | Bacteria | 787 |
| 391 | Ga0114129_10803025 | 3300009147 | Bacteria | 1200 |
| 392 | Ga0105243_10336891 | 3300009148 | Bacteria | 1380 |
| 393 | Ga0105243_10571340 | 3300009148 | Bacteria | 1084 |
| 394 | Ga0105241_10145737 | 3300009174 | Bacteria | 1932 |
| 395 | Ga0105241_10251998 | 3300009174 | Bacteria | 1497 |
| 396 | Ga0105241_10421547 | 3300009174 | Bacteria | 1175 |
| 397 | Ga0105241_10497460 | 3300009174 | Bacteria | 1086 |
| 398 | Ga0105241_10721348 | 3300009174 | Bacteria | 912 |
| 399 | Ga0105242_10350072 | 3300009176 | Bacteria | 1364 |
| 400 | Ga0105242_10376779 | 3300009176 | Bacteria | 1318 |
| 401 | Ga0105248_10284816 | 3300009177 | Bacteria | 1860 |
| 402 | Ga0105237_10001070 | 3300009545 | Bacteria | 36790 |
| 403 | Ga0105237_10054286 | 3300009545 | Bacteria | 4015 |
| 404 | Ga0105237_10219809 | 3300009545 | Bacteria | 1900 |
| 405 | Ga0105237_10745415 | 3300009545 | Bacteria | 986 |
| 406 | Ga0105237_10896931 | 3300009545 | Bacteria | 893 |
| 407 | Ga0105237_11112702 | 3300009545 | Bacteria | 797 |
| 408 | Ga0105237_11633537 | 3300009545 | Bacteria | 651 |
| 409 | Ga0105238_10012597 | 3300009551 | Bacteria | 8537 |
| 410 | Ga0105238_10026677 | 3300009551 | Bacteria | 5890 |
| 411 | Ga0105238_10144804 | 3300009551 | Bacteria | 2352 |
| 412 | Ga0105238_11115291 | 3300009551 | Bacteria | 812 |
| 413 | Ga0105238_11215300 | 3300009551 | Bacteria | 778 |
| 414 | Ga0105249_10147904 | 3300009553 | Bacteria | 2259 |
| 415 | Ga0105249_10154860 | 3300009553 | Bacteria | 2209 |
| 416 | Ga0105249_10357884 | 3300009553 | Bacteria | 1480 |
| 417 | Ga0105249_10359397 | 3300009553 | Bacteria | 1477 |
| 418 | Ga0105249_10406344 | 3300009553 | Bacteria | 1393 |
| 419 | Ga0105249_11188666 | 3300009553 | Bacteria | 833 |
| 420 | Ga0123340_1058714 | 3300009763 | Bacteria | 1164 |
| 421 | Ga0123341_1005490 | 3300009765 | Bacteria | 11313 |
| 422 | Ga0123341_1017290 | 3300009765 | Bacteria | 6322 |
| 423 | Ga0123342_1018253 | 3300009766 | Bacteria | 5633 |
| 424 | Ga0123342_1019698 | 3300009766 | Bacteria | 5085 |
| 425 | Ga0105239_10008784 | 3300010375 | Bacteria | 11435 |
| 426 | Ga0105239_10501837 | 3300010375 | Bacteria | 1379 |
| 427 | Ga0105239_10530800 | 3300010375 | Bacteria | 1339 |
| 428 | Ga0105239_10687690 | 3300010375 | Bacteria | 1169 |
| 429 | Ga0105239_10707819 | 3300010375 | Bacteria | 1152 |
| 430 | Ga0105239_11224442 | 3300010375 | Bacteria | 865 |
| 431 | Ga0105239_11811102 | 3300010375 | Bacteria | 707 |
| 432 | Ga0105246_10278490 | 3300011119 | Bacteria | 1341 |
| 433 | Ga0105246_10860944 | 3300011119 | Bacteria | 809 |
| 434 | Ga0157336_1011556 | 3300012477 | Bacteria | 688 |
| 435 | Ga0157337_1004344 | 3300012483 | Bacteria | 900 |
| 436 | Ga0157322_1011849 | 3300012490 | Bacteria | 725 |
| 437 | Ga0157335_1017071 | 3300012492 | Bacteria | 654 |
| 438 | Ga0157341_1003500 | 3300012494 | Bacteria | 1098 |
| 439 | Ga0157326_1004470 | 3300012513 | Bacteria | 1469 |
| 440 | Ga0157373_10011316 | 3300013100 | Bacteria | 6560 |
| 441 | Ga0157373_10235722 | 3300013100 | Bacteria | 1293 |
| 442 | Ga0157371_10221421 | 3300013102 | Bacteria | 1359 |
| 443 | Ga0157371_10269063 | 3300013102 | Bacteria | 1229 |
| 444 | Ga0157370_10235560 | 3300013104 | Bacteria | 1694 |
| 445 | Ga0157370_10280834 | 3300013104 | Bacteria | 1539 |
| 446 | Ga0157369_10030062 | 3300013105 | Bacteria | 5994 |
| 447 | Ga0157369_10066010 | 3300013105 | Bacteria | 3894 |
| 448 | Ga0157369_10592128 | 3300013105 | Bacteria | 1145 |
| 449 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 450 | Ga0157378_11749985 | 3300013297 | Bacteria | 669 |
| 451 | Ga0163162_10420389 | 3300013306 | Bacteria | 1469 |
| 452 | Ga0163162_10599872 | 3300013306 | Bacteria | 1227 |
| 453 | Ga0163162_10601306 | 3300013306 | Bacteria | 1226 |
| 454 | Ga0163162_11570527 | 3300013306 | Bacteria | 750 |
| 455 | Ga0157372_10252779 | 3300013307 | Bacteria | 2046 |
| 456 | Ga0157372_11662276 | 3300013307 | Bacteria | 735 |
| 457 | Ga0157375_10809287 | 3300013308 | Bacteria | 1085 |
| 458 | Ga0163163_10283279 | 3300014325 | Bacteria | 1709 |
| 459 | Ga0163163_11277198 | 3300014325 | Bacteria | 796 |
| 460 | Ga0163163_12127994 | 3300014325 | Bacteria | 621 |
| 461 | Ga0163163_12210041 | 3300014325 | Bacteria | 609 |
| 462 | Ga0157380_10906414 | 3300014326 | Bacteria | 908 |
| 463 | Ga0182008_10702647 | 3300014497 | Bacteria | 578 |
| 464 | Ga0157377_10577928 | 3300014745 | Bacteria | 798 |
| 465 | Ga0157379_10555742 | 3300014968 | Bacteria | 1068 |
| 466 | Ga0157379_10845111 | 3300014968 | Bacteria | 866 |
| 467 | Ga0157379_11039853 | 3300014968 | Bacteria | 782 |
| 468 | Ga0157379_11435066 | 3300014968 | Bacteria | 670 |
| 469 | Ga0157376_10329717 | 3300014969 | Bacteria | 1454 |
| 470 | Ga0157376_10360807 | 3300014969 | Bacteria | 1393 |
| 471 | Ga0182006_1076059 | 3300015261 | Bacteria | 1234 |
| 472 | Ga0182007_10070537 | 3300015262 | Bacteria | 1145 |
| 473 | Ga0182005_1065239 | 3300015265 | Bacteria | 996 |
| 474 | Ga0183363_1121 | 3300015690 | Bacteria | 20584 |
| 475 | Ga0163161_11005207 | 3300017792 | Bacteria | 712 |
| 476 | Ga0163161_11196992 | 3300017792 | Bacteria | 657 |
| 477 | Ga0214544_1002211 | 3300021320 | Bacteria | 40993 |
| 478 | Ga0214542_1002553 | 3300021321 | Bacteria | 37593 |
| 479 | Ga0214542_1023288 | 3300021321 | Bacteria | 3746 |
| 480 | Ga0214543_1000032 | 3300021327 | Bacteria | 200766 |
| 481 | Ga0214543_1005345 | 3300021327 | Bacteria | 23734 |
| 482 | Ga0213874_10007273 | 3300021377 | Bacteria | 2651 |
| 483 | Ga0213876_10076608 | 3300021384 | Bacteria | 1766 |
| 484 | Ga0213875_10069901 | 3300021388 | Bacteria | 1639 |
| 485 | Ga0213875_10173625 | 3300021388 | Bacteria | 1012 |
| 486 | Ga0213871_10039050 | 3300021441 | Bacteria | 1269 |
| 487 | Ga0228711_1000015 | 3300022739 | Bacteria | 126974 |
| 488 | Ga0228710_1000015 | 3300022740 | Bacteria | 133640 |
| 489 | Ga0209435_100024 | 3300025206 | Bacteria | 199665 |
| 490 | Ga0209436_100747 | 3300025208 | Bacteria | 13472 |
| 491 | Ga0209436_102829 | 3300025208 | Bacteria | 4929 |
| 492 | Ga0209436_113709 | 3300025208 | Bacteria | 1314 |
| 493 | Ga0209563_105579 | 3300025230 | Bacteria | 2258 |
| 494 | Ga0207427_104571 | 3300025231 | Bacteria | 2268 |
| 495 | Ga0209437_100969 | 3300025233 | Bacteria | 10256 |
| 496 | Ga0209437_100970 | 3300025233 | Bacteria | 10253 |
| 497 | Ga0207425_1000010 | 3300025245 | Bacteria | 572898 |
| 498 | Ga0207425_1010336 | 3300025245 | Bacteria | 2277 |
| 499 | Ga0207425_1027304 | 3300025245 | Bacteria | 1165 |
| 500 | Ga0207425_1028939 | 3300025245 | Bacteria | 1120 |
| 501 | Ga0207425_1059856 | 3300025245 | Bacteria | 674 |
| 502 | Ga0207425_1063179 | 3300025245 | Bacteria | 649 |
| 503 | Ga0209646_1000064 | 3300025246 | Bacteria | 246524 |
| 504 | Ga0209646_1008880 | 3300025246 | Bacteria | 1606 |
| 505 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 506 | Ga0209026_1000053 | 3300025250 | Bacteria | 246524 |
| 507 | Ga0209677_100816 | 3300025253 | Bacteria | 15575 |
| 508 | Ga0209677_102830 | 3300025253 | Bacteria | 6135 |
| 509 | Ga0209148_1000038 | 3300025254 | Bacteria | 493744 |
| 510 | Ga0209148_1018493 | 3300025254 | Bacteria | 1169 |
| 511 | Ga0209759_1000042 | 3300025256 | Bacteria | 246524 |
| 512 | Ga0209759_1000119 | 3300025256 | Bacteria | 141051 |
| 513 | Ga0209129_1003311 | 3300025258 | Bacteria | 7110 |
| 514 | Ga0209129_1003860 | 3300025258 | Bacteria | 6244 |
| 515 | Ga0209129_1004622 | 3300025258 | Bacteria | 5273 |
| 516 | Ga0209129_1009973 | 3300025258 | Bacteria | 2423 |
| 517 | Ga0209129_1013981 | 3300025258 | Bacteria | 1732 |
| 518 | Ga0209129_1021010 | 3300025258 | Bacteria | 1204 |
| 519 | Ga0209129_1035221 | 3300025258 | Bacteria | 815 |
| 520 | Ga0209233_1000188 | 3300025261 | Bacteria | 132904 |
| 521 | Ga0209233_1000925 | 3300025261 | Bacteria | 12809 |
| 522 | Ga0209233_1003053 | 3300025261 | Bacteria | 5953 |
| 523 | Ga0209233_1006179 | 3300025261 | Bacteria | 3881 |
| 524 | Ga0209233_1007083 | 3300025261 | Bacteria | 3577 |
| 525 | Ga0209233_1011270 | 3300025261 | Bacteria | 2639 |
| 526 | Ga0209233_1013455 | 3300025261 | Bacteria | 2336 |
| 527 | Ga0209233_1050210 | 3300025261 | Bacteria | 853 |
| 528 | Ga0209565_1019241 | 3300025263 | Bacteria | 1462 |
| 529 | Ga0209565_1021440 | 3300025263 | Bacteria | 1351 |
| 530 | Ga0207666_1004017 | 3300025271 | Bacteria | 1830 |
| 531 | Ga0209455_1000204 | 3300025272 | Bacteria | 85420 |
| 532 | Ga0209673_1000825 | 3300025273 | Bacteria | 40781 |
| 533 | Ga0209673_1000864 | 3300025273 | Bacteria | 39329 |
| 534 | Ga0209673_1001977 | 3300025273 | Bacteria | 15950 |
| 535 | Ga0209673_1012038 | 3300025273 | Bacteria | 3516 |
| 536 | Ga0209673_1014347 | 3300025273 | Bacteria | 3068 |
| 537 | Ga0209673_1029006 | 3300025273 | Bacteria | 1769 |
| 538 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 539 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 540 | Ga0209130_1001130 | 3300025284 | Bacteria | 19559 |
| 541 | Ga0209130_1021190 | 3300025284 | Bacteria | 1472 |
| 542 | Ga0209130_1022665 | 3300025284 | Bacteria | 1396 |
| 543 | Ga0207673_1001859 | 3300025290 | Bacteria | 2351 |
| 544 | Ga0209676_1001545 | 3300025292 | Bacteria | 20721 |
| 545 | Ga0209676_1002955 | 3300025292 | Bacteria | 11087 |
| 546 | Ga0209676_1029437 | 3300025292 | Bacteria | 1695 |
| 547 | Ga0209025_1000022 | 3300025294 | Bacteria | 574487 |
| 548 | Ga0209025_1000303 | 3300025294 | Bacteria | 110086 |
| 549 | Ga0209025_1018223 | 3300025294 | Bacteria | 3999 |
| 550 | Ga0209025_1035969 | 3300025294 | Bacteria | 2226 |
| 551 | Ga0209025_1076174 | 3300025294 | Bacteria | 1163 |
| 552 | Ga0209025_1108888 | 3300025294 | Bacteria | 856 |
| 553 | Ga0209025_1114335 | 3300025294 | Bacteria | 821 |
| 554 | Ga0209025_1158082 | 3300025294 | Bacteria | 615 |
| 555 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 556 | Ga0209564_1002708 | 3300025295 | Bacteria | 13379 |
| 557 | Ga0209564_1006724 | 3300025295 | Bacteria | 6113 |
| 558 | Ga0209564_1028708 | 3300025295 | Bacteria | 1769 |
| 559 | Ga0209564_1028709 | 3300025295 | Bacteria | 1769 |
| 560 | Ga0209564_1038119 | 3300025295 | Bacteria | 1342 |
| 561 | Ga0209564_1044462 | 3300025295 | Bacteria | 1152 |
| 562 | Ga0209564_1059134 | 3300025295 | Bacteria | 871 |
| 563 | Ga0209564_1060915 | 3300025295 | Bacteria | 844 |
| 564 | Ga0209758_1000584 | 3300025297 | Bacteria | 56878 |
| 565 | Ga0209758_1005081 | 3300025297 | Bacteria | 10418 |
| 566 | Ga0209758_1005457 | 3300025297 | Bacteria | 9780 |
| 567 | Ga0209758_1006057 | 3300025297 | Bacteria | 8913 |
| 568 | Ga0209758_1007716 | 3300025297 | Bacteria | 7224 |
| 569 | Ga0209758_1007810 | 3300025297 | Bacteria | 7143 |
| 570 | Ga0209758_1067228 | 3300025297 | Bacteria | 1147 |
| 571 | Ga0209758_1094800 | 3300025297 | Bacteria | 864 |
| 572 | Ga0209758_1101405 | 3300025297 | Bacteria | 818 |
| 573 | Ga0209758_1103555 | 3300025297 | Bacteria | 803 |
| 574 | Ga0209758_1111129 | 3300025297 | Bacteria | 758 |
| 575 | Ga0209050_1002103 | 3300025298 | Bacteria | 18193 |
| 576 | Ga0209050_1003219 | 3300025298 | Bacteria | 12352 |
| 577 | Ga0209256_1002683 | 3300025299 | Bacteria | 13954 |
| 578 | Ga0209256_1004555 | 3300025299 | Bacteria | 8604 |
| 579 | Ga0209256_1005314 | 3300025299 | Bacteria | 7491 |
| 580 | Ga0209256_1015662 | 3300025299 | Bacteria | 2637 |
| 581 | Ga0209256_1026985 | 3300025299 | Bacteria | 1644 |
| 582 | Ga0209256_1044054 | 3300025299 | Bacteria | 1116 |
| 583 | Ga0209256_1074909 | 3300025299 | Bacteria | 752 |
| 584 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 585 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 586 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 587 | Ga0207426_1000605 | 3300025302 | Bacteria | 46505 |
| 588 | Ga0207426_1003449 | 3300025302 | Bacteria | 8580 |
| 589 | Ga0207426_1004394 | 3300025302 | Bacteria | 6901 |
| 590 | Ga0207426_1033419 | 3300025302 | Bacteria | 1658 |
| 591 | Ga0207426_1102888 | 3300025302 | Bacteria | 734 |
| 592 | Ga0209051_1000914 | 3300025303 | Bacteria | 29357 |
| 593 | Ga0209051_1002149 | 3300025303 | Bacteria | 14647 |
| 594 | Ga0209051_1049570 | 3300025303 | Bacteria | 1413 |
| 595 | Ga0209051_1058167 | 3300025303 | Bacteria | 1234 |
| 596 | Ga0209051_1092745 | 3300025303 | Bacteria | 835 |
| 597 | Ga0209051_1100821 | 3300025303 | Bacteria | 777 |
| 598 | Ga0209051_1101244 | 3300025303 | Bacteria | 774 |
| 599 | Ga0209257_1000817 | 3300025304 | Bacteria | 45150 |
| 600 | Ga0209257_1002507 | 3300025304 | Bacteria | 18088 |
| 601 | Ga0209257_1014551 | 3300025304 | Bacteria | 3371 |
| 602 | Ga0209257_1081649 | 3300025304 | Bacteria | 828 |
| 603 | Ga0209257_1087031 | 3300025304 | Bacteria | 788 |
| 604 | Ga0207697_10183153 | 3300025315 | Bacteria | 918 |
| 605 | Ga0207656_10169352 | 3300025321 | Bacteria | 1043 |
| 606 | Ga0207696_1059111 | 3300025711 | Bacteria | 1081 |
| 607 | Ga0207696_1066851 | 3300025711 | Bacteria | 1004 |
| 608 | Ga0207653_10002069 | 3300025885 | Bacteria | 6392 |
| 609 | Ga0207682_10188622 | 3300025893 | Bacteria | 944 |
| 610 | Ga0207692_10143795 | 3300025898 | Bacteria | 1359 |
| 611 | Ga0207692_10182104 | 3300025898 | Bacteria | 1224 |
| 612 | Ga0207692_10251460 | 3300025898 | Bacteria | 1059 |
| 613 | Ga0207642_10153786 | 3300025899 | Bacteria | 1228 |
| 614 | Ga0207642_10154579 | 3300025899 | Bacteria | 1225 |
| 615 | Ga0207710_10066137 | 3300025900 | Bacteria | 1649 |
| 616 | Ga0207710_10118810 | 3300025900 | Bacteria | 1261 |
| 617 | Ga0207688_10036755 | 3300025901 | Bacteria | 2715 |
| 618 | Ga0207688_10170052 | 3300025901 | Bacteria | 1295 |
| 619 | Ga0207680_10151154 | 3300025903 | Bacteria | 1548 |
| 620 | Ga0207680_10268268 | 3300025903 | Bacteria | 1183 |
| 621 | Ga0207680_10269652 | 3300025903 | Bacteria | 1180 |
| 622 | Ga0207680_10678482 | 3300025903 | Bacteria | 738 |
| 623 | Ga0207647_10020923 | 3300025904 | Bacteria | 4377 |
| 624 | Ga0207647_10123459 | 3300025904 | Bacteria | 1526 |
| 625 | Ga0207647_10167943 | 3300025904 | Bacteria | 1278 |
| 626 | Ga0207685_10075648 | 3300025905 | Bacteria | 1378 |
| 627 | Ga0207699_10048434 | 3300025906 | Bacteria | 2497 |
| 628 | Ga0207699_10747762 | 3300025906 | Bacteria | 717 |
| 629 | Ga0207645_10216210 | 3300025907 | Bacteria | 1263 |
| 630 | Ga0207645_10345962 | 3300025907 | Bacteria | 994 |
| 631 | Ga0207643_10012061 | 3300025908 | Bacteria | 4668 |
| 632 | Ga0207705_10424032 | 3300025909 | Bacteria | 1030 |
| 633 | Ga0207705_10897083 | 3300025909 | Bacteria | 687 |
| 634 | Ga0207654_10111792 | 3300025911 | Bacteria | 1701 |
| 635 | Ga0207654_10162516 | 3300025911 | Bacteria | 1444 |
| 636 | Ga0207654_10243499 | 3300025911 | Bacteria | 1203 |
| 637 | Ga0207707_10091218 | 3300025912 | Bacteria | 2663 |
| 638 | Ga0207707_10110359 | 3300025912 | Bacteria | 2404 |
| 639 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 640 | Ga0207695_10000599 | 3300025913 | Bacteria | 72238 |
| 641 | Ga0207695_10185740 | 3300025913 | Bacteria | 1998 |
| 642 | Ga0207695_10347578 | 3300025913 | Bacteria | 1371 |
| 643 | Ga0207695_10602979 | 3300025913 | Bacteria | 979 |
| 644 | Ga0207695_10916655 | 3300025913 | Bacteria | 756 |
| 645 | Ga0207671_10001852 | 3300025914 | Bacteria | 23614 |
| 646 | Ga0207671_10041691 | 3300025914 | Bacteria | 3398 |
| 647 | Ga0207671_10074646 | 3300025914 | Bacteria | 2535 |
| 648 | Ga0207671_10137222 | 3300025914 | Bacteria | 1882 |
| 649 | Ga0207671_10169506 | 3300025914 | Bacteria | 1695 |
| 650 | Ga0207671_10262894 | 3300025914 | Bacteria | 1358 |
| 651 | Ga0207671_10307566 | 3300025914 | Bacteria | 1253 |
| 652 | Ga0207693_10001926 | 3300025915 | Bacteria | 18180 |
| 653 | Ga0207693_10022819 | 3300025915 | Bacteria | 4968 |
| 654 | Ga0207693_10896374 | 3300025915 | Bacteria | 681 |
| 655 | Ga0207663_10000218 | 3300025916 | Bacteria | 25518 |
| 656 | Ga0207663_10278254 | 3300025916 | Bacteria | 1242 |
| 657 | Ga0207663_10633030 | 3300025916 | Bacteria | 843 |
| 658 | Ga0207660_10125797 | 3300025917 | Bacteria | 1946 |
| 659 | Ga0207660_10196644 | 3300025917 | Bacteria | 1573 |
| 660 | Ga0207660_10719386 | 3300025917 | Bacteria | 814 |
| 661 | Ga0207660_10980937 | 3300025917 | Bacteria | 689 |
| 662 | Ga0207662_10029232 | 3300025918 | Bacteria | 3192 |
| 663 | Ga0207657_10011937 | 3300025919 | Bacteria | 8597 |
| 664 | Ga0207657_10042894 | 3300025919 | Bacteria | 3988 |
| 665 | Ga0207657_10184754 | 3300025919 | Bacteria | 1684 |
| 666 | Ga0207649_10278021 | 3300025920 | Bacteria | 1216 |
| 667 | Ga0207649_10295983 | 3300025920 | Bacteria | 1182 |
| 668 | Ga0207649_10745714 | 3300025920 | Bacteria | 762 |
| 669 | Ga0207652_10014975 | 3300025921 | Bacteria | 6291 |
| 670 | Ga0207652_10051466 | 3300025921 | Bacteria | 3531 |
| 671 | Ga0207652_10178552 | 3300025921 | Bacteria | 1907 |
| 672 | Ga0207652_10247386 | 3300025921 | Bacteria | 1608 |
| 673 | Ga0207646_10024544 | 3300025922 | Bacteria | 5523 |
| 674 | Ga0207681_10583279 | 3300025923 | Bacteria | 922 |
| 675 | Ga0207681_10624399 | 3300025923 | Bacteria | 892 |
| 676 | Ga0207694_10017395 | 3300025924 | Bacteria | 5436 |
| 677 | Ga0207694_10058951 | 3300025924 | Bacteria | 2986 |
| 678 | Ga0207694_10577698 | 3300025924 | Bacteria | 944 |
| 679 | Ga0207694_10581697 | 3300025924 | Bacteria | 941 |
| 680 | Ga0207694_10582934 | 3300025924 | Bacteria | 940 |
| 681 | Ga0207650_10002132 | 3300025925 | Bacteria | 13834 |
| 682 | Ga0207687_10174946 | 3300025927 | Bacteria | 1659 |
| 683 | Ga0207687_10312348 | 3300025927 | Bacteria | 1270 |
| 684 | Ga0207700_10028497 | 3300025928 | Bacteria | 3927 |
| 685 | Ga0207700_10162421 | 3300025928 | Bacteria | 1856 |
| 686 | Ga0207664_10008551 | 3300025929 | Bacteria | 7147 |
| 687 | Ga0207664_10019269 | 3300025929 | Bacteria | 5040 |
| 688 | Ga0207664_10842846 | 3300025929 | Bacteria | 824 |
| 689 | Ga0207644_10052527 | 3300025931 | Bacteria | 2929 |
| 690 | Ga0207644_10362620 | 3300025931 | Bacteria | 1179 |
| 691 | Ga0207644_10588068 | 3300025931 | Bacteria | 923 |
| 692 | Ga0207690_10180895 | 3300025932 | Bacteria | 1587 |
| 693 | Ga0207706_10017336 | 3300025933 | Bacteria | 6487 |
| 694 | Ga0207706_10024819 | 3300025933 | Bacteria | 5373 |
| 695 | Ga0207706_10177321 | 3300025933 | Bacteria | 1872 |
| 696 | Ga0207706_10691664 | 3300025933 | Bacteria | 872 |
| 697 | Ga0207686_10113572 | 3300025934 | Bacteria | 1831 |
| 698 | Ga0207709_10125723 | 3300025935 | Bacteria | 1739 |
| 699 | Ga0207709_10213516 | 3300025935 | Bacteria | 1387 |
| 700 | Ga0207709_10479660 | 3300025935 | Bacteria | 967 |
| 701 | Ga0207670_10765472 | 3300025936 | Bacteria | 803 |
| 702 | Ga0207670_10838880 | 3300025936 | Bacteria | 767 |
| 703 | Ga0207669_10129274 | 3300025937 | Bacteria | 1732 |
| 704 | Ga0207669_10148688 | 3300025937 | Bacteria | 1637 |
| 705 | Ga0207669_10977420 | 3300025937 | Bacteria | 710 |
| 706 | Ga0207665_10005572 | 3300025939 | Bacteria | 8396 |
| 707 | Ga0207665_10096951 | 3300025939 | Bacteria | 2052 |
| 708 | Ga0207665_10626583 | 3300025939 | Bacteria | 841 |
| 709 | Ga0207665_10896494 | 3300025939 | Bacteria | 703 |
| 710 | Ga0207665_10998136 | 3300025939 | Bacteria | 666 |
| 711 | Ga0207691_10213024 | 3300025940 | Bacteria | 1677 |
| 712 | Ga0207691_10676163 | 3300025940 | Bacteria | 871 |
| 713 | Ga0207691_10815269 | 3300025940 | Bacteria | 784 |
| 714 | Ga0207711_10724750 | 3300025941 | Bacteria | 927 |
| 715 | Ga0207661_10202043 | 3300025944 | Bacteria | 1747 |
| 716 | Ga0207667_10012912 | 3300025949 | Bacteria | 9594 |
| 717 | Ga0207667_10374831 | 3300025949 | Bacteria | 1450 |
| 718 | Ga0207667_10708426 | 3300025949 | Bacteria | 1009 |
| 719 | Ga0207667_11025820 | 3300025949 | Bacteria | 811 |
| 720 | Ga0207667_11056972 | 3300025949 | Bacteria | 797 |
| 721 | Ga0207712_10265973 | 3300025961 | Bacteria | 1393 |
| 722 | Ga0207712_10377846 | 3300025961 | Bacteria | 1185 |
| 723 | Ga0207712_10439966 | 3300025961 | Bacteria | 1104 |
| 724 | Ga0207712_10563146 | 3300025961 | Bacteria | 982 |
| 725 | Ga0207712_10836207 | 3300025961 | Bacteria | 811 |
| 726 | Ga0207712_11447523 | 3300025961 | Bacteria | 615 |
| 727 | Ga0207668_10034259 | 3300025972 | Bacteria | 3371 |
| 728 | Ga0207668_10115150 | 3300025972 | Bacteria | 2025 |
| 729 | Ga0207668_10335973 | 3300025972 | Bacteria | 1258 |
| 730 | Ga0207640_10082080 | 3300025981 | Bacteria | 2206 |
| 731 | Ga0207640_10095376 | 3300025981 | Bacteria | 2071 |
| 732 | Ga0207640_10290151 | 3300025981 | Bacteria | 1289 |
| 733 | Ga0207640_10576471 | 3300025981 | Bacteria | 949 |
| 734 | Ga0207658_10537705 | 3300025986 | Bacteria | 1044 |
| 735 | Ga0207677_11066392 | 3300026023 | Bacteria | 735 |
| 736 | Ga0207677_11403137 | 3300026023 | Bacteria | 643 |
| 737 | Ga0207703_10082720 | 3300026035 | Bacteria | 2680 |
| 738 | Ga0207703_10215009 | 3300026035 | Bacteria | 1716 |
| 739 | Ga0207703_10437335 | 3300026035 | Bacteria | 1220 |
| 740 | Ga0207703_10568359 | 3300026035 | Bacteria | 1070 |
| 741 | Ga0207703_10735320 | 3300026035 | Bacteria | 939 |
| 742 | Ga0207639_10032054 | 3300026041 | Bacteria | 3866 |
| 743 | Ga0207639_10060119 | 3300026041 | Bacteria | 2931 |
| 744 | Ga0207639_10226993 | 3300026041 | Bacteria | 1616 |
| 745 | Ga0207678_10014673 | 3300026067 | Bacteria | 6894 |
| 746 | Ga0207678_10105086 | 3300026067 | Bacteria | 2409 |
| 747 | Ga0207678_10116776 | 3300026067 | Bacteria | 2277 |
| 748 | Ga0207678_10931100 | 3300026067 | Bacteria | 769 |
| 749 | Ga0207708_10809324 | 3300026075 | Bacteria | 807 |
| 750 | Ga0207702_10417925 | 3300026078 | Bacteria | 1296 |
| 751 | Ga0207702_10498187 | 3300026078 | Bacteria | 1187 |
| 752 | Ga0207702_11162490 | 3300026078 | Bacteria | 766 |
| 753 | Ga0207641_10040588 | 3300026088 | Bacteria | 3898 |
| 754 | Ga0207641_10591440 | 3300026088 | Bacteria | 1085 |
| 755 | Ga0207641_10889212 | 3300026088 | Bacteria | 884 |
| 756 | Ga0207648_10011030 | 3300026089 | Bacteria | 8530 |
| 757 | Ga0207676_10568268 | 3300026095 | Bacteria | 1085 |
| 758 | Ga0207676_11301193 | 3300026095 | Bacteria | 722 |
| 759 | Ga0207674_10068821 | 3300026116 | Bacteria | 3562 |
| 760 | Ga0207674_10151658 | 3300026116 | Bacteria | 2275 |
| 761 | Ga0207674_10188280 | 3300026116 | Bacteria | 2014 |
| 762 | Ga0207675_100040050 | 3300026118 | Bacteria | 4372 |
| 763 | Ga0207675_100604527 | 3300026118 | Bacteria | 1100 |
| 764 | Ga0207683_10053025 | 3300026121 | Bacteria | 3555 |
| 765 | Ga0207698_10583192 | 3300026142 | Bacteria | 1100 |
| 766 | Ga0207698_11598754 | 3300026142 | Bacteria | 667 |
| 767 | Ga0209281_1000573 | 3300027111 | Bacteria | 43668 |
| 768 | Ga0209281_1001498 | 3300027111 | Bacteria | 13357 |
| 769 | Ga0209389_1002002 | 3300027296 | Bacteria | 15108 |
| 770 | Ga0209371_1002385 | 3300027312 | Bacteria | 10609 |
| 771 | Ga0209371_1058949 | 3300027312 | Bacteria | 710 |
| 772 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 773 | Ga0209589_1000300 | 3300027357 | Bacteria | 63625 |
| 774 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 775 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 776 | Ga0209179_1017049 | 3300027512 | Bacteria | 1371 |
| 777 | Ga0209179_1059062 | 3300027512 | Bacteria | 831 |
| 778 | Ga0209282_1000054 | 3300027666 | Bacteria | 101427 |
| 779 | Ga0209813_10036049 | 3300027866 | Bacteria | 1484 |
| 780 | Ga0209813_10049896 | 3300027866 | Bacteria | 1304 |
| 781 | Ga0209813_10153312 | 3300027866 | Bacteria | 827 |
| 782 | Ga0209813_10227598 | 3300027866 | Bacteria | 700 |
| 783 | Ga0209974_10092975 | 3300027876 | Bacteria | 1047 |
| 784 | Ga0209974_10123372 | 3300027876 | Bacteria | 919 |
| 785 | Ga0268266_10012436 | 3300028379 | Bacteria | 7358 |
| 786 | Ga0268266_10014157 | 3300028379 | Bacteria | 6863 |
| 787 | Ga0268266_10020829 | 3300028379 | Bacteria | 5592 |
| 788 | Ga0268266_10073688 | 3300028379 | Bacteria | 2963 |
| 789 | Ga0268266_10163131 | 3300028379 | Bacteria | 2017 |
| 790 | Ga0268266_10247200 | 3300028379 | Bacteria | 1649 |
| 791 | Ga0268266_10532816 | 3300028379 | Bacteria | 1124 |
| 792 | Ga0268266_10790242 | 3300028379 | Bacteria | 916 |
| 793 | Ga0268266_11139255 | 3300028379 | Bacteria | 754 |
| 794 | Ga0268266_11248062 | 3300028379 | Bacteria | 718 |
| 795 | Ga0268265_10198713 | 3300028380 | Bacteria | 1737 |
| 796 | Ga0268265_10366074 | 3300028380 | Bacteria | 1321 |
| 797 | Ga0268264_10000655 | 3300028381 | Bacteria | 40734 |
| 798 | Ga0268264_10447926 | 3300028381 | Bacteria | 1250 |
| 799 | Ga0265326_10001795 | 3300028558 | Bacteria | 7402 |
| 800 | Ga0265319_1001825 | 3300028563 | Bacteria | 12143 |
| 801 | Ga0265334_10000469 | 3300028573 | Bacteria | 20809 |
| 802 | Ga0265318_10007417 | 3300028577 | Bacteria | 4956 |
| 803 | Ga0265323_10001237 | 3300028653 | Bacteria | 12839 |
| 804 | Ga0265336_10000535 | 3300028666 | Bacteria | 21804 |
| 805 | Ga0307517_10000125 | 3300028786 | Bacteria | 115466 |
| 806 | Ga0307515_10001393 | 3300028794 | Bacteria | 54715 |
| 807 | Ga0307515_10040194 | 3300028794 | Bacteria | 7404 |
| 808 | Ga0307515_10065844 | 3300028794 | Bacteria | 5032 |
| 809 | Ga0307515_10100071 | 3300028794 | Bacteria | 3513 |
| 810 | Ga0307515_10182119 | 3300028794 | Bacteria | 2046 |
| 811 | Ga0307515_10398804 | 3300028794 | Bacteria | 1002 |
| 812 | Ga0265338_10000131 | 3300028800 | Bacteria | 137627 |
| 813 | Ga0265338_10168673 | 3300028800 | Bacteria | 1682 |
| 814 | Ga0311001_1103890 | 3300029277 | Bacteria | 1796 |
| 815 | Ga0310981_1004097 | 3300029285 | Bacteria | 1425 |
| 816 | Ga0265324_10001269 | 3300029957 | Bacteria | 14862 |
| 817 | Ga0268256_1002127 | 3300030500 | Bacteria | 10559 |
| 818 | Ga0268256_1072371 | 3300030500 | Bacteria | 661 |
| 819 | Ga0307511_10071057 | 3300030521 | Bacteria | 2542 |
| 820 | Ga0265330_10313325 | 3300031235 | Bacteria | 662 |
| 821 | Ga0265332_10026568 | 3300031238 | Bacteria | 2539 |
| 822 | Ga0265325_10057917 | 3300031241 | Bacteria | 1975 |
| 823 | Ga0265339_10030677 | 3300031249 | Bacteria | 3043 |
| 824 | Ga0265316_10148533 | 3300031344 | Bacteria | 1757 |
| 825 | Ga0265316_10187162 | 3300031344 | Bacteria | 1540 |
| 826 | Ga0307513_10005182 | 3300031456 | Bacteria | 17271 |
| 827 | Ga0307513_10143103 | 3300031456 | Bacteria | 2314 |
| 828 | Ga0307513_10304695 | 3300031456 | Bacteria | 1358 |
| 829 | Ga0307513_10327399 | 3300031456 | Bacteria | 1288 |
| 830 | Ga0307513_10580817 | 3300031456 | Bacteria | 831 |
| 831 | Ga0307513_10585943 | 3300031456 | Bacteria | 825 |
| 832 | Ga0307509_10041031 | 3300031507 | Bacteria | 5027 |
| 833 | Ga0307509_10353192 | 3300031507 | Bacteria | 1192 |
| 834 | Ga0307408_100012729 | 3300031548 | Bacteria | 5578 |
| 835 | Ga0307408_100016332 | 3300031548 | Bacteria | 4953 |
| 836 | Ga0307408_100027626 | 3300031548 | Bacteria | 3913 |
| 837 | Ga0307408_100038322 | 3300031548 | Bacteria | 3381 |
| 838 | Ga0307408_100776864 | 3300031548 | Bacteria | 867 |
| 839 | Ga0265313_10003614 | 3300031595 | Bacteria | 12415 |
| 840 | Ga0307508_10000378 | 3300031616 | Bacteria | 53801 |
| 841 | Ga0307508_10044639 | 3300031616 | Bacteria | 3962 |
| 842 | Ga0307508_10096553 | 3300031616 | Bacteria | 2547 |
| 843 | Ga0307508_10117010 | 3300031616 | Bacteria | 2267 |
| 844 | Ga0307508_10189157 | 3300031616 | Bacteria | 1660 |
| 845 | Ga0307508_10326929 | 3300031616 | Bacteria | 1125 |
| 846 | Ga0316575_10144645 | 3300031665 | Bacteria | 979 |
| 847 | Ga0265314_10017878 | 3300031711 | Bacteria | 5552 |
| 848 | Ga0265342_10020769 | 3300031712 | Bacteria | 4203 |
| 849 | Ga0307516_10114735 | 3300031730 | Bacteria | 2491 |
| 850 | Ga0307516_10174401 | 3300031730 | Bacteria | 1888 |
| 851 | Ga0307516_10207509 | 3300031730 | Bacteria | 1675 |
| 852 | Ga0307405_10050000 | 3300031731 | Bacteria | 2586 |
| 853 | Ga0307405_10083046 | 3300031731 | Bacteria | 2099 |
| 854 | Ga0307405_10113053 | 3300031731 | Bacteria | 1843 |
| 855 | Ga0307405_10192671 | 3300031731 | Bacteria | 1474 |
| 856 | Ga0307405_10199654 | 3300031731 | Bacteria | 1451 |
| 857 | Ga0307405_10381714 | 3300031731 | Bacteria | 1097 |
| 858 | Ga0307413_10126131 | 3300031824 | Bacteria | 1743 |
| 859 | Ga0307413_10253244 | 3300031824 | Bacteria | 1307 |
| 860 | Ga0307410_10007156 | 3300031852 | Bacteria | 6085 |
| 861 | Ga0307410_10201000 | 3300031852 | Bacteria | 1521 |
| 862 | Ga0307410_10316483 | 3300031852 | Bacteria | 1237 |
| 863 | Ga0307410_10508370 | 3300031852 | Bacteria | 992 |
| 864 | Ga0307406_10036624 | 3300031901 | Bacteria | 3024 |
| 865 | Ga0307406_10251323 | 3300031901 | Bacteria | 1332 |
| 866 | Ga0307406_10419198 | 3300031901 | Bacteria | 1066 |
| 867 | Ga0307406_10447080 | 3300031901 | Bacteria | 1036 |
| 868 | Ga0307407_10011518 | 3300031903 | Bacteria | 4213 |
| 869 | Ga0307407_10662297 | 3300031903 | Bacteria | 783 |
| 870 | Ga0307412_10041042 | 3300031911 | Bacteria | 2996 |
| 871 | Ga0307412_10076697 | 3300031911 | Bacteria | 2297 |
| 872 | Ga0307412_10118477 | 3300031911 | Bacteria | 1902 |
| 873 | Ga0307412_10137880 | 3300031911 | Bacteria | 1782 |
| 874 | Ga0307412_10163888 | 3300031911 | Bacteria | 1655 |
| 875 | Ga0307412_10241880 | 3300031911 | Bacteria | 1396 |
| 876 | Ga0315914_1000013 | 3300031967 | Bacteria | 133640 |
| 877 | Ga0307409_100004876 | 3300031995 | Bacteria | 7628 |
| 878 | Ga0307409_100045054 | 3300031995 | Bacteria | 3327 |
| 879 | Ga0307409_101062512 | 3300031995 | Bacteria | 830 |
| 880 | Ga0307409_101947674 | 3300031995 | Bacteria | 617 |
| 881 | Ga0307416_100010349 | 3300032002 | Bacteria | 6157 |
| 882 | Ga0307416_100047875 | 3300032002 | Bacteria | 3388 |
| 883 | Ga0307416_100221340 | 3300032002 | Bacteria | 1815 |
| 884 | Ga0307416_100334228 | 3300032002 | Bacteria | 1524 |
| 885 | Ga0307416_100433393 | 3300032002 | Bacteria | 1362 |
| 886 | Ga0307416_100456649 | 3300032002 | Bacteria | 1331 |
| 887 | Ga0307416_100729760 | 3300032002 | Bacteria | 1082 |
| 888 | Ga0307416_100909837 | 3300032002 | Bacteria | 980 |
| 889 | Ga0307416_101763188 | 3300032002 | Bacteria | 723 |
| 890 | Ga0307414_10022676 | 3300032004 | Bacteria | 3966 |
| 891 | Ga0307414_10023691 | 3300032004 | Bacteria | 3898 |
| 892 | Ga0307414_10367138 | 3300032004 | Bacteria | 1240 |
| 893 | Ga0307414_11500318 | 3300032004 | Bacteria | 627 |
| 894 | Ga0307415_100010922 | 3300032126 | Bacteria | 5167 |
| 895 | Ga0307415_100102687 | 3300032126 | Bacteria | 2101 |
| 896 | Ga0307415_100194833 | 3300032126 | Bacteria | 1602 |
| 897 | Ga0307415_100212815 | 3300032126 | Bacteria | 1543 |
| 898 | Ga0307415_100442306 | 3300032126 | Bacteria | 1121 |
| 899 | Ga0307415_100475817 | 3300032126 | Bacteria | 1086 |
| 900 | Ga0316593_10011301 | 3300032168 | Bacteria | 2590 |
| 901 | Ga0316593_10155232 | 3300032168 | Bacteria | 834 |
| 902 | Ga0307507_10023232 | 3300033179 | Bacteria | 6813 |
| 903 | Ga0307507_10309089 | 3300033179 | Bacteria | 962 |
| 904 | Ga0307510_10019223 | 3300033180 | Bacteria | 8016 |
| 905 | Ga0307510_10075120 | 3300033180 | Bacteria | 3334 |
| 906 | Ga0307510_10227413 | 3300033180 | Bacteria | 1371 |
| 907 | Ga0315913_1000097 | 3300033430 | Bacteria | 51051 |
| 908 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 909 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 910 | Ga0316586_1022492 | 3300033527 | Bacteria | 1048 |
| 911 | Ga0316215_1006608 | 3300033544 | Bacteria | 1125 |
| 912 | Ga0316215_1007336 | 3300033544 | Bacteria | 1074 |
| 913 | Ga0316214_1003835 | 3300033545 | Bacteria | 1910 |
| 914 | Ga0373930_0060467 | 3300034816 | Bacteria | 844 |
| 915 | Ga0373926_0068693 | 3300035083 | Bacteria | 1299 |
| 916 | Ga0373926_0183521 | 3300035083 | Bacteria | 802 |
| 917 | Ga0373934_0038719 | 3300035086 | Bacteria | 1878 |
| 918 | Ga0373940_0085362 | 3300035088 | Bacteria | 939 |
| 919 | Ga0373944_0024464 | 3300035089 | Bacteria | 1771 |
| 920 | Ga0373949_0023572 | 3300035090 | Bacteria | 1426 |
| 921 | Ga0373952_0007333 | 3300035092 | Bacteria | 2065 |
| 922 | Ga0373923_0070704 | 3300035111 | Bacteria | 1498 |
| 923 | Ga0373936_0022605 | 3300035113 | Bacteria | 2448 |
| 924 | Ga0373936_0113018 | 3300035113 | Bacteria | 1154 |
| 925 | Ga0373936_0130018 | 3300035113 | Bacteria | 1081 |
| 926 | Ga0373945_0009397 | 3300035116 | Bacteria | 3203 |
| 927 | Ga0373953_0089085 | 3300035117 | Bacteria | 1289 |
| 928 | Ga0373954_0000100 | 3300035118 | Bacteria | 28999 |
| 929 | Ga0373954_0012064 | 3300035118 | Bacteria | 3839 |
| 930 | Ga0373954_0180527 | 3300035118 | Bacteria | 1035 |
| 931 | Ga0373956_0015818 | 3300035119 | Bacteria | 3163 |
| 932 | Ga0373956_0061795 | 3300035119 | Bacteria | 1697 |
| 933 | Ga0373943_0003463 | 3300035170 | Bacteria | 7175 |
| 934 | Ga0373943_0013859 | 3300035170 | Bacteria | 3645 |
| 935 | Ga0373943_0125965 | 3300035170 | Bacteria | 1366 |
| 936 | Ga0373946_0005668 | 3300035171 | Bacteria | 4513 |
| 937 | Ga0373946_0029093 | 3300035171 | Bacteria | 2197 |
| 938 | Ga0373955_0003141 | 3300035172 | Bacteria | 7226 |
| 939 | Ga0373955_0154665 | 3300035172 | Bacteria | 1351 |
| 940 | Ga0373955_0368936 | 3300035172 | Bacteria | 870 |
| 941 | Ga0373961_0124000 | 3300035241 | Bacteria | 859 |
| 942 | Ga0373962_0119763 | 3300035242 | Bacteria | 838 |
| 943 | Ga0316574_0310493 | 3300035398 | Bacteria | 1002 |
| 944 | Ga0373924_0002732 | 3300035410 | Bacteria | 5961 |
| 945 | Ga0373924_0070831 | 3300035410 | Bacteria | 1470 |
| 946 | Ga0373931_0051137 | 3300035691 | Bacteria | 2200 |
| 947 | Ga0373935_0006317 | 3300035692 | Bacteria | 7061 |
| 948 | Ga0373935_0010090 | 3300035692 | Bacteria | 5657 |
| 949 | Ga0373935_0047345 | 3300035692 | Bacteria | 2718 |
| 950 | Ga0373935_0069246 | 3300035692 | Bacteria | 2272 |
| 951 | Ga0373935_0080178 | 3300035692 | Bacteria | 2120 |
| 952 | Ga0373935_0101688 | 3300035692 | Bacteria | 1896 |
| 953 | Ga0373935_1310739 | 3300035692 | Bacteria | 541 |
| 954 | Ga0373927_0019967 | 3300035695 | Bacteria | 4394 |
| 955 | Ga0373927_0025263 | 3300035695 | Bacteria | 3882 |
| 956 | Ga0373927_0025754 | 3300035695 | Bacteria | 3845 |
| 957 | Ga0373927_0050046 | 3300035695 | Bacteria | 2701 |
| 958 | Ga0373927_0210714 | 3300035695 | Bacteria | 1276 |
| 959 | Ga0373933_0032326 | 3300035724 | Bacteria | 3041 |
| 960 | Ga0373933_0153266 | 3300035724 | Bacteria | 1460 |
| 961 | Ga0373933_0158464 | 3300035724 | Bacteria | 1436 |
| 962 | Ga0373947_0005298 | 3300035725 | Bacteria | 7541 |
| 963 | Ga0373947_0015233 | 3300035725 | Bacteria | 4414 |
| 964 | Ga0310104_00079 | 3300036242 | Bacteria | 4049 |
| 965 | Ga0373937_0372659 | 3300036401 | Bacteria | 1353 |
| 966 | Ga0373937_0870788 | 3300036401 | Bacteria | 849 |
| 967 | Ga0310112_018869 | 3300036458 | Bacteria | 972 |
| 968 | Ga0373925_0005636 | 3300037068 | Bacteria | 9315 |
| 969 | Ga0373925_0008352 | 3300037068 | Bacteria | 7539 |
| 970 | Ga0373925_0045136 | 3300037068 | Bacteria | 3273 |
| 971 | Ga0373925_0298656 | 3300037068 | Bacteria | 1300 |
| 972 | Ga0373925_0385728 | 3300037068 | Bacteria | 1141 |
| 973 | Ga0373925_0464376 | 3300037068 | Bacteria | 1037 |
| 974 | Ga0373925_0600591 | 3300037068 | Bacteria | 906 |
| 975 | Ga0395899_0181581 | 3300037312 | Bacteria | 1477 |
| 976 | Ga0395899_0215112 | 3300037312 | Bacteria | 1334 |
| 977 | Ga0395900_0012290 | 3300037418 | Bacteria | 8757 |
| 978 | Ga0395900_0031276 | 3300037418 | Bacteria | 5467 |
| 979 | Ga0395900_0050005 | 3300037418 | Bacteria | 4306 |
| 980 | Ga0395900_0128904 | 3300037418 | Bacteria | 2593 |
| 981 | Ga0395900_0298104 | 3300037418 | Bacteria | 1599 |
| 982 | Ga0395900_0880864 | 3300037418 | Bacteria | 819 |
| 983 | Ga0395898_0029950 | 3300037466 | Bacteria | 5449 |
| 984 | Ga0395898_0104107 | 3300037466 | Bacteria | 2722 |
| 985 | Ga0395898_0639357 | 3300037466 | Bacteria | 1006 |
| 986 | Ga0395905_0012867 | 3300037471 | Bacteria | 8042 |
| 987 | Ga0395905_0032064 | 3300037471 | Bacteria | 4942 |
| 988 | Ga0395905_0033796 | 3300037471 | Bacteria | 4803 |
| 989 | Ga0395905_0122200 | 3300037471 | Bacteria | 2448 |
| 990 | Ga0395905_0145663 | 3300037471 | Bacteria | 2228 |
| 991 | Ga0395905_0167375 | 3300037471 | Bacteria | 2065 |
| 992 | Ga0395905_0212637 | 3300037471 | Bacteria | 1811 |
| 993 | Ga0395905_0329762 | 3300037471 | Bacteria | 1416 |
| 994 | Ga0395905_0546988 | 3300037471 | Bacteria | 1059 |
| 995 | Ga0436364_0877349 | 3300037853 | Bacteria | 964 |
| 996 | Ga0436364_1550501 | 3300037853 | Bacteria | 2024 |
| 997 | Ga0395901_0052439 | 3300038443 | Bacteria | 4239 |
| 998 | Ga0395901_0091387 | 3300038443 | Bacteria | 3186 |
| 999 | Ga0395901_0179544 | 3300038443 | Bacteria | 2220 |
| 1000 | Ga0395901_0262534 | 3300038443 | Bacteria | 1797 |
| 1001 | Ga0395901_0391260 | 3300038443 | Bacteria | 1429 |
| 1002 | Ga0395901_0403424 | 3300038443 | Bacteria | 1404 |
| 1003 | Ga0436365_0334854 | 3300039437 | Bacteria | 1102 |
| 1004 | Ga0436360_0077529 | 3300039438 | Bacteria | 699 |
| 1005 | Ga0436363_1140251 | 3300039450 | Bacteria | 1259 |
| 1006 | Ga0436363_1416214 | 3300039450 | Bacteria | 3509 |
| 1007 | Ga0439436_0020046 | 3300041404 | Bacteria | 1992 |
| 1008 | Ga0439436_0143939 | 3300041404 | Bacteria | 671 |
| 1009 | Ga0439439_0012516 | 3300041406 | Bacteria | 2052 |
| 1010 | Ga0439447_049450 | 3300041407 | Bacteria | 1007 |
| 1011 | Ga0439465_0015249 | 3300041413 | Bacteria | 2397 |
| 1012 | Ga0439465_0199717 | 3300041413 | Bacteria | 728 |
| 1013 | Ga0439465_0228722 | 3300041413 | Bacteria | 683 |
| 1014 | Ga0439465_0255743 | 3300041413 | Bacteria | 648 |
| 1015 | Ga0451790_40977 | 3300041444 | Bacteria | 707 |
| 1016 | Ga0451790_43748 | 3300041444 | Bacteria | 639 |
| 1017 | Ga0451794_06620 | 3300041446 | Bacteria | 656 |
| 1018 | Ga0451794_19747 | 3300041446 | Bacteria | 972 |
| 1019 | Ga0451794_30427 | 3300041446 | Bacteria | 1200 |
| 1020 | Ga0451791_0540605 | 3300041451 | Bacteria | 1020 |
| 1021 | Ga0451793_0500431 | 3300041452 | Bacteria | 846 |
| 1022 | Ga0451793_1332179 | 3300041452 | Bacteria | 1491 |
| 1023 | Ga0451797_0261817 | 3300041453 | Bacteria | 1412 |
| 1024 | Ga0451800_1614829 | 3300041459 | Bacteria | 1534 |
| 1025 | Ga0451802_0387222 | 3300041460 | Bacteria | 1179 |
| 1026 | Ga0451805_093557 | 3300041461 | Bacteria | 686 |
| 1027 | Ga0451805_105019 | 3300041461 | Bacteria | 1527 |
| 1028 | Ga0451804_0446889 | 3300041463 | Bacteria | 1590 |
| 1029 | Ga0451807_1614199 | 3300041486 | Bacteria | 648 |
| 1030 | Ga0451833_0705110 | 3300041491 | Bacteria | 3395 |
| 1031 | Ga0451837_1342466 | 3300041494 | Bacteria | 970 |
| 1032 | Ga0451839_0023059 | 3300041496 | Bacteria | 2901 |
| 1033 | Ga0451840_02584 | 3300041497 | Bacteria | 1864 |
| 1034 | Ga0451841_0087010 | 3300041498 | Bacteria | 4773 |
| 1035 | Ga0451841_0468289 | 3300041498 | Bacteria | 1809 |
| 1036 | Ga0451844_06822 | 3300041500 | Bacteria | 890 |
| 1037 | Ga0451845_0062342 | 3300041501 | Bacteria | 6073 |
| 1038 | Ga0451845_0910627 | 3300041501 | Bacteria | 729 |
| 1039 | Ga0451846_01205 | 3300041502 | Bacteria | 8545 |
| 1040 | Ga0451847_0040601 | 3300041503 | Bacteria | 5858 |
| 1041 | Ga0451847_0230433 | 3300041503 | Bacteria | 681 |
| 1042 | Ga0451848_20644 | 3300041504 | Bacteria | 1845 |
| 1043 | Ga0451849_0364808 | 3300041505 | Bacteria | 1946 |
| 1044 | Ga0451851_0450253 | 3300041507 | Bacteria | 964 |
| 1045 | Ga0451843_0956766 | 3300041509 | Bacteria | 1885 |
| 1046 | Ga0451854_09647 | 3300041510 | Bacteria | 5803 |
| 1047 | Ga0451853_2317430 | 3300041512 | Bacteria | 8180 |
| 1048 | Ga0452268_20544 | 3300041907 | Bacteria | 1265 |
| 1049 | Ga0452268_47665 | 3300041907 | Bacteria | 809 |
| 1050 | Ga0452270_1255 | 3300041909 | Bacteria | 975 |
| 1051 | Ga0439433_0013404 | 3300041999 | Bacteria | 1800 |
| 1052 | Ga0439442_038874 | 3300042002 | Bacteria | 997 |
| 1053 | Ga0439445_0195117 | 3300042004 | Bacteria | 597 |
| 1054 | Ga0439449_0006732 | 3300042007 | Bacteria | 4386 |
| 1055 | Ga0439449_0054575 | 3300042007 | Bacteria | 1476 |
| 1056 | Ga0439449_0101230 | 3300042007 | Bacteria | 1065 |
| 1057 | Ga0439452_028778 | 3300042010 | Bacteria | 1383 |
| 1058 | Ga0439454_004038 | 3300042011 | Bacteria | 1668 |
| 1059 | Ga0439457_036043 | 3300042014 | Bacteria | 1100 |
| 1060 | Ga0439462_0114593 | 3300042015 | Bacteria | 747 |
| 1061 | Ga0450920_009054 | 3300042122 | Bacteria | 1831 |
| 1062 | Ga0450923_033863 | 3300042125 | Bacteria | 1052 |
| 1063 | Ga0450906_006379 | 3300042145 | Bacteria | 2383 |
| 1064 | Ga0450906_034473 | 3300042145 | Bacteria | 894 |
| 1065 | Ga0450910_024747 | 3300042147 | Bacteria | 922 |
| 1066 | Ga0439446_0139922 | 3300042156 | Bacteria | 790 |
| 1067 | Ga0439458_0024387 | 3300042157 | Bacteria | 1414 |
| 1068 | Ga0439458_0114002 | 3300042157 | Bacteria | 708 |
| 1069 | Ga0450909_014549 | 3300042185 | Bacteria | 1158 |
| 1070 | Ga0439459_0065768 | 3300042438 | Bacteria | 829 |
| 1071 | Ga0439459_0149042 | 3300042438 | Bacteria | 610 |
| 1072 | Ga0450918_002411 | 3300042531 | Bacteria | 3533 |
| 1073 | Ga0466972_0009543 | 3300044658 | Bacteria | 4874 |
| 1074 | Ga0466972_0010313 | 3300044658 | Bacteria | 4691 |
| 1075 | Ga0466965_0043824 | 3300044683 | Bacteria | 2210 |
| 1076 | Ga0466966_0328826 | 3300044684 | Bacteria | 918 |
| 1077 | Ga0466963_0571417 | 3300044694 | Bacteria | 798 |
| 1078 | Ga0466971_0267720 | 3300044719 | Bacteria | 816 |
| 1079 | Ga0466968_0039813 | 3300044735 | Bacteria | 1979 |
| 1080 | Ga0466968_0500013 | 3300044735 | Bacteria | 606 |
| 1081 | Ga0466970_0120853 | 3300044765 | Bacteria | 1434 |
| 1082 | Ga0466970_0280446 | 3300044765 | Bacteria | 937 |
| 1083 | Ga0466970_0398052 | 3300044765 | Bacteria | 785 |
| 1084 | Ga0466957_0183247 | 3300044842 | Bacteria | 1368 |
| 1085 | Ga0466960_0306295 | 3300044901 | Bacteria | 896 |
| 1086 | Ga0466960_0333658 | 3300044901 | Bacteria | 861 |
| 1087 | Ga0451576_0268673 | 3300045051 | Bacteria | 1783 |
| 1088 | Ga0466967_0116210 | 3300045976 | Bacteria | 2465 |
| 1089 | Ga0466967_0504747 | 3300045976 | Bacteria | 1187 |
| 1090 | Ga0495617_051710 | 3300046452 | Bacteria | 1365 |
| 1091 | Ga0495617_120064 | 3300046452 | Bacteria | 847 |
| 1092 | Ga0495617_191278 | 3300046452 | Bacteria | 642 |
| 1093 | Ga0495627_027112 | 3300046453 | Bacteria | 1841 |
| 1094 | Ga0495627_091553 | 3300046453 | Bacteria | 874 |
| 1095 | Ga0495627_127225 | 3300046453 | Bacteria | 718 |
| 1096 | Ga0495592_0052463 | 3300046454 | Bacteria | 3028 |
| 1097 | Ga0495592_0066229 | 3300046454 | Bacteria | 2643 |
| 1098 | Ga0495592_0076879 | 3300046454 | Bacteria | 2421 |
| 1099 | Ga0495592_0653508 | 3300046454 | Bacteria | 636 |
| 1100 | Ga0495603_0007442 | 3300046455 | Bacteria | 6584 |
| 1101 | Ga0495603_0055263 | 3300046455 | Bacteria | 2352 |
| 1102 | Ga0495603_0125496 | 3300046455 | Bacteria | 1496 |
| 1103 | Ga0495603_0294904 | 3300046455 | Bacteria | 931 |
| 1104 | Ga0495590_0019220 | 3300046457 | Bacteria | 2436 |
| 1105 | Ga0495590_0095975 | 3300046457 | Bacteria | 1051 |
| 1106 | Ga0495590_0110661 | 3300046457 | Bacteria | 980 |
| 1107 | Ga0495590_0167563 | 3300046457 | Bacteria | 800 |
| 1108 | Ga0495591_015562 | 3300046458 | Bacteria | 2681 |
| 1109 | Ga0495629_0007179 | 3300046459 | Bacteria | 8209 |
| 1110 | Ga0495629_0016778 | 3300046459 | Bacteria | 5255 |
| 1111 | Ga0495629_0020113 | 3300046459 | Bacteria | 4766 |
| 1112 | Ga0495629_0083222 | 3300046459 | Bacteria | 2233 |
| 1113 | Ga0495629_0099061 | 3300046459 | Bacteria | 2034 |
| 1114 | Ga0495638_0021308 | 3300046460 | Bacteria | 4273 |
| 1115 | Ga0495638_0077879 | 3300046460 | Bacteria | 2017 |
| 1116 | Ga0495638_0118477 | 3300046460 | Bacteria | 1566 |
| 1117 | Ga0495638_0139171 | 3300046460 | Bacteria | 1418 |
| 1118 | Ga0495638_0360000 | 3300046460 | Bacteria | 765 |
| 1119 | Ga0495641_0012494 | 3300046461 | Bacteria | 4745 |
| 1120 | Ga0495641_0111870 | 3300046461 | Bacteria | 1218 |
| 1121 | Ga0495651_0000990 | 3300046462 | Bacteria | 22041 |
| 1122 | Ga0495651_0013306 | 3300046462 | Bacteria | 6364 |
| 1123 | Ga0495651_0418928 | 3300046462 | Bacteria | 871 |
| 1124 | Ga0495653_0000149 | 3300046463 | Bacteria | 58288 |
| 1125 | Ga0495653_0104959 | 3300046463 | Bacteria | 2041 |
| 1126 | Ga0495653_0349662 | 3300046463 | Bacteria | 951 |
| 1127 | Ga0495650_0143717 | 3300046471 | Bacteria | 861 |
| 1128 | Ga0495650_0143952 | 3300046471 | Bacteria | 860 |
| 1129 | Ga0495580_0022295 | 3300046472 | Bacteria | 4661 |
| 1130 | Ga0495580_0243520 | 3300046472 | Bacteria | 1232 |
| 1131 | Ga0495582_0000163 | 3300046473 | Bacteria | 35979 |
| 1132 | Ga0495582_0015152 | 3300046473 | Bacteria | 4241 |
| 1133 | Ga0495582_0116912 | 3300046473 | Bacteria | 1500 |
| 1134 | Ga0495605_0027351 | 3300046474 | Bacteria | 2956 |
| 1135 | Ga0495605_0064266 | 3300046474 | Bacteria | 1748 |
| 1136 | Ga0495605_0201719 | 3300046474 | Bacteria | 866 |
| 1137 | Ga0495605_0233506 | 3300046474 | Bacteria | 791 |
| 1138 | Ga0495605_0234254 | 3300046474 | Bacteria | 790 |
| 1139 | Ga0495639_0000873 | 3300046475 | Bacteria | 13634 |
| 1140 | Ga0495639_0036968 | 3300046475 | Bacteria | 2188 |
| 1141 | Ga0495639_0134033 | 3300046475 | Bacteria | 1187 |
| 1142 | Ga0495662_0000285 | 3300046476 | Bacteria | 21823 |
| 1143 | Ga0495662_0156979 | 3300046476 | Bacteria | 1120 |
| 1144 | Ga0495664_0005138 | 3300046477 | Bacteria | 7181 |
| 1145 | Ga0495664_0034135 | 3300046477 | Bacteria | 2992 |
| 1146 | Ga0495585_0101819 | 3300046492 | Bacteria | 1535 |
| 1147 | Ga0495585_0105082 | 3300046492 | Bacteria | 1506 |
| 1148 | Ga0495585_0162916 | 3300046492 | Bacteria | 1156 |
| 1149 | Ga0495585_0356567 | 3300046492 | Bacteria | 710 |
| 1150 | Ga0495594_0002164 | 3300046499 | Bacteria | 10224 |
| 1151 | Ga0495594_0177180 | 3300046499 | Bacteria | 1213 |
| 1152 | Ga0495596_0142130 | 3300046500 | Bacteria | 932 |
| 1153 | Ga0495607_0014002 | 3300046501 | Bacteria | 5237 |
| 1154 | Ga0495607_0110814 | 3300046501 | Bacteria | 1455 |
| 1155 | Ga0495607_0155712 | 3300046501 | Bacteria | 1165 |
| 1156 | Ga0495607_0273367 | 3300046501 | Bacteria | 804 |
| 1157 | Ga0495583_0090017 | 3300046506 | Bacteria | 1322 |
| 1158 | Ga0495583_0092005 | 3300046506 | Bacteria | 1304 |
| 1159 | Ga0495583_0138755 | 3300046506 | Bacteria | 1013 |
| 1160 | Ga0495583_0167313 | 3300046506 | Bacteria | 905 |
| 1161 | Ga0495583_0185398 | 3300046506 | Bacteria | 850 |
| 1162 | Ga0495606_0004034 | 3300046507 | Bacteria | 14975 |
| 1163 | Ga0495606_0027177 | 3300046507 | Bacteria | 4063 |
| 1164 | Ga0495606_0036411 | 3300046507 | Bacteria | 3351 |
| 1165 | Ga0495606_0037805 | 3300046507 | Bacteria | 3274 |
| 1166 | Ga0495606_0111077 | 3300046507 | Bacteria | 1653 |
| 1167 | Ga0495606_0217061 | 3300046507 | Bacteria | 1080 |
| 1168 | Ga0495606_0244632 | 3300046507 | Bacteria | 998 |
| 1169 | Ga0495606_0279877 | 3300046507 | Bacteria | 912 |
| 1170 | Ga0495608_0006327 | 3300046511 | Bacteria | 8397 |
| 1171 | Ga0495608_0239568 | 3300046511 | Bacteria | 1134 |
| 1172 | Ga0495608_0300374 | 3300046511 | Bacteria | 994 |
| 1173 | Ga0495608_0375591 | 3300046511 | Bacteria | 872 |
| 1174 | Ga0495610_0021518 | 3300046512 | Bacteria | 3545 |
| 1175 | Ga0495610_0049985 | 3300046512 | Bacteria | 2043 |
| 1176 | Ga0495610_0073233 | 3300046512 | Bacteria | 1592 |
| 1177 | Ga0495610_0092046 | 3300046512 | Bacteria | 1373 |
| 1178 | Ga0495610_0138990 | 3300046512 | Bacteria | 1047 |
| 1179 | Ga0495610_0140822 | 3300046512 | Bacteria | 1038 |
| 1180 | Ga0495610_0143034 | 3300046512 | Bacteria | 1027 |
| 1181 | Ga0495616_0003845 | 3300046513 | Bacteria | 9570 |
| 1182 | Ga0495618_0034866 | 3300046514 | Bacteria | 3158 |
| 1183 | Ga0495618_0099764 | 3300046514 | Bacteria | 1858 |
| 1184 | Ga0495618_0324938 | 3300046514 | Bacteria | 952 |
| 1185 | Ga0495620_0008766 | 3300046515 | Bacteria | 5412 |
| 1186 | Ga0495620_0011590 | 3300046515 | Bacteria | 4593 |
| 1187 | Ga0495620_0041601 | 3300046515 | Bacteria | 2014 |
| 1188 | Ga0495620_0140987 | 3300046515 | Bacteria | 942 |
| 1189 | Ga0495620_0199183 | 3300046515 | Bacteria | 770 |
| 1190 | Ga0495628_0053224 | 3300046516 | Bacteria | 3195 |
| 1191 | Ga0495628_0106321 | 3300046516 | Bacteria | 2161 |
| 1192 | Ga0495628_0215453 | 3300046516 | Bacteria | 1443 |
| 1193 | Ga0495630_0027680 | 3300046517 | Bacteria | 4208 |
| 1194 | Ga0495630_0029804 | 3300046517 | Bacteria | 4057 |
| 1195 | Ga0495631_0007141 | 3300046518 | Bacteria | 5707 |
| 1196 | Ga0495631_0050633 | 3300046518 | Bacteria | 1816 |
| 1197 | Ga0495631_0061512 | 3300046518 | Bacteria | 1628 |
| 1198 | Ga0495631_0163607 | 3300046518 | Bacteria | 954 |
| 1199 | Ga0495632_0053677 | 3300046519 | Bacteria | 1978 |
| 1200 | Ga0495632_0069504 | 3300046519 | Bacteria | 1695 |
| 1201 | Ga0495632_0097889 | 3300046519 | Bacteria | 1384 |
| 1202 | Ga0495632_0113199 | 3300046519 | Bacteria | 1272 |
| 1203 | Ga0495632_0148294 | 3300046519 | Bacteria | 1085 |
| 1204 | Ga0495632_0406026 | 3300046519 | Bacteria | 594 |
| 1205 | Ga0495637_0063527 | 3300046520 | Bacteria | 1508 |
| 1206 | Ga0495643_0010467 | 3300046522 | Bacteria | 5707 |
| 1207 | Ga0495643_0011617 | 3300046522 | Bacteria | 5353 |
| 1208 | Ga0495643_0071765 | 3300046522 | Bacteria | 1816 |
| 1209 | Ga0495643_0120853 | 3300046522 | Bacteria | 1323 |
| 1210 | Ga0495643_0128976 | 3300046522 | Bacteria | 1271 |
| 1211 | Ga0495644_0074077 | 3300046523 | Bacteria | 1280 |
| 1212 | Ga0495644_0277617 | 3300046523 | Bacteria | 653 |
| 1213 | Ga0495648_0001935 | 3300046524 | Bacteria | 19722 |
| 1214 | Ga0495648_0008251 | 3300046524 | Bacteria | 8213 |
| 1215 | Ga0495648_0015480 | 3300046524 | Bacteria | 5537 |
| 1216 | Ga0495648_0086535 | 3300046524 | Bacteria | 1767 |
| 1217 | Ga0495648_0361201 | 3300046524 | Bacteria | 660 |
| 1218 | Ga0495663_0047321 | 3300046525 | Bacteria | 1324 |
| 1219 | Ga0495666_0057685 | 3300046526 | Bacteria | 1858 |
| 1220 | Ga0495666_0057810 | 3300046526 | Bacteria | 1856 |
| 1221 | Ga0495652_0004067 | 3300046529 | Bacteria | 14128 |
| 1222 | Ga0495652_0091173 | 3300046529 | Bacteria | 2492 |
| 1223 | Ga0495652_0169584 | 3300046529 | Bacteria | 1686 |
| 1224 | Ga0495654_0000169 | 3300046530 | Bacteria | 64210 |
| 1225 | Ga0495654_0008744 | 3300046530 | Bacteria | 5576 |
| 1226 | Ga0495654_0063133 | 3300046530 | Bacteria | 1774 |
| 1227 | Ga0495654_0088680 | 3300046530 | Bacteria | 1438 |
| 1228 | Ga0495654_0202547 | 3300046530 | Bacteria | 848 |
| 1229 | Ga0495665_0004495 | 3300046531 | Bacteria | 7527 |
| 1230 | Ga0495640_0007699 | 3300046533 | Bacteria | 8474 |
| 1231 | Ga0495640_0016564 | 3300046533 | Bacteria | 5511 |
| 1232 | Ga0495640_0017722 | 3300046533 | Bacteria | 5299 |
| 1233 | Ga0495640_0044682 | 3300046533 | Bacteria | 3079 |
| 1234 | Ga0495640_0102873 | 3300046533 | Bacteria | 1874 |
| 1235 | Ga0495640_0146627 | 3300046533 | Bacteria | 1518 |
| 1236 | Ga0495586_0030573 | 3300046535 | Bacteria | 2882 |
| 1237 | Ga0495587_0149435 | 3300046536 | Bacteria | 1331 |
| 1238 | Ga0495587_0434788 | 3300046536 | Bacteria | 727 |
| 1239 | Ga0495598_0228688 | 3300046537 | Bacteria | 681 |
| 1240 | Ga0495598_0263375 | 3300046537 | Bacteria | 642 |
| 1241 | Ga0495609_0039691 | 3300046538 | Bacteria | 2118 |
| 1242 | Ga0495609_0160948 | 3300046538 | Bacteria | 951 |
| 1243 | Ga0495609_0169871 | 3300046538 | Bacteria | 921 |
| 1244 | Ga0495609_0310991 | 3300046538 | Bacteria | 640 |
| 1245 | Ga0495621_0013886 | 3300046539 | Bacteria | 2539 |
| 1246 | Ga0495597_0009306 | 3300046542 | Bacteria | 4863 |
| 1247 | Ga0495597_0024609 | 3300046542 | Bacteria | 2777 |
| 1248 | Ga0495597_0075007 | 3300046542 | Bacteria | 1452 |
| 1249 | Ga0495597_0128654 | 3300046542 | Bacteria | 1051 |
| 1250 | Ga0495597_0190657 | 3300046542 | Bacteria | 825 |
| 1251 | Ga0495645_0187257 | 3300046543 | Bacteria | 1413 |
| 1252 | Ga0495645_0313988 | 3300046543 | Bacteria | 1020 |
| 1253 | Ga0495645_0592660 | 3300046543 | Bacteria | 683 |
| 1254 | Ga0495645_0746600 | 3300046543 | Bacteria | 591 |
| 1255 | Ga0495622_0020195 | 3300046557 | Bacteria | 3102 |
| 1256 | Ga0495622_0032660 | 3300046557 | Bacteria | 2430 |
| 1257 | Ga0495622_0084171 | 3300046557 | Bacteria | 1463 |
| 1258 | Ga0495622_0094497 | 3300046557 | Bacteria | 1372 |
| 1259 | Ga0495622_0318953 | 3300046557 | Bacteria | 675 |
| 1260 | Ga0495633_0055449 | 3300046558 | Bacteria | 1863 |
| 1261 | Ga0495633_0070701 | 3300046558 | Bacteria | 1628 |
| 1262 | Ga0495633_0115593 | 3300046558 | Bacteria | 1243 |
| 1263 | Ga0495633_0132887 | 3300046558 | Bacteria | 1151 |
| 1264 | Ga0495667_0016440 | 3300046559 | Bacteria | 4998 |
| 1265 | Ga0495667_0032383 | 3300046559 | Bacteria | 3504 |
| 1266 | Ga0495667_0271969 | 3300046559 | Bacteria | 1076 |
| 1267 | Ga0495656_0070658 | 3300046615 | Bacteria | 1549 |
| 1268 | Ga0495656_0163017 | 3300046615 | Bacteria | 1085 |
| 1269 | Ga0495656_0204799 | 3300046615 | Bacteria | 980 |
| 1270 | Ga0495656_0207938 | 3300046615 | Bacteria | 974 |
| 1271 | Ga0495668_0009874 | 3300046616 | Bacteria | 5822 |
| 1272 | Ga0495668_0063697 | 3300046616 | Bacteria | 2030 |
| 1273 | Ga0495668_0095153 | 3300046616 | Bacteria | 1630 |
| 1274 | Ga0495668_0201897 | 3300046616 | Bacteria | 1088 |
| 1275 | Ga0495668_0271703 | 3300046616 | Bacteria | 928 |
| 1276 | Ga0495668_0283076 | 3300046616 | Bacteria | 908 |
| 1277 | Ga0495668_0488217 | 3300046616 | Bacteria | 678 |
| 1278 | Ga0495634_0044824 | 3300046642 | Bacteria | 2991 |
| 1279 | Ga0495634_0050558 | 3300046642 | Bacteria | 2790 |
| 1280 | Ga0495634_0366988 | 3300046642 | Bacteria | 860 |
| 1281 | Ga0495634_0417166 | 3300046642 | Bacteria | 795 |
| 1282 | Ga0495611_0053779 | 3300046648 | Bacteria | 1818 |
| 1283 | Ga0495611_0057726 | 3300046648 | Bacteria | 1759 |
| 1284 | Ga0495611_0234501 | 3300046648 | Bacteria | 852 |
| 1285 | Ga0495625_0027395 | 3300046660 | Bacteria | 4291 |
| 1286 | Ga0495625_0036051 | 3300046660 | Bacteria | 3639 |
| 1287 | Ga0495625_0064552 | 3300046660 | Bacteria | 2582 |
| 1288 | Ga0495625_0125448 | 3300046660 | Bacteria | 1743 |
| 1289 | Ga0495625_0233111 | 3300046660 | Bacteria | 1201 |
| 1290 | Ga0495625_0667476 | 3300046660 | Bacteria | 617 |
| 1291 | Ga0495635_0009893 | 3300046663 | Bacteria | 6666 |
| 1292 | Ga0495635_0036862 | 3300046663 | Bacteria | 3386 |
| 1293 | Ga0495635_0102905 | 3300046663 | Bacteria | 1951 |
| 1294 | Ga0495635_0479966 | 3300046663 | Bacteria | 820 |
| 1295 | Ga0495635_0578370 | 3300046663 | Bacteria | 735 |
| 1296 | Ga0495659_0100765 | 3300046664 | Bacteria | 1118 |
| 1297 | Ga0495661_0152638 | 3300046665 | Bacteria | 1246 |
| 1298 | Ga0495588_0025858 | 3300046674 | Bacteria | 2928 |
| 1299 | Ga0495588_0052266 | 3300046674 | Bacteria | 2105 |
| 1300 | Ga0495588_0059100 | 3300046674 | Bacteria | 1982 |
| 1301 | Ga0495588_0064395 | 3300046674 | Bacteria | 1902 |
| 1302 | Ga0495588_0079565 | 3300046674 | Bacteria | 1710 |
| 1303 | Ga0495588_0081997 | 3300046674 | Bacteria | 1684 |
| 1304 | Ga0495588_0104250 | 3300046674 | Bacteria | 1492 |
| 1305 | Ga0495588_0349138 | 3300046674 | Bacteria | 777 |
| 1306 | Ga0495657_0020577 | 3300046675 | Bacteria | 4741 |
| 1307 | Ga0495657_0088229 | 3300046675 | Bacteria | 1995 |
| 1308 | Ga0495599_0006010 | 3300046678 | Bacteria | 7303 |
| 1309 | Ga0495623_0078486 | 3300046679 | Bacteria | 2046 |
| 1310 | Ga0495623_0134558 | 3300046679 | Bacteria | 1476 |
| 1311 | Ga0495623_0200184 | 3300046679 | Bacteria | 1148 |
| 1312 | Ga0495623_0264429 | 3300046679 | Bacteria | 962 |
| 1313 | Ga0495646_0002026 | 3300046680 | Bacteria | 12277 |
| 1314 | Ga0495646_0009353 | 3300046680 | Bacteria | 6217 |
| 1315 | Ga0495647_0006072 | 3300046681 | Bacteria | 3982 |
| 1316 | Ga0495647_0085938 | 3300046681 | Bacteria | 1282 |
| 1317 | Ga0495647_0184717 | 3300046681 | Bacteria | 908 |
| 1318 | Ga0495647_0222830 | 3300046681 | Bacteria | 833 |
| 1319 | Ga0495658_0001480 | 3300046683 | Bacteria | 12346 |
| 1320 | Ga0495658_0024761 | 3300046683 | Bacteria | 3201 |
| 1321 | Ga0495658_0117919 | 3300046683 | Bacteria | 1602 |
| 1322 | Ga0495669_0071622 | 3300046684 | Bacteria | 1581 |
| 1323 | Ga0495669_0187682 | 3300046684 | Bacteria | 986 |
| 1324 | Ga0495613_0033309 | 3300046689 | Bacteria | 3829 |
| 1325 | Ga0495613_0068299 | 3300046689 | Bacteria | 2592 |
| 1326 | Ga0495613_0222981 | 3300046689 | Bacteria | 1323 |
| 1327 | Ga0495613_0292012 | 3300046689 | Bacteria | 1130 |
| 1328 | Ga0495624_0004478 | 3300046690 | Bacteria | 10223 |
| 1329 | Ga0495624_0019695 | 3300046690 | Bacteria | 4498 |
| 1330 | Ga0495624_0257636 | 3300046690 | Bacteria | 1054 |
| 1331 | Ga0495670_0019785 | 3300046691 | Bacteria | 3317 |
| 1332 | Ga0495670_0067647 | 3300046691 | Bacteria | 1804 |
| 1333 | Ga0495670_0227925 | 3300046691 | Bacteria | 990 |
| 1334 | Ga0495670_0284616 | 3300046691 | Bacteria | 884 |
| 1335 | Ga0495671_0020389 | 3300046692 | Bacteria | 3493 |
| 1336 | Ga0495671_0066997 | 3300046692 | Bacteria | 1766 |
| 1337 | Ga0495671_0098045 | 3300046692 | Bacteria | 1433 |
| 1338 | Ga0495671_0106435 | 3300046692 | Bacteria | 1369 |
| 1339 | Ga0495671_0119333 | 3300046692 | Bacteria | 1287 |
| 1340 | Ga0495649_0056016 | 3300046694 | Bacteria | 2129 |
| 1341 | Ga0495649_0128244 | 3300046694 | Bacteria | 1339 |
| 1342 | Ga0495649_0402130 | 3300046694 | Bacteria | 687 |
| 1343 | Ga0495649_0450401 | 3300046694 | Bacteria | 643 |
| 1344 | Ga0495589_0086867 | 3300046794 | Bacteria | 1519 |
| 1345 | Ga0495589_0108956 | 3300046794 | Bacteria | 1337 |
| 1346 | Ga0495589_0440352 | 3300046794 | Bacteria | 597 |
| 1347 | Ga0495600_0001328 | 3300046809 | Bacteria | 13642 |
| 1348 | Ga0495600_0200756 | 3300046809 | Bacteria | 1280 |
| 1349 | Ga0495600_0249391 | 3300046809 | Bacteria | 1129 |
| 1350 | Ga0495660_0003610 | 3300046810 | Bacteria | 9536 |
| 1351 | Ga0495660_0216181 | 3300046810 | Bacteria | 906 |
| 1352 | Ga0495581_0004107 | 3300047315 | Bacteria | 8377 |
| 1353 | Ga0495581_0046393 | 3300047315 | Bacteria | 2511 |
| 1354 | Ga0495581_0443387 | 3300047315 | Bacteria | 756 |
| 1355 | Ga0495604_0024237 | 3300047317 | Bacteria | 4841 |
| 1356 | Ga0495604_0038744 | 3300047317 | Bacteria | 3750 |
| 1357 | Ga0495604_0056047 | 3300047317 | Bacteria | 3035 |
| 1358 | Ga0495604_0154622 | 3300047317 | Bacteria | 1626 |
| 1359 | Ga0495604_0298678 | 3300047317 | Bacteria | 1082 |
| 1360 | Ga0495636_0254486 | 3300047318 | Bacteria | 813 |
| 1361 | Ga0495636_0372624 | 3300047318 | Bacteria | 676 |
| 1362 | Ga0495674_0033963 | 3300047319 | Bacteria | 4615 |
| 1363 | Ga0495674_0081704 | 3300047319 | Bacteria | 2771 |
| 1364 | Ga0495674_0084213 | 3300047319 | Bacteria | 2725 |
| 1365 | Ga0495674_0133161 | 3300047319 | Bacteria | 2093 |
| 1366 | Ga0495674_0881304 | 3300047319 | Bacteria | 692 |
| 1367 | Ga0495672_0072639 | 3300047320 | Bacteria | 1942 |
| 1368 | Ga0495672_0118367 | 3300047320 | Bacteria | 1412 |
| 1369 | Ga0495672_0151289 | 3300047320 | Bacteria | 1203 |
| 1370 | Ga0495672_0215848 | 3300047320 | Bacteria | 950 |
| 1371 | Ga0495672_0224259 | 3300047320 | Bacteria | 926 |
| 1372 | Ga0495676_0267319 | 3300047321 | Bacteria | 1161 |
| 1373 | Ga0495676_0425480 | 3300047321 | Bacteria | 878 |
| 1374 | Ga0495676_0522864 | 3300047321 | Bacteria | 777 |
| 1375 | Ga0495680_0026837 | 3300047322 | Bacteria | 4741 |
| 1376 | Ga0495680_0636489 | 3300047322 | Bacteria | 710 |
| 1377 | Ga0495683_0094699 | 3300047323 | Bacteria | 1443 |
| 1378 | Ga0495683_0106493 | 3300047323 | Bacteria | 1343 |
| 1379 | Ga0495687_047418 | 3300047443 | Bacteria | 1849 |
| 1380 | Ga0495675_0009679 | 3300047444 | Bacteria | 6007 |
| 1381 | Ga0495675_0467629 | 3300047444 | Bacteria | 727 |
| 1382 | Ga0495685_058639 | 3300047447 | Bacteria | 1299 |
| 1383 | Ga0495673_0054337 | 3300047469 | Bacteria | 1742 |
| 1384 | Ga0495673_0060972 | 3300047469 | Bacteria | 1616 |
| 1385 | Ga0495673_0084303 | 3300047469 | Bacteria | 1310 |
| 1386 | Ga0495673_0206468 | 3300047469 | Bacteria | 732 |
| 1387 | Ga0495681_0111401 | 3300047470 | Bacteria | 1185 |
| 1388 | Ga0495681_0164393 | 3300047470 | Bacteria | 922 |
| 1389 | Ga0495684_0003854 | 3300047471 | Bacteria | 11683 |
| 1390 | Ga0495684_0063489 | 3300047471 | Bacteria | 2807 |
| 1391 | Ga0495684_0068141 | 3300047471 | Bacteria | 2706 |
| 1392 | Ga0495686_0012709 | 3300047472 | Bacteria | 5880 |
| 1393 | Ga0495686_0020367 | 3300047472 | Bacteria | 4423 |
| 1394 | Ga0495686_0053911 | 3300047472 | Bacteria | 2519 |
| 1395 | Ga0495686_0070208 | 3300047472 | Bacteria | 2158 |
| 1396 | Ga0495686_0113885 | 3300047472 | Bacteria | 1619 |
| 1397 | Ga0495686_0115126 | 3300047472 | Bacteria | 1608 |
| 1398 | Ga0495686_0117960 | 3300047472 | Bacteria | 1585 |
| 1399 | Ga0495686_0136673 | 3300047472 | Bacteria | 1449 |
| 1400 | Ga0495593_0003980 | 3300047673 | Bacteria | 8815 |
| 1401 | Ga0495593_0012224 | 3300047673 | Bacteria | 4907 |
| 1402 | Ga0495593_0056011 | 3300047673 | Bacteria | 2073 |
| 1403 | Ga0495602_0368581 | 3300048088 | Bacteria | 1032 |
| 1404 | Ga0495602_0547652 | 3300048088 | Bacteria | 802 |
| 1405 | Ga0495602_0549525 | 3300048088 | Bacteria | 800 |
| 1406 | Ga0495614_0096077 | 3300048089 | Bacteria | 1292 |
| 1407 | Ga0495614_0160820 | 3300048089 | Bacteria | 1005 |
| 1408 | Ga0495615_0018125 | 3300048090 | Bacteria | 1545 |
| 1409 | Ga0495615_0077871 | 3300048090 | Bacteria | 904 |
| 1410 | Ga0495626_0008866 | 3300048091 | Bacteria | 5467 |
| 1411 | Ga0495626_0009507 | 3300048091 | Bacteria | 5253 |
| 1412 | Ga0495626_0078153 | 3300048091 | Bacteria | 1474 |
| 1413 | Ga0495626_0232172 | 3300048091 | Bacteria | 745 |
| 1414 | Ga0496100_0304033 | 3300048903 | Bacteria | 1194 |
| 1415 | Ga0496100_0700908 | 3300048903 | Bacteria | 790 |
| 1416 | Ga0496100_1082482 | 3300048903 | Bacteria | 631 |
| 1417 | Ga0496100_1423029 | 3300048903 | Bacteria | 547 |
| 1418 | Ga0496101_0218582 | 3300048904 | Bacteria | 1478 |
| 1419 | Ga0496101_0664100 | 3300048904 | Bacteria | 823 |
| 1420 | Ga0496101_0758557 | 3300048904 | Bacteria | 765 |
| 1421 | Ga0496102_0275494 | 3300048905 | Bacteria | 1586 |
| 1422 | Ga0496102_0401030 | 3300048905 | Bacteria | 1289 |
| 1423 | Ga0496102_0488810 | 3300048905 | Bacteria | 1152 |
| 1424 | Ga0496102_0597617 | 3300048905 | Bacteria | 1026 |
| 1425 | Ga0496102_1348092 | 3300048905 | Bacteria | 632 |
| 1426 | Ga0496102_1607049 | 3300048905 | Bacteria | 568 |
| 1427 | Ga0496103_0169291 | 3300048906 | Bacteria | 1402 |
| 1428 | Ga0496103_0420846 | 3300048906 | Bacteria | 857 |
| 1429 | Ga0496104_0038871 | 3300048907 | Bacteria | 4454 |
| 1430 | Ga0496104_0117685 | 3300048907 | Bacteria | 2550 |
| 1431 | Ga0496104_0134355 | 3300048907 | Bacteria | 2376 |
| 1432 | Ga0496104_0245933 | 3300048907 | Bacteria | 1701 |
| 1433 | Ga0496104_0424340 | 3300048907 | Bacteria | 1242 |
| 1434 | Ga0496105_0005725 | 3300048908 | Bacteria | 9460 |
| 1435 | Ga0496105_0068020 | 3300048908 | Bacteria | 2941 |
| 1436 | Ga0496105_0100695 | 3300048908 | Bacteria | 2386 |
| 1437 | Ga0496105_0203046 | 3300048908 | Bacteria | 1617 |
| 1438 | Ga0496105_0579954 | 3300048908 | Bacteria | 872 |
| 1439 | Ga0496106_0012368 | 3300048909 | Bacteria | 6300 |
| 1440 | Ga0496106_0287189 | 3300048909 | Bacteria | 1319 |
| 1441 | Ga0496106_0592345 | 3300048909 | Bacteria | 888 |
| 1442 | Ga0496106_0675079 | 3300048909 | Bacteria | 824 |
| 1443 | Ga0496107_0146618 | 3300048910 | Bacteria | 1745 |
| 1444 | Ga0496107_0195912 | 3300048910 | Bacteria | 1501 |
| 1445 | Ga0496107_0931367 | 3300048910 | Bacteria | 632 |
| 1446 | Ga0496108_0065562 | 3300048911 | Bacteria | 3061 |
| 1447 | Ga0496108_0093770 | 3300048911 | Bacteria | 2554 |
| 1448 | Ga0496108_0407426 | 3300048911 | Bacteria | 1187 |
| 1449 | Ga0496108_0605644 | 3300048911 | Bacteria | 954 |
| 1450 | Ga0496109_0052420 | 3300048912 | Bacteria | 3718 |
| 1451 | Ga0496109_0694864 | 3300048912 | Bacteria | 955 |
| 1452 | Ga0496110_0072438 | 3300048913 | Bacteria | 3057 |
| 1453 | Ga0496110_0225558 | 3300048913 | Bacteria | 1704 |
| 1454 | Ga0496110_0457335 | 3300048913 | Bacteria | 1163 |
| 1455 | Ga0496110_0618696 | 3300048913 | Bacteria | 981 |
| 1456 | Ga0496110_0893074 | 3300048913 | Bacteria | 794 |
| 1457 | Ga0496111_0010053 | 3300048914 | Bacteria | 6330 |
| 1458 | Ga0496111_0065502 | 3300048914 | Bacteria | 2637 |
| 1459 | Ga0496111_0470529 | 3300048914 | Bacteria | 926 |
| 1460 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 1461 | Ga0496112_0049260 | 3300048915 | Bacteria | 4129 |
| 1462 | Ga0496112_0065915 | 3300048915 | Bacteria | 3573 |
| 1463 | Ga0496112_0110610 | 3300048915 | Bacteria | 2717 |
| 1464 | Ga0496112_0116362 | 3300048915 | Bacteria | 2644 |
| 1465 | Ga0496112_0126745 | 3300048915 | Bacteria | 2523 |
| 1466 | Ga0496112_1395192 | 3300048915 | Bacteria | 615 |
| 1467 | Ga0496113_0212481 | 3300048916 | Bacteria | 1540 |
| 1468 | Ga0496113_0243254 | 3300048916 | Bacteria | 1436 |
| 1469 | Ga0496113_0435358 | 3300048916 | Bacteria | 1053 |
| 1470 | Ga0496113_0704217 | 3300048916 | Bacteria | 806 |
| 1471 | Ga0496113_0917896 | 3300048916 | Bacteria | 692 |
| 1472 | Ga0496113_1280684 | 3300048916 | Bacteria | 570 |
| 1473 | Ga0496114_0089784 | 3300048917 | Bacteria | 2608 |
| 1474 | Ga0496114_0189609 | 3300048917 | Bacteria | 1798 |
| 1475 | Ga0496114_0202573 | 3300048917 | Bacteria | 1738 |
| 1476 | Ga0496114_0230803 | 3300048917 | Bacteria | 1626 |
| 1477 | Ga0496114_0346523 | 3300048917 | Bacteria | 1314 |
| 1478 | Ga0496114_0613657 | 3300048917 | Bacteria | 959 |
| 1479 | Ga0496115_0004922 | 3300048918 | Bacteria | 9702 |
| 1480 | Ga0496115_0063129 | 3300048918 | Bacteria | 2988 |
| 1481 | Ga0496115_0161711 | 3300048918 | Bacteria | 1850 |
| 1482 | Ga0496115_0224324 | 3300048918 | Bacteria | 1550 |
| 1483 | Ga0496115_0397682 | 3300048918 | Bacteria | 1118 |
| 1484 | Ga0496115_0707357 | 3300048918 | Bacteria | 791 |
| 1485 | Ga0496115_0906199 | 3300048918 | Bacteria | 679 |
| 1486 | Ga0496116_0016936 | 3300048919 | Bacteria | 5681 |
| 1487 | Ga0496116_0020299 | 3300048919 | Bacteria | 5049 |
| 1488 | Ga0496116_0087897 | 3300048919 | Bacteria | 1901 |
| 1489 | Ga0496116_0090144 | 3300048919 | Bacteria | 1867 |
| 1490 | Ga0496116_0150213 | 3300048919 | Bacteria | 1295 |
| 1491 | Ga0496116_0246987 | 3300048919 | Bacteria | 891 |
| 1492 | Ga0496116_0266409 | 3300048919 | Bacteria | 840 |
| 1493 | Ga0496117_0036203 | 3300048920 | Bacteria | 3696 |
| 1494 | Ga0496117_0039434 | 3300048920 | Bacteria | 3486 |
| 1495 | Ga0496117_0079630 | 3300048920 | Bacteria | 2157 |
| 1496 | Ga0496117_0113384 | 3300048920 | Bacteria | 1683 |
| 1497 | Ga0496117_0131919 | 3300048920 | Bacteria | 1512 |
| 1498 | Ga0496118_0010277 | 3300048921 | Bacteria | 9286 |
| 1499 | Ga0496118_0038146 | 3300048921 | Bacteria | 3855 |
| 1500 | Ga0496118_0047138 | 3300048921 | Bacteria | 3345 |
| 1501 | Ga0496118_0048277 | 3300048921 | Bacteria | 3290 |
| 1502 | Ga0496118_0083225 | 3300048921 | Bacteria | 2238 |
| 1503 | Ga0496118_0115246 | 3300048921 | Bacteria | 1769 |
| 1504 | Ga0496118_0154123 | 3300048921 | Bacteria | 1432 |
| 1505 | Ga0496118_0193744 | 3300048921 | Bacteria | 1212 |
| 1506 | Ga0496118_0345288 | 3300048921 | Bacteria | 795 |
| 1507 | Ga0496118_0419965 | 3300048921 | Bacteria | 688 |
| 1508 | Ga0496119_0022470 | 3300048922 | Bacteria | 4514 |
| 1509 | Ga0496119_0026500 | 3300048922 | Bacteria | 4017 |
| 1510 | Ga0496119_0049927 | 3300048922 | Bacteria | 2582 |
| 1511 | Ga0496119_0132438 | 3300048922 | Bacteria | 1357 |
| 1512 | Ga0496119_0192824 | 3300048922 | Bacteria | 1060 |
| 1513 | Ga0496119_0195203 | 3300048922 | Bacteria | 1052 |
| 1514 | Ga0496119_0314293 | 3300048922 | Bacteria | 768 |
| 1515 | Ga0496120_0003668 | 3300048923 | Bacteria | 13738 |
| 1516 | Ga0496120_0014732 | 3300048923 | Bacteria | 5192 |
| 1517 | Ga0496120_0067605 | 3300048923 | Bacteria | 1973 |
| 1518 | Ga0496120_0120324 | 3300048923 | Bacteria | 1358 |
| 1519 | Ga0496120_0136578 | 3300048923 | Bacteria | 1249 |
| 1520 | Ga0496120_0236970 | 3300048923 | Bacteria | 863 |
| 1521 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 1522 | Ga0496121_0002196 | 3300048924 | Bacteria | 30506 |
| 1523 | Ga0496121_0012437 | 3300048924 | Bacteria | 9278 |
| 1524 | Ga0496121_0015937 | 3300048924 | Bacteria | 7805 |
| 1525 | Ga0496121_0018961 | 3300048924 | Bacteria | 6903 |
| 1526 | Ga0496121_0059739 | 3300048924 | Bacteria | 3141 |
| 1527 | Ga0496121_0071016 | 3300048924 | Bacteria | 2801 |
| 1528 | Ga0496121_0074250 | 3300048924 | Bacteria | 2721 |
| 1529 | Ga0496121_0091959 | 3300048924 | Bacteria | 2366 |
| 1530 | Ga0496121_0133823 | 3300048924 | Bacteria | 1850 |
| 1531 | Ga0496121_0136963 | 3300048924 | Bacteria | 1822 |
| 1532 | Ga0496121_0145522 | 3300048924 | Bacteria | 1751 |
| 1533 | Ga0496121_0181295 | 3300048924 | Bacteria | 1520 |
| 1534 | Ga0496121_0198020 | 3300048924 | Bacteria | 1434 |
| 1535 | Ga0496121_0213609 | 3300048924 | Bacteria | 1364 |
| 1536 | Ga0496121_0385665 | 3300048924 | Bacteria | 922 |
| 1537 | Ga0496121_0410174 | 3300048924 | Bacteria | 884 |
| 1538 | Ga0496121_0510997 | 3300048924 | Bacteria | 760 |
| 1539 | Ga0496122_0000179 | 3300048925 | Bacteria | 149332 |
| 1540 | Ga0496122_0037393 | 3300048925 | Bacteria | 3908 |
| 1541 | Ga0496122_0049928 | 3300048925 | Bacteria | 3195 |
| 1542 | Ga0496122_0085161 | 3300048925 | Bacteria | 2182 |
| 1543 | Ga0496122_0090444 | 3300048925 | Bacteria | 2088 |
| 1544 | Ga0496122_0172441 | 3300048925 | Bacteria | 1301 |
| 1545 | Ga0496122_0209271 | 3300048925 | Bacteria | 1131 |
| 1546 | Ga0496122_0262012 | 3300048925 | Bacteria | 958 |
| 1547 | Ga0496122_0326762 | 3300048925 | Bacteria | 812 |
| 1548 | Ga0496123_0000305 | 3300048926 | Bacteria | 95376 |
| 1549 | Ga0496123_0017503 | 3300048926 | Bacteria | 5761 |
| 1550 | Ga0496123_0029976 | 3300048926 | Bacteria | 3992 |
| 1551 | Ga0496123_0041395 | 3300048926 | Bacteria | 3194 |
| 1552 | Ga0496123_0100858 | 3300048926 | Bacteria | 1680 |
| 1553 | Ga0496123_0130297 | 3300048926 | Bacteria | 1395 |
| 1554 | Ga0496123_0135023 | 3300048926 | Bacteria | 1359 |
| 1555 | Ga0496123_0166396 | 3300048926 | Bacteria | 1168 |
| 1556 | Ga0496123_0180592 | 3300048926 | Bacteria | 1103 |
| 1557 | Ga0496124_0004199 | 3300048927 | Bacteria | 16960 |
| 1558 | Ga0496124_0004355 | 3300048927 | Bacteria | 16569 |
| 1559 | Ga0496124_0004631 | 3300048927 | Bacteria | 15936 |
| 1560 | Ga0496124_0051261 | 3300048927 | Bacteria | 3512 |
| 1561 | Ga0496124_0116377 | 3300048927 | Bacteria | 2143 |
| 1562 | Ga0496124_0177566 | 3300048927 | Bacteria | 1642 |
| 1563 | Ga0496124_0180285 | 3300048927 | Bacteria | 1626 |
| 1564 | Ga0496124_0182153 | 3300048927 | Bacteria | 1615 |
| 1565 | Ga0496124_0203903 | 3300048927 | Bacteria | 1501 |
| 1566 | Ga0496124_0205157 | 3300048927 | Bacteria | 1495 |
| 1567 | Ga0496124_0235980 | 3300048927 | Bacteria | 1363 |
| 1568 | Ga0496124_0293249 | 3300048927 | Bacteria | 1179 |
| 1569 | Ga0496124_0293752 | 3300048927 | Bacteria | 1178 |
| 1570 | Ga0496124_0507002 | 3300048927 | Bacteria | 807 |
| 1571 | Ga0496124_0731920 | 3300048927 | Bacteria | 622 |
| 1572 | Ga0496125_0000141 | 3300048928 | Bacteria | 158991 |
| 1573 | Ga0496125_0063176 | 3300048928 | Bacteria | 2954 |
| 1574 | Ga0496125_0103317 | 3300048928 | Bacteria | 2091 |
| 1575 | Ga0496125_0114457 | 3300048928 | Bacteria | 1943 |
| 1576 | Ga0496125_0126066 | 3300048928 | Bacteria | 1814 |
| 1577 | Ga0496125_0164647 | 3300048928 | Bacteria | 1500 |
| 1578 | Ga0496125_0165868 | 3300048928 | Bacteria | 1492 |
| 1579 | Ga0496125_0234291 | 3300048928 | Bacteria | 1171 |
| 1580 | Ga0496125_0289968 | 3300048928 | Bacteria | 1008 |
| 1581 | Ga0496125_0327707 | 3300048928 | Bacteria | 925 |
| 1582 | Ga0496125_0435865 | 3300048928 | Bacteria | 755 |
| 1583 | Ga0496125_0499966 | 3300048928 | Bacteria | 684 |
| 1584 | Ga0496125_0526708 | 3300048928 | Bacteria | 659 |
| 1585 | Ga0496126_0027348 | 3300048929 | Bacteria | 5449 |
| 1586 | Ga0496126_0055514 | 3300048929 | Bacteria | 3583 |
| 1587 | Ga0496126_0106083 | 3300048929 | Bacteria | 2452 |
| 1588 | Ga0496126_0157376 | 3300048929 | Bacteria | 1944 |
| 1589 | Ga0496126_0179786 | 3300048929 | Bacteria | 1797 |
| 1590 | Ga0496126_0195531 | 3300048929 | Bacteria | 1710 |
| 1591 | Ga0496126_0209361 | 3300048929 | Bacteria | 1642 |
| 1592 | Ga0496126_0218163 | 3300048929 | Bacteria | 1604 |
| 1593 | Ga0496126_0311670 | 3300048929 | Bacteria | 1295 |
| 1594 | Ga0496126_0315366 | 3300048929 | Bacteria | 1287 |
| 1595 | Ga0496126_0370688 | 3300048929 | Bacteria | 1167 |
| 1596 | Ga0496126_0426882 | 3300048929 | Bacteria | 1070 |
| 1597 | Ga0496126_0568184 | 3300048929 | Bacteria | 897 |
| 1598 | Ga0496126_0627878 | 3300048929 | Bacteria | 843 |
| 1599 | Ga0496126_0683432 | 3300048929 | Bacteria | 799 |
| 1600 | Ga0501306_000444 | 3300049127 | Bacteria | 3135 |
| 1601 | Ga0501306_007899 | 3300049127 | Bacteria | 1284 |
| 1602 | Ga0501306_039073 | 3300049127 | Bacteria | 730 |
| 1603 | Ga0501308_002370 | 3300049128 | Bacteria | 1648 |
| 1604 | Ga0501309_000912 | 3300049129 | Bacteria | 2663 |
| 1605 | Ga0501309_004872 | 3300049129 | Bacteria | 1579 |
| 1606 | Ga0501310_010190 | 3300049130 | Bacteria | 1045 |
| 1607 | Ga0501310_011449 | 3300049130 | Bacteria | 1004 |
| 1608 | Ga0501310_013612 | 3300049130 | Bacteria | 946 |
| 1609 | Ga0501310_032438 | 3300049130 | Bacteria | 699 |
| 1610 | Ga0501304_003511 | 3300049160 | Bacteria | 1152 |
| 1611 | Ga0501305_003020 | 3300049161 | Bacteria | 1871 |
| 1612 | Ga0501305_003176 | 3300049161 | Bacteria | 1843 |
| 1613 | Ga0501305_009509 | 3300049161 | Bacteria | 1279 |
| 1614 | Ga0501307_034945 | 3300049162 | Bacteria | 712 |
| 1615 | Ga0495678_057051 | 3300049459 | Bacteria | 1481 |
| 1616 | Ga0495678_114186 | 3300049459 | Bacteria | 916 |
| 1617 | Ga0495678_152901 | 3300049459 | Bacteria | 743 |
| 1618 | Ga0495678_162925 | 3300049459 | Bacteria | 711 |
| 1619 | Ga0495682_0114243 | 3300049460 | Bacteria | 967 |
| 1620 | Ga0501311_000194 | 3300049527 | Bacteria | 3556 |
| 1621 | Ga0501311_006601 | 3300049527 | Bacteria | 1311 |
| 1622 | Ga0501313_009901 | 3300049529 | Bacteria | 1078 |
| 1623 | Ga0501314_002564 | 3300049530 | Bacteria | 1414 |
| 1624 | Ga0501314_002648 | 3300049530 | Bacteria | 1399 |
| 1625 | Ga0501314_008466 | 3300049530 | Bacteria | 930 |
| 1626 | Ga0501315_000060 | 3300049531 | Bacteria | 4828 |
| 1627 | Ga0501315_001308 | 3300049531 | Bacteria | 2090 |
| 1628 | Ga0501315_014320 | 3300049531 | Bacteria | 1004 |
| 1629 | Ga0501316_000132 | 3300049532 | Bacteria | 3939 |
| 1630 | Ga0501316_001097 | 3300049532 | Bacteria | 2191 |
| 1631 | Ga0501317_000084 | 3300049533 | Bacteria | 4633 |
| 1632 | Ga0501317_000409 | 3300049533 | Bacteria | 2945 |
| 1633 | Ga0501317_017769 | 3300049533 | Bacteria | 935 |
| 1634 | Ga0501318_000193 | 3300049534 | Bacteria | 3208 |
| 1635 | Ga0501319_005724 | 3300049535 | Bacteria | 899 |
| 1636 | Ga0501319_006566 | 3300049535 | Bacteria | 861 |
| 1637 | Ga0501320_005669 | 3300049536 | Bacteria | 1146 |
| 1638 | Ga0501321_010209 | 3300049537 | Bacteria | 1026 |
| 1639 | Ga0501321_025502 | 3300049537 | Bacteria | 762 |
| 1640 | Ga0501322_000140 | 3300049538 | Bacteria | 2796 |
| 1641 | Ga0501323_006869 | 3300049539 | Bacteria | 1283 |
| 1642 | Ga0501324_013699 | 3300049540 | Bacteria | 771 |
| 1643 | Ga0501324_014661 | 3300049540 | Bacteria | 753 |
| 1644 | Ga0501334_06607 | 3300049550 | Bacteria | 786 |
| 1645 | Ga0501031_0000651 | 3300049568 | Bacteria | 20547 |
| 1646 | Ga0501031_0002703 | 3300049568 | Bacteria | 11283 |
| 1647 | Ga0501031_0004402 | 3300049568 | Bacteria | 9129 |
| 1648 | Ga0501031_0007624 | 3300049568 | Bacteria | 7048 |
| 1649 | Ga0501031_0095082 | 3300049568 | Bacteria | 1944 |
| 1650 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 1651 | Ga0501032_0003488 | 3300049569 | Bacteria | 12021 |
| 1652 | Ga0501032_0006160 | 3300049569 | Bacteria | 8827 |
| 1653 | Ga0501032_0066026 | 3300049569 | Bacteria | 2418 |
| 1654 | Ga0501032_0233067 | 3300049569 | Bacteria | 1197 |
| 1655 | Ga0501032_0319882 | 3300049569 | Bacteria | 1001 |
| 1656 | Ga0501032_0686129 | 3300049569 | Bacteria | 650 |
| 1657 | Ga0501033_0000121 | 3300049570 | Bacteria | 75242 |
| 1658 | Ga0501033_0006462 | 3300049570 | Bacteria | 9172 |
| 1659 | Ga0501033_0007122 | 3300049570 | Bacteria | 8728 |
| 1660 | Ga0501033_0010287 | 3300049570 | Bacteria | 7177 |
| 1661 | Ga0501033_0011172 | 3300049570 | Bacteria | 6877 |
| 1662 | Ga0501033_0015204 | 3300049570 | Bacteria | 5842 |
| 1663 | Ga0501033_0079988 | 3300049570 | Bacteria | 2398 |
| 1664 | Ga0501033_0080471 | 3300049570 | Bacteria | 2390 |
| 1665 | Ga0501033_0087475 | 3300049570 | Bacteria | 2280 |
| 1666 | Ga0501033_0511846 | 3300049570 | Bacteria | 830 |
| 1667 | Ga0501034_0000298 | 3300049571 | Bacteria | 88154 |
| 1668 | Ga0501034_0004897 | 3300049571 | Bacteria | 14760 |
| 1669 | Ga0501034_0006180 | 3300049571 | Bacteria | 12912 |
| 1670 | Ga0501034_0009013 | 3300049571 | Bacteria | 10479 |
| 1671 | Ga0501034_0012627 | 3300049571 | Bacteria | 8716 |
| 1672 | Ga0501034_0014685 | 3300049571 | Bacteria | 8064 |
| 1673 | Ga0501034_0030885 | 3300049571 | Bacteria | 5444 |
| 1674 | Ga0501034_0031298 | 3300049571 | Bacteria | 5404 |
| 1675 | Ga0501034_0073278 | 3300049571 | Bacteria | 3433 |
| 1676 | Ga0501034_0209490 | 3300049571 | Bacteria | 1905 |
| 1677 | Ga0501034_0386571 | 3300049571 | Bacteria | 1324 |
| 1678 | Ga0501034_0420618 | 3300049571 | Bacteria | 1257 |
| 1679 | Ga0501036_0000724 | 3300049572 | Bacteria | 24360 |
| 1680 | Ga0501036_0002605 | 3300049572 | Bacteria | 14223 |
| 1681 | Ga0501036_0025540 | 3300049572 | Bacteria | 4984 |
| 1682 | Ga0501036_0194494 | 3300049572 | Bacteria | 1706 |
| 1683 | Ga0501036_0236449 | 3300049572 | Bacteria | 1532 |
| 1684 | Ga0501036_0256206 | 3300049572 | Bacteria | 1466 |
| 1685 | Ga0501036_1008151 | 3300049572 | Bacteria | 681 |
| 1686 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 1687 | Ga0501037_0000191 | 3300049573 | Bacteria | 56839 |
| 1688 | Ga0501037_0000195 | 3300049573 | Bacteria | 55440 |
| 1689 | Ga0501037_0006435 | 3300049573 | Bacteria | 8594 |
| 1690 | Ga0501037_0270062 | 3300049573 | Bacteria | 1187 |
| 1691 | Ga0501037_0838005 | 3300049573 | Bacteria | 605 |
| 1692 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 1693 | Ga0501038_0001882 | 3300049574 | Bacteria | 19398 |
| 1694 | Ga0501038_0005274 | 3300049574 | Bacteria | 12021 |
| 1695 | Ga0501038_0047294 | 3300049574 | Bacteria | 3727 |
| 1696 | Ga0501038_0158498 | 3300049574 | Bacteria | 1841 |
| 1697 | Ga0501038_0468144 | 3300049574 | Bacteria | 967 |
| 1698 | Ga0501038_0702777 | 3300049574 | Bacteria | 757 |
| 1699 | Ga0501038_0757002 | 3300049574 | Bacteria | 724 |
| 1700 | Ga0501039_0000080 | 3300049575 | Bacteria | 72519 |
| 1701 | Ga0501039_0002279 | 3300049575 | Bacteria | 14235 |
| 1702 | Ga0501039_0032207 | 3300049575 | Bacteria | 4040 |
| 1703 | Ga0501039_0077058 | 3300049575 | Bacteria | 2593 |
| 1704 | Ga0501039_0216355 | 3300049575 | Bacteria | 1506 |
| 1705 | Ga0501039_0279144 | 3300049575 | Bacteria | 1313 |
| 1706 | Ga0501039_0752592 | 3300049575 | Bacteria | 761 |
| 1707 | Ga0501040_0008666 | 3300049576 | Bacteria | 6603 |
| 1708 | Ga0501040_0046602 | 3300049576 | Bacteria | 2959 |
| 1709 | Ga0501040_0185433 | 3300049576 | Bacteria | 1476 |
| 1710 | Ga0501040_0498267 | 3300049576 | Bacteria | 878 |
| 1711 | Ga0501041_0053535 | 3300049577 | Bacteria | 2462 |
| 1712 | Ga0501042_0060942 | 3300049578 | Bacteria | 2695 |
| 1713 | Ga0501042_0490992 | 3300049578 | Bacteria | 891 |
| 1714 | Ga0501043_0000080 | 3300049579 | Bacteria | 85372 |
| 1715 | Ga0501043_0004023 | 3300049579 | Bacteria | 12021 |
| 1716 | Ga0501043_0015219 | 3300049579 | Bacteria | 6023 |
| 1717 | Ga0501043_0024392 | 3300049579 | Bacteria | 4746 |
| 1718 | Ga0501043_0052836 | 3300049579 | Bacteria | 3191 |
| 1719 | Ga0501043_0256680 | 3300049579 | Bacteria | 1345 |
| 1720 | Ga0501043_0574453 | 3300049579 | Bacteria | 835 |
| 1721 | Ga0501043_0712068 | 3300049579 | Bacteria | 732 |
| 1722 | Ga0501046_0018165 | 3300049580 | Bacteria | 5856 |
| 1723 | Ga0501046_0048594 | 3300049580 | Bacteria | 3359 |
| 1724 | Ga0501046_0363102 | 3300049580 | Bacteria | 1050 |
| 1725 | Ga0501047_0011259 | 3300049581 | Bacteria | 8466 |
| 1726 | Ga0501047_0017299 | 3300049581 | Bacteria | 6904 |
| 1727 | Ga0501047_0025104 | 3300049581 | Bacteria | 5725 |
| 1728 | Ga0501047_0040375 | 3300049581 | Bacteria | 4513 |
| 1729 | Ga0501047_0080199 | 3300049581 | Bacteria | 3137 |
| 1730 | Ga0501047_0106587 | 3300049581 | Bacteria | 2683 |
| 1731 | Ga0501047_0135845 | 3300049581 | Bacteria | 2339 |
| 1732 | Ga0501047_0224418 | 3300049581 | Bacteria | 1734 |
| 1733 | Ga0501047_0235624 | 3300049581 | Bacteria | 1682 |
| 1734 | Ga0501047_0549634 | 3300049581 | Bacteria | 979 |
| 1735 | Ga0501047_0911058 | 3300049581 | Bacteria | 692 |
| 1736 | Ga0501048_0030318 | 3300049582 | Bacteria | 3913 |
| 1737 | Ga0501048_0235219 | 3300049582 | Bacteria | 1300 |
| 1738 | Ga0501048_0639197 | 3300049582 | Bacteria | 764 |
| 1739 | Ga0501067_0054293 | 3300049583 | Bacteria | 2220 |
| 1740 | Ga0501067_0059220 | 3300049583 | Bacteria | 2120 |
| 1741 | Ga0501067_0211083 | 3300049583 | Bacteria | 1081 |
| 1742 | Ga0501068_0022655 | 3300049584 | Bacteria | 3674 |
| 1743 | Ga0501068_0211224 | 3300049584 | Bacteria | 1232 |
| 1744 | Ga0501069_0000172 | 3300049585 | Bacteria | 29114 |
| 1745 | Ga0501069_0045997 | 3300049585 | Bacteria | 2419 |
| 1746 | Ga0501069_0059883 | 3300049585 | Bacteria | 2125 |
| 1747 | Ga0501069_0157705 | 3300049585 | Bacteria | 1306 |
| 1748 | Ga0501070_0001286 | 3300049586 | Bacteria | 22525 |
| 1749 | Ga0501070_0006301 | 3300049586 | Bacteria | 10097 |
| 1750 | Ga0501070_0015591 | 3300049586 | Bacteria | 6390 |
| 1751 | Ga0501070_0018655 | 3300049586 | Bacteria | 5820 |
| 1752 | Ga0501070_0052211 | 3300049586 | Bacteria | 3393 |
| 1753 | Ga0501070_0296563 | 3300049586 | Bacteria | 1317 |
| 1754 | Ga0501070_0634142 | 3300049586 | Bacteria | 850 |
| 1755 | Ga0501070_0798960 | 3300049586 | Bacteria | 741 |
| 1756 | Ga0501070_0897266 | 3300049586 | Bacteria | 692 |
| 1757 | Ga0501071_0050678 | 3300049587 | Bacteria | 2990 |
| 1758 | Ga0501072_0117144 | 3300049588 | Bacteria | 2122 |
| 1759 | Ga0501073_0018884 | 3300049589 | Bacteria | 4983 |
| 1760 | Ga0501073_0032628 | 3300049589 | Bacteria | 3713 |
| 1761 | Ga0501073_0047706 | 3300049589 | Bacteria | 3009 |
| 1762 | Ga0501073_0392284 | 3300049589 | Bacteria | 959 |
| 1763 | Ga0501074_0002583 | 3300049590 | Bacteria | 12638 |
| 1764 | Ga0501074_0040640 | 3300049590 | Bacteria | 3368 |
| 1765 | Ga0501074_0368918 | 3300049590 | Bacteria | 1018 |
| 1766 | Ga0501074_0528040 | 3300049590 | Bacteria | 836 |
| 1767 | Ga0501076_0588821 | 3300049592 | Bacteria | 917 |
| 1768 | Ga0501202_125437 | 3300049652 | Bacteria | 649 |
| 1769 | Ga0501238_015849 | 3300049671 | Bacteria | 1041 |
| 1770 | Ga0501079_0143858 | 3300049741 | Bacteria | 1858 |
| 1771 | Ga0501080_0003453 | 3300049742 | Bacteria | 13951 |
| 1772 | Ga0501080_0004752 | 3300049742 | Bacteria | 12113 |
| 1773 | Ga0501080_0020715 | 3300049742 | Bacteria | 6091 |
| 1774 | Ga0501080_0214502 | 3300049742 | Bacteria | 1763 |
| 1775 | Ga0501080_0603270 | 3300049742 | Bacteria | 974 |
| 1776 | Ga0501080_0681820 | 3300049742 | Bacteria | 907 |
| 1777 | Ga0501080_1012279 | 3300049742 | Bacteria | 720 |
| 1778 | Ga0501081_0373523 | 3300049743 | Bacteria | 1053 |
| 1779 | Ga0501083_0001214 | 3300049744 | Bacteria | 17447 |
| 1780 | Ga0501083_0012045 | 3300049744 | Bacteria | 6055 |
| 1781 | Ga0501083_0027007 | 3300049744 | Bacteria | 3964 |
| 1782 | Ga0501083_0366141 | 3300049744 | Bacteria | 937 |
| 1783 | Ga0501241_009543 | 3300049758 | Bacteria | 1767 |
| 1784 | Ga0501280_003866 | 3300049776 | Bacteria | 2252 |
| 1785 | Ga0501035_0000160 | 3300049822 | Bacteria | 82214 |
| 1786 | Ga0501035_0000167 | 3300049822 | Bacteria | 80102 |
| 1787 | Ga0501035_0000347 | 3300049822 | Bacteria | 53369 |
| 1788 | Ga0501035_0002188 | 3300049822 | Bacteria | 19398 |
| 1789 | Ga0501035_0005457 | 3300049822 | Bacteria | 12026 |
| 1790 | Ga0501035_0009004 | 3300049822 | Bacteria | 9284 |
| 1791 | Ga0501035_0009166 | 3300049822 | Bacteria | 9204 |
| 1792 | Ga0501035_0022061 | 3300049822 | Bacteria | 5849 |
| 1793 | Ga0501035_0093710 | 3300049822 | Bacteria | 2642 |
| 1794 | Ga0501035_0174152 | 3300049822 | Bacteria | 1857 |
| 1795 | Ga0501035_0190500 | 3300049822 | Bacteria | 1763 |
| 1796 | Ga0501035_0208235 | 3300049822 | Bacteria | 1674 |
| 1797 | Ga0501035_0508070 | 3300049822 | Bacteria | 991 |
| 1798 | Ga0501035_0851207 | 3300049822 | Bacteria | 725 |
| 1799 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 1800 | Ga0501044_0000544 | 3300049823 | Bacteria | 45911 |
| 1801 | Ga0501044_0009229 | 3300049823 | Bacteria | 10770 |
| 1802 | Ga0501044_0022577 | 3300049823 | Bacteria | 6704 |
| 1803 | Ga0501044_0050656 | 3300049823 | Bacteria | 4283 |
| 1804 | Ga0501044_0059863 | 3300049823 | Bacteria | 3901 |
| 1805 | Ga0501044_0062595 | 3300049823 | Bacteria | 3803 |
| 1806 | Ga0501044_0076474 | 3300049823 | Bacteria | 3397 |
| 1807 | Ga0501044_0092919 | 3300049823 | Bacteria | 3042 |
| 1808 | Ga0501044_0106357 | 3300049823 | Bacteria | 2818 |
| 1809 | Ga0501044_0229111 | 3300049823 | Bacteria | 1806 |
| 1810 | Ga0501044_0233590 | 3300049823 | Bacteria | 1785 |
| 1811 | Ga0501044_0463333 | 3300049823 | Bacteria | 1172 |
| 1812 | Ga0501044_0644986 | 3300049823 | Bacteria | 948 |
| 1813 | Ga0501045_0001715 | 3300049824 | Bacteria | 14765 |
| 1814 | Ga0501045_0334010 | 3300049824 | Bacteria | 1128 |
| 1815 | Ga0501045_0786164 | 3300049824 | Bacteria | 701 |
| 1816 | Ga0501204_025851 | 3300049850 | Bacteria | 792 |
| 1817 | nmdc:mga03683_177435_c1 | 3300050489 | Bacteria | 971 |
| 1818 | nmdc:mga03683_25558_c1 | 3300050489 | Bacteria | 2322 |
| 1819 | nmdc:mga03683_348988_c1 | 3300050489 | Bacteria | 700 |
| 1820 | nmdc:mga03n38_15142_c1 | 3300050490 | Bacteria | 2972 |
| 1821 | nmdc:mga03n38_167867_c1 | 3300050490 | Bacteria | 1116 |
| 1822 | nmdc:mga03n38_408113_c1 | 3300050490 | Bacteria | 749 |
| 1823 | nmdc:mga03n38_564306_c1 | 3300050490 | Bacteria | 645 |
| 1824 | nmdc:mga03n38_83412_c2 | 3300050490 | Bacteria | 1064 |
| 1825 | nmdc:mga00v17_1284_c1 | 3300050491 | Bacteria | 13184 |
| 1826 | nmdc:mga00v17_243765_c1 | 3300050491 | Bacteria | 1165 |
| 1827 | nmdc:mga00v17_257607_c1 | 3300050491 | Bacteria | 1132 |
| 1828 | nmdc:mga00v17_26923_c1 | 3300050491 | Bacteria | 3354 |
| 1829 | nmdc:mga00v17_818324_c1 | 3300050491 | Bacteria | 593 |
| 1830 | nmdc:mga0yw44_126980_c1 | 3300050492 | Bacteria | 1648 |
| 1831 | nmdc:mga0yw44_158476_c1 | 3300050492 | Bacteria | 1481 |
| 1832 | nmdc:mga0yw44_167639_c1 | 3300050492 | Bacteria | 1441 |
| 1833 | nmdc:mga0yw44_174646_c1 | 3300050492 | Bacteria | 1412 |
| 1834 | nmdc:mga0yw44_175118_c1 | 3300050492 | Bacteria | 1410 |
| 1835 | nmdc:mga0yw44_231648_c1 | 3300050492 | Bacteria | 1226 |
| 1836 | nmdc:mga0yw44_24060_c1 | 3300050492 | Bacteria | 3441 |
| 1837 | nmdc:mga0yw44_29953_c1 | 3300050492 | Bacteria | 3148 |
| 1838 | nmdc:mga0yw44_3148_c2 | 3300050492 | Bacteria | 3283 |
| 1839 | nmdc:mga0yw44_53959_c1 | 3300050492 | Bacteria | 2442 |
| 1840 | nmdc:mga0yw44_57394_c1 | 3300050492 | Bacteria | 2375 |
| 1841 | nmdc:mga0yw44_622060_c1 | 3300050492 | Bacteria | 734 |
| 1842 | nmdc:mga0yw44_68829_c1 | 3300050492 | Bacteria | 2191 |
| 1843 | nmdc:mga0k408_20070_c1 | 3300050493 | Bacteria | 3739 |
| 1844 | nmdc:mga0k408_240627_c1 | 3300050493 | Bacteria | 1081 |
| 1845 | nmdc:mga0k408_263196_c1 | 3300050493 | Bacteria | 1030 |
| 1846 | nmdc:mga0k408_439977_c1 | 3300050493 | Bacteria | 775 |
| 1847 | nmdc:mga0k408_579178_c1 | 3300050493 | Bacteria | 663 |
| 1848 | nmdc:mga06z11_118295_c1 | 3300050494 | Bacteria | 1476 |
| 1849 | nmdc:mga06z11_149729_c1 | 3300050494 | Bacteria | 1326 |
| 1850 | nmdc:mga06z11_167200_c1 | 3300050494 | Bacteria | 1261 |
| 1851 | nmdc:mga06z11_384457_c1 | 3300050494 | Bacteria | 843 |
| 1852 | nmdc:mga06z11_471270_c1 | 3300050494 | Bacteria | 760 |
| 1853 | nmdc:mga06z11_640924_c1 | 3300050494 | Bacteria | 647 |
| 1854 | nmdc:mga06z11_70427_c1 | 3300050494 | Bacteria | 1849 |
| 1855 | nmdc:mga06z11_76642_c2 | 3300050494 | Bacteria | 1437 |
| 1856 | nmdc:mga04h51_20498_c1 | 3300050495 | Bacteria | 1975 |
| 1857 | nmdc:mga04h51_40208_c1 | 3300050495 | Bacteria | 1523 |
| 1858 | nmdc:mga04h51_80770_c1 | 3300050495 | Bacteria | 1153 |
| 1859 | nmdc:mga07m45_187182_c1 | 3300050496 | Bacteria | 1204 |
| 1860 | nmdc:mga07m45_199906_c1 | 3300050496 | Bacteria | 1163 |
| 1861 | nmdc:mga07m45_292431_c1 | 3300050496 | Bacteria | 948 |
| 1862 | nmdc:mga07m45_480802_c1 | 3300050496 | Bacteria | 720 |
| 1863 | nmdc:mga07m45_65659_c1 | 3300050496 | Bacteria | 2060 |
| 1864 | nmdc:mga07m45_68266_c1 | 3300050496 | Bacteria | 2021 |
| 1865 | nmdc:mga07m45_87948_c1 | 3300050496 | Bacteria | 1778 |
| 1866 | nmdc:mga05p37_107787_c1 | 3300050507 | Bacteria | 3427 |
| 1867 | nmdc:mga09592_1193976_c1 | 3300050508 | Bacteria | 629 |
| 1868 | nmdc:mga0qj67_328369_c1 | 3300050509 | Bacteria | 1238 |
| 1869 | nmdc:mga0n895_442643_c1 | 3300050512 | Bacteria | 1313 |
| 1870 | nmdc:mga0n895_5268_c1 | 3300050512 | Bacteria | 10768 |
| 1871 | nmdc:mga0rr50_615796_c1 | 3300050513 | Bacteria | 926 |
| 1872 | nmdc:mga0sz30_130156_c1 | 3300050516 | Bacteria | 1109 |
| 1873 | nmdc:mga0sz30_132964_c1 | 3300050516 | Bacteria | 1097 |
| 1874 | nmdc:mga0sz30_135357_c1 | 3300050516 | Bacteria | 1087 |
| 1875 | nmdc:mga0sz30_146402_c1 | 3300050516 | Bacteria | 1044 |
| 1876 | nmdc:mga0sz30_17788_c1 | 3300050516 | Bacteria | 2838 |
| 1877 | nmdc:mga0sz30_236683_c1 | 3300050516 | Bacteria | 813 |
| 1878 | nmdc:mga0sz30_24769_c1 | 3300050516 | Bacteria | 2451 |
| 1879 | Ga0495601_0056376 | 3300053077 | Bacteria | 2488 |
| 1880 | Ga0495601_0158728 | 3300053077 | Bacteria | 1478 |
| 1881 | Ga0495601_0174072 | 3300053077 | Bacteria | 1407 |
| 1882 | Ga0495601_0234530 | 3300053077 | Bacteria | 1198 |
| 1883 | Ga0495612_0052075 | 3300053078 | Bacteria | 1683 |
| 1884 | Ga0495612_0137090 | 3300053078 | Bacteria | 1060 |
| 1885 | Ga0495612_0338722 | 3300053078 | Bacteria | 678 |
| 1886 | Ga0500610_0086740 | 3300053079 | Bacteria | 1628 |
| 1887 | Ga0500610_0102190 | 3300053079 | Bacteria | 1482 |
| 1888 | Ga0500635_0095247 | 3300053080 | Bacteria | 1088 |
| 1889 | Ga0495655_0013054 | 3300053083 | Bacteria | 1708 |
| 1890 | Ga0495655_0033255 | 3300053083 | Bacteria | 1267 |
| 1891 | Ga0495655_0084300 | 3300053083 | Bacteria | 914 |
| 1892 | Ga0495595_0006801 | 3300053084 | Bacteria | 4667 |
| 1893 | Ga0495619_0001443 | 3300053085 | Bacteria | 15640 |
| 1894 | Ga0500578_0014351 | 3300053086 | Bacteria | 5096 |
| 1895 | Ga0500578_0015697 | 3300053086 | Bacteria | 4863 |
| 1896 | Ga0500578_0084328 | 3300053086 | Bacteria | 2019 |
| 1897 | Ga0500578_0156352 | 3300053086 | Bacteria | 1417 |
| 1898 | Ga0500578_0178822 | 3300053086 | Bacteria | 1308 |
| 1899 | Ga0500643_000227 | 3300053087 | Bacteria | 52101 |
| 1900 | Ga0500643_021452 | 3300053087 | Bacteria | 2093 |
| 1901 | Ga0500643_035296 | 3300053087 | Bacteria | 1501 |
| 1902 | Ga0500644_0008515 | 3300053088 | Bacteria | 2710 |
| 1903 | Ga0500644_0268444 | 3300053088 | Bacteria | 723 |
| 1904 | Ga0500646_0013276 | 3300053090 | Bacteria | 2131 |
| 1905 | Ga0500646_0187275 | 3300053090 | Bacteria | 704 |
| 1906 | Ga0500647_0082642 | 3300053091 | Bacteria | 1540 |
| 1907 | Ga0500583_0205078 | 3300053092 | Bacteria | 979 |
| 1908 | Ga0500583_0251208 | 3300053092 | Bacteria | 873 |
| 1909 | Ga0500651_0021718 | 3300053093 | Bacteria | 4003 |
| 1910 | Ga0500651_0224117 | 3300053093 | Bacteria | 1101 |
| 1911 | Ga0500651_0268116 | 3300053093 | Bacteria | 988 |
| 1912 | Ga0500651_0286415 | 3300053093 | Bacteria | 949 |
| 1913 | Ga0500566_0000320 | 3300053094 | Bacteria | 25974 |
| 1914 | Ga0500566_0034994 | 3300053094 | Bacteria | 2919 |
| 1915 | Ga0500566_0361817 | 3300053094 | Bacteria | 661 |
| 1916 | Ga0500640_031882 | 3300053095 | Bacteria | 2311 |
| 1917 | Ga0500640_065532 | 3300053095 | Bacteria | 1566 |
| 1918 | Ga0500641_0003415 | 3300053096 | Bacteria | 5615 |
| 1919 | Ga0500641_0153810 | 3300053096 | Bacteria | 992 |
| 1920 | Ga0500650_0001944 | 3300053098 | Bacteria | 6560 |
| 1921 | Ga0500650_0225259 | 3300053098 | Bacteria | 847 |
| 1922 | Ga0500650_0275431 | 3300053098 | Bacteria | 749 |
| 1923 | Ga0500654_119310 | 3300053099 | Bacteria | 1045 |
| 1924 | Ga0500654_132521 | 3300053099 | Bacteria | 938 |
| 1925 | Ga0500554_085161 | 3300053102 | Bacteria | 1045 |
| 1926 | Ga0500554_103480 | 3300053102 | Bacteria | 954 |
| 1927 | Ga0500555_003915 | 3300053103 | Bacteria | 4237 |
| 1928 | Ga0500555_030794 | 3300053103 | Bacteria | 1522 |
| 1929 | Ga0500555_096216 | 3300053103 | Bacteria | 756 |
| 1930 | Ga0500556_0000125 | 3300053104 | Bacteria | 65777 |
| 1931 | Ga0500556_0301825 | 3300053104 | Bacteria | 626 |
| 1932 | Ga0500557_156065 | 3300053105 | Bacteria | 749 |
| 1933 | Ga0500562_029407 | 3300053108 | Bacteria | 1445 |
| 1934 | Ga0500562_051142 | 3300053108 | Bacteria | 1105 |
| 1935 | Ga0500562_179705 | 3300053108 | Bacteria | 574 |
| 1936 | Ga0500569_015781 | 3300053109 | Bacteria | 1898 |
| 1937 | Ga0500569_123083 | 3300053109 | Bacteria | 864 |
| 1938 | Ga0500569_249165 | 3300053109 | Bacteria | 602 |
| 1939 | Ga0500572_001453 | 3300053111 | Bacteria | 6482 |
| 1940 | Ga0500572_003008 | 3300053111 | Bacteria | 3934 |
| 1941 | Ga0500572_004079 | 3300053111 | Bacteria | 3319 |
| 1942 | Ga0500572_005431 | 3300053111 | Bacteria | 2886 |
| 1943 | Ga0500592_012356 | 3300053116 | Bacteria | 1367 |
| 1944 | Ga0500594_0003742 | 3300053118 | Bacteria | 3351 |
| 1945 | Ga0500594_0076516 | 3300053118 | Bacteria | 993 |
| 1946 | Ga0500594_0128286 | 3300053118 | Bacteria | 801 |
| 1947 | Ga0500595_004583 | 3300053119 | Bacteria | 6165 |
| 1948 | Ga0500595_016409 | 3300053119 | Bacteria | 2759 |
| 1949 | Ga0500595_029914 | 3300053119 | Bacteria | 1842 |
| 1950 | Ga0500595_070086 | 3300053119 | Bacteria | 1042 |
| 1951 | Ga0500595_089460 | 3300053119 | Bacteria | 892 |
| 1952 | Ga0500607_099409 | 3300053121 | Bacteria | 1447 |
| 1953 | Ga0500608_014127 | 3300053122 | Bacteria | 3557 |
| 1954 | Ga0500608_075094 | 3300053122 | Bacteria | 1603 |
| 1955 | Ga0500614_006081 | 3300053123 | Bacteria | 2538 |
| 1956 | Ga0500614_014604 | 3300053123 | Bacteria | 1742 |
| 1957 | Ga0500614_148761 | 3300053123 | Bacteria | 704 |
| 1958 | Ga0500618_007381 | 3300053125 | Bacteria | 3141 |
| 1959 | Ga0500618_018644 | 3300053125 | Bacteria | 1715 |
| 1960 | Ga0500618_021998 | 3300053125 | Bacteria | 1552 |
| 1961 | Ga0500618_048846 | 3300053125 | Bacteria | 960 |
| 1962 | Ga0500623_204432 | 3300053127 | Bacteria | 724 |
| 1963 | Ga0500626_191428 | 3300053128 | Bacteria | 815 |
| 1964 | Ga0500642_0000105 | 3300053130 | Bacteria | 40593 |
| 1965 | Ga0500642_0428789 | 3300053130 | Bacteria | 571 |
| 1966 | Ga0500652_000301 | 3300053131 | Bacteria | 17879 |
| 1967 | Ga0500655_069503 | 3300053133 | Bacteria | 716 |
| 1968 | Ga0500658_0041978 | 3300053134 | Bacteria | 1836 |
| 1969 | Ga0500658_0132638 | 3300053134 | Bacteria | 1112 |
| 1970 | Ga0500658_0163884 | 3300053134 | Bacteria | 1008 |
| 1971 | Ga0500559_0002803 | 3300053136 | Bacteria | 8808 |
| 1972 | Ga0500559_0004117 | 3300053136 | Bacteria | 6972 |
| 1973 | Ga0500559_0047761 | 3300053136 | Bacteria | 1880 |
| 1974 | Ga0500559_0094839 | 3300053136 | Bacteria | 1369 |
| 1975 | Ga0500564_004201 | 3300053138 | Bacteria | 5729 |
| 1976 | Ga0500564_189623 | 3300053138 | Bacteria | 852 |
| 1977 | Ga0500568_0001953 | 3300053139 | Bacteria | 12637 |
| 1978 | Ga0500568_0003848 | 3300053139 | Bacteria | 8189 |
| 1979 | Ga0500568_0050784 | 3300053139 | Bacteria | 1633 |
| 1980 | Ga0500568_0054507 | 3300053139 | Bacteria | 1563 |
| 1981 | Ga0500568_0060124 | 3300053139 | Bacteria | 1472 |
| 1982 | Ga0500568_0121610 | 3300053139 | Bacteria | 972 |
| 1983 | Ga0500573_0051024 | 3300053140 | Bacteria | 2379 |
| 1984 | Ga0500577_0083822 | 3300053142 | Bacteria | 1276 |
| 1985 | Ga0500586_000283 | 3300053145 | Bacteria | 10219 |
| 1986 | Ga0500588_0027678 | 3300053146 | Bacteria | 1599 |
| 1987 | Ga0500589_076626 | 3300053147 | Bacteria | 1501 |
| 1988 | Ga0500590_019927 | 3300053148 | Bacteria | 3477 |
| 1989 | Ga0500590_082463 | 3300053148 | Bacteria | 1576 |
| 1990 | Ga0500603_009617 | 3300053150 | Bacteria | 2166 |
| 1991 | Ga0500603_013709 | 3300053150 | Bacteria | 1883 |
| 1992 | Ga0500604_0036252 | 3300053151 | Bacteria | 1470 |
| 1993 | Ga0500604_0049762 | 3300053151 | Bacteria | 1289 |
| 1994 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 1995 | Ga0500616_0000876 | 3300053153 | Bacteria | 33191 |
| 1996 | Ga0500616_0004053 | 3300053153 | Bacteria | 10652 |
| 1997 | Ga0500616_0015762 | 3300053153 | Bacteria | 4314 |
| 1998 | Ga0500616_0023156 | 3300053153 | Bacteria | 3462 |
| 1999 | Ga0500616_0037795 | 3300053153 | Bacteria | 2611 |
| 2000 | Ga0500616_0091357 | 3300053153 | Bacteria | 1507 |
| 2001 | Ga0500616_0140697 | 3300053153 | Bacteria | 1128 |
| 2002 | Ga0500619_000847 | 3300053154 | Bacteria | 5225 |
| 2003 | Ga0500620_001784 | 3300053155 | Bacteria | 4106 |
| 2004 | Ga0500620_011956 | 3300053155 | Bacteria | 2346 |
| 2005 | Ga0500620_106040 | 3300053155 | Bacteria | 983 |
| 2006 | Ga0500622_0001277 | 3300053156 | Bacteria | 20505 |
| 2007 | Ga0500622_0004034 | 3300053156 | Bacteria | 9449 |
| 2008 | Ga0500622_0071766 | 3300053156 | Bacteria | 1749 |
| 2009 | Ga0500624_003843 | 3300053157 | Bacteria | 1969 |
| 2010 | Ga0500624_005626 | 3300053157 | Bacteria | 1672 |
| 2011 | Ga0500624_014638 | 3300053157 | Bacteria | 1189 |
| 2012 | Ga0500627_0004443 | 3300053158 | Bacteria | 4507 |
| 2013 | Ga0500627_0057865 | 3300053158 | Bacteria | 1701 |
| 2014 | Ga0500627_0064661 | 3300053158 | Bacteria | 1613 |
| 2015 | Ga0500627_0075227 | 3300053158 | Bacteria | 1500 |
| 2016 | Ga0500627_0228549 | 3300053158 | Bacteria | 828 |
| 2017 | Ga0500630_030399 | 3300053159 | Bacteria | 2656 |
| 2018 | Ga0500633_0133711 | 3300053160 | Bacteria | 926 |
| 2019 | Ga0500633_0148145 | 3300053160 | Bacteria | 879 |
| 2020 | Ga0500634_0094521 | 3300053161 | Bacteria | 1509 |
| 2021 | Ga0500638_002268 | 3300053162 | Bacteria | 6590 |
| 2022 | Ga0500638_135474 | 3300053162 | Bacteria | 1111 |
| 2023 | Ga0500638_202755 | 3300053162 | Bacteria | 838 |
| 2024 | Ga0500639_002134 | 3300053163 | Bacteria | 9896 |
| 2025 | Ga0500639_099603 | 3300053163 | Bacteria | 1433 |
| 2026 | Ga0500636_0004057 | 3300053177 | Bacteria | 8266 |
| 2027 | Ga0500636_0105133 | 3300053177 | Bacteria | 1600 |
| 2028 | Ga0500636_0122353 | 3300053177 | Bacteria | 1458 |
| 2029 | Ga0500636_0210649 | 3300053177 | Bacteria | 1020 |
| 2030 | Ga0500636_0241209 | 3300053177 | Bacteria | 928 |
| 2031 | Ga0500637_0022986 | 3300053178 | Bacteria | 3402 |
| 2032 | Ga0500637_0073848 | 3300053178 | Bacteria | 1964 |
| 2033 | Ga0500637_0105143 | 3300053178 | Bacteria | 1637 |
| 2034 | Ga0500637_0129175 | 3300053178 | Bacteria | 1465 |
| 2035 | Ga0500567_099548 | 3300053723 | Bacteria | 1211 |
| 2036 | Ga0500567_144680 | 3300053723 | Bacteria | 903 |
| 2037 | Ga0500611_000533 | 3300053727 | Bacteria | 3857 |
| 2038 | Ga0500611_017745 | 3300053727 | Bacteria | 1301 |
| 2039 | Ga0500645_012887 | 3300053730 | Bacteria | 2694 |
| 2040 | Ga0500645_095920 | 3300053730 | Bacteria | 839 |
| 2041 | Ga0500645_100114 | 3300053730 | Bacteria | 818 |
| 2042 | Ga0500609_001189 | 3300053731 | Bacteria | 3871 |
| 2043 | Ga0500609_012600 | 3300053731 | Bacteria | 1144 |
| 2044 | Ga0500552_001810 | 3300053733 | Bacteria | 2050 |
| 2045 | Ga0500596_002522 | 3300053735 | Bacteria | 3610 |
| 2046 | Ga0500596_002612 | 3300053735 | Bacteria | 3536 |
| 2047 | Ga0500596_005669 | 3300053735 | Bacteria | 2172 |
| 2048 | Ga0500601_000668 | 3300053737 | Bacteria | 4680 |
| 2049 | Ga0501084_0208952 | 3300054114 | Bacteria | 1647 |
| 2050 | Ga0587084_002030 | 3300059477 | Bacteria | 2034 |
| 2051 | Ga0587084_020477 | 3300059477 | Bacteria | 984 |
| 2052 | Ga0587084_027157 | 3300059477 | Bacteria | 898 |
| 2053 | Ga0587084_065251 | 3300059477 | Bacteria | 676 |
| 2054 | Ga0587093_006135 | 3300059478 | Bacteria | 1297 |
| 2055 | Ga0587093_025816 | 3300059478 | Bacteria | 817 |
| 2056 | Ga0587066_016961 | 3300059490 | Bacteria | 1154 |
| 2057 | Ga0587066_025694 | 3300059490 | Bacteria | 1012 |
| 2058 | Ga0587066_049213 | 3300059490 | Bacteria | 823 |
| 2059 | Ga0587066_092013 | 3300059490 | Bacteria | 675 |
| 2060 | Ga0587070_003021 | 3300059491 | Bacteria | 1973 |
| 2061 | Ga0587070_021067 | 3300059491 | Bacteria | 1097 |
| 2062 | Ga0587070_028503 | 3300059491 | Bacteria | 996 |
| 2063 | Ga0587070_050158 | 3300059491 | Bacteria | 831 |
| 2064 | Ga0587073_0002863 | 3300059492 | Bacteria | 2283 |
| 2065 | Ga0587073_0003501 | 3300059492 | Bacteria | 2159 |
| 2066 | Ga0587073_0020094 | 3300059492 | Bacteria | 1269 |
| 2067 | Ga0587073_0077065 | 3300059492 | Bacteria | 819 |
| 2068 | Ga0587077_000009 | 3300059493 | Bacteria | 7681 |
| 2069 | Ga0587077_000966 | 3300059493 | Bacteria | 2861 |
| 2070 | Ga0587077_001192 | 3300059493 | Bacteria | 2699 |
| 2071 | Ga0587077_007037 | 3300059493 | Bacteria | 1621 |
| 2072 | Ga0587077_084584 | 3300059493 | Bacteria | 735 |
| 2073 | Ga0587077_086847 | 3300059493 | Bacteria | 728 |
| 2074 | Ga0587077_100241 | 3300059493 | Bacteria | 695 |
| 2075 | Ga0587080_001548 | 3300059503 | Bacteria | 2523 |
| 2076 | Ga0587080_021206 | 3300059503 | Bacteria | 1067 |
| 2077 | Ga0587080_025000 | 3300059503 | Bacteria | 1005 |
| 2078 | Ga0587080_030585 | 3300059503 | Bacteria | 935 |
| 2079 | Ga0587080_046042 | 3300059503 | Bacteria | 810 |
| 2080 | Ga0587080_055123 | 3300059503 | Bacteria | 761 |
| 2081 | Ga0587080_073464 | 3300059503 | Bacteria | 689 |
| 2082 | Ga0587080_080642 | 3300059503 | Bacteria | 667 |
| 2083 | Ga0587082_002172 | 3300059504 | Bacteria | 2171 |
| 2084 | Ga0587082_010331 | 3300059504 | Bacteria | 1345 |
| 2085 | Ga0587082_011836 | 3300059504 | Bacteria | 1284 |
| 2086 | Ga0587082_018124 | 3300059504 | Bacteria | 1117 |
| 2087 | Ga0587082_060319 | 3300059504 | Bacteria | 746 |
| 2088 | Ga0587083_0000779 | 3300059505 | Bacteria | 3164 |
| 2089 | Ga0587083_0005010 | 3300059505 | Bacteria | 1886 |
| 2090 | Ga0587083_0009643 | 3300059505 | Bacteria | 1543 |
| 2091 | Ga0587083_0048563 | 3300059505 | Bacteria | 917 |
| 2092 | Ga0587083_0063068 | 3300059505 | Bacteria | 841 |
| 2093 | Ga0587083_0070597 | 3300059505 | Bacteria | 810 |
| 2094 | Ga0587083_0143102 | 3300059505 | Bacteria | 639 |
| 2095 | Ga0587086_012441 | 3300059507 | Bacteria | 1057 |
| 2096 | Ga0587086_019666 | 3300059507 | Bacteria | 911 |
| 2097 | Ga0587086_025772 | 3300059507 | Bacteria | 834 |
| 2098 | Ga0587088_003238 | 3300059508 | Bacteria | 1952 |
| 2099 | Ga0587088_005796 | 3300059508 | Bacteria | 1641 |
| 2100 | Ga0587088_092060 | 3300059508 | Bacteria | 665 |
| 2101 | Ga0587089_014607 | 3300059509 | Bacteria | 1028 |
| 2102 | Ga0587090_014809 | 3300059510 | Bacteria | 1145 |
| 2103 | Ga0587090_033265 | 3300059510 | Bacteria | 873 |
| 2104 | Ga0587090_044553 | 3300059510 | Bacteria | 793 |
| 2105 | Ga0587091_002706 | 3300059511 | Bacteria | 2139 |
| 2106 | Ga0587091_030088 | 3300059511 | Bacteria | 1013 |
| 2107 | Ga0587091_069227 | 3300059511 | Bacteria | 768 |
| 2108 | Ga0587091_123639 | 3300059511 | Bacteria | 631 |
| 2109 | Ga0587092_030647 | 3300059512 | Bacteria | 888 |
| 2110 | Ga0587094_003207 | 3300059513 | Bacteria | 1762 |
| 2111 | Ga0587094_010537 | 3300059513 | Bacteria | 1201 |
| 2112 | Ga0587094_025919 | 3300059513 | Bacteria | 881 |
| 2113 | Ga0587095_001259 | 3300059514 | Bacteria | 1524 |
| 2114 | Ga0587106_000532 | 3300059605 | Bacteria | 2754 |
| 2115 | Ga0587106_001821 | 3300059605 | Bacteria | 1981 |
| 2116 | Ga0587106_032656 | 3300059605 | Bacteria | 844 |
| 2117 | Ga0587106_048323 | 3300059605 | Bacteria | 746 |
| 2118 | Ga0587106_065610 | 3300059605 | Bacteria | 677 |
| 2119 | Ga0587125_000201 | 3300059607 | Bacteria | 2966 |
| 2120 | Ga0587099_000819 | 3300059622 | Bacteria | 1980 |
| 2121 | Ga0587101_000083 | 3300059623 | Bacteria | 4378 |
| 2122 | Ga0587101_001406 | 3300059623 | Bacteria | 2070 |
| 2123 | Ga0587101_001709 | 3300059623 | Bacteria | 1953 |
| 2124 | Ga0587101_026514 | 3300059623 | Bacteria | 875 |
| 2125 | Ga0587101_033032 | 3300059623 | Bacteria | 817 |
| 2126 | Ga0587113_018961 | 3300059625 | Bacteria | 709 |
| 2127 | Ga0587117_001509 | 3300059627 | Bacteria | 1988 |
| 2128 | Ga0587128_001043 | 3300059630 | Bacteria | 2460 |
| 2129 | Ga0587128_002525 | 3300059630 | Bacteria | 1917 |
| 2130 | Ga0587128_014831 | 3300059630 | Bacteria | 1121 |
| 2131 | Ga0587062_000087 | 3300059639 | Bacteria | 4502 |
| 2132 | Ga0587062_001045 | 3300059639 | Bacteria | 2235 |
| 2133 | Ga0587067_000579 | 3300059640 | Bacteria | 3324 |
| 2134 | Ga0587067_002914 | 3300059640 | Bacteria | 2086 |
| 2135 | Ga0587067_020253 | 3300059640 | Bacteria | 1135 |
| 2136 | Ga0587067_040989 | 3300059640 | Bacteria | 900 |
| 2137 | Ga0587068_004710 | 3300059641 | Bacteria | 1818 |
| 2138 | Ga0587068_005189 | 3300059641 | Bacteria | 1764 |
| 2139 | Ga0587068_017886 | 3300059641 | Bacteria | 1137 |
| 2140 | Ga0587068_027314 | 3300059641 | Bacteria | 970 |
| 2141 | Ga0587069_000933 | 3300059642 | Bacteria | 2487 |
| 2142 | Ga0587069_007649 | 3300059642 | Bacteria | 1341 |
| 2143 | Ga0587069_066102 | 3300059642 | Bacteria | 677 |
| 2144 | Ga0587072_001084 | 3300059643 | Bacteria | 3200 |
| 2145 | Ga0587072_023890 | 3300059643 | Bacteria | 1102 |
| 2146 | Ga0587072_057239 | 3300059643 | Bacteria | 795 |
| 2147 | Ga0587075_007386 | 3300059644 | Bacteria | 1377 |
| 2148 | Ga0587075_045319 | 3300059644 | Bacteria | 751 |
| 2149 | Ga0587076_001067 | 3300059645 | Bacteria | 2654 |
| 2150 | Ga0587076_002866 | 3300059645 | Bacteria | 1988 |
| 2151 | Ga0587076_006339 | 3300059645 | Bacteria | 1573 |
| 2152 | Ga0587076_012964 | 3300059645 | Bacteria | 1255 |
| 2153 | Ga0587076_013372 | 3300059645 | Bacteria | 1244 |
| 2154 | Ga0587076_040978 | 3300059645 | Bacteria | 865 |
| 2155 | Ga0587076_047296 | 3300059645 | Bacteria | 826 |
| 2156 | Ga0587078_001949 | 3300059646 | Bacteria | 1943 |
| 2157 | Ga0587078_003530 | 3300059646 | Bacteria | 1592 |
| 2158 | Ga0587078_011343 | 3300059646 | Bacteria | 1034 |
| 2159 | Ga0587078_025263 | 3300059646 | Bacteria | 774 |
| 2160 | Ga0587079_001640 | 3300059647 | Bacteria | 2567 |
| 2161 | Ga0587079_001675 | 3300059647 | Bacteria | 2547 |
| 2162 | Ga0587079_035708 | 3300059647 | Bacteria | 979 |
| 2163 | Ga0587079_081662 | 3300059647 | Bacteria | 741 |
| 2164 | Ga0587100_000435 | 3300059648 | Bacteria | 1974 |
| 2165 | Ga0587100_009027 | 3300059648 | Bacteria | 816 |
| 2166 | Ga0587102_001812 | 3300059649 | Bacteria | 1566 |
| 2167 | Ga0587102_013443 | 3300059649 | Bacteria | 847 |
| 2168 | Ga0587104_000880 | 3300059650 | Bacteria | 1447 |
| 2169 | Ga0587105_000231 | 3300059651 | Bacteria | 2030 |
| 2170 | Ga0587107_000246 | 3300059652 | Bacteria | 3204 |
| 2171 | Ga0587107_011972 | 3300059652 | Bacteria | 1073 |
| 2172 | Ga0587107_026748 | 3300059652 | Bacteria | 849 |
| 2173 | Ga0587107_030915 | 3300059652 | Bacteria | 814 |
| 2174 | Ga0587107_032044 | 3300059652 | Bacteria | 806 |
| 2175 | Ga0587107_050262 | 3300059652 | Bacteria | 705 |
| 2176 | Ga0587107_063701 | 3300059652 | Bacteria | 657 |
| 2177 | Ga0587110_003745 | 3300059654 | Bacteria | 1289 |
| 2178 | Ga0587114_015371 | 3300059655 | Bacteria | 1011 |
| 2179 | Ga0587118_01321 | 3300059657 | Bacteria | 1483 |
| 2180 | Ga0587124_001062 | 3300059660 | Bacteria | 1707 |
| 2181 | Ga0587071_004370 | 3300060344 | Bacteria | 2102 |
| 2182 | Ga0587071_038692 | 3300060344 | Bacteria | 948 |
| 2183 | Ga0587071_039260 | 3300060344 | Bacteria | 943 |
| 2184 | Ga0587071_084729 | 3300060344 | Bacteria | 711 |
| 2185 | Ga0587111_0008874 | 3300060346 | Bacteria | 1679 |
| 2186 | Ga0587111_0021561 | 3300060346 | Bacteria | 1244 |
| 2187 | Ga0587111_0026461 | 3300060346 | Bacteria | 1156 |
| 2188 | Ga0587111_0174304 | 3300060346 | Bacteria | 594 |
| 2189 | Ga0501082_0077674 | 3300060353 | Bacteria | 2863 |
| 2190 | Ga0501082_0949836 | 3300060353 | Bacteria | 752 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10803025 | Ga0114129_108030252 | 156 |
| 2 | 3300042157 | Ga0439458_0024387 | Ga0439458_0024387_95_604 | 156 |
| 3 | 3300050494 | nmdc:mga06z11_640924_c1 | nmdc:mga06z11_640924_c1_108_617 | 156 |
| 4 | 3300012483 | Ga0157337_1004344 | Ga0157337_10043442 | 162 |
| 5 | 3300053087 | Ga0500643_035296 | Ga0500643_035296_884_1393 | 162 |
| 6 | 3300053092 | Ga0500583_0205078 | Ga0500583_0205078_243_752 | 162 |
| 7 | 3300005578 | Ga0068854_100289438 | Ga0068854_1002894383 | 163 |
| 8 | 3300005937 | Ga0081455_10011724 | Ga0081455_1001172414 | 163 |
| 9 | 3300025981 | Ga0207640_10082080 | Ga0207640_100820802 | 163 |
| 10 | 3300037471 | Ga0395905_0122200 | Ga0395905_0122200_1418_1951 | 163 |
| 11 | 3300049743 | Ga0501081_0373523 | Ga0501081_0373523_468_1001 | 163 |
| 12 | 3300001989 | JGI24739J22299_10023100 | JGI24739J22299_100231003 | 164 |
| 13 | 3300001990 | JGI24737J22298_10014566 | JGI24737J22298_100145662 | 164 |
| 14 | 3300005366 | Ga0070659_100093075 | Ga0070659_1000930753 | 164 |
| 15 | 3300005563 | Ga0068855_100748333 | Ga0068855_1007483331 | 164 |
| 16 | 3300006195 | Ga0075366_10807706 | Ga0075366_108077061 | 164 |
| 17 | 3300025297 | Ga0209758_1005457 | Ga0209758_100545712 | 164 |
| 18 | 3300025932 | Ga0207690_10180895 | Ga0207690_101808953 | 164 |
| 19 | 3300025949 | Ga0207667_10374831 | Ga0207667_103748314 | 164 |
| 20 | 3300033180 | Ga0307510_10019223 | Ga0307510_100192237 | 164 |
| 21 | 3300049576 | Ga0501040_0185433 | Ga0501040_0185433_429_938 | 164 |
| 22 | 3300049578 | Ga0501042_0490992 | Ga0501042_0490992_360_869 | 164 |
| 23 | 3300050494 | nmdc:mga06z11_149729_c1 | nmdc:mga06z11_149729_c1_59_592 | 164 |
| 24 | 3300050507 | nmdc:mga05p37_107787_c1 | nmdc:mga05p37_107787_c1_154_687 | 164 |
| 25 | 3300050516 | nmdc:mga0sz30_135357_c1 | nmdc:mga0sz30_135357_c1_397_930 | 164 |
| 26 | 3300013249 | Ga0171463_1011 | Ga0171463_101141 | 166 |
| 27 | 3300015690 | Ga0183363_1121 | Ga0183363_11217 | 166 |
| 28 | 3300031995 | Ga0307409_101062512 | Ga0307409_1010625122 | 166 |
| 29 | 3300053095 | Ga0500640_065532 | Ga0500640_065532_303_836 | 166 |
| 30 | 3300059503 | Ga0587080_021206 | Ga0587080_021206_44_544 | 166 |
| 31 | 3300003752 | Ga0055539_1004785 | Ga0055539_10047854 | 167 |
| 32 | 3300006042 | Ga0075368_10127719 | Ga0075368_101277192 | 167 |
| 33 | 3300006186 | Ga0075369_10307634 | Ga0075369_103076341 | 167 |
| 34 | 3300006358 | Ga0068871_100185062 | Ga0068871_1001850622 | 167 |
| 35 | 3300025253 | Ga0209677_100816 | Ga0209677_10081616 | 167 |
| 36 | 3300025302 | Ga0207426_1000605 | Ga0207426_10006051 | 167 |
| 37 | 3300035692 | Ga0373935_1310739 | Ga0373935_1310739_12_515 | 167 |
| 38 | 3300042004 | Ga0439445_0195117 | Ga0439445_0195117_71_574 | 167 |
| 39 | 3300046506 | Ga0495583_0092005 | Ga0495583_0092005_782_1285 | 167 |
| 40 | 3300048903 | Ga0496100_1423029 | Ga0496100_1423029_32_535 | 167 |
| 41 | 3300048921 | Ga0496118_0038146 | Ga0496118_0038146_23_556 | 167 |
| 42 | 3300048924 | Ga0496121_0071016 | Ga0496121_0071016_957_1490 | 167 |
| 43 | 3300049742 | Ga0501080_0214502 | Ga0501080_0214502_1242_1745 | 167 |
| 44 | 3300049742 | Ga0501080_1012279 | Ga0501080_1012279_22_525 | 167 |
| 45 | 3300005335 | Ga0070666_10353481 | Ga0070666_103534812 | 168 |
| 46 | 3300005353 | Ga0070669_100178786 | Ga0070669_1001787861 | 168 |
| 47 | 3300005842 | Ga0068858_100281378 | Ga0068858_1002813783 | 168 |
| 48 | 3300009101 | Ga0105247_10183825 | Ga0105247_101838253 | 168 |
| 49 | 3300025261 | Ga0209233_1000925 | Ga0209233_10009255 | 168 |
| 50 | 3300025903 | Ga0207680_10151154 | Ga0207680_101511543 | 168 |
| 51 | 3300053153 | Ga0500616_0000085 | Ga0500616_0000085_137586_138119 | 168 |
| 52 | 3300060346 | Ga0587111_0174304 | Ga0587111_0174304_19_552 | 168 |
| 53 | iso_pu_bacteria | 2965110997 | 2965119198 | 168 |
| 54 | 3300005327 | Ga0070658_10129002 | Ga0070658_101290025 | 169 |
| 55 | 3300009101 | Ga0105247_10651234 | Ga0105247_106512341 | 169 |
| 56 | 3300009174 | Ga0105241_10497460 | Ga0105241_104974602 | 169 |
| 57 | 3300009553 | Ga0105249_10359397 | Ga0105249_103593972 | 169 |
| 58 | 3300011119 | Ga0105246_10860944 | Ga0105246_108609442 | 169 |
| 59 | 3300012477 | Ga0157336_1011556 | Ga0157336_10115561 | 169 |
| 60 | 3300012492 | Ga0157335_1017071 | Ga0157335_10170712 | 169 |
| 61 | 3300013297 | Ga0157378_11749985 | Ga0157378_117499852 | 169 |
| 62 | 3300013306 | Ga0163162_10420389 | Ga0163162_104203894 | 169 |
| 63 | 3300014325 | Ga0163163_11277198 | Ga0163163_112771982 | 169 |
| 64 | 3300014497 | Ga0182008_10702647 | Ga0182008_107026471 | 169 |
| 65 | 3300014745 | Ga0157377_10577928 | Ga0157377_105779282 | 169 |
| 66 | 3300015261 | Ga0182006_1076059 | Ga0182006_10760593 | 169 |
| 67 | 3300025909 | Ga0207705_10897083 | Ga0207705_108970832 | 169 |
| 68 | 3300035083 | Ga0373926_0068693 | Ga0373926_0068693_418_927 | 169 |
| 69 | 3300035088 | Ga0373940_0085362 | Ga0373940_0085362_213_722 | 169 |
| 70 | 3300035089 | Ga0373944_0024464 | Ga0373944_0024464_130_639 | 169 |
| 71 | 3300035092 | Ga0373952_0007333 | Ga0373952_0007333_1013_1522 | 169 |
| 72 | 3300035113 | Ga0373936_0022605 | Ga0373936_0022605_1038_1547 | 169 |
| 73 | 3300035170 | Ga0373943_0003463 | Ga0373943_0003463_902_1411 | 169 |
| 74 | 3300035172 | Ga0373955_0368936 | Ga0373955_0368936_264_773 | 169 |
| 75 | 3300035241 | Ga0373961_0124000 | Ga0373961_0124000_216_725 | 169 |
| 76 | 3300035691 | Ga0373931_0051137 | Ga0373931_0051137_65_574 | 169 |
| 77 | 3300035692 | Ga0373935_0006317 | Ga0373935_0006317_4337_4846 | 169 |
| 78 | 3300035695 | Ga0373927_0025754 | Ga0373927_0025754_2095_2604 | 169 |
| 79 | 3300035724 | Ga0373933_0153266 | Ga0373933_0153266_774_1283 | 169 |
| 80 | 3300037068 | Ga0373925_0005636 | Ga0373925_0005636_6901_7410 | 169 |
| 81 | 3300037418 | Ga0395900_0050005 | Ga0395900_0050005_3642_4151 | 169 |
| 82 | 3300037466 | Ga0395898_0104107 | Ga0395898_0104107_1857_2366 | 169 |
| 83 | 3300037471 | Ga0395905_0546988 | Ga0395905_0546988_24_533 | 169 |
| 84 | 3300037853 | Ga0436364_0877349 | Ga0436364_0877349_256_765 | 169 |
| 85 | 3300041463 | Ga0451804_0446889 | Ga0451804_0446889_436_945 | 169 |
| 86 | 3300042011 | Ga0439454_004038 | Ga0439454_004038_659_1168 | 169 |
| 87 | 3300042438 | Ga0439459_0149042 | Ga0439459_0149042_13_522 | 169 |
| 88 | 3300046454 | Ga0495592_0076879 | Ga0495592_0076879_59_568 | 169 |
| 89 | 3300046455 | Ga0495603_0007442 | Ga0495603_0007442_2085_2594 | 169 |
| 90 | 3300046459 | Ga0495629_0016778 | Ga0495629_0016778_4418_4927 | 169 |
| 91 | 3300046460 | Ga0495638_0360000 | Ga0495638_0360000_228_737 | 169 |
| 92 | 3300046461 | Ga0495641_0012494 | Ga0495641_0012494_2092_2601 | 169 |
| 93 | 3300046463 | Ga0495653_0104959 | Ga0495653_0104959_705_1214 | 169 |
| 94 | 3300046471 | Ga0495650_0143952 | Ga0495650_0143952_124_633 | 169 |
| 95 | 3300046472 | Ga0495580_0022295 | Ga0495580_0022295_853_1362 | 169 |
| 96 | 3300046472 | Ga0495580_0243520 | Ga0495580_0243520_99_608 | 169 |
| 97 | 3300046473 | Ga0495582_0000163 | Ga0495582_0000163_2251_2760 | 169 |
| 98 | 3300046474 | Ga0495605_0201719 | Ga0495605_0201719_280_789 | 169 |
| 99 | 3300046475 | Ga0495639_0000873 | Ga0495639_0000873_7583_8092 | 169 |
| 100 | 3300046475 | Ga0495639_0036968 | Ga0495639_0036968_897_1406 | 169 |
| 101 | 3300046476 | Ga0495662_0000285 | Ga0495662_0000285_2497_3006 | 169 |
| 102 | 3300046477 | Ga0495664_0005138 | Ga0495664_0005138_3144_3653 | 169 |
| 103 | 3300046499 | Ga0495594_0002164 | Ga0495594_0002164_2233_2742 | 169 |
| 104 | 3300046512 | Ga0495610_0049985 | Ga0495610_0049985_712_1221 | 169 |
| 105 | 3300046514 | Ga0495618_0034866 | Ga0495618_0034866_736_1245 | 169 |
| 106 | 3300046515 | Ga0495620_0041601 | Ga0495620_0041601_647_1156 | 169 |
| 107 | 3300046516 | Ga0495628_0106321 | Ga0495628_0106321_418_927 | 169 |
| 108 | 3300046517 | Ga0495630_0027680 | Ga0495630_0027680_2190_2699 | 169 |
| 109 | 3300046518 | Ga0495631_0163607 | Ga0495631_0163607_65_574 | 169 |
| 110 | 3300046519 | Ga0495632_0148294 | Ga0495632_0148294_344_853 | 169 |
| 111 | 3300046519 | Ga0495632_0406026 | Ga0495632_0406026_57_566 | 169 |
| 112 | 3300046522 | Ga0495643_0120853 | Ga0495643_0120853_456_965 | 169 |
| 113 | 3300046526 | Ga0495666_0057685 | Ga0495666_0057685_97_606 | 169 |
| 114 | 3300046526 | Ga0495666_0057810 | Ga0495666_0057810_337_846 | 169 |
| 115 | 3300046529 | Ga0495652_0091173 | Ga0495652_0091173_265_774 | 169 |
| 116 | 3300046530 | Ga0495654_0202547 | Ga0495654_0202547_179_688 | 169 |
| 117 | 3300046531 | Ga0495665_0004495 | Ga0495665_0004495_4365_4874 | 169 |
| 118 | 3300046533 | Ga0495640_0017722 | Ga0495640_0017722_2808_3317 | 169 |
| 119 | 3300046537 | Ga0495598_0263375 | Ga0495598_0263375_97_606 | 169 |
| 120 | 3300046538 | Ga0495609_0169871 | Ga0495609_0169871_303_812 | 169 |
| 121 | 3300046543 | Ga0495645_0592660 | Ga0495645_0592660_19_528 | 169 |
| 122 | 3300046559 | Ga0495667_0032383 | Ga0495667_0032383_2446_2955 | 169 |
| 123 | 3300046616 | Ga0495668_0201897 | Ga0495668_0201897_276_785 | 169 |
| 124 | 3300046648 | Ga0495611_0234501 | Ga0495611_0234501_82_591 | 169 |
| 125 | 3300046663 | Ga0495635_0036862 | Ga0495635_0036862_2020_2529 | 169 |
| 126 | 3300046674 | Ga0495588_0079565 | Ga0495588_0079565_26_535 | 169 |
| 127 | 3300046680 | Ga0495646_0009353 | Ga0495646_0009353_4924_5433 | 169 |
| 128 | 3300046681 | Ga0495647_0006072 | Ga0495647_0006072_2081_2590 | 169 |
| 129 | 3300046681 | Ga0495647_0085938 | Ga0495647_0085938_209_718 | 169 |
| 130 | 3300046683 | Ga0495658_0001480 | Ga0495658_0001480_5079_5588 | 169 |
| 131 | 3300046684 | Ga0495669_0071622 | Ga0495669_0071622_743_1252 | 169 |
| 132 | 3300046689 | Ga0495613_0068299 | Ga0495613_0068299_1836_2345 | 169 |
| 133 | 3300046690 | Ga0495624_0004478 | Ga0495624_0004478_2709_3218 | 169 |
| 134 | 3300046692 | Ga0495671_0066997 | Ga0495671_0066997_779_1288 | 169 |
| 135 | 3300047315 | Ga0495581_0004107 | Ga0495581_0004107_840_1349 | 169 |
| 136 | 3300047317 | Ga0495604_0298678 | Ga0495604_0298678_525_1034 | 169 |
| 137 | 3300047319 | Ga0495674_0081704 | Ga0495674_0081704_380_889 | 169 |
| 138 | 3300047320 | Ga0495672_0215848 | Ga0495672_0215848_301_810 | 169 |
| 139 | 3300047320 | Ga0495672_0224259 | Ga0495672_0224259_393_902 | 169 |
| 140 | 3300047321 | Ga0495676_0522864 | Ga0495676_0522864_250_759 | 169 |
| 141 | 3300047469 | Ga0495673_0206468 | Ga0495673_0206468_74_583 | 169 |
| 142 | 3300047673 | Ga0495593_0003980 | Ga0495593_0003980_2552_3061 | 169 |
| 143 | 3300048089 | Ga0495614_0096077 | Ga0495614_0096077_624_1133 | 169 |
| 144 | 3300048903 | Ga0496100_1082482 | Ga0496100_1082482_93_602 | 169 |
| 145 | 3300048905 | Ga0496102_0597617 | Ga0496102_0597617_323_832 | 169 |
| 146 | 3300048907 | Ga0496104_0134355 | Ga0496104_0134355_340_849 | 169 |
| 147 | 3300048907 | Ga0496104_0424340 | Ga0496104_0424340_17_526 | 169 |
| 148 | 3300048908 | Ga0496105_0068020 | Ga0496105_0068020_818_1327 | 169 |
| 149 | 3300048909 | Ga0496106_0012368 | Ga0496106_0012368_3684_4193 | 169 |
| 150 | 3300048910 | Ga0496107_0195912 | Ga0496107_0195912_413_922 | 169 |
| 151 | 3300048912 | Ga0496109_0052420 | Ga0496109_0052420_2617_3126 | 169 |
| 152 | 3300048913 | Ga0496110_0893074 | Ga0496110_0893074_207_716 | 169 |
| 153 | 3300048915 | Ga0496112_0065915 | Ga0496112_0065915_563_1072 | 169 |
| 154 | 3300048916 | Ga0496113_1280684 | Ga0496113_1280684_49_558 | 169 |
| 155 | 3300048917 | Ga0496114_0202573 | Ga0496114_0202573_699_1208 | 169 |
| 156 | 3300048918 | Ga0496115_0224324 | Ga0496115_0224324_311_820 | 169 |
| 157 | 3300048919 | Ga0496116_0087897 | Ga0496116_0087897_516_1025 | 169 |
| 158 | 3300048926 | Ga0496123_0130297 | Ga0496123_0130297_443_952 | 169 |
| 159 | 3300048926 | Ga0496123_0180592 | Ga0496123_0180592_475_984 | 169 |
| 160 | 3300048929 | Ga0496126_0055514 | Ga0496126_0055514_2355_2864 | 169 |
| 161 | 3300049459 | Ga0495678_114186 | Ga0495678_114186_134_643 | 169 |
| 162 | 3300049460 | Ga0495682_0114243 | Ga0495682_0114243_197_706 | 169 |
| 163 | 3300049652 | Ga0501202_125437 | Ga0501202_125437_123_632 | 169 |
| 164 | 3300050492 | nmdc:mga0yw44_158476_c1 | nmdc:mga0yw44_158476_c1_140_649 | 169 |
| 165 | 3300050493 | nmdc:mga0k408_579178_c1 | nmdc:mga0k408_579178_c1_23_532 | 169 |
| 166 | 3300053077 | Ga0495601_0174072 | Ga0495601_0174072_693_1202 | 169 |
| 167 | 3300053078 | Ga0495612_0338722 | Ga0495612_0338722_21_530 | 169 |
| 168 | 3300053083 | Ga0495655_0084300 | Ga0495655_0084300_186_695 | 169 |
| 169 | 3300053086 | Ga0500578_0156352 | Ga0500578_0156352_18_527 | 169 |
| 170 | 3300053087 | Ga0500643_000227 | Ga0500643_000227_35925_36434 | 169 |
| 171 | 3300053094 | Ga0500566_0034994 | Ga0500566_0034994_1859_2368 | 169 |
| 172 | 3300053096 | Ga0500641_0153810 | Ga0500641_0153810_19_528 | 169 |
| 173 | 3300053098 | Ga0500650_0225259 | Ga0500650_0225259_284_793 | 169 |
| 174 | 3300053099 | Ga0500654_119310 | Ga0500654_119310_518_1027 | 169 |
| 175 | 3300053103 | Ga0500555_003915 | Ga0500555_003915_2777_3286 | 169 |
| 176 | 3300053108 | Ga0500562_179705 | Ga0500562_179705_52_561 | 169 |
| 177 | 3300053109 | Ga0500569_249165 | Ga0500569_249165_52_561 | 169 |
| 178 | 3300053111 | Ga0500572_005431 | Ga0500572_005431_779_1288 | 169 |
| 179 | 3300053118 | Ga0500594_0076516 | Ga0500594_0076516_35_544 | 169 |
| 180 | 3300053119 | Ga0500595_004583 | Ga0500595_004583_5637_6146 | 169 |
| 181 | 3300053119 | Ga0500595_089460 | Ga0500595_089460_47_556 | 169 |
| 182 | 3300053122 | Ga0500608_014127 | Ga0500608_014127_155_664 | 169 |
| 183 | 3300053123 | Ga0500614_006081 | Ga0500614_006081_1367_1876 | 169 |
| 184 | 3300053125 | Ga0500618_018644 | Ga0500618_018644_698_1207 | 169 |
| 185 | 3300053127 | Ga0500623_204432 | Ga0500623_204432_74_583 | 169 |
| 186 | 3300053130 | Ga0500642_0428789 | Ga0500642_0428789_13_522 | 169 |
| 187 | 3300053136 | Ga0500559_0047761 | Ga0500559_0047761_709_1218 | 169 |
| 188 | 3300053138 | Ga0500564_004201 | Ga0500564_004201_2748_3257 | 169 |
| 189 | 3300053139 | Ga0500568_0121610 | Ga0500568_0121610_13_522 | 169 |
| 190 | 3300053147 | Ga0500589_076626 | Ga0500589_076626_227_736 | 169 |
| 191 | 3300053150 | Ga0500603_013709 | Ga0500603_013709_633_1142 | 169 |
| 192 | 3300053154 | Ga0500619_000847 | Ga0500619_000847_4622_5131 | 169 |
| 193 | 3300053155 | Ga0500620_011956 | Ga0500620_011956_662_1171 | 169 |
| 194 | 3300053157 | Ga0500624_005626 | Ga0500624_005626_66_575 | 169 |
| 195 | 3300053162 | Ga0500638_002268 | Ga0500638_002268_4492_5001 | 169 |
| 196 | 3300053178 | Ga0500637_0105143 | Ga0500637_0105143_47_556 | 169 |
| 197 | 3300053178 | Ga0500637_0129175 | Ga0500637_0129175_623_1132 | 169 |
| 198 | 3300053723 | Ga0500567_144680 | Ga0500567_144680_376_885 | 169 |
| 199 | 3300060353 | Ga0501082_0949836 | Ga0501082_0949836_228_737 | 169 |
| 200 | 3300001977 | JGI24746J21847_1014539 | JGI24746J21847_10145392 | 170 |
| 201 | 3300002077 | JGI24744J21845_10011648 | JGI24744J21845_100116483 | 170 |
| 202 | 3300002244 | JGI24742J22300_10008938 | JGI24742J22300_100089383 | 170 |
| 203 | 3300005328 | Ga0070676_10175790 | Ga0070676_101757901 | 170 |
| 204 | 3300005340 | Ga0070689_100395279 | Ga0070689_1003952791 | 170 |
| 205 | 3300005365 | Ga0070688_100350601 | Ga0070688_1003506012 | 170 |
| 206 | 3300005367 | Ga0070667_100244954 | Ga0070667_1002449541 | 170 |
| 207 | 3300005457 | Ga0070662_100524098 | Ga0070662_1005240982 | 170 |
| 208 | 3300005539 | Ga0068853_101187741 | Ga0068853_1011877411 | 170 |
| 209 | 3300005718 | Ga0068866_10315407 | Ga0068866_103154072 | 170 |
| 210 | 3300006237 | Ga0097621_100639187 | Ga0097621_1006391872 | 170 |
| 211 | 3300013306 | Ga0163162_10599872 | Ga0163162_105998722 | 170 |
| 212 | 3300025302 | Ga0207426_1102888 | Ga0207426_11028882 | 170 |
| 213 | 3300025899 | Ga0207642_10154579 | Ga0207642_101545792 | 170 |
| 214 | 3300025914 | Ga0207671_10307566 | Ga0207671_103075662 | 170 |
| 215 | 3300025934 | Ga0207686_10113572 | Ga0207686_101135723 | 170 |
| 216 | 3300025935 | Ga0207709_10213516 | Ga0207709_102135161 | 170 |
| 217 | 3300028381 | Ga0268264_10447926 | Ga0268264_104479262 | 170 |
| 218 | iso_pu_bacteria | 2876406927 | 2876407196 | 170 |
| 219 | 3300026116 | Ga0207674_10151658 | Ga0207674_101516581 | 172 |
| 220 | 3300031456 | Ga0307513_10585943 | Ga0307513_105859431 | 172 |
| 221 | 3300059639 | Ga0587062_000087 | Ga0587062_000087_2196_2729 | 172 |
| 222 | iso_pu_bacteria | 2503198000 | 2503202652 | 173 |
| 223 | iso_pu_bacteria | 2507262055 | 2507509767 | 173 |
| 224 | iso_pu_bacteria | 2508501009 | 2508543783 | 173 |
| 225 | iso_pu_bacteria | 2508501042 | 2508698429 | 173 |
| 226 | iso_pu_bacteria | 2508501050 | 2508735876 | 173 |
| 227 | iso_pu_bacteria | 2508501122 | 2509112687 | 173 |
| 228 | iso_pu_bacteria | 2508501123 | 2509117733 | 173 |
| 229 | iso_pu_bacteria | 2508501127 | 2509143582 | 173 |
| 230 | iso_pu_bacteria | 2509276018 | 2509373003 | 173 |
| 231 | iso_pu_bacteria | 2509276019 | 2509380423 | 173 |
| 232 | iso_pu_bacteria | 2509276021 | 2509387438 | 173 |
| 233 | iso_pu_bacteria | 2509276022 | 2509397157 | 173 |
| 234 | iso_pu_bacteria | 2509276033 | 2509442828 | 173 |
| 235 | iso_pu_bacteria | 2510065019 | 2510132549 | 173 |
| 236 | iso_pu_bacteria | 2510065057 | 2510308401 | 173 |
| 237 | iso_pu_bacteria | 2510065059 | 2510319905 | 173 |
| 238 | iso_pu_bacteria | 2510461069 | 2510843195 | 173 |
| 239 | iso_pu_bacteria | 2510461076 | 2510893894 | 173 |
| 240 | iso_pu_bacteria | 2510461076 | 2510898919 | 173 |
| 241 | iso_pu_bacteria | 2510917022 | 2511132387 | 173 |
| 242 | iso_pu_bacteria | 2510917026 | 2511174065 | 173 |
| 243 | iso_pu_bacteria | 2510917028 | 2511181291 | 173 |
| 244 | iso_pu_bacteria | 2510917030 | 2511193811 | 173 |
| 245 | iso_pu_bacteria | 2511231027 | 2511390488 | 173 |
| 246 | iso_pu_bacteria | 2511231028 | 2511396967 | 173 |
| 247 | iso_pu_bacteria | 2511231052 | 2511501272 | 173 |
| 248 | iso_pu_bacteria | 2512047086 | 2512532697 | 173 |
| 249 | iso_pu_bacteria | 2512875016 | 2512930574 | 173 |
| 250 | iso_pu_bacteria | 2512875024 | 2512958306 | 173 |
| 251 | iso_pu_bacteria | 2512875026 | 2512971974 | 173 |
| 252 | iso_pu_bacteria | 2513237084 | 2513574103 | 173 |
| 253 | iso_pu_bacteria | 2513237085 | 2513579041 | 173 |
| 254 | iso_pu_bacteria | 2513237086 | 2513587134 | 173 |
| 255 | iso_pu_bacteria | 2513237088 | 2513599768 | 173 |
| 256 | iso_pu_bacteria | 2513237089 | 2513607081 | 173 |
| 257 | iso_pu_bacteria | 2513237090 | 2513612119 | 173 |
| 258 | iso_pu_bacteria | 2513237091 | 2513620837 | 173 |
| 259 | iso_pu_bacteria | 2513237092 | 2513625283 | 173 |
| 260 | iso_pu_bacteria | 2513237093 | 2513632522 | 173 |
| 261 | iso_pu_bacteria | 2513237094 | 2513644600 | 173 |
| 262 | iso_pu_bacteria | 2513237095 | 2513646167 | 173 |
| 263 | iso_pu_bacteria | 2513237096 | 2513658403 | 173 |
| 264 | iso_pu_bacteria | 2513237101 | 2513695926 | 173 |
| 265 | iso_pu_bacteria | 2513237103 | 2513708971 | 173 |
| 266 | iso_pu_bacteria | 2513237137 | 2513857521 | 173 |
| 267 | iso_pu_bacteria | 2513237138 | 2513866864 | 173 |
| 268 | iso_pu_bacteria | 2513237139 | 2513875845 | 173 |
| 269 | iso_pu_bacteria | 2513237140 | 2513886844 | 173 |
| 270 | iso_pu_bacteria | 2513237143 | 2513906985 | 173 |
| 271 | iso_pu_bacteria | 2513237144 | 2513909597 | 173 |
| 272 | iso_pu_bacteria | 2513237145 | 2513920105 | 173 |
| 273 | iso_pu_bacteria | 2513237146 | 2513929471 | 173 |
| 274 | iso_pu_bacteria | 2513237156 | 2513987842 | 173 |
| 275 | iso_pu_bacteria | 2513237159 | 2514002399 | 173 |
| 276 | iso_pu_bacteria | 2513237160 | 2514008879 | 173 |
| 277 | iso_pu_bacteria | 2513237161 | 2514011488 | 173 |
| 278 | iso_pu_bacteria | 2513237162 | 2514019598 | 173 |
| 279 | iso_pu_bacteria | 2513237164 | 2514032561 | 173 |
| 280 | iso_pu_bacteria | 2513237305 | 2514422072 | 173 |
| 281 | iso_pu_bacteria | 2513237351 | 2514589877 | 173 |
| 282 | iso_pu_bacteria | 2515075009 | 2515111539 | 173 |
| 283 | iso_pu_bacteria | 2515154107 | 2515613332 | 173 |
| 284 | iso_pu_bacteria | 2515154112 | 2515630021 | 173 |
| 285 | iso_pu_bacteria | 2515154113 | 2515639322 | 173 |
| 286 | iso_pu_bacteria | 2515154114 | 2515646522 | 173 |
| 287 | iso_pu_bacteria | 2515154116 | 2515661954 | 173 |
| 288 | iso_pu_bacteria | 2515154134 | 2515744445 | 173 |
| 289 | iso_pu_bacteria | 2516143018 | 2516209150 | 173 |
| 290 | iso_pu_bacteria | 2516653046 | 2516892554 | 173 |
| 291 | iso_pu_bacteria | 2516653077 | 2517040185 | 173 |
| 292 | iso_pu_bacteria | 2516653085 | 2517075727 | 173 |
| 293 | iso_pu_bacteria | 2517093000 | 2517094316 | 173 |
| 294 | iso_pu_bacteria | 2517093001 | 2517103533 | 173 |
| 295 | iso_pu_bacteria | 2517287029 | 2517406118 | 173 |
| 296 | iso_pu_bacteria | 2517487022 | 2517569366 | 173 |
| 297 | iso_pu_bacteria | 2517572143 | 2517893474 | 173 |
| 298 | iso_pu_bacteria | 2519899620 | 2520375132 | 173 |
| 299 | iso_pu_bacteria | 2524023205 | 2524441042 | 173 |
| 300 | iso_pu_bacteria | 2524023207 | 2524454329 | 173 |
| 301 | iso_pu_bacteria | 2524023209 | 2524461383 | 173 |
| 302 | iso_pu_bacteria | 2524023210 | 2524469984 | 173 |
| 303 | iso_pu_bacteria | 2524023228 | 2524537979 | 173 |
| 304 | iso_pu_bacteria | 2528768022 | 2528856450 | 173 |
| 305 | iso_pu_bacteria | 2529292951 | 2530643640 | 173 |
| 306 | iso_pu_bacteria | 2534681786 | 2535484933 | 173 |
| 307 | iso_pu_bacteria | 2534681796 | 2535515869 | 173 |
| 308 | iso_pu_bacteria | 2537561587 | 2537874335 | 173 |
| 309 | iso_pu_bacteria | 2551306084 | 2551678254 | 173 |
| 310 | iso_pu_bacteria | 2551306085 | 2551687645 | 173 |
| 311 | iso_pu_bacteria | 2551306086 | 2551695269 | 173 |
| 312 | iso_pu_bacteria | 2551306087 | 2551699385 | 173 |
| 313 | iso_pu_bacteria | 2551306089 | 2551711309 | 173 |
| 314 | iso_pu_bacteria | 2551306090 | 2551723056 | 173 |
| 315 | iso_pu_bacteria | 2551306091 | 2551728468 | 173 |
| 316 | iso_pu_bacteria | 2551306091 | 2551730899 | 173 |
| 317 | iso_pu_bacteria | 2551306092 | 2551733991 | 173 |
| 318 | iso_pu_bacteria | 2551306093 | 2551742267 | 173 |
| 319 | iso_pu_bacteria | 2554235003 | 2554248080 | 173 |
| 320 | iso_pu_bacteria | 2558860100 | 2558863227 | 173 |
| 321 | iso_pu_bacteria | 2558860242 | 2559295197 | 173 |
| 322 | iso_pu_bacteria | 2558860983 | 2561468206 | 173 |
| 323 | iso_pu_bacteria | 2582581283 | 2585168178 | 173 |
| 324 | iso_pu_bacteria | 2582581294 | 2585199615 | 173 |
| 325 | iso_pu_bacteria | 2582581298 | 2585226126 | 173 |
| 326 | iso_pu_bacteria | 2582581299 | 2585231211 | 173 |
| 327 | iso_pu_bacteria | 2582581304 | 2585254082 | 173 |
| 328 | iso_pu_bacteria | 2582581306 | 2585268793 | 173 |
| 329 | iso_pu_bacteria | 2582581307 | 2585273001 | 173 |
| 330 | iso_pu_bacteria | 2582581308 | 2585282859 | 173 |
| 331 | iso_pu_bacteria | 2582581315 | 2585325225 | 173 |
| 332 | iso_pu_bacteria | 2582581316 | 2585333358 | 173 |
| 333 | iso_pu_bacteria | 2582581865 | 2585390971 | 173 |
| 334 | iso_pu_bacteria | 2582581866 | 2585398179 | 173 |
| 335 | iso_pu_bacteria | 2582581867 | 2585400393 | 173 |
| 336 | iso_pu_bacteria | 2585427526 | 2585529500 | 173 |
| 337 | iso_pu_bacteria | 2585427527 | 2585534941 | 173 |
| 338 | iso_pu_bacteria | 2585427528 | 2585543717 | 173 |
| 339 | iso_pu_bacteria | 2585427529 | 2585547160 | 173 |
| 340 | iso_pu_bacteria | 2585427530 | 2585551612 | 173 |
| 341 | iso_pu_bacteria | 2585427531 | 2585558040 | 173 |
| 342 | iso_pu_bacteria | 2585427590 | 2585824501 | 173 |
| 343 | iso_pu_bacteria | 2585427593 | 2585842045 | 173 |
| 344 | iso_pu_bacteria | 2585427594 | 2585845542 | 173 |
| 345 | iso_pu_bacteria | 2585427608 | 2585897491 | 173 |
| 346 | iso_pu_bacteria | 2585427609 | 2585904922 | 173 |
| 347 | iso_pu_bacteria | 2585427633 | 2585995387 | 173 |
| 348 | iso_pu_bacteria | 2585427634 | 2585999942 | 173 |
| 349 | iso_pu_bacteria | 2585428125 | 2587979962 | 173 |
| 350 | iso_pu_bacteria | 2588253730 | 2588516216 | 173 |
| 351 | iso_pu_bacteria | 2597489875 | 2597813663 | 173 |
| 352 | iso_pu_bacteria | 2599185156 | 2599333507 | 173 |
| 353 | iso_pu_bacteria | 2599185170 | 2599418316 | 173 |
| 354 | iso_pu_bacteria | 2599185210 | 2599601517 | 173 |
| 355 | iso_pu_bacteria | 2599185236 | 2599721229 | 173 |
| 356 | iso_pu_bacteria | 2599185301 | 2599939551 | 173 |
| 357 | iso_pu_bacteria | 2599185352 | 2600192216 | 173 |
| 358 | iso_pu_bacteria | 2600254933 | 2600375484 | 173 |
| 359 | iso_pu_bacteria | 2600255279 | 2601612146 | 173 |
| 360 | iso_pu_bacteria | 2600255308 | 2601749070 | 173 |
| 361 | iso_pu_bacteria | 2602042107 | 2603859856 | 173 |
| 362 | iso_pu_bacteria | 2615840624 | 2616298080 | 173 |
| 363 | iso_pu_bacteria | 2615840626 | 2616308128 | 173 |
| 364 | iso_pu_bacteria | 2615840698 | 2616556852 | 173 |
| 365 | iso_pu_bacteria | 2617270735 | 2617349291 | 173 |
| 366 | iso_pu_bacteria | 2617270742 | 2617381488 | 173 |
| 367 | iso_pu_bacteria | 2643221550 | 2643773778 | 173 |
| 368 | iso_pu_bacteria | 2643221551 | 2643775182 | 173 |
| 369 | iso_pu_bacteria | 2643221555 | 2643793628 | 173 |
| 370 | iso_pu_bacteria | 2643221557 | 2643808296 | 173 |
| 371 | iso_pu_bacteria | 2643221558 | 2643812206 | 173 |
| 372 | iso_pu_bacteria | 2643221564 | 2643837516 | 173 |
| 373 | iso_pu_bacteria | 2643221568 | 2643857822 | 173 |
| 374 | iso_pu_bacteria | 2643221582 | 2643919619 | 173 |
| 375 | iso_pu_bacteria | 2643221595 | 2643987311 | 173 |
| 376 | iso_pu_bacteria | 2643221599 | 2644006161 | 173 |
| 377 | iso_pu_bacteria | 2643221607 | 2644049681 | 173 |
| 378 | iso_pu_bacteria | 2643221610 | 2644068116 | 173 |
| 379 | iso_pu_bacteria | 2643221618 | 2644108033 | 173 |
| 380 | iso_pu_bacteria | 2643221623 | 2644131939 | 173 |
| 381 | iso_pu_bacteria | 2643221626 | 2644150543 | 173 |
| 382 | iso_pu_bacteria | 2643221627 | 2644155635 | 173 |
| 383 | iso_pu_bacteria | 2643221634 | 2644191300 | 173 |
| 384 | iso_pu_bacteria | 2643221636 | 2644203911 | 173 |
| 385 | iso_pu_bacteria | 2643221637 | 2644207705 | 173 |
| 386 | iso_pu_bacteria | 2643221643 | 2644240101 | 173 |
| 387 | iso_pu_bacteria | 2643221653 | 2644300123 | 173 |
| 388 | iso_pu_bacteria | 2643221655 | 2644310101 | 173 |
| 389 | iso_pu_bacteria | 2643221659 | 2644335305 | 173 |
| 390 | iso_pu_bacteria | 2643221668 | 2644379286 | 173 |
| 391 | iso_pu_bacteria | 2643221675 | 2644419060 | 173 |
| 392 | iso_pu_bacteria | 2643221680 | 2644450421 | 173 |
| 393 | iso_pu_bacteria | 2643221686 | 2644482714 | 173 |
| 394 | iso_pu_bacteria | 2643221688 | 2644494812 | 173 |
| 395 | iso_pu_bacteria | 2643221689 | 2644499205 | 173 |
| 396 | iso_pu_bacteria | 2643221693 | 2644520158 | 173 |
| 397 | iso_pu_bacteria | 2643221698 | 2644544820 | 173 |
| 398 | iso_pu_bacteria | 2643221712 | 2644617147 | 173 |
| 399 | iso_pu_bacteria | 2643221718 | 2644654488 | 173 |
| 400 | iso_pu_bacteria | 2643221719 | 2644658349 | 173 |
| 401 | iso_pu_bacteria | 2643221723 | 2644677793 | 173 |
| 402 | iso_pu_bacteria | 2643221726 | 2644687284 | 173 |
| 403 | iso_pu_bacteria | 2657244999 | 2657686413 | 173 |
| 404 | iso_pu_bacteria | 2667528174 | 2671114758 | 173 |
| 405 | iso_pu_bacteria | 2667528175 | 2671118112 | 173 |
| 406 | iso_pu_bacteria | 2687453392 | 2688599072 | 173 |
| 407 | iso_pu_bacteria | 2690316117 | 2692316533 | 173 |
| 408 | iso_pu_bacteria | 2693429783 | 2694631921 | 173 |
| 409 | iso_pu_bacteria | 2693429784 | 2694634658 | 173 |
| 410 | iso_pu_bacteria | 2718217882 | 2719180524 | 173 |
| 411 | iso_pu_bacteria | 2718217927 | 2719385118 | 173 |
| 412 | iso_pu_bacteria | 2718217997 | 2719664877 | 173 |
| 413 | iso_pu_bacteria | 2718218009 | 2719731273 | 173 |
| 414 | iso_pu_bacteria | 2718218199 | 2720491297 | 173 |
| 415 | iso_pu_bacteria | 2718218232 | 2720612657 | 173 |
| 416 | iso_pu_bacteria | 2718218233 | 2720619495 | 173 |
| 417 | iso_pu_bacteria | 2718218235 | 2720630951 | 173 |
| 418 | iso_pu_bacteria | 2718218269 | 2720774589 | 173 |
| 419 | iso_pu_bacteria | 2718218363 | 2721146618 | 173 |
| 420 | iso_pu_bacteria | 2718218365 | 2721158143 | 173 |
| 421 | iso_pu_bacteria | 2718218366 | 2721163497 | 173 |
| 422 | iso_pu_bacteria | 2718218423 | 2721398838 | 173 |
| 423 | iso_pu_bacteria | 2721755514 | 2722839667 | 173 |
| 424 | iso_pu_bacteria | 2721755556 | 2723026314 | 173 |
| 425 | iso_pu_bacteria | 2721755684 | 2723559857 | 173 |
| 426 | iso_pu_bacteria | 2721755685 | 2723566477 | 173 |
| 427 | iso_pu_bacteria | 2721755686 | 2723576076 | 173 |
| 428 | iso_pu_bacteria | 2721755755 | 2723846158 | 173 |
| 429 | iso_pu_bacteria | 2721755809 | 2724037651 | 173 |
| 430 | iso_pu_bacteria | 2721755810 | 2724044029 | 173 |
| 431 | iso_pu_bacteria | 2721755819 | 2724089196 | 173 |
| 432 | iso_pu_bacteria | 2721755822 | 2724103742 | 173 |
| 433 | iso_pu_bacteria | 2721755823 | 2724109580 | 173 |
| 434 | iso_pu_bacteria | 2724679232 | 2725948695 | 173 |
| 435 | iso_pu_bacteria | 2728368998 | 2728747763 | 173 |
| 436 | iso_pu_bacteria | 2728369352 | 2730107250 | 173 |
| 437 | iso_pu_bacteria | 2728369365 | 2730163761 | 173 |
| 438 | iso_pu_bacteria | 2728369397 | 2730297775 | 173 |
| 439 | iso_pu_bacteria | 2738541293 | 2738799606 | 173 |
| 440 | iso_pu_bacteria | 2738541317 | 2738945241 | 173 |
| 441 | iso_pu_bacteria | 2738541333 | 2739038921 | 173 |
| 442 | iso_pu_bacteria | 2738543024 | 2739309057 | 173 |
| 443 | iso_pu_bacteria | 2744054633 | 2745082435 | 173 |
| 444 | iso_pu_bacteria | 2751185800 | 2753359562 | 173 |
| 445 | iso_pu_bacteria | 2751185821 | 2753460134 | 173 |
| 446 | iso_pu_bacteria | 2756170246 | 2756677766 | 173 |
| 447 | iso_pu_bacteria | 2757320392 | 2757572025 | 173 |
| 448 | iso_pu_bacteria | 2758568016 | 2758641823 | 173 |
| 449 | iso_pu_bacteria | 2765235802 | 2765465548 | 173 |
| 450 | iso_pu_bacteria | 2765235942 | 2766063709 | 173 |
| 451 | iso_pu_bacteria | 2767802442 | 2770195573 | 173 |
| 452 | iso_pu_bacteria | 2773857925 | 2774868366 | 173 |
| 453 | iso_pu_bacteria | 2775506901 | 2776259150 | 173 |
| 454 | iso_pu_bacteria | 2775506902 | 2776271565 | 173 |
| 455 | iso_pu_bacteria | 2775506904 | 2776279923 | 173 |
| 456 | iso_pu_bacteria | 2775507049 | 2776913091 | 173 |
| 457 | iso_pu_bacteria | 2775507266 | 2778176277 | 173 |
| 458 | iso_pu_bacteria | 2791355082 | 2792581297 | 173 |
| 459 | iso_pu_bacteria | 2791355091 | 2792624837 | 173 |
| 460 | iso_pu_bacteria | 2791355092 | 2792630871 | 173 |
| 461 | iso_pu_bacteria | 2791355094 | 2792642401 | 173 |
| 462 | iso_pu_bacteria | 2791355123 | 2792750759 | 173 |
| 463 | iso_pu_bacteria | 2791355196 | 2793060259 | 173 |
| 464 | iso_pu_bacteria | 2791355197 | 2793071769 | 173 |
| 465 | iso_pu_bacteria | 2791355199 | 2793076672 | 173 |
| 466 | iso_pu_bacteria | 2791355253 | 2793282381 | 173 |
| 467 | iso_pu_bacteria | 2791355256 | 2793299599 | 173 |
| 468 | iso_pu_bacteria | 2791355259 | 2793318468 | 173 |
| 469 | iso_pu_bacteria | 2791355260 | 2793325209 | 173 |
| 470 | iso_pu_bacteria | 2791355261 | 2793331451 | 173 |
| 471 | iso_pu_bacteria | 2791355262 | 2793337875 | 173 |
| 472 | iso_pu_bacteria | 2791355263 | 2793344740 | 173 |
| 473 | iso_pu_bacteria | 2791355264 | 2793351000 | 173 |
| 474 | iso_pu_bacteria | 2791355265 | 2793357347 | 173 |
| 475 | iso_pu_bacteria | 2791355266 | 2793364024 | 173 |
| 476 | iso_pu_bacteria | 2791355267 | 2793371080 | 173 |
| 477 | iso_pu_bacteria | 2802428858 | 2802719379 | 173 |
| 478 | iso_pu_bacteria | 2802428859 | 2802723060 | 173 |
| 479 | iso_pu_bacteria | 2802428860 | 2802734755 | 173 |
| 480 | iso_pu_bacteria | 2802428861 | 2802741297 | 173 |
| 481 | iso_pu_bacteria | 2802428862 | 2802745046 | 173 |
| 482 | iso_pu_bacteria | 2802428863 | 2802751481 | 173 |
| 483 | iso_pu_bacteria | 2802429268 | 2804751747 | 173 |
| 484 | iso_pu_bacteria | 2802429603 | 2805917625 | 173 |
| 485 | iso_pu_bacteria | 2802429605 | 2805931637 | 173 |
| 486 | iso_pu_bacteria | 2802429606 | 2805937752 | 173 |
| 487 | iso_pu_bacteria | 2802429633 | 2806049360 | 173 |
| 488 | iso_pu_bacteria | 2802429634 | 2806056368 | 173 |
| 489 | iso_pu_bacteria | 2802429635 | 2806063408 | 173 |
| 490 | iso_pu_bacteria | 2802429636 | 2806070954 | 173 |
| 491 | iso_pu_bacteria | 2802429637 | 2806077768 | 173 |
| 492 | iso_pu_bacteria | 2808606387 | 2808985085 | 173 |
| 493 | iso_pu_bacteria | 2816332527 | 2818241494 | 173 |
| 494 | iso_pu_bacteria | 2818991272 | 2819242262 | 173 |
| 495 | iso_pu_bacteria | 2818991439 | 2819559513 | 173 |
| 496 | iso_pu_bacteria | 2818991448 | 2819610709 | 173 |
| 497 | iso_pu_bacteria | 2818991453 | 2819638359 | 173 |
| 498 | iso_pu_bacteria | 2818991461 | 2819683814 | 173 |
| 499 | iso_pu_bacteria | 2821123053 | 2821124587 | 173 |
| 500 | iso_pu_bacteria | 2824653114 | 2824654972 | 173 |
| 501 | iso_pu_bacteria | 2824661429 | 2824662370 | 173 |
| 502 | iso_pu_bacteria | 2824671348 | 2824672619 | 173 |
| 503 | iso_pu_bacteria | 2824687955 | 2824689048 | 173 |
| 504 | iso_pu_bacteria | 2824696289 | 2824697415 | 173 |
| 505 | iso_pu_bacteria | 2824704595 | 2824706687 | 173 |
| 506 | iso_pu_bacteria | 2824753945 | 2824759429 | 173 |
| 507 | iso_pu_bacteria | 2824763712 | 2824769665 | 173 |
| 508 | iso_pu_bacteria | 2824773399 | 2824774024 | 173 |
| 509 | iso_pu_bacteria | 2835312727 | 2835318460 | 173 |
| 510 | iso_pu_bacteria | 2837651117 | 2837653704 | 173 |
| 511 | iso_pu_bacteria | 2837678835 | 2837679320 | 173 |
| 512 | iso_pu_bacteria | 2837678835 | 2837682798 | 173 |
| 513 | iso_pu_bacteria | 2838016132 | 2838017545 | 173 |
| 514 | iso_pu_bacteria | 2838022645 | 2838022887 | 173 |
| 515 | iso_pu_bacteria | 2838029111 | 2838032382 | 173 |
| 516 | iso_pu_bacteria | 2838035591 | 2838041255 | 173 |
| 517 | iso_pu_bacteria | 2838042994 | 2838046192 | 173 |
| 518 | iso_pu_bacteria | 2838048938 | 2838048973 | 173 |
| 519 | iso_pu_bacteria | 2838061910 | 2838063596 | 173 |
| 520 | iso_pu_bacteria | 2838068647 | 2838072751 | 173 |
| 521 | iso_pu_bacteria | 2838074704 | 2838079221 | 173 |
| 522 | iso_pu_bacteria | 2838122688 | 2838130073 | 173 |
| 523 | iso_pu_bacteria | 2838661181 | 2838662992 | 173 |
| 524 | iso_pu_bacteria | 2838668709 | 2838674911 | 173 |
| 525 | iso_pu_bacteria | 2838675328 | 2838675948 | 173 |
| 526 | iso_pu_bacteria | 2838680041 | 2838681623 | 173 |
| 527 | iso_pu_bacteria | 2838686498 | 2838692720 | 173 |
| 528 | iso_pu_bacteria | 2838694306 | 2838694340 | 173 |
| 529 | iso_pu_bacteria | 2838701080 | 2838707214 | 173 |
| 530 | iso_pu_bacteria | 2838707686 | 2838707720 | 173 |
| 531 | iso_pu_bacteria | 2838714209 | 2838714830 | 173 |
| 532 | iso_pu_bacteria | 2838719591 | 2838721369 | 173 |
| 533 | iso_pu_bacteria | 2838724970 | 2838725590 | 173 |
| 534 | iso_pu_bacteria | 2838729681 | 2838735094 | 173 |
| 535 | iso_pu_bacteria | 2838736955 | 2838742444 | 173 |
| 536 | iso_pu_bacteria | 2838742623 | 2838747547 | 173 |
| 537 | iso_pu_bacteria | 2839993093 | 2839995584 | 173 |
| 538 | iso_pu_bacteria | 2840764183 | 2840768029 | 173 |
| 539 | iso_pu_bacteria | 2841734538 | 2841740443 | 173 |
| 540 | iso_pu_bacteria | 2841840854 | 2841846399 | 173 |
| 541 | iso_pu_bacteria | 2841846520 | 2841848336 | 173 |
| 542 | iso_pu_bacteria | 2841851746 | 2841857330 | 173 |
| 543 | iso_pu_bacteria | 2841859092 | 2841859109 | 173 |
| 544 | iso_pu_bacteria | 2841864319 | 2841865219 | 173 |
| 545 | iso_pu_bacteria | 2841941048 | 2841941230 | 173 |
| 546 | iso_pu_bacteria | 2841949485 | 2841952743 | 173 |
| 547 | iso_pu_bacteria | 2841966195 | 2841967385 | 173 |
| 548 | iso_pu_bacteria | 2841974524 | 2841979217 | 173 |
| 549 | iso_pu_bacteria | 2841983080 | 2841990793 | 173 |
| 550 | iso_pu_bacteria | 2842038055 | 2842038633 | 173 |
| 551 | iso_pu_bacteria | 2842045827 | 2842048422 | 173 |
| 552 | iso_pu_bacteria | 2842077413 | 2842081050 | 173 |
| 553 | iso_pu_bacteria | 2842110456 | 2842117508 | 173 |
| 554 | iso_pu_bacteria | 2842118031 | 2842121669 | 173 |
| 555 | iso_pu_bacteria | 2842124991 | 2842125634 | 173 |
| 556 | iso_pu_bacteria | 2842130223 | 2842130843 | 173 |
| 557 | iso_pu_bacteria | 2842140634 | 2842146123 | 173 |
| 558 | iso_pu_bacteria | 2842146304 | 2842151858 | 173 |
| 559 | iso_pu_bacteria | 2842152218 | 2842153987 | 173 |
| 560 | iso_pu_bacteria | 2842156927 | 2842163212 | 173 |
| 561 | iso_pu_bacteria | 2842163707 | 2842170321 | 173 |
| 562 | iso_pu_bacteria | 2842170452 | 2842171074 | 173 |
| 563 | iso_pu_bacteria | 2842175837 | 2842177607 | 173 |
| 564 | iso_pu_bacteria | 2842180545 | 2842186888 | 173 |
| 565 | iso_pu_bacteria | 2842187318 | 2842187939 | 173 |
| 566 | iso_pu_bacteria | 2842192696 | 2842197641 | 173 |
| 567 | iso_pu_bacteria | 2842198810 | 2842199316 | 173 |
| 568 | iso_pu_bacteria | 2842205361 | 2842210162 | 173 |
| 569 | iso_pu_bacteria | 2842211629 | 2842212250 | 173 |
| 570 | iso_pu_bacteria | 2842217011 | 2842224194 | 173 |
| 571 | iso_pu_bacteria | 2842224351 | 2842226131 | 173 |
| 572 | iso_pu_bacteria | 2842229732 | 2842234894 | 173 |
| 573 | iso_pu_bacteria | 2842237096 | 2842237130 | 173 |
| 574 | iso_pu_bacteria | 2842243621 | 2842248959 | 173 |
| 575 | iso_pu_bacteria | 2842250916 | 2842257052 | 173 |
| 576 | iso_pu_bacteria | 2842257432 | 2842262751 | 173 |
| 577 | iso_pu_bacteria | 2842264693 | 2842268738 | 173 |
| 578 | iso_pu_bacteria | 2842271015 | 2842277189 | 173 |
| 579 | iso_pu_bacteria | 2842278818 | 2842283616 | 173 |
| 580 | iso_pu_bacteria | 2842285085 | 2842286876 | 173 |
| 581 | iso_pu_bacteria | 2842291075 | 2842294707 | 173 |
| 582 | iso_pu_bacteria | 2842298080 | 2842302972 | 173 |
| 583 | iso_pu_bacteria | 2842304105 | 2842311002 | 173 |
| 584 | iso_pu_bacteria | 2842311132 | 2842317327 | 173 |
| 585 | iso_pu_bacteria | 2842317721 | 2842324083 | 173 |
| 586 | iso_pu_bacteria | 2842341865 | 2842343341 | 173 |
| 587 | iso_pu_bacteria | 2842357229 | 2842361841 | 173 |
| 588 | iso_pu_bacteria | 2842363717 | 2842365519 | 173 |
| 589 | iso_pu_bacteria | 2842370503 | 2842372087 | 173 |
| 590 | iso_pu_bacteria | 2842377471 | 2842381105 | 173 |
| 591 | iso_pu_bacteria | 2842384541 | 2842388176 | 173 |
| 592 | iso_pu_bacteria | 2842395702 | 2842402236 | 173 |
| 593 | iso_pu_bacteria | 2842402390 | 2842404144 | 173 |
| 594 | iso_pu_bacteria | 2842409023 | 2842411171 | 173 |
| 595 | iso_pu_bacteria | 2842415677 | 2842417373 | 173 |
| 596 | iso_pu_bacteria | 2842422224 | 2842426564 | 173 |
| 597 | iso_pu_bacteria | 2842428310 | 2842432871 | 173 |
| 598 | iso_pu_bacteria | 2842434925 | 2842439176 | 173 |
| 599 | iso_pu_bacteria | 2842441272 | 2842445805 | 173 |
| 600 | iso_pu_bacteria | 2842447887 | 2842451345 | 173 |
| 601 | iso_pu_bacteria | 2842462802 | 2842466843 | 173 |
| 602 | iso_pu_bacteria | 2842469257 | 2842473790 | 173 |
| 603 | iso_pu_bacteria | 2842475841 | 2842478989 | 173 |
| 604 | iso_pu_bacteria | 2842482326 | 2842483119 | 173 |
| 605 | iso_pu_bacteria | 2842489311 | 2842495136 | 173 |
| 606 | iso_pu_bacteria | 2842495871 | 2842502314 | 173 |
| 607 | iso_pu_bacteria | 2842502639 | 2842506291 | 173 |
| 608 | iso_pu_bacteria | 2842515876 | 2842515893 | 173 |
| 609 | iso_pu_bacteria | 2842521101 | 2842527563 | 173 |
| 610 | iso_pu_bacteria | 2842871566 | 2842872895 | 173 |
| 611 | iso_pu_bacteria | 2842922631 | 2842925085 | 173 |
| 612 | iso_pu_bacteria | 2844002411 | 2844006788 | 173 |
| 613 | iso_pu_bacteria | 2844009547 | 2844014471 | 173 |
| 614 | iso_pu_bacteria | 2844163670 | 2844169508 | 173 |
| 615 | iso_pu_bacteria | 2844454524 | 2844454871 | 173 |
| 616 | iso_pu_bacteria | 2847417321 | 2847418401 | 173 |
| 617 | iso_pu_bacteria | 2847670302 | 2847670804 | 173 |
| 618 | iso_pu_bacteria | 2847686936 | 2847687059 | 173 |
| 619 | iso_pu_bacteria | 2847939898 | 2847945407 | 173 |
| 620 | iso_pu_bacteria | 2848992105 | 2848993380 | 173 |
| 621 | iso_pu_bacteria | 2849076700 | 2849080405 | 173 |
| 622 | iso_pu_bacteria | 2850079185 | 2850081038 | 173 |
| 623 | iso_pu_bacteria | 2852387548 | 2852389365 | 173 |
| 624 | iso_pu_bacteria | 2854896431 | 2854901796 | 173 |
| 625 | iso_pu_bacteria | 2854911287 | 2854912154 | 173 |
| 626 | iso_pu_bacteria | 2854916844 | 2854919415 | 173 |
| 627 | iso_pu_bacteria | 2855825444 | 2855831624 | 173 |
| 628 | iso_pu_bacteria | 2855839649 | 2855840742 | 173 |
| 629 | iso_pu_bacteria | 2855872281 | 2855873434 | 173 |
| 630 | iso_pu_bacteria | 2856314179 | 2856316261 | 173 |
| 631 | iso_pu_bacteria | 2856320880 | 2856325085 | 173 |
| 632 | iso_pu_bacteria | 2856328259 | 2856330557 | 173 |
| 633 | iso_pu_bacteria | 2856334872 | 2856340857 | 173 |
| 634 | iso_pu_bacteria | 2856342000 | 2856345825 | 173 |
| 635 | iso_pu_bacteria | 2856349417 | 2856349749 | 173 |
| 636 | iso_pu_bacteria | 2856356410 | 2856359243 | 173 |
| 637 | iso_pu_bacteria | 2856364286 | 2856369141 | 173 |
| 638 | iso_pu_bacteria | 2857349434 | 2857355595 | 173 |
| 639 | iso_pu_bacteria | 2857367948 | 2857372485 | 173 |
| 640 | iso_pu_bacteria | 2857509624 | 2857510242 | 173 |
| 641 | iso_pu_bacteria | 2857516855 | 2857521662 | 173 |
| 642 | iso_pu_bacteria | 2857524615 | 2857528504 | 173 |
| 643 | iso_pu_bacteria | 2857531043 | 2857532168 | 173 |
| 644 | iso_pu_bacteria | 2858800743 | 2858801269 | 173 |
| 645 | iso_pu_bacteria | 2869162929 | 2869168968 | 173 |
| 646 | iso_pu_bacteria | 2869169390 | 2869169854 | 173 |
| 647 | iso_pu_bacteria | 2869234852 | 2869237153 | 173 |
| 648 | iso_pu_bacteria | 2869242130 | 2869243179 | 173 |
| 649 | iso_pu_bacteria | 2869249662 | 2869252750 | 173 |
| 650 | iso_pu_bacteria | 2869256925 | 2869262755 | 173 |
| 651 | iso_pu_bacteria | 2869264136 | 2869270272 | 173 |
| 652 | iso_pu_bacteria | 2869271264 | 2869273288 | 173 |
| 653 | iso_pu_bacteria | 2869278585 | 2869280893 | 173 |
| 654 | iso_pu_bacteria | 2869285874 | 2869288401 | 173 |
| 655 | iso_pu_bacteria | 2871429161 | 2871432110 | 173 |
| 656 | iso_pu_bacteria | 2871435913 | 2871439280 | 173 |
| 657 | iso_pu_bacteria | 2871444079 | 2871451492 | 173 |
| 658 | iso_pu_bacteria | 2871451962 | 2871455271 | 173 |
| 659 | iso_pu_bacteria | 2871459585 | 2871459666 | 173 |
| 660 | iso_pu_bacteria | 2871466892 | 2871471641 | 173 |
| 661 | iso_pu_bacteria | 2871474448 | 2871480981 | 173 |
| 662 | iso_pu_bacteria | 2871481445 | 2871488344 | 173 |
| 663 | iso_pu_bacteria | 2871488783 | 2871495243 | 173 |
| 664 | iso_pu_bacteria | 2871495908 | 2871500467 | 173 |
| 665 | iso_pu_bacteria | 2874102143 | 2874104416 | 173 |
| 666 | iso_pu_bacteria | 2874109183 | 2874112669 | 173 |
| 667 | iso_pu_bacteria | 2874116593 | 2874121370 | 173 |
| 668 | iso_pu_bacteria | 2874123672 | 2874125718 | 173 |
| 669 | iso_pu_bacteria | 2874131515 | 2874138149 | 173 |
| 670 | iso_pu_bacteria | 2874139085 | 2874141439 | 173 |
| 671 | iso_pu_bacteria | 2874146452 | 2874150989 | 173 |
| 672 | iso_pu_bacteria | 2874155637 | 2874157328 | 173 |
| 673 | iso_pu_bacteria | 2874162495 | 2874163775 | 173 |
| 674 | iso_pu_bacteria | 2874168670 | 2874172582 | 173 |
| 675 | iso_pu_bacteria | 2874590934 | 2874595124 | 173 |
| 676 | iso_pu_bacteria | 2874604998 | 2874610932 | 173 |
| 677 | iso_pu_bacteria | 2874620515 | 2874621666 | 173 |
| 678 | iso_pu_bacteria | 2874628541 | 2874632700 | 173 |
| 679 | iso_pu_bacteria | 2874645413 | 2874650985 | 173 |
| 680 | iso_pu_bacteria | 2876363079 | 2876368080 | 173 |
| 681 | iso_pu_bacteria | 2876369609 | 2876374951 | 173 |
| 682 | iso_pu_bacteria | 2876377896 | 2876378185 | 173 |
| 683 | iso_pu_bacteria | 2876386047 | 2876392711 | 173 |
| 684 | iso_pu_bacteria | 2876392853 | 2876395256 | 173 |
| 685 | iso_pu_bacteria | 2876399893 | 2876405245 | 173 |
| 686 | iso_pu_bacteria | 2876413966 | 2876417018 | 173 |
| 687 | iso_pu_bacteria | 2876420981 | 2876427153 | 173 |
| 688 | iso_pu_bacteria | 2876771140 | 2876775060 | 173 |
| 689 | iso_pu_bacteria | 2876818435 | 2876823875 | 173 |
| 690 | iso_pu_bacteria | 2878035449 | 2878041584 | 173 |
| 691 | iso_pu_bacteria | 2878730984 | 2878734398 | 173 |
| 692 | iso_pu_bacteria | 2878738818 | 2878743168 | 173 |
| 693 | iso_pu_bacteria | 2878745973 | 2878748829 | 173 |
| 694 | iso_pu_bacteria | 2878753008 | 2878758091 | 173 |
| 695 | iso_pu_bacteria | 2878760144 | 2878764556 | 173 |
| 696 | iso_pu_bacteria | 2878767105 | 2878771657 | 173 |
| 697 | iso_pu_bacteria | 2878774303 | 2878776396 | 173 |
| 698 | iso_pu_bacteria | 2878781027 | 2878782373 | 173 |
| 699 | iso_pu_bacteria | 2879074833 | 2879080503 | 173 |
| 700 | iso_pu_bacteria | 2879099564 | 2879109351 | 173 |
| 701 | iso_pu_bacteria | 2879127579 | 2879134891 | 173 |
| 702 | iso_pu_bacteria | 2879142872 | 2879149202 | 173 |
| 703 | iso_pu_bacteria | 2881147464 | 2881152561 | 173 |
| 704 | iso_pu_bacteria | 2881155292 | 2881155988 | 173 |
| 705 | iso_pu_bacteria | 2881161766 | 2881161783 | 173 |
| 706 | iso_pu_bacteria | 2881665667 | 2881671577 | 173 |
| 707 | iso_pu_bacteria | 2881845957 | 2881846275 | 173 |
| 708 | iso_pu_bacteria | 2881861095 | 2881862938 | 173 |
| 709 | iso_pu_bacteria | 2882456835 | 2882459691 | 173 |
| 710 | iso_pu_bacteria | 2882632389 | 2882633072 | 173 |
| 711 | iso_pu_bacteria | 2882912400 | 2882915325 | 173 |
| 712 | iso_pu_bacteria | 2884298095 | 2884300439 | 173 |
| 713 | iso_pu_bacteria | 2885305155 | 2885310668 | 173 |
| 714 | iso_pu_bacteria | 2885312484 | 2885317432 | 173 |
| 715 | iso_pu_bacteria | 2885318864 | 2885320323 | 173 |
| 716 | iso_pu_bacteria | 2885326080 | 2885326385 | 173 |
| 717 | iso_pu_bacteria | 2885342637 | 2885348528 | 173 |
| 718 | iso_pu_bacteria | 2885350715 | 2885355688 | 173 |
| 719 | iso_pu_bacteria | 2885366525 | 2885372829 | 173 |
| 720 | iso_pu_bacteria | 2885374607 | 2885380935 | 173 |
| 721 | iso_pu_bacteria | 2888337043 | 2888340684 | 173 |
| 722 | iso_pu_bacteria | 2888343758 | 2888347863 | 173 |
| 723 | iso_pu_bacteria | 2888350351 | 2888356880 | 173 |
| 724 | iso_pu_bacteria | 2888378607 | 2888382828 | 173 |
| 725 | iso_pu_bacteria | 2888388044 | 2888394972 | 173 |
| 726 | iso_pu_bacteria | 2889010040 | 2889011927 | 173 |
| 727 | iso_pu_bacteria | 2889016732 | 2889023141 | 173 |
| 728 | iso_pu_bacteria | 2889033259 | 2889041107 | 173 |
| 729 | iso_pu_bacteria | 2891373044 | 2891377327 | 173 |
| 730 | iso_pu_bacteria | 2893066018 | 2893070180 | 173 |
| 731 | iso_pu_bacteria | 2894232714 | 2894240755 | 173 |
| 732 | iso_pu_bacteria | 2894652903 | 2894654248 | 173 |
| 733 | iso_pu_bacteria | 2894817345 | 2894818640 | 173 |
| 734 | iso_pu_bacteria | 2896384573 | 2896386892 | 173 |
| 735 | iso_pu_bacteria | 2899792073 | 2899794872 | 173 |
| 736 | iso_pu_bacteria | 2899845264 | 2899848093 | 173 |
| 737 | iso_pu_bacteria | 2903448605 | 2903452100 | 173 |
| 738 | iso_pu_bacteria | 2903492973 | 2903495118 | 173 |
| 739 | iso_pu_bacteria | 2903492973 | 2903496177 | 173 |
| 740 | iso_pu_bacteria | 2903513507 | 2903518364 | 173 |
| 741 | iso_pu_bacteria | 2903521522 | 2903527076 | 173 |
| 742 | iso_pu_bacteria | 2903528002 | 2903533303 | 173 |
| 743 | iso_pu_bacteria | 2903540706 | 2903545280 | 173 |
| 744 | iso_pu_bacteria | 2903748898 | 2903758252 | 173 |
| 745 | iso_pu_bacteria | 2904578770 | 2904583221 | 173 |
| 746 | iso_pu_bacteria | 2904659560 | 2904661886 | 173 |
| 747 | iso_pu_bacteria | 2904666416 | 2904668617 | 173 |
| 748 | iso_pu_bacteria | 2904690495 | 2904696906 | 173 |
| 749 | iso_pu_bacteria | 2904699407 | 2904701669 | 173 |
| 750 | iso_pu_bacteria | 2904711408 | 2904716661 | 173 |
| 751 | iso_pu_bacteria | 2906308376 | 2906311181 | 173 |
| 752 | iso_pu_bacteria | 2906321335 | 2906323948 | 173 |
| 753 | iso_pu_bacteria | 2906328253 | 2906328369 | 173 |
| 754 | iso_pu_bacteria | 2906363423 | 2906370610 | 173 |
| 755 | iso_pu_bacteria | 2906386501 | 2906391168 | 173 |
| 756 | iso_pu_bacteria | 2906393657 | 2906394189 | 173 |
| 757 | iso_pu_bacteria | 2906401398 | 2906407930 | 173 |
| 758 | iso_pu_bacteria | 2906408224 | 2906410564 | 173 |
| 759 | iso_pu_bacteria | 2906414383 | 2906416398 | 173 |
| 760 | iso_pu_bacteria | 2906427513 | 2906428176 | 173 |
| 761 | iso_pu_bacteria | 2906610324 | 2906610359 | 173 |
| 762 | iso_pu_bacteria | 2906626472 | 2906628258 | 173 |
| 763 | iso_pu_bacteria | 2906635258 | 2906642774 | 173 |
| 764 | iso_pu_bacteria | 2906643746 | 2906644209 | 173 |
| 765 | iso_pu_bacteria | 2906660503 | 2906665909 | 173 |
| 766 | iso_pu_bacteria | 2908739725 | 2908743880 | 173 |
| 767 | iso_pu_bacteria | 2908756301 | 2908761482 | 173 |
| 768 | iso_pu_bacteria | 2913295892 | 2913301777 | 173 |
| 769 | iso_pu_bacteria | 2913308742 | 2913309943 | 173 |
| 770 | iso_pu_bacteria | 2915650412 | 2915654118 | 173 |
| 771 | iso_pu_bacteria | 2915980308 | 2915985668 | 173 |
| 772 | iso_pu_bacteria | 2915986958 | 2915991801 | 173 |
| 773 | iso_pu_bacteria | 2915993759 | 2916000604 | 173 |
| 774 | iso_pu_bacteria | 2916000859 | 2916007564 | 173 |
| 775 | iso_pu_bacteria | 2916007675 | 2916008882 | 173 |
| 776 | iso_pu_bacteria | 2916014648 | 2916018775 | 173 |
| 777 | iso_pu_bacteria | 2916021584 | 2916026383 | 173 |
| 778 | iso_pu_bacteria | 2916028427 | 2916034650 | 173 |
| 779 | iso_pu_bacteria | 2916035215 | 2916040631 | 173 |
| 780 | iso_pu_bacteria | 2916041962 | 2916048201 | 173 |
| 781 | iso_pu_bacteria | 2916048683 | 2916054390 | 173 |
| 782 | iso_pu_bacteria | 2916055098 | 2916060799 | 173 |
| 783 | iso_pu_bacteria | 2916061851 | 2916068167 | 173 |
| 784 | iso_pu_bacteria | 2916068649 | 2916075017 | 173 |
| 785 | iso_pu_bacteria | 2919073203 | 2919076131 | 173 |
| 786 | iso_pu_bacteria | 2919100787 | 2919104091 | 173 |
| 787 | iso_pu_bacteria | 2919114240 | 2919114919 | 173 |
| 788 | iso_pu_bacteria | 2919119836 | 2919123869 | 173 |
| 789 | iso_pu_bacteria | 2919166419 | 2919167993 | 173 |
| 790 | iso_pu_bacteria | 2919171160 | 2919175589 | 173 |
| 791 | iso_pu_bacteria | 2919408235 | 2919409575 | 173 |
| 792 | iso_pu_bacteria | 2920760137 | 2920765479 | 173 |
| 793 | iso_pu_bacteria | 2920822456 | 2920824107 | 173 |
| 794 | iso_pu_bacteria | 2921201388 | 2921208182 | 173 |
| 795 | iso_pu_bacteria | 2921208531 | 2921209425 | 173 |
| 796 | iso_pu_bacteria | 2921237296 | 2921242267 | 173 |
| 797 | iso_pu_bacteria | 2921244191 | 2921248072 | 173 |
| 798 | iso_pu_bacteria | 2921250672 | 2921256122 | 173 |
| 799 | iso_pu_bacteria | 2921257292 | 2921263458 | 173 |
| 800 | iso_pu_bacteria | 2921263974 | 2921270091 | 173 |
| 801 | iso_pu_bacteria | 2921282425 | 2921285909 | 173 |
| 802 | iso_pu_bacteria | 2921289301 | 2921296758 | 173 |
| 803 | iso_pu_bacteria | 2921296804 | 2921299127 | 173 |
| 804 | iso_pu_bacteria | 2922130491 | 2922132704 | 173 |
| 805 | iso_pu_bacteria | 2922151315 | 2922154890 | 173 |
| 806 | iso_pu_bacteria | 2922158528 | 2922161782 | 173 |
| 807 | iso_pu_bacteria | 2922172374 | 2922175792 | 173 |
| 808 | iso_pu_bacteria | 2922185730 | 2922191536 | 173 |
| 809 | iso_pu_bacteria | 2922361189 | 2922361954 | 173 |
| 810 | iso_pu_bacteria | 2922368715 | 2922375212 | 173 |
| 811 | iso_pu_bacteria | 2922386360 | 2922392040 | 173 |
| 812 | iso_pu_bacteria | 2922425934 | 2922429002 | 173 |
| 813 | iso_pu_bacteria | 2923556063 | 2923562202 | 173 |
| 814 | iso_pu_bacteria | 2924144063 | 2924147667 | 173 |
| 815 | iso_pu_bacteria | 2924150972 | 2924157724 | 173 |
| 816 | iso_pu_bacteria | 2924158325 | 2924165049 | 173 |
| 817 | iso_pu_bacteria | 2924165586 | 2924172869 | 173 |
| 818 | iso_pu_bacteria | 2924172951 | 2924179190 | 173 |
| 819 | iso_pu_bacteria | 2924179722 | 2924184585 | 173 |
| 820 | iso_pu_bacteria | 2924186466 | 2924192969 | 173 |
| 821 | iso_pu_bacteria | 2924193448 | 2924199579 | 173 |
| 822 | iso_pu_bacteria | 2924200457 | 2924204255 | 173 |
| 823 | iso_pu_bacteria | 2924207177 | 2924213329 | 173 |
| 824 | iso_pu_bacteria | 2924214083 | 2924214805 | 173 |
| 825 | iso_pu_bacteria | 2924221636 | 2924221990 | 173 |
| 826 | iso_pu_bacteria | 2924228884 | 2924233678 | 173 |
| 827 | iso_pu_bacteria | 2924710171 | 2924712525 | 173 |
| 828 | iso_pu_bacteria | 2924726620 | 2924727270 | 173 |
| 829 | iso_pu_bacteria | 2924733363 | 2924736146 | 173 |
| 830 | iso_pu_bacteria | 2924748358 | 2924750373 | 173 |
| 831 | iso_pu_bacteria | 2924754689 | 2924761550 | 173 |
| 832 | iso_pu_bacteria | 2924762789 | 2924763835 | 173 |
| 833 | iso_pu_bacteria | 2924776078 | 2924777282 | 173 |
| 834 | iso_pu_bacteria | 2924784321 | 2924785832 | 173 |
| 835 | iso_pu_bacteria | 2926754445 | 2926755885 | 173 |
| 836 | iso_pu_bacteria | 2926760298 | 2926762983 | 173 |
| 837 | iso_pu_bacteria | 2928521798 | 2928524352 | 173 |
| 838 | iso_pu_bacteria | 2929138655 | 2929140705 | 173 |
| 839 | iso_pu_bacteria | 2929615660 | 2929615900 | 173 |
| 840 | iso_pu_bacteria | 2929624759 | 2929630513 | 173 |
| 841 | iso_pu_bacteria | 2932784394 | 2932792462 | 173 |
| 842 | iso_pu_bacteria | 2932794094 | 2932800392 | 173 |
| 843 | iso_pu_bacteria | 2932801729 | 2932804565 | 173 |
| 844 | iso_pu_bacteria | 2932809354 | 2932813961 | 173 |
| 845 | iso_pu_bacteria | 2932818245 | 2932819527 | 173 |
| 846 | iso_pu_bacteria | 2932828146 | 2932833767 | 173 |
| 847 | iso_pu_bacteria | 2933006813 | 2933008632 | 173 |
| 848 | iso_pu_bacteria | 2933011516 | 2933011731 | 173 |
| 849 | iso_pu_bacteria | 2933570622 | 2933577511 | 173 |
| 850 | iso_pu_bacteria | 2933577622 | 2933578814 | 173 |
| 851 | iso_pu_bacteria | 2933586486 | 2933593605 | 173 |
| 852 | iso_pu_bacteria | 2933594066 | 2933596765 | 173 |
| 853 | iso_pu_bacteria | 2933599457 | 2933603680 | 173 |
| 854 | iso_pu_bacteria | 2935608549 | 2935611374 | 173 |
| 855 | iso_pu_bacteria | 2935616580 | 2935618729 | 173 |
| 856 | iso_pu_bacteria | 2935630451 | 2935637735 | 173 |
| 857 | iso_pu_bacteria | 2935638405 | 2935644431 | 173 |
| 858 | iso_pu_bacteria | 2935648319 | 2935648758 | 173 |
| 859 | iso_pu_bacteria | 2935656913 | 2935657159 | 173 |
| 860 | iso_pu_bacteria | 2935665750 | 2935674169 | 173 |
| 861 | iso_pu_bacteria | 2935675223 | 2935678549 | 173 |
| 862 | iso_pu_bacteria | 2935684952 | 2935687954 | 173 |
| 863 | iso_pu_bacteria | 2935694250 | 2935701434 | 173 |
| 864 | iso_pu_bacteria | 2935703347 | 2935708288 | 173 |
| 865 | iso_pu_bacteria | 2935713505 | 2935714974 | 173 |
| 866 | iso_pu_bacteria | 2935722832 | 2935726461 | 173 |
| 867 | iso_pu_bacteria | 2935732158 | 2935733792 | 173 |
| 868 | iso_pu_bacteria | 2935741537 | 2935743171 | 173 |
| 869 | iso_pu_bacteria | 2935750917 | 2935754790 | 173 |
| 870 | iso_pu_bacteria | 2935760218 | 2935765498 | 173 |
| 871 | iso_pu_bacteria | 2935769743 | 2935775251 | 173 |
| 872 | iso_pu_bacteria | 2935777560 | 2935779549 | 173 |
| 873 | iso_pu_bacteria | 2935785616 | 2935791551 | 173 |
| 874 | iso_pu_bacteria | 2935793552 | 2935799863 | 173 |
| 875 | iso_pu_bacteria | 2935801545 | 2935805451 | 173 |
| 876 | iso_pu_bacteria | 2935810662 | 2935816745 | 173 |
| 877 | iso_pu_bacteria | 2935819856 | 2935820851 | 173 |
| 878 | iso_pu_bacteria | 2935827899 | 2935833820 | 173 |
| 879 | iso_pu_bacteria | 2935837841 | 2935839495 | 173 |
| 880 | iso_pu_bacteria | 2935847175 | 2935850889 | 173 |
| 881 | iso_pu_bacteria | 2935855204 | 2935857094 | 173 |
| 882 | iso_pu_bacteria | 2935864058 | 2935864638 | 173 |
| 883 | iso_pu_bacteria | 2935873716 | 2935876416 | 173 |
| 884 | iso_pu_bacteria | 2935883170 | 2935889759 | 173 |
| 885 | iso_pu_bacteria | 2935894831 | 2935894865 | 173 |
| 886 | iso_pu_bacteria | 2935901341 | 2935908189 | 173 |
| 887 | iso_pu_bacteria | 2935908558 | 2935913744 | 173 |
| 888 | iso_pu_bacteria | 2935916978 | 2935920266 | 173 |
| 889 | iso_pu_bacteria | 2935926038 | 2935930605 | 173 |
| 890 | iso_pu_bacteria | 2935934488 | 2935939422 | 173 |
| 891 | iso_pu_bacteria | 2935942939 | 2935946371 | 173 |
| 892 | iso_pu_bacteria | 2935951376 | 2935955790 | 173 |
| 893 | iso_pu_bacteria | 2935959822 | 2935966946 | 173 |
| 894 | iso_pu_bacteria | 2935967501 | 2935972500 | 173 |
| 895 | iso_pu_bacteria | 2935975950 | 2935981669 | 173 |
| 896 | iso_pu_bacteria | 2935984226 | 2935991044 | 173 |
| 897 | iso_pu_bacteria | 2935992306 | 2935997615 | 173 |
| 898 | iso_pu_bacteria | 2936002035 | 2936007133 | 173 |
| 899 | iso_pu_bacteria | 2936011229 | 2936011668 | 173 |
| 900 | iso_pu_bacteria | 2936019824 | 2936020263 | 173 |
| 901 | iso_pu_bacteria | 2936028420 | 2936028958 | 173 |
| 902 | iso_pu_bacteria | 2936037263 | 2936042993 | 173 |
| 903 | iso_pu_bacteria | 2936046547 | 2936046986 | 173 |
| 904 | iso_pu_bacteria | 2936055302 | 2936058134 | 173 |
| 905 | iso_pu_bacteria | 2936367885 | 2936371435 | 173 |
| 906 | iso_pu_bacteria | 2936375103 | 2936379457 | 173 |
| 907 | iso_pu_bacteria | 2936381700 | 2936387944 | 173 |
| 908 | iso_pu_bacteria | 2936996657 | 2937001413 | 173 |
| 909 | iso_pu_bacteria | 2937002841 | 2937008151 | 173 |
| 910 | iso_pu_bacteria | 2937009748 | 2937015641 | 173 |
| 911 | iso_pu_bacteria | 2937016420 | 2937019599 | 173 |
| 912 | iso_pu_bacteria | 2937023124 | 2937028370 | 173 |
| 913 | iso_pu_bacteria | 2937029754 | 2937034848 | 173 |
| 914 | iso_pu_bacteria | 2937036028 | 2937040790 | 173 |
| 915 | iso_pu_bacteria | 2937042894 | 2937049359 | 173 |
| 916 | iso_pu_bacteria | 2937049772 | 2937056389 | 173 |
| 917 | iso_pu_bacteria | 2937056579 | 2937060868 | 173 |
| 918 | iso_pu_bacteria | 2937063883 | 2937069362 | 173 |
| 919 | iso_pu_bacteria | 2937071275 | 2937076552 | 173 |
| 920 | iso_pu_bacteria | 2937078374 | 2937079345 | 173 |
| 921 | iso_pu_bacteria | 2937084907 | 2937088450 | 173 |
| 922 | iso_pu_bacteria | 2937091812 | 2937096832 | 173 |
| 923 | iso_pu_bacteria | 2937098957 | 2937105919 | 173 |
| 924 | iso_pu_bacteria | 2937106411 | 2937113065 | 173 |
| 925 | iso_pu_bacteria | 2937113482 | 2937118555 | 173 |
| 926 | iso_pu_bacteria | 2937119839 | 2937125239 | 173 |
| 927 | iso_pu_bacteria | 2937126314 | 2937129968 | 173 |
| 928 | iso_pu_bacteria | 2937813078 | 2937813402 | 173 |
| 929 | iso_pu_bacteria | 2937822353 | 2937826665 | 173 |
| 930 | iso_pu_bacteria | 2937836603 | 2937840003 | 173 |
| 931 | iso_pu_bacteria | 2937843397 | 2937845885 | 173 |
| 932 | iso_pu_bacteria | 2937848649 | 2937853638 | 173 |
| 933 | iso_pu_bacteria | 2937861824 | 2937864423 | 173 |
| 934 | iso_pu_bacteria | 2937868953 | 2937869764 | 173 |
| 935 | iso_pu_bacteria | 2937877337 | 2937879313 | 173 |
| 936 | iso_pu_bacteria | 2937891427 | 2937898199 | 173 |
| 937 | iso_pu_bacteria | 2937972304 | 2937974953 | 173 |
| 938 | iso_pu_bacteria | 2937980651 | 2937988319 | 173 |
| 939 | iso_pu_bacteria | 2937994558 | 2937999130 | 173 |
| 940 | iso_pu_bacteria | 2938014810 | 2938019877 | 173 |
| 941 | iso_pu_bacteria | 2940556831 | 2940559833 | 173 |
| 942 | iso_pu_bacteria | 2941499720 | 2941499946 | 173 |
| 943 | iso_pu_bacteria | 2941507105 | 2941514408 | 173 |
| 944 | iso_pu_bacteria | 2941515067 | 2941522304 | 173 |
| 945 | iso_pu_bacteria | 2941523033 | 2941530177 | 173 |
| 946 | iso_pu_bacteria | 2941531003 | 2941536077 | 173 |
| 947 | iso_pu_bacteria | 2941538514 | 2941540184 | 173 |
| 948 | iso_pu_bacteria | 2954011201 | 2954015372 | 173 |
| 949 | iso_pu_bacteria | 2957375807 | 2957377132 | 173 |
| 950 | iso_pu_bacteria | 2957382221 | 2957385712 | 173 |
| 951 | iso_pu_bacteria | 2957388812 | 2957388835 | 173 |
| 952 | iso_pu_bacteria | 2957395598 | 2957401725 | 173 |
| 953 | iso_pu_bacteria | 2957402308 | 2957406441 | 173 |
| 954 | iso_pu_bacteria | 2957408893 | 2957414198 | 173 |
| 955 | iso_pu_bacteria | 2957415311 | 2957418168 | 173 |
| 956 | iso_pu_bacteria | 2957422303 | 2957429133 | 173 |
| 957 | iso_pu_bacteria | 2957430029 | 2957435562 | 173 |
| 958 | iso_pu_bacteria | 2957437181 | 2957443034 | 173 |
| 959 | iso_pu_bacteria | 2957443900 | 2957449775 | 173 |
| 960 | iso_pu_bacteria | 2957450854 | 2957453198 | 173 |
| 961 | iso_pu_bacteria | 2957457609 | 2957464198 | 173 |
| 962 | iso_pu_bacteria | 2957464669 | 2957468116 | 173 |
| 963 | iso_pu_bacteria | 2957471148 | 2957477675 | 173 |
| 964 | iso_pu_bacteria | 2957478035 | 2957483694 | 173 |
| 965 | iso_pu_bacteria | 2957484790 | 2957491289 | 173 |
| 966 | iso_pu_bacteria | 2957491536 | 2957496674 | 173 |
| 967 | iso_pu_bacteria | 2957498199 | 2957504892 | 173 |
| 968 | iso_pu_bacteria | 2957505466 | 2957512930 | 173 |
| 969 | iso_pu_bacteria | 2958034702 | 2958036856 | 173 |
| 970 | iso_pu_bacteria | 2958041894 | 2958050478 | 173 |
| 971 | iso_pu_bacteria | 2958064165 | 2958070260 | 173 |
| 972 | iso_pu_bacteria | 2958071322 | 2958072558 | 173 |
| 973 | iso_pu_bacteria | 2958084443 | 2958086488 | 173 |
| 974 | iso_pu_bacteria | 2958100919 | 2958101574 | 173 |
| 975 | iso_pu_bacteria | 2958108152 | 2958110465 | 173 |
| 976 | iso_pu_bacteria | 2958115193 | 2958122505 | 173 |
| 977 | iso_pu_bacteria | 2958122699 | 2958130094 | 173 |
| 978 | iso_pu_bacteria | 2958130278 | 2958132802 | 173 |
| 979 | iso_pu_bacteria | 2958137437 | 2958142874 | 173 |
| 980 | iso_pu_bacteria | 2958144490 | 2958145617 | 173 |
| 981 | iso_pu_bacteria | 2958158011 | 2958162958 | 173 |
| 982 | iso_pu_bacteria | 2958165035 | 2958169604 | 173 |
| 983 | iso_pu_bacteria | 2958172287 | 2958177436 | 173 |
| 984 | iso_pu_bacteria | 2958179912 | 2958182934 | 173 |
| 985 | iso_pu_bacteria | 2960584000 | 2960586008 | 173 |
| 986 | iso_pu_bacteria | 2960591022 | 2960593523 | 173 |
| 987 | iso_pu_bacteria | 2960597568 | 2960602386 | 173 |
| 988 | iso_pu_bacteria | 2960603979 | 2960608999 | 173 |
| 989 | iso_pu_bacteria | 2960610863 | 2960616764 | 173 |
| 990 | iso_pu_bacteria | 2960617483 | 2960623101 | 173 |
| 991 | iso_pu_bacteria | 2960624210 | 2960630976 | 173 |
| 992 | iso_pu_bacteria | 2960631154 | 2960636896 | 173 |
| 993 | iso_pu_bacteria | 2960637947 | 2960639646 | 173 |
| 994 | iso_pu_bacteria | 2960645483 | 2960652511 | 173 |
| 995 | iso_pu_bacteria | 2960652885 | 2960655267 | 173 |
| 996 | iso_pu_bacteria | 2960660292 | 2960666652 | 173 |
| 997 | iso_pu_bacteria | 2960667422 | 2960673107 | 173 |
| 998 | iso_pu_bacteria | 2960674078 | 2960677295 | 173 |
| 999 | iso_pu_bacteria | 2960680706 | 2960686305 | 173 |
| 1000 | iso_pu_bacteria | 2960687367 | 2960693516 | 173 |
| 1001 | iso_pu_bacteria | 2960693952 | 2960700507 | 173 |
| 1002 | iso_pu_bacteria | 2961077736 | 2961080814 | 173 |
| 1003 | iso_pu_bacteria | 2961114664 | 2961117039 | 173 |
| 1004 | iso_pu_bacteria | 2961127735 | 2961129438 | 173 |
| 1005 | iso_pu_bacteria | 2961136820 | 2961139058 | 173 |
| 1006 | iso_pu_bacteria | 2961163497 | 2961168064 | 173 |
| 1007 | iso_pu_bacteria | 2961170736 | 2961174721 | 173 |
| 1008 | iso_pu_bacteria | 2961183825 | 2961186451 | 173 |
| 1009 | iso_pu_bacteria | 2963644680 | 2963648653 | 173 |
| 1010 | iso_pu_bacteria | 2964607997 | 2964611279 | 173 |
| 1011 | iso_pu_bacteria | 2964615318 | 2964621254 | 173 |
| 1012 | iso_pu_bacteria | 2964621998 | 2964626448 | 173 |
| 1013 | iso_pu_bacteria | 2964628898 | 2964635554 | 173 |
| 1014 | iso_pu_bacteria | 2964636051 | 2964641217 | 173 |
| 1015 | iso_pu_bacteria | 2964643177 | 2964647064 | 173 |
| 1016 | iso_pu_bacteria | 2964649959 | 2964655517 | 173 |
| 1017 | iso_pu_bacteria | 2964656573 | 2964661948 | 173 |
| 1018 | iso_pu_bacteria | 2964663802 | 2964670117 | 173 |
| 1019 | iso_pu_bacteria | 2964670856 | 2964677220 | 173 |
| 1020 | iso_pu_bacteria | 2964678106 | 2964684936 | 173 |
| 1021 | iso_pu_bacteria | 2964685014 | 2964691770 | 173 |
| 1022 | iso_pu_bacteria | 2964691889 | 2964698503 | 173 |
| 1023 | iso_pu_bacteria | 2964698721 | 2964703425 | 173 |
| 1024 | iso_pu_bacteria | 2964705432 | 2964710556 | 173 |
| 1025 | iso_pu_bacteria | 2964712639 | 2964713691 | 173 |
| 1026 | iso_pu_bacteria | 2964719344 | 2964721087 | 173 |
| 1027 | iso_pu_bacteria | 2965018300 | 2965022883 | 173 |
| 1028 | iso_pu_bacteria | 2965025482 | 2965027332 | 173 |
| 1029 | iso_pu_bacteria | 2965032056 | 2965037911 | 173 |
| 1030 | iso_pu_bacteria | 2965040258 | 2965040804 | 173 |
| 1031 | iso_pu_bacteria | 2965047637 | 2965050108 | 173 |
| 1032 | iso_pu_bacteria | 2965062239 | 2965066157 | 173 |
| 1033 | iso_pu_bacteria | 2965089291 | 2965091037 | 173 |
| 1034 | iso_pu_bacteria | 2967664464 | 2967671049 | 173 |
| 1035 | iso_pu_bacteria | 2967671571 | 2967672373 | 173 |
| 1036 | iso_pu_bacteria | 2967678726 | 2967683409 | 173 |
| 1037 | iso_pu_bacteria | 2967686174 | 2967692233 | 173 |
| 1038 | iso_pu_bacteria | 2967693043 | 2967694497 | 173 |
| 1039 | iso_pu_bacteria | 2967699805 | 2967702495 | 173 |
| 1040 | iso_pu_bacteria | 2967706974 | 2967714195 | 173 |
| 1041 | iso_pu_bacteria | 2967714385 | 2967718842 | 173 |
| 1042 | iso_pu_bacteria | 2967721400 | 2967726172 | 173 |
| 1043 | iso_pu_bacteria | 2967728569 | 2967729652 | 173 |
| 1044 | iso_pu_bacteria | 2967735183 | 2967739544 | 173 |
| 1045 | iso_pu_bacteria | 2967742019 | 2967745160 | 173 |
| 1046 | iso_pu_bacteria | 2967748971 | 2967754769 | 173 |
| 1047 | iso_pu_bacteria | 2967755722 | 2967762226 | 173 |
| 1048 | iso_pu_bacteria | 2967762386 | 2967766740 | 173 |
| 1049 | iso_pu_bacteria | 2967769361 | 2967775200 | 173 |
| 1050 | iso_pu_bacteria | 2967775926 | 2967782609 | 173 |
| 1051 | iso_pu_bacteria | 2967996073 | 2968000656 | 173 |
| 1052 | iso_pu_bacteria | 2968003550 | 2968009971 | 173 |
| 1053 | iso_pu_bacteria | 2968016561 | 2968017469 | 173 |
| 1054 | iso_pu_bacteria | 2968083720 | 2968083880 | 173 |
| 1055 | iso_pu_bacteria | 2968091066 | 2968092495 | 173 |
| 1056 | iso_pu_bacteria | 2968097103 | 2968102417 | 173 |
| 1057 | iso_pu_bacteria | 2968110612 | 2968112947 | 173 |
| 1058 | iso_pu_bacteria | 2968117919 | 2968122820 | 173 |
| 1059 | iso_pu_bacteria | 2968128360 | 2968128774 | 173 |
| 1060 | iso_pu_bacteria | 2968171901 | 2968176464 | 173 |
| 1061 | iso_pu_bacteria | 2970019648 | 2970026361 | 173 |
| 1062 | iso_pu_bacteria | 2970026789 | 2970033120 | 173 |
| 1063 | iso_pu_bacteria | 2970033650 | 2970034149 | 173 |
| 1064 | iso_pu_bacteria | 2970040964 | 2970046971 | 173 |
| 1065 | iso_pu_bacteria | 2970047711 | 2970051794 | 173 |
| 1066 | iso_pu_bacteria | 2970054988 | 2970060505 | 173 |
| 1067 | iso_pu_bacteria | 2970061556 | 2970062282 | 173 |
| 1068 | iso_pu_bacteria | 2970068827 | 2970069232 | 173 |
| 1069 | iso_pu_bacteria | 2970076120 | 2970079546 | 173 |
| 1070 | iso_pu_bacteria | 2970082768 | 2970086676 | 173 |
| 1071 | iso_pu_bacteria | 2970088815 | 2970091739 | 173 |
| 1072 | iso_pu_bacteria | 2970095765 | 2970102540 | 173 |
| 1073 | iso_pu_bacteria | 2970102677 | 2970107856 | 173 |
| 1074 | iso_pu_bacteria | 2970109326 | 2970115555 | 173 |
| 1075 | iso_pu_bacteria | 2970116247 | 2970120781 | 173 |
| 1076 | iso_pu_bacteria | 2970122695 | 2970128520 | 173 |
| 1077 | iso_pu_bacteria | 2970129317 | 2970129813 | 173 |
| 1078 | iso_pu_bacteria | 2970136068 | 2970143452 | 173 |
| 1079 | iso_pu_bacteria | 2970143518 | 2970149810 | 173 |
| 1080 | iso_pu_bacteria | 2970149975 | 2970156337 | 173 |
| 1081 | iso_pu_bacteria | 2970156795 | 2970158342 | 173 |
| 1082 | iso_pu_bacteria | 2970164137 | 2970167606 | 173 |
| 1083 | iso_pu_bacteria | 2970170962 | 2970173589 | 173 |
| 1084 | iso_pu_bacteria | 2970177841 | 2970178668 | 173 |
| 1085 | iso_pu_bacteria | 2970184632 | 2970190746 | 173 |
| 1086 | iso_pu_bacteria | 2970191845 | 2970198217 | 173 |
| 1087 | iso_pu_bacteria | 2970469710 | 2970472355 | 173 |
| 1088 | iso_pu_bacteria | 2970489779 | 2970490902 | 173 |
| 1089 | iso_pu_bacteria | 2970503327 | 2970507307 | 173 |
| 1090 | iso_pu_bacteria | 2970510686 | 2970513844 | 173 |
| 1091 | iso_pu_bacteria | 2970524798 | 2970530020 | 173 |
| 1092 | iso_pu_bacteria | 2970532167 | 2970539355 | 173 |
| 1093 | iso_pu_bacteria | 2970540015 | 2970540152 | 173 |
| 1094 | iso_pu_bacteria | 2970547951 | 2970548655 | 173 |
| 1095 | iso_pu_bacteria | 2970554993 | 2970559403 | 173 |
| 1096 | iso_pu_bacteria | 2970593180 | 2970595497 | 173 |
| 1097 | iso_pu_bacteria | 2970619444 | 2970620313 | 173 |
| 1098 | iso_pu_bacteria | 2970627176 | 2970632003 | 173 |
| 1099 | iso_pu_bacteria | 2977516862 | 2977520503 | 173 |
| 1100 | iso_pu_bacteria | 2977523885 | 2977530226 | 173 |
| 1101 | iso_pu_bacteria | 2977530762 | 2977532344 | 173 |
| 1102 | iso_pu_bacteria | 2977537788 | 2977541446 | 173 |
| 1103 | iso_pu_bacteria | 2977544691 | 2977551373 | 173 |
| 1104 | iso_pu_bacteria | 2977551784 | 2977557500 | 173 |
| 1105 | iso_pu_bacteria | 2977558990 | 2977559959 | 173 |
| 1106 | iso_pu_bacteria | 2977565890 | 2977569828 | 173 |
| 1107 | iso_pu_bacteria | 2977572785 | 2977578820 | 173 |
| 1108 | iso_pu_bacteria | 2977579622 | 2977583942 | 173 |
| 1109 | iso_pu_bacteria | 2977821940 | 2977828835 | 173 |
| 1110 | iso_pu_bacteria | 2977828996 | 2977829842 | 173 |
| 1111 | iso_pu_bacteria | 2977843712 | 2977845402 | 173 |
| 1112 | iso_pu_bacteria | 2977851361 | 2977851799 | 173 |
| 1113 | iso_pu_bacteria | 2977858184 | 2977860258 | 173 |
| 1114 | iso_pu_bacteria | 2977864932 | 2977871966 | 173 |
| 1115 | iso_pu_bacteria | 2977872689 | 2977873260 | 173 |
| 1116 | iso_pu_bacteria | 2977907340 | 2977913686 | 173 |
| 1117 | iso_pu_bacteria | 2977922695 | 2977928119 | 173 |
| 1118 | iso_pu_bacteria | 2977935797 | 2977939448 | 173 |
| 1119 | iso_pu_bacteria | 2977942078 | 2977946935 | 173 |
| 1120 | iso_pu_bacteria | 2977950692 | 2977951354 | 173 |
| 1121 | iso_pu_bacteria | 2977957713 | 2977958681 | 173 |
| 1122 | iso_pu_bacteria | 2977971508 | 2977980095 | 173 |
| 1123 | iso_pu_bacteria | 2977986579 | 2977989479 | 173 |
| 1124 | iso_pu_bacteria | 2978969890 | 2978974444 | 173 |
| 1125 | iso_pu_bacteria | 2979089926 | 2979094524 | 173 |
| 1126 | iso_pu_bacteria | 2979095461 | 2979098093 | 173 |
| 1127 | iso_pu_bacteria | 2979100975 | 2979103766 | 173 |
| 1128 | iso_pu_bacteria | 2979710463 | 2979715731 | 173 |
| 1129 | iso_pu_bacteria | 2979779861 | 2979783234 | 173 |
| 1130 | iso_pu_bacteria | 2979808191 | 2979812503 | 173 |
| 1131 | iso_pu_bacteria | 2984509177 | 2984511668 | 173 |
| 1132 | iso_pu_bacteria | 2984518228 | 2984521971 | 173 |
| 1133 | iso_pu_bacteria | 2984537506 | 2984541269 | 173 |
| 1134 | iso_pu_bacteria | 2984587000 | 2984589782 | 173 |
| 1135 | iso_pu_bacteria | 2984601300 | 2984603547 | 173 |
| 1136 | iso_pu_bacteria | 2987636660 | 2987640729 | 173 |
| 1137 | iso_pu_bacteria | 2987645492 | 2987647826 | 173 |
| 1138 | iso_pu_bacteria | 2987652177 | 2987652481 | 173 |
| 1139 | iso_pu_bacteria | 2987659509 | 2987664078 | 173 |
| 1140 | iso_pu_bacteria | 2987666974 | 2987670303 | 173 |
| 1141 | iso_pu_bacteria | 2987673487 | 2987674281 | 173 |
| 1142 | iso_pu_bacteria | 2989349275 | 2989353402 | 173 |
| 1143 | iso_pu_bacteria | 2989771324 | 2989775905 | 173 |
| 1144 | iso_pu_bacteria | 2989776772 | 2989778460 | 173 |
| 1145 | iso_pu_bacteria | 2995392953 | 2995397034 | 173 |
| 1146 | iso_pu_bacteria | 2996310559 | 2996310964 | 173 |
| 1147 | iso_pu_bacteria | 2996336353 | 2996340563 | 173 |
| 1148 | iso_pu_bacteria | 2996341866 | 2996347156 | 173 |
| 1149 | iso_pu_bacteria | 2996348954 | 2996351226 | 173 |
| 1150 | iso_pu_bacteria | 2996386984 | 2996390919 | 173 |
| 1151 | iso_pu_bacteria | 2996887358 | 2996888846 | 173 |
| 1152 | iso_pu_bacteria | 2996893221 | 2996898882 | 173 |
| 1153 | iso_pu_bacteria | 3000135777 | 3000136178 | 173 |
| 1154 | iso_pu_bacteria | 3002141150 | 3002143937 | 173 |
| 1155 | iso_pu_bacteria | 3003930520 | 3003933077 | 173 |
| 1156 | iso_pu_bacteria | 3004167301 | 3004170180 | 173 |
| 1157 | iso_pu_bacteria | 3004188549 | 3004193133 | 173 |
| 1158 | iso_pu_bacteria | 3004195979 | 3004196117 | 173 |
| 1159 | iso_pu_bacteria | 3004203850 | 3004208926 | 173 |
| 1160 | iso_pu_bacteria | 3004211236 | 3004213112 | 173 |
| 1161 | iso_pu_bacteria | 3004218560 | 3004222125 | 173 |
| 1162 | iso_pu_bacteria | 3004232784 | 3004239280 | 173 |
| 1163 | iso_pu_bacteria | 3004268573 | 3004273814 | 173 |
| 1164 | iso_pu_bacteria | 3004275668 | 3004277924 | 173 |
| 1165 | iso_pu_bacteria | 3004289098 | 3004290241 | 173 |
| 1166 | iso_pu_bacteria | 3004334049 | 3004340250 | 173 |
| 1167 | iso_pu_bacteria | 3005409236 | 3005412757 | 173 |
| 1168 | iso_pu_bacteria | 3005416602 | 3005417902 | 173 |
| 1169 | iso_pu_bacteria | 3005445848 | 3005446994 | 173 |
| 1170 | iso_pu_bacteria | 3005452660 | 3005453627 | 173 |
| 1171 | iso_pu_bacteria | 3005474847 | 3005479147 | 173 |
| 1172 | iso_pu_bacteria | 3005506211 | 3005512696 | 173 |
| 1173 | iso_pu_bacteria | 3005594810 | 3005598081 | 173 |
| 1174 | iso_pu_bacteria | 3005718088 | 3005721271 | 173 |
| 1175 | iso_pu_bacteria | 637000159 | 637073569 | 173 |
| 1176 | iso_pu_bacteria | 639633055 | 639647674 | 173 |
| 1177 | iso_pu_bacteria | 643692032 | 643825411 | 173 |
| 1178 | iso_pu_bacteria | 648276728 | 648741353 | 173 |
| 1179 | iso_pu_bacteria | 649633066 | 649873505 | 173 |
| 1180 | iso_pu_bacteria | 650716007 | 650740403 | 173 |
| 1181 | iso_pu_bacteria | 8002285264 | 8002285930 | 173 |
| 1182 | iso_pu_bacteria | 8003570095 | 8003571465 | 173 |
| 1183 | iso_pu_bacteria | 8003992118 | 8003993240 | 173 |
| 1184 | iso_pu_bacteria | 8003999396 | 8004000497 | 173 |
| 1185 | iso_pu_bacteria | 8004300914 | 8004307028 | 173 |
| 1186 | iso_pu_bacteria | 8004312739 | 8004316477 | 173 |
| 1187 | iso_pu_bacteria | 8004361976 | 8004366431 | 173 |
| 1188 | iso_pu_bacteria | 8004374579 | 8004379603 | 173 |
| 1189 | iso_pu_bacteria | 8004387939 | 8004390932 | 173 |
| 1190 | iso_pu_bacteria | 8004445564 | 8004451624 | 173 |
| 1191 | iso_pu_bacteria | 8004633249 | 8004638913 | 173 |
| 1192 | iso_pu_bacteria | 8004640170 | 8004643115 | 173 |
| 1193 | iso_pu_bacteria | 8004695233 | 8004703055 | 173 |
| 1194 | iso_pu_bacteria | 8004703790 | 8004714465 | 173 |
| 1195 | iso_pu_bacteria | 8004714634 | 8004717484 | 173 |
| 1196 | iso_pu_bacteria | 8004727605 | 8004731780 | 173 |
| 1197 | iso_pu_bacteria | 8005246636 | 8005251034 | 173 |
| 1198 | iso_pu_bacteria | 8005258706 | 8005260117 | 173 |
| 1199 | iso_pu_bacteria | 8005275841 | 8005279889 | 173 |
| 1200 | iso_pu_bacteria | 8005282627 | 8005286951 | 173 |
| 1201 | iso_pu_bacteria | 8005289223 | 8005293034 | 173 |
| 1202 | iso_pu_bacteria | 8005301065 | 8005304846 | 173 |
| 1203 | iso_pu_bacteria | 8005307578 | 8005308636 | 173 |
| 1204 | iso_pu_bacteria | 8005314921 | 8005316448 | 173 |
| 1205 | iso_pu_bacteria | 8005321885 | 8005323373 | 173 |
| 1206 | iso_pu_bacteria | 8005376324 | 8005376361 | 173 |
| 1207 | iso_pu_bacteria | 8005382845 | 8005385747 | 173 |
| 1208 | iso_pu_bacteria | 8005395548 | 8005400605 | 173 |
| 1209 | iso_pu_bacteria | 8005430974 | 8005435331 | 173 |
| 1210 | iso_pu_bacteria | 8005460587 | 8005462187 | 173 |
| 1211 | iso_pu_bacteria | 8005484373 | 8005487110 | 173 |
| 1212 | iso_pu_bacteria | 8005497431 | 8005499606 | 173 |
| 1213 | iso_pu_bacteria | 8005542996 | 8005544505 | 173 |
| 1214 | iso_pu_bacteria | 8005556819 | 8005559794 | 173 |
| 1215 | iso_pu_bacteria | 8005563573 | 8005564966 | 173 |
| 1216 | iso_pu_bacteria | 8005570704 | 8005570874 | 173 |
| 1217 | iso_pu_bacteria | 8005619151 | 8005620786 | 173 |
| 1218 | iso_pu_bacteria | 8005626139 | 8005628920 | 173 |
| 1219 | iso_pu_bacteria | 8005645114 | 8005646536 | 173 |
| 1220 | iso_pu_bacteria | 8005658619 | 8005659721 | 173 |
| 1221 | iso_pu_bacteria | 8005668836 | 8005671023 | 173 |
| 1222 | iso_pu_bacteria | 8005682033 | 8005686565 | 173 |
| 1223 | iso_pu_bacteria | 8005688590 | 8005691271 | 173 |
| 1224 | iso_pu_bacteria | 8005695170 | 8005698522 | 173 |
| 1225 | iso_pu_bacteria | 8006926726 | 8006930384 | 173 |
| 1226 | iso_pu_bacteria | 8006933436 | 8006942201 | 173 |
| 1227 | iso_pu_bacteria | 8006964411 | 8006964512 | 173 |
| 1228 | iso_pu_bacteria | 8006973647 | 8006981935 | 173 |
| 1229 | iso_pu_bacteria | 8006984368 | 8006986869 | 173 |
| 1230 | iso_pu_bacteria | 8006994254 | 8006996088 | 173 |
| 1231 | iso_pu_bacteria | 8016511872 | 8016514670 | 173 |
| 1232 | iso_pu_bacteria | 8016522445 | 8016530769 | 173 |
| 1233 | iso_pu_bacteria | 8016530956 | 8016536060 | 173 |
| 1234 | iso_pu_bacteria | 8016539877 | 8016540339 | 173 |
| 1235 | iso_pu_bacteria | 8016548790 | 8016552891 | 173 |
| 1236 | iso_pu_bacteria | 8016557553 | 8016561270 | 173 |
| 1237 | iso_pu_bacteria | 8016566248 | 8016574406 | 173 |
| 1238 | iso_pu_bacteria | 8016575299 | 8016578504 | 173 |
| 1239 | iso_pu_bacteria | 8016583857 | 8016591256 | 173 |
| 1240 | iso_pu_bacteria | 8016595262 | 8016599127 | 173 |
| 1241 | iso_pu_bacteria | 8016603502 | 8016611921 | 173 |
| 1242 | iso_pu_bacteria | 8016613128 | 8016621883 | 173 |
| 1243 | iso_pu_bacteria | 8016622563 | 8016627971 | 173 |
| 1244 | iso_pu_bacteria | 8016630954 | 8016632294 | 173 |
| 1245 | iso_pu_bacteria | 8017057580 | 8017061764 | 173 |
| 1246 | iso_pu_bacteria | 8018127388 | 8018131578 | 173 |
| 1247 | iso_pu_bacteria | 8018150411 | 8018150793 | 173 |
| 1248 | iso_pu_bacteria | 8018163183 | 8018169241 | 173 |
| 1249 | iso_pu_bacteria | 8018176218 | 8018180140 | 173 |
| 1250 | iso_pu_bacteria | 8019530166 | 8019535786 | 173 |
| 1251 | iso_pu_bacteria | 8019538911 | 8019543693 | 173 |
| 1252 | iso_pu_bacteria | 8019547302 | 8019555079 | 173 |
| 1253 | iso_pu_bacteria | 8019555841 | 8019557922 | 173 |
| 1254 | iso_pu_bacteria | 8019565922 | 8019567363 | 173 |
| 1255 | iso_pu_bacteria | 8019576017 | 8019581264 | 173 |
| 1256 | iso_pu_bacteria | 8019586578 | 8019588891 | 173 |
| 1257 | iso_pu_bacteria | 8019597564 | 8019602343 | 173 |
| 1258 | iso_pu_bacteria | 8019608314 | 8019616218 | 173 |
| 1259 | iso_pu_bacteria | 8019619141 | 8019626838 | 173 |
| 1260 | iso_pu_bacteria | 8019629233 | 8019635674 | 173 |
| 1261 | iso_pu_bacteria | 8019638758 | 8019644011 | 173 |
| 1262 | iso_pu_bacteria | 8019648815 | 8019657008 | 173 |
| 1263 | iso_pu_bacteria | 8019659431 | 8019663470 | 173 |
| 1264 | iso_pu_bacteria | 8019668869 | 8019673084 | 173 |
| 1265 | iso_pu_bacteria | 8019678201 | 8019683056 | 173 |
| 1266 | iso_pu_bacteria | 8019687851 | 8019688753 | 173 |
| 1267 | iso_pu_bacteria | 8023680758 | 8023681983 | 173 |
| 1268 | iso_pu_bacteria | 8024479707 | 8024482504 | 173 |
| 1269 | iso_pu_bacteria | 8024486573 | 8024489489 | 173 |
| 1270 | iso_pu_bacteria | 8024501048 | 8024503005 | 173 |
| 1271 | iso_pu_bacteria | 8045864390 | 8045865492 | 173 |
| 1272 | iso_pu_bacteria | 8046767195 | 8046768492 | 173 |
| 1273 | iso_pu_bacteria | 8049293176 | 8049294292 | 173 |
| 1274 | iso_pu_bacteria | 8054460903 | 8054462016 | 173 |
| 1275 | iso_pu_bacteria | 8054558443 | 8054562914 | 173 |
| 1276 | iso_pu_bacteria | 8055617313 | 8055621996 | 173 |
| 1277 | iso_pu_bacteria | 8055742211 | 8055747547 | 173 |
| 1278 | iso_pu_bacteria | 8056375014 | 8056380979 | 173 |
| 1279 | iso_pu_bacteria | 8056382006 | 8056384495 | 173 |
| 1280 | iso_pu_bacteria | 8056681323 | 8056684533 | 173 |
| 1281 | iso_pu_bacteria | 8056689827 | 8056691243 | 173 |
| 1282 | iso_pu_bacteria | 8056875544 | 8056879580 | 173 |
| 1283 | iso_pu_bacteria | 8056967851 | 8056972377 | 173 |
| 1284 | iso_pu_bacteria | 8057575449 | 8057577979 | 173 |
| 1285 | iso_pu_bacteria | 8057874678 | 8057876559 | 173 |
| 1286 | iso_pu_bacteria | 3004248173 | 3004249011 | 175 |
| 1287 | 3300003320 | rootH2_10008940 | rootH2_1000894017 | 176 |
| 1288 | 3300000546 | LJNas_1019970 | LJNas_10199701 | 177 |
| 1289 | 3300001979 | JGI24740J21852_10005876 | JGI24740J21852_100058767 | 177 |
| 1290 | 3300001979 | JGI24740J21852_10038834 | JGI24740J21852_100388342 | 177 |
| 1291 | 3300002067 | JGI24735J21928_10008865 | JGI24735J21928_100088656 | 177 |
| 1292 | 3300002070 | JGI24750J21931_1002476 | JGI24750J21931_10024763 | 177 |
| 1293 | 3300002074 | JGI24748J21848_1006619 | JGI24748J21848_10066192 | 177 |
| 1294 | 3300002704 | JGI25155J39150_1000061 | JGI25155J39150_100006119 | 177 |
| 1295 | 3300002705 | JGI25156J39149_1001959 | JGI25156J39149_100195910 | 177 |
| 1296 | 3300002737 | JGI25162J39368_1009004 | JGI25162J39368_10090043 | 177 |
| 1297 | 3300002737 | JGI25162J39368_1009005 | JGI25162J39368_10090053 | 177 |
| 1298 | 3300002738 | JGI25154J39366_1002042 | JGI25154J39366_10020426 | 177 |
| 1299 | 3300002739 | JGI25158J39367_1002239 | JGI25158J39367_10022391 | 177 |
| 1300 | 3300002741 | JGI25157J39369_1000106 | JGI25157J39369_100010619 | 177 |
| 1301 | 3300002741 | JGI25157J39369_1002241 | JGI25157J39369_100224110 | 177 |
| 1302 | 3300002773 | JGI25152J39213_1035375 | JGI25152J39213_10353751 | 177 |
| 1303 | 3300002773 | JGI25152J39213_1043016 | JGI25152J39213_10430161 | 177 |
| 1304 | 3300002773 | JGI25152J39213_1043464 | JGI25152J39213_10434641 | 177 |
| 1305 | 3300002773 | JGI25152J39213_1047518 | JGI25152J39213_10475181 | 177 |
| 1306 | 3300002774 | JGI25150J39212_1009762 | JGI25150J39212_10097624 | 177 |
| 1307 | 3300002774 | JGI25150J39212_1014332 | JGI25150J39212_10143322 | 177 |
| 1308 | 3300002774 | JGI25150J39212_1018199 | JGI25150J39212_10181992 | 177 |
| 1309 | 3300002774 | JGI25150J39212_1041666 | JGI25150J39212_10416661 | 177 |
| 1310 | 3300002987 | JGI25159J45721_1001742 | JGI25159J45721_100174210 | 177 |
| 1311 | 3300002987 | JGI25159J45721_1001758 | JGI25159J45721_100175810 | 177 |
| 1312 | 3300002987 | JGI25159J45721_1001854 | JGI25159J45721_100185410 | 177 |
| 1313 | 3300003162 | Ga0006778J45830_1043587 | Ga0006778J45830_10435879 | 177 |
| 1314 | 3300003162 | Ga0006778J45830_1078890 | Ga0006778J45830_10788902 | 177 |
| 1315 | 3300003187 | JGI25151J46595_10033134 | JGI25151J46595_100331343 | 177 |
| 1316 | 3300003187 | JGI25151J46595_10051541 | JGI25151J46595_100515412 | 177 |
| 1317 | 3300003187 | JGI25151J46595_10094552 | JGI25151J46595_100945521 | 177 |
| 1318 | 3300003187 | JGI25151J46595_10095923 | JGI25151J46595_100959231 | 177 |
| 1319 | 3300003187 | JGI25151J46595_10097329 | JGI25151J46595_100973291 | 177 |
| 1320 | 3300003203 | JGI25406J46586_10001918 | JGI25406J46586_100019185 | 177 |
| 1321 | 3300003214 | JGI25165J46597_1001303 | JGI25165J46597_100130310 | 177 |
| 1322 | 3300003214 | JGI25165J46597_1008576 | JGI25165J46597_10085763 | 177 |
| 1323 | 3300003214 | JGI25165J46597_1009987 | JGI25165J46597_10099873 | 177 |
| 1324 | 3300003215 | JGI25153J46596_10001601 | JGI25153J46596_1000160110 | 177 |
| 1325 | 3300003215 | JGI25153J46596_10013209 | JGI25153J46596_100132095 | 177 |
| 1326 | 3300003215 | JGI25153J46596_10022281 | JGI25153J46596_100222811 | 177 |
| 1327 | 3300003215 | JGI25153J46596_10080670 | JGI25153J46596_100806701 | 177 |
| 1328 | 3300003215 | JGI25153J46596_10086554 | JGI25153J46596_100865541 | 177 |
| 1329 | 3300003215 | JGI25153J46596_10114136 | JGI25153J46596_101141361 | 177 |
| 1330 | 3300003215 | JGI25153J46596_10127048 | JGI25153J46596_101270481 | 177 |
| 1331 | 3300003300 | Ga0006758J48902_1009309 | Ga0006758J48902_100930911 | 177 |
| 1332 | 3300003322 | rootL2_10037314 | rootL2_100373142 | 177 |
| 1333 | 3300003354 | JGI25160J50197_1000711 | JGI25160J50197_10007112 | 177 |
| 1334 | 3300003354 | JGI25160J50197_1002401 | JGI25160J50197_100240110 | 177 |
| 1335 | 3300003354 | JGI25160J50197_1010180 | JGI25160J50197_10101802 | 177 |
| 1336 | 3300003354 | JGI25160J50197_1020369 | JGI25160J50197_10203692 | 177 |
| 1337 | 3300003354 | JGI25160J50197_1023262 | JGI25160J50197_10232623 | 177 |
| 1338 | 3300003354 | JGI25160J50197_1062080 | JGI25160J50197_10620801 | 177 |
| 1339 | 3300003354 | JGI25160J50197_1065297 | JGI25160J50197_10652971 | 177 |
| 1340 | 3300003374 | JGI25161J50226_1001504 | JGI25161J50226_100150410 | 177 |
| 1341 | 3300003374 | JGI25161J50226_1005101 | JGI25161J50226_10051016 | 177 |
| 1342 | 3300003374 | JGI25161J50226_1005181 | JGI25161J50226_10051811 | 177 |
| 1343 | 3300003544 | Ga0007417J51691_1064787 | Ga0007417J51691_10647872 | 177 |
| 1344 | 3300003559 | Ga0007427J51700_119959 | Ga0007427J51700_1199591 | 177 |
| 1345 | 3300003575 | Ga0007409J51694_1066553 | Ga0007409J51694_10665532 | 177 |
| 1346 | 3300003578 | Ga0006562J51391_1040260 | Ga0006562J51391_10402604 | 177 |
| 1347 | 3300003579 | Ga0007429J51699_1060640 | Ga0007429J51699_10606404 | 177 |
| 1348 | 3300003579 | Ga0007429J51699_1080175 | Ga0007429J51699_10801753 | 177 |
| 1349 | 3300003693 | Ga0032354_1024703 | Ga0032354_102470318 | 177 |
| 1350 | 3300003762 | Ga0055542_1001882 | Ga0055542_100188210 | 177 |
| 1351 | 3300003762 | Ga0055542_1002921 | Ga0055542_10029219 | 177 |
| 1352 | 3300003763 | Ga0055529_1004418 | Ga0055529_10044183 | 177 |
| 1353 | 3300003771 | Ga0055526_1003723 | Ga0055526_10037233 | 177 |
| 1354 | 3300003771 | Ga0055526_1035691 | Ga0055526_10356911 | 177 |
| 1355 | 3300003771 | Ga0055526_1064369 | Ga0055526_10643691 | 177 |
| 1356 | 3300003775 | Ga0055524_1036623 | Ga0055524_10366233 | 177 |
| 1357 | 3300003775 | Ga0055524_1044107 | Ga0055524_10441072 | 177 |
| 1358 | 3300003775 | Ga0055524_1050093 | Ga0055524_10500932 | 177 |
| 1359 | 3300003775 | Ga0055524_1066669 | Ga0055524_10666692 | 177 |
| 1360 | 3300003781 | Ga0055536_1001886 | Ga0055536_100188614 | 177 |
| 1361 | 3300003781 | Ga0055536_1002273 | Ga0055536_100227313 | 177 |
| 1362 | 3300003781 | Ga0055536_1006942 | Ga0055536_10069426 | 177 |
| 1363 | 3300003790 | Ga0055528_1021587 | Ga0055528_10215874 | 177 |
| 1364 | 3300003790 | Ga0055528_1056056 | Ga0055528_10560561 | 177 |
| 1365 | 3300003790 | Ga0055528_1076269 | Ga0055528_10762691 | 177 |
| 1366 | 3300003790 | Ga0055528_1076384 | Ga0055528_10763841 | 177 |
| 1367 | 3300003791 | Ga0055530_10009225 | Ga0055530_100092256 | 177 |
| 1368 | 3300003791 | Ga0055530_10024067 | Ga0055530_100240672 | 177 |
| 1369 | 3300003792 | Ga0055540_1004614 | Ga0055540_10046148 | 177 |
| 1370 | 3300003792 | Ga0055540_1064046 | Ga0055540_10640461 | 177 |
| 1371 | 3300003792 | Ga0055540_1065134 | Ga0055540_10651341 | 177 |
| 1372 | 3300003792 | Ga0055540_1077922 | Ga0055540_10779221 | 177 |
| 1373 | 3300003792 | Ga0055540_1085533 | Ga0055540_10855331 | 177 |
| 1374 | 3300003794 | Ga0055531_10006947 | Ga0055531_100069478 | 177 |
| 1375 | 3300003794 | Ga0055531_10017723 | Ga0055531_100177232 | 177 |
| 1376 | 3300003794 | Ga0055531_10080310 | Ga0055531_100803102 | 177 |
| 1377 | 3300004625 | Ga0055543_1000156 | Ga0055543_10001566 | 177 |
| 1378 | 3300004625 | Ga0055543_1000856 | Ga0055543_100085610 | 177 |
| 1379 | 3300004625 | Ga0055543_1000880 | Ga0055543_100088018 | 177 |
| 1380 | 3300004625 | Ga0055543_1001602 | Ga0055543_100160210 | 177 |
| 1381 | 3300004798 | Ga0058859_11714120 | Ga0058859_117141202 | 177 |
| 1382 | 3300004801 | Ga0058860_10018536 | Ga0058860_100185363 | 177 |
| 1383 | 3300004801 | Ga0058860_11771056 | Ga0058860_117710561 | 177 |
| 1384 | 3300005262 | Ga0065165_1002620 | Ga0065165_100262010 | 177 |
| 1385 | 3300005262 | Ga0065165_1002688 | Ga0065165_100268810 | 177 |
| 1386 | 3300005262 | Ga0065165_1008206 | Ga0065165_10082066 | 177 |
| 1387 | 3300005262 | Ga0065165_1014496 | Ga0065165_10144965 | 177 |
| 1388 | 3300005262 | Ga0065165_1019265 | Ga0065165_10192655 | 177 |
| 1389 | 3300005262 | Ga0065165_1020288 | Ga0065165_10202885 | 177 |
| 1390 | 3300005289 | Ga0065704_10166257 | Ga0065704_101662571 | 177 |
| 1391 | 3300005295 | Ga0065707_10012753 | Ga0065707_100127533 | 177 |
| 1392 | 3300005327 | Ga0070658_10092435 | Ga0070658_100924355 | 177 |
| 1393 | 3300005328 | Ga0070676_10812915 | Ga0070676_108129151 | 177 |
| 1394 | 3300005331 | Ga0070670_100003237 | Ga0070670_10000323711 | 177 |
| 1395 | 3300005331 | Ga0070670_100139598 | Ga0070670_1001395982 | 177 |
| 1396 | 3300005335 | Ga0070666_10461003 | Ga0070666_104610032 | 177 |
| 1397 | 3300005335 | Ga0070666_10739099 | Ga0070666_107390991 | 177 |
| 1398 | 3300005335 | Ga0070666_10788376 | Ga0070666_107883761 | 177 |
| 1399 | 3300005337 | Ga0070682_100060292 | Ga0070682_1000602925 | 177 |
| 1400 | 3300005337 | Ga0070682_100106402 | Ga0070682_1001064024 | 177 |
| 1401 | 3300005337 | Ga0070682_100644370 | Ga0070682_1006443702 | 177 |
| 1402 | 3300005337 | Ga0070682_101449987 | Ga0070682_1014499871 | 177 |
| 1403 | 3300005339 | Ga0070660_100228895 | Ga0070660_1002288951 | 177 |
| 1404 | 3300005339 | Ga0070660_100286912 | Ga0070660_1002869121 | 177 |
| 1405 | 3300005340 | Ga0070689_101175664 | Ga0070689_1011756641 | 177 |
| 1406 | 3300005343 | Ga0070687_100950748 | Ga0070687_1009507481 | 177 |
| 1407 | 3300005344 | Ga0070661_100490127 | Ga0070661_1004901272 | 177 |
| 1408 | 3300005345 | Ga0070692_10549122 | Ga0070692_105491222 | 177 |
| 1409 | 3300005347 | Ga0070668_100162574 | Ga0070668_1001625741 | 177 |
| 1410 | 3300005347 | Ga0070668_100167991 | Ga0070668_1001679914 | 177 |
| 1411 | 3300005347 | Ga0070668_100231234 | Ga0070668_1002312341 | 177 |
| 1412 | 3300005347 | Ga0070668_100334546 | Ga0070668_1003345462 | 177 |
| 1413 | 3300005347 | Ga0070668_100927361 | Ga0070668_1009273611 | 177 |
| 1414 | 3300005353 | Ga0070669_100237958 | Ga0070669_1002379583 | 177 |
| 1415 | 3300005353 | Ga0070669_100279858 | Ga0070669_1002798582 | 177 |
| 1416 | 3300005353 | Ga0070669_100311739 | Ga0070669_1003117393 | 177 |
| 1417 | 3300005353 | Ga0070669_100440199 | Ga0070669_1004401992 | 177 |
| 1418 | 3300005354 | Ga0070675_100903392 | Ga0070675_1009033922 | 177 |
| 1419 | 3300005355 | Ga0070671_100016669 | Ga0070671_1000166695 | 177 |
| 1420 | 3300005355 | Ga0070671_100177196 | Ga0070671_1001771962 | 177 |
| 1421 | 3300005355 | Ga0070671_100329945 | Ga0070671_1003299452 | 177 |
| 1422 | 3300005355 | Ga0070671_101149589 | Ga0070671_1011495891 | 177 |
| 1423 | 3300005355 | Ga0070671_101211801 | Ga0070671_1012118011 | 177 |
| 1424 | 3300005356 | Ga0070674_100224686 | Ga0070674_1002246861 | 177 |
| 1425 | 3300005356 | Ga0070674_100422934 | Ga0070674_1004229342 | 177 |
| 1426 | 3300005364 | Ga0070673_100870080 | Ga0070673_1008700801 | 177 |
| 1427 | 3300005365 | Ga0070688_100220798 | Ga0070688_1002207982 | 177 |
| 1428 | 3300005366 | Ga0070659_100100837 | Ga0070659_1001008372 | 177 |
| 1429 | 3300005367 | Ga0070667_100967783 | Ga0070667_1009677832 | 177 |
| 1430 | 3300005367 | Ga0070667_101192686 | Ga0070667_1011926862 | 177 |
| 1431 | 3300005367 | Ga0070667_101453121 | Ga0070667_1014531211 | 177 |
| 1432 | 3300005406 | Ga0070703_10123651 | Ga0070703_101236512 | 177 |
| 1433 | 3300005434 | Ga0070709_10004324 | Ga0070709_1000432411 | 177 |
| 1434 | 3300005434 | Ga0070709_10499759 | Ga0070709_104997591 | 177 |
| 1435 | 3300005435 | Ga0070714_100059218 | Ga0070714_1000592186 | 177 |
| 1436 | 3300005435 | Ga0070714_100112402 | Ga0070714_1001124022 | 177 |
| 1437 | 3300005436 | Ga0070713_100027784 | Ga0070713_1000277843 | 177 |
| 1438 | 3300005436 | Ga0070713_100030565 | Ga0070713_1000305656 | 177 |
| 1439 | 3300005436 | Ga0070713_100187641 | Ga0070713_1001876412 | 177 |
| 1440 | 3300005436 | Ga0070713_101186952 | Ga0070713_1011869521 | 177 |
| 1441 | 3300005436 | Ga0070713_101663701 | Ga0070713_1016637011 | 177 |
| 1442 | 3300005437 | Ga0070710_10003270 | Ga0070710_100032706 | 177 |
| 1443 | 3300005437 | Ga0070710_10033673 | Ga0070710_100336735 | 177 |
| 1444 | 3300005437 | Ga0070710_10211874 | Ga0070710_102118741 | 177 |
| 1445 | 3300005439 | Ga0070711_100007497 | Ga0070711_10000749713 | 177 |
| 1446 | 3300005439 | Ga0070711_100123070 | Ga0070711_1001230703 | 177 |
| 1447 | 3300005439 | Ga0070711_100126700 | Ga0070711_1001267004 | 177 |
| 1448 | 3300005439 | Ga0070711_100201995 | Ga0070711_1002019952 | 177 |
| 1449 | 3300005439 | Ga0070711_100357588 | Ga0070711_1003575883 | 177 |
| 1450 | 3300005444 | Ga0070694_100180173 | Ga0070694_1001801732 | 177 |
| 1451 | 3300005445 | Ga0070708_100035098 | Ga0070708_1000350989 | 177 |
| 1452 | 3300005455 | Ga0070663_100146891 | Ga0070663_1001468912 | 177 |
| 1453 | 3300005455 | Ga0070663_100254636 | Ga0070663_1002546363 | 177 |
| 1454 | 3300005455 | Ga0070663_100816616 | Ga0070663_1008166161 | 177 |
| 1455 | 3300005456 | Ga0070678_100023343 | Ga0070678_1000233436 | 177 |
| 1456 | 3300005458 | Ga0070681_10018722 | Ga0070681_100187228 | 177 |
| 1457 | 3300005458 | Ga0070681_10068789 | Ga0070681_100687897 | 177 |
| 1458 | 3300005466 | Ga0070685_10472265 | Ga0070685_104722651 | 177 |
| 1459 | 3300005466 | Ga0070685_10917889 | Ga0070685_109178891 | 177 |
| 1460 | 3300005467 | Ga0070706_100045185 | Ga0070706_1000451857 | 177 |
| 1461 | 3300005467 | Ga0070706_100246691 | Ga0070706_1002466913 | 177 |
| 1462 | 3300005467 | Ga0070706_101013047 | Ga0070706_1010130471 | 177 |
| 1463 | 3300005468 | Ga0070707_100065254 | Ga0070707_1000652546 | 177 |
| 1464 | 3300005471 | Ga0070698_100298640 | Ga0070698_1002986401 | 177 |
| 1465 | 3300005471 | Ga0070698_100327715 | Ga0070698_1003277153 | 177 |
| 1466 | 3300005471 | Ga0070698_101101846 | Ga0070698_1011018462 | 177 |
| 1467 | 3300005530 | Ga0070679_100237155 | Ga0070679_1002371553 | 177 |
| 1468 | 3300005530 | Ga0070679_100305294 | Ga0070679_1003052942 | 177 |
| 1469 | 3300005530 | Ga0070679_100329362 | Ga0070679_1003293622 | 177 |
| 1470 | 3300005535 | Ga0070684_100792115 | Ga0070684_1007921151 | 177 |
| 1471 | 3300005535 | Ga0070684_100911036 | Ga0070684_1009110362 | 177 |
| 1472 | 3300005535 | Ga0070684_101120991 | Ga0070684_1011209912 | 177 |
| 1473 | 3300005536 | Ga0070697_100102676 | Ga0070697_1001026764 | 177 |
| 1474 | 3300005536 | Ga0070697_100279312 | Ga0070697_1002793122 | 177 |
| 1475 | 3300005539 | Ga0068853_100027914 | Ga0068853_1000279146 | 177 |
| 1476 | 3300005539 | Ga0068853_100087278 | Ga0068853_1000872784 | 177 |
| 1477 | 3300005539 | Ga0068853_100159771 | Ga0068853_1001597714 | 177 |
| 1478 | 3300005539 | Ga0068853_100495158 | Ga0068853_1004951582 | 177 |
| 1479 | 3300005539 | Ga0068853_101444864 | Ga0068853_1014448641 | 177 |
| 1480 | 3300005543 | Ga0070672_100153802 | Ga0070672_1001538023 | 177 |
| 1481 | 3300005543 | Ga0070672_100921346 | Ga0070672_1009213461 | 177 |
| 1482 | 3300005544 | Ga0070686_100291835 | Ga0070686_1002918351 | 177 |
| 1483 | 3300005546 | Ga0070696_100105177 | Ga0070696_1001051773 | 177 |
| 1484 | 3300005547 | Ga0070693_100556937 | Ga0070693_1005569371 | 177 |
| 1485 | 3300005548 | Ga0070665_100006166 | Ga0070665_10000616618 | 177 |
| 1486 | 3300005548 | Ga0070665_100149739 | Ga0070665_1001497393 | 177 |
| 1487 | 3300005548 | Ga0070665_100189603 | Ga0070665_1001896033 | 177 |
| 1488 | 3300005548 | Ga0070665_100578965 | Ga0070665_1005789653 | 177 |
| 1489 | 3300005548 | Ga0070665_100588727 | Ga0070665_1005887272 | 177 |
| 1490 | 3300005548 | Ga0070665_100658220 | Ga0070665_1006582202 | 177 |
| 1491 | 3300005549 | Ga0070704_100474375 | Ga0070704_1004743751 | 177 |
| 1492 | 3300005563 | Ga0068855_100017220 | Ga0068855_10001722013 | 177 |
| 1493 | 3300005563 | Ga0068855_100324040 | Ga0068855_1003240404 | 177 |
| 1494 | 3300005563 | Ga0068855_100408666 | Ga0068855_1004086663 | 177 |
| 1495 | 3300005563 | Ga0068855_100516500 | Ga0068855_1005165001 | 177 |
| 1496 | 3300005563 | Ga0068855_100528959 | Ga0068855_1005289593 | 177 |
| 1497 | 3300005563 | Ga0068855_100860885 | Ga0068855_1008608852 | 177 |
| 1498 | 3300005563 | Ga0068855_101690612 | Ga0068855_1016906121 | 177 |
| 1499 | 3300005564 | Ga0070664_100444593 | Ga0070664_1004445932 | 177 |
| 1500 | 3300005564 | Ga0070664_101316078 | Ga0070664_1013160782 | 177 |
| 1501 | 3300005577 | Ga0068857_100250838 | Ga0068857_1002508382 | 177 |
| 1502 | 3300005577 | Ga0068857_100788810 | Ga0068857_1007888102 | 177 |
| 1503 | 3300005578 | Ga0068854_100367640 | Ga0068854_1003676402 | 177 |
| 1504 | 3300005578 | Ga0068854_100767970 | Ga0068854_1007679701 | 177 |
| 1505 | 3300005614 | Ga0068856_100055880 | Ga0068856_1000558804 | 177 |
| 1506 | 3300005614 | Ga0068856_100137388 | Ga0068856_1001373886 | 177 |
| 1507 | 3300005614 | Ga0068856_100156445 | Ga0068856_1001564453 | 177 |
| 1508 | 3300005614 | Ga0068856_100489690 | Ga0068856_1004896902 | 177 |
| 1509 | 3300005614 | Ga0068856_100700160 | Ga0068856_1007001601 | 177 |
| 1510 | 3300005614 | Ga0068856_100817239 | Ga0068856_1008172391 | 177 |
| 1511 | 3300005615 | Ga0070702_100640463 | Ga0070702_1006404631 | 177 |
| 1512 | 3300005616 | Ga0068852_100626597 | Ga0068852_1006265973 | 177 |
| 1513 | 3300005616 | Ga0068852_101350716 | Ga0068852_1013507161 | 177 |
| 1514 | 3300005616 | Ga0068852_101864462 | Ga0068852_1018644621 | 177 |
| 1515 | 3300005617 | Ga0068859_100087579 | Ga0068859_1000875796 | 177 |
| 1516 | 3300005617 | Ga0068859_101045611 | Ga0068859_1010456112 | 177 |
| 1517 | 3300005618 | Ga0068864_100514273 | Ga0068864_1005142732 | 177 |
| 1518 | 3300005618 | Ga0068864_101231776 | Ga0068864_1012317762 | 177 |
| 1519 | 3300005719 | Ga0068861_100287874 | Ga0068861_1002878742 | 177 |
| 1520 | 3300005834 | Ga0068851_10105812 | Ga0068851_101058122 | 177 |
| 1521 | 3300005834 | Ga0068851_10382695 | Ga0068851_103826952 | 177 |
| 1522 | 3300005842 | Ga0068858_100044764 | Ga0068858_1000447645 | 177 |
| 1523 | 3300005842 | Ga0068858_100401297 | Ga0068858_1004012972 | 177 |
| 1524 | 3300005842 | Ga0068858_100622112 | Ga0068858_1006221122 | 177 |
| 1525 | 3300005842 | Ga0068858_100653539 | Ga0068858_1006535392 | 177 |
| 1526 | 3300005843 | Ga0068860_100078148 | Ga0068860_1000781486 | 177 |
| 1527 | 3300005843 | Ga0068860_100138904 | Ga0068860_1001389046 | 177 |
| 1528 | 3300005843 | Ga0068860_100671828 | Ga0068860_1006718281 | 177 |
| 1529 | 3300005844 | Ga0068862_100434499 | Ga0068862_1004344992 | 177 |
| 1530 | 3300005983 | Ga0081540_1002663 | Ga0081540_100266319 | 177 |
| 1531 | 3300005983 | Ga0081540_1014636 | Ga0081540_10146367 | 177 |
| 1532 | 3300005983 | Ga0081540_1072665 | Ga0081540_10726652 | 177 |
| 1533 | 3300005983 | Ga0081540_1186647 | Ga0081540_11866472 | 177 |
| 1534 | 3300005985 | Ga0081539_10000273 | Ga0081539_1000027318 | 177 |
| 1535 | 3300005985 | Ga0081539_10004419 | Ga0081539_1000441918 | 177 |
| 1536 | 3300005985 | Ga0081539_10038639 | Ga0081539_100386395 | 177 |
| 1537 | 3300006028 | Ga0070717_10023212 | Ga0070717_100232128 | 177 |
| 1538 | 3300006028 | Ga0070717_10257030 | Ga0070717_102570302 | 177 |
| 1539 | 3300006028 | Ga0070717_11382128 | Ga0070717_113821281 | 177 |
| 1540 | 3300006038 | Ga0075365_10004647 | Ga0075365_100046479 | 177 |
| 1541 | 3300006038 | Ga0075365_10027241 | Ga0075365_100272416 | 177 |
| 1542 | 3300006038 | Ga0075365_10057229 | Ga0075365_100572291 | 177 |
| 1543 | 3300006038 | Ga0075365_10062221 | Ga0075365_100622215 | 177 |
| 1544 | 3300006038 | Ga0075365_10089365 | Ga0075365_100893653 | 177 |
| 1545 | 3300006038 | Ga0075365_10121312 | Ga0075365_101213122 | 177 |
| 1546 | 3300006038 | Ga0075365_10168486 | Ga0075365_101684863 | 177 |
| 1547 | 3300006038 | Ga0075365_10206089 | Ga0075365_102060893 | 177 |
| 1548 | 3300006038 | Ga0075365_10235649 | Ga0075365_102356492 | 177 |
| 1549 | 3300006038 | Ga0075365_10255350 | Ga0075365_102553503 | 177 |
| 1550 | 3300006038 | Ga0075365_10264031 | Ga0075365_102640311 | 177 |
| 1551 | 3300006038 | Ga0075365_10626635 | Ga0075365_106266352 | 177 |
| 1552 | 3300006038 | Ga0075365_10747840 | Ga0075365_107478402 | 177 |
| 1553 | 3300006042 | Ga0075368_10085252 | Ga0075368_100852522 | 177 |
| 1554 | 3300006042 | Ga0075368_10106170 | Ga0075368_101061702 | 177 |
| 1555 | 3300006042 | Ga0075368_10117777 | Ga0075368_101177771 | 177 |
| 1556 | 3300006042 | Ga0075368_10203279 | Ga0075368_102032791 | 177 |
| 1557 | 3300006042 | Ga0075368_10240025 | Ga0075368_102400251 | 177 |
| 1558 | 3300006042 | Ga0075368_10410777 | Ga0075368_104107771 | 177 |
| 1559 | 3300006048 | Ga0075363_100073492 | Ga0075363_1000734923 | 177 |
| 1560 | 3300006048 | Ga0075363_100099958 | Ga0075363_1000999582 | 177 |
| 1561 | 3300006048 | Ga0075363_100141538 | Ga0075363_1001415383 | 177 |
| 1562 | 3300006048 | Ga0075363_100351063 | Ga0075363_1003510631 | 177 |
| 1563 | 3300006048 | Ga0075363_100776260 | Ga0075363_1007762601 | 177 |
| 1564 | 3300006051 | Ga0075364_10010552 | Ga0075364_100105525 | 177 |
| 1565 | 3300006051 | Ga0075364_10036710 | Ga0075364_100367103 | 177 |
| 1566 | 3300006051 | Ga0075364_10042063 | Ga0075364_100420633 | 177 |
| 1567 | 3300006051 | Ga0075364_10119377 | Ga0075364_101193772 | 177 |
| 1568 | 3300006051 | Ga0075364_10254910 | Ga0075364_102549103 | 177 |
| 1569 | 3300006051 | Ga0075364_10316047 | Ga0075364_103160472 | 177 |
| 1570 | 3300006051 | Ga0075364_10426515 | Ga0075364_104265152 | 177 |
| 1571 | 3300006051 | Ga0075364_10447344 | Ga0075364_104473442 | 177 |
| 1572 | 3300006051 | Ga0075364_10641372 | Ga0075364_106413721 | 177 |
| 1573 | 3300006163 | Ga0070715_10001968 | Ga0070715_100019684 | 177 |
| 1574 | 3300006163 | Ga0070715_10011442 | Ga0070715_100114428 | 177 |
| 1575 | 3300006163 | Ga0070715_10330699 | Ga0070715_103306991 | 177 |
| 1576 | 3300006173 | Ga0070716_100272909 | Ga0070716_1002729092 | 177 |
| 1577 | 3300006173 | Ga0070716_100470612 | Ga0070716_1004706121 | 177 |
| 1578 | 3300006173 | Ga0070716_100473025 | Ga0070716_1004730252 | 177 |
| 1579 | 3300006175 | Ga0070712_100025062 | Ga0070712_1000250627 | 177 |
| 1580 | 3300006175 | Ga0070712_100056366 | Ga0070712_1000563663 | 177 |
| 1581 | 3300006175 | Ga0070712_100060765 | Ga0070712_1000607653 | 177 |
| 1582 | 3300006177 | Ga0075362_10079775 | Ga0075362_100797752 | 177 |
| 1583 | 3300006177 | Ga0075362_10110162 | Ga0075362_101101622 | 177 |
| 1584 | 3300006177 | Ga0075362_10153066 | Ga0075362_101530661 | 177 |
| 1585 | 3300006178 | Ga0075367_10033189 | Ga0075367_100331896 | 177 |
| 1586 | 3300006178 | Ga0075367_10037524 | Ga0075367_100375242 | 177 |
| 1587 | 3300006178 | Ga0075367_10054062 | Ga0075367_100540625 | 177 |
| 1588 | 3300006178 | Ga0075367_10065439 | Ga0075367_100654394 | 177 |
| 1589 | 3300006178 | Ga0075367_10308575 | Ga0075367_103085752 | 177 |
| 1590 | 3300006178 | Ga0075367_10586198 | Ga0075367_105861981 | 177 |
| 1591 | 3300006178 | Ga0075367_10691774 | Ga0075367_106917741 | 177 |
| 1592 | 3300006186 | Ga0075369_10014487 | Ga0075369_100144874 | 177 |
| 1593 | 3300006186 | Ga0075369_10020381 | Ga0075369_100203812 | 177 |
| 1594 | 3300006186 | Ga0075369_10037612 | Ga0075369_100376124 | 177 |
| 1595 | 3300006186 | Ga0075369_10375803 | Ga0075369_103758032 | 177 |
| 1596 | 3300006195 | Ga0075366_10131212 | Ga0075366_101312123 | 177 |
| 1597 | 3300006195 | Ga0075366_10138136 | Ga0075366_101381363 | 177 |
| 1598 | 3300006195 | Ga0075366_10174089 | Ga0075366_101740893 | 177 |
| 1599 | 3300006195 | Ga0075366_10355545 | Ga0075366_103555452 | 177 |
| 1600 | 3300006237 | Ga0097621_100292431 | Ga0097621_1002924313 | 177 |
| 1601 | 3300006237 | Ga0097621_101368845 | Ga0097621_1013688451 | 177 |
| 1602 | 3300006353 | Ga0075370_10039567 | Ga0075370_100395676 | 177 |
| 1603 | 3300006353 | Ga0075370_10062119 | Ga0075370_100621193 | 177 |
| 1604 | 3300006353 | Ga0075370_10122384 | Ga0075370_101223842 | 177 |
| 1605 | 3300006353 | Ga0075370_10161654 | Ga0075370_101616543 | 177 |
| 1606 | 3300006353 | Ga0075370_10179770 | Ga0075370_101797702 | 177 |
| 1607 | 3300006353 | Ga0075370_10187626 | Ga0075370_101876261 | 177 |
| 1608 | 3300006353 | Ga0075370_10347804 | Ga0075370_103478042 | 177 |
| 1609 | 3300006353 | Ga0075370_10367753 | Ga0075370_103677531 | 177 |
| 1610 | 3300006353 | Ga0075370_10371994 | Ga0075370_103719942 | 177 |
| 1611 | 3300006353 | Ga0075370_10705560 | Ga0075370_107055601 | 177 |
| 1612 | 3300006358 | Ga0068871_100308486 | Ga0068871_1003084862 | 177 |
| 1613 | 3300006358 | Ga0068871_100474415 | Ga0068871_1004744153 | 177 |
| 1614 | 3300006844 | Ga0075428_101573100 | Ga0075428_1015731001 | 177 |
| 1615 | 3300006846 | Ga0075430_100224662 | Ga0075430_1002246623 | 177 |
| 1616 | 3300006881 | Ga0068865_101156479 | Ga0068865_1011564791 | 177 |
| 1617 | 3300006931 | Ga0097620_100087577 | Ga0097620_1000875776 | 177 |
| 1618 | 3300006931 | Ga0097620_101045554 | Ga0097620_1010455542 | 177 |
| 1619 | 3300006942 | Ga0099824_1018607 | Ga0099824_10186074 | 177 |
| 1620 | 3300006942 | Ga0099824_1032925 | Ga0099824_10329253 | 177 |
| 1621 | 3300006943 | Ga0099822_1005414 | Ga0099822_100541423 | 177 |
| 1622 | 3300006946 | Ga0079104_1000547 | Ga0079104_100054739 | 177 |
| 1623 | 3300006946 | Ga0079104_1065570 | Ga0079104_10655702 | 177 |
| 1624 | 3300006946 | Ga0079104_1065575 | Ga0079104_10655751 | 177 |
| 1625 | 3300007076 | Ga0075435_100092843 | Ga0075435_1000928432 | 177 |
| 1626 | 3300007076 | Ga0075435_100655224 | Ga0075435_1006552241 | 177 |
| 1627 | 3300007265 | Ga0099794_10106923 | Ga0099794_101069232 | 177 |
| 1628 | 3300007265 | Ga0099794_10477110 | Ga0099794_104771101 | 177 |
| 1629 | 3300007265 | Ga0099794_10550597 | Ga0099794_105505971 | 177 |
| 1630 | 3300007265 | Ga0099794_10556276 | Ga0099794_105562761 | 177 |
| 1631 | 3300007788 | Ga0099795_10055043 | Ga0099795_100550433 | 177 |
| 1632 | 3300007788 | Ga0099795_10060930 | Ga0099795_100609302 | 177 |
| 1633 | 3300009036 | Ga0105244_10078483 | Ga0105244_100784833 | 177 |
| 1634 | 3300009092 | Ga0105250_10074943 | Ga0105250_100749431 | 177 |
| 1635 | 3300009092 | Ga0105250_10164015 | Ga0105250_101640152 | 177 |
| 1636 | 3300009093 | Ga0105240_10000005 | Ga0105240_1000000518 | 177 |
| 1637 | 3300009093 | Ga0105240_10015249 | Ga0105240_1001524910 | 177 |
| 1638 | 3300009093 | Ga0105240_10349884 | Ga0105240_103498842 | 177 |
| 1639 | 3300009093 | Ga0105240_10398679 | Ga0105240_103986793 | 177 |
| 1640 | 3300009093 | Ga0105240_10501863 | Ga0105240_105018632 | 177 |
| 1641 | 3300009093 | Ga0105240_10788852 | Ga0105240_107888521 | 177 |
| 1642 | 3300009093 | Ga0105240_11016121 | Ga0105240_110161212 | 177 |
| 1643 | 3300009093 | Ga0105240_12181467 | Ga0105240_121814671 | 177 |
| 1644 | 3300009094 | Ga0111539_11432011 | Ga0111539_114320112 | 177 |
| 1645 | 3300009098 | Ga0105245_10811286 | Ga0105245_108112862 | 177 |
| 1646 | 3300009101 | Ga0105247_10042031 | Ga0105247_100420312 | 177 |
| 1647 | 3300009101 | Ga0105247_10158943 | Ga0105247_101589431 | 177 |
| 1648 | 3300009101 | Ga0105247_10641537 | Ga0105247_106415371 | 177 |
| 1649 | 3300009148 | Ga0105243_10336891 | Ga0105243_103368912 | 177 |
| 1650 | 3300009148 | Ga0105243_10571340 | Ga0105243_105713402 | 177 |
| 1651 | 3300009174 | Ga0105241_10145737 | Ga0105241_101457373 | 177 |
| 1652 | 3300009174 | Ga0105241_10251998 | Ga0105241_102519982 | 177 |
| 1653 | 3300009174 | Ga0105241_10421547 | Ga0105241_104215471 | 177 |
| 1654 | 3300009174 | Ga0105241_10721348 | Ga0105241_107213482 | 177 |
| 1655 | 3300009176 | Ga0105242_10350072 | Ga0105242_103500723 | 177 |
| 1656 | 3300009176 | Ga0105242_10376779 | Ga0105242_103767793 | 177 |
| 1657 | 3300009177 | Ga0105248_10284816 | Ga0105248_102848163 | 177 |
| 1658 | 3300009545 | Ga0105237_10001070 | Ga0105237_1000107034 | 177 |
| 1659 | 3300009545 | Ga0105237_10054286 | Ga0105237_100542862 | 177 |
| 1660 | 3300009545 | Ga0105237_10219809 | Ga0105237_102198093 | 177 |
| 1661 | 3300009545 | Ga0105237_10745415 | Ga0105237_107454152 | 177 |
| 1662 | 3300009545 | Ga0105237_10896931 | Ga0105237_108969311 | 177 |
| 1663 | 3300009545 | Ga0105237_11112702 | Ga0105237_111127022 | 177 |
| 1664 | 3300009545 | Ga0105237_11633537 | Ga0105237_116335371 | 177 |
| 1665 | 3300009551 | Ga0105238_10012597 | Ga0105238_1001259714 | 177 |
| 1666 | 3300009551 | Ga0105238_10026677 | Ga0105238_100266776 | 177 |
| 1667 | 3300009551 | Ga0105238_10144804 | Ga0105238_101448044 | 177 |
| 1668 | 3300009551 | Ga0105238_11115291 | Ga0105238_111152912 | 177 |
| 1669 | 3300009551 | Ga0105238_11215300 | Ga0105238_112153001 | 177 |
| 1670 | 3300009553 | Ga0105249_10147904 | Ga0105249_101479042 | 177 |
| 1671 | 3300009553 | Ga0105249_10154860 | Ga0105249_101548603 | 177 |
| 1672 | 3300009553 | Ga0105249_10357884 | Ga0105249_103578843 | 177 |
| 1673 | 3300009553 | Ga0105249_10406344 | Ga0105249_104063443 | 177 |
| 1674 | 3300009553 | Ga0105249_11188666 | Ga0105249_111886661 | 177 |
| 1675 | 3300009763 | Ga0123340_1058714 | Ga0123340_10587142 | 177 |
| 1676 | 3300009765 | Ga0123341_1005490 | Ga0123341_100549010 | 177 |
| 1677 | 3300009765 | Ga0123341_1017290 | Ga0123341_10172903 | 177 |
| 1678 | 3300009766 | Ga0123342_1018253 | Ga0123342_10182539 | 177 |
| 1679 | 3300009766 | Ga0123342_1019698 | Ga0123342_10196988 | 177 |
| 1680 | 3300010375 | Ga0105239_10008784 | Ga0105239_100087846 | 177 |
| 1681 | 3300010375 | Ga0105239_10501837 | Ga0105239_105018371 | 177 |
| 1682 | 3300010375 | Ga0105239_10530800 | Ga0105239_105308002 | 177 |
| 1683 | 3300010375 | Ga0105239_10687690 | Ga0105239_106876903 | 177 |
| 1684 | 3300010375 | Ga0105239_10707819 | Ga0105239_107078192 | 177 |
| 1685 | 3300010375 | Ga0105239_11224442 | Ga0105239_112244422 | 177 |
| 1686 | 3300010375 | Ga0105239_11811102 | Ga0105239_118111022 | 177 |
| 1687 | 3300011119 | Ga0105246_10278490 | Ga0105246_102784903 | 177 |
| 1688 | 3300012490 | Ga0157322_1011849 | Ga0157322_10118492 | 177 |
| 1689 | 3300012494 | Ga0157341_1003500 | Ga0157341_10035002 | 177 |
| 1690 | 3300012513 | Ga0157326_1004470 | Ga0157326_10044703 | 177 |
| 1691 | 3300013100 | Ga0157373_10011316 | Ga0157373_1001131610 | 177 |
| 1692 | 3300013100 | Ga0157373_10235722 | Ga0157373_102357222 | 177 |
| 1693 | 3300013102 | Ga0157371_10221421 | Ga0157371_102214212 | 177 |
| 1694 | 3300013102 | Ga0157371_10269063 | Ga0157371_102690633 | 177 |
| 1695 | 3300013104 | Ga0157370_10235560 | Ga0157370_102355602 | 177 |
| 1696 | 3300013104 | Ga0157370_10280834 | Ga0157370_102808342 | 177 |
| 1697 | 3300013105 | Ga0157369_10030062 | Ga0157369_100300623 | 177 |
| 1698 | 3300013105 | Ga0157369_10066010 | Ga0157369_100660106 | 177 |
| 1699 | 3300013105 | Ga0157369_10592128 | Ga0157369_105921282 | 177 |
| 1700 | 3300013306 | Ga0163162_10601306 | Ga0163162_106013061 | 177 |
| 1701 | 3300013306 | Ga0163162_11570527 | Ga0163162_115705272 | 177 |
| 1702 | 3300013307 | Ga0157372_10252779 | Ga0157372_102527793 | 177 |
| 1703 | 3300013307 | Ga0157372_11662276 | Ga0157372_116622762 | 177 |
| 1704 | 3300013308 | Ga0157375_10809287 | Ga0157375_108092871 | 177 |
| 1705 | 3300014325 | Ga0163163_10283279 | Ga0163163_102832792 | 177 |
| 1706 | 3300014325 | Ga0163163_12127994 | Ga0163163_121279941 | 177 |
| 1707 | 3300014325 | Ga0163163_12210041 | Ga0163163_122100411 | 177 |
| 1708 | 3300014326 | Ga0157380_10906414 | Ga0157380_109064141 | 177 |
| 1709 | 3300014968 | Ga0157379_10555742 | Ga0157379_105557422 | 177 |
| 1710 | 3300014968 | Ga0157379_10845111 | Ga0157379_108451112 | 177 |
| 1711 | 3300014968 | Ga0157379_11039853 | Ga0157379_110398531 | 177 |
| 1712 | 3300014968 | Ga0157379_11435066 | Ga0157379_114350662 | 177 |
| 1713 | 3300014969 | Ga0157376_10329717 | Ga0157376_103297173 | 177 |
| 1714 | 3300014969 | Ga0157376_10360807 | Ga0157376_103608072 | 177 |
| 1715 | 3300015262 | Ga0182007_10070537 | Ga0182007_100705372 | 177 |
| 1716 | 3300015265 | Ga0182005_1065239 | Ga0182005_10652392 | 177 |
| 1717 | 3300017792 | Ga0163161_11005207 | Ga0163161_110052072 | 177 |
| 1718 | 3300017792 | Ga0163161_11196992 | Ga0163161_111969921 | 177 |
| 1719 | 3300021320 | Ga0214544_1002211 | Ga0214544_100221137 | 177 |
| 1720 | 3300021321 | Ga0214542_1002553 | Ga0214542_100255337 | 177 |
| 1721 | 3300021321 | Ga0214542_1023288 | Ga0214542_10232883 | 177 |
| 1722 | 3300021327 | Ga0214543_1000032 | Ga0214543_1000032172 | 177 |
| 1723 | 3300021327 | Ga0214543_1005345 | Ga0214543_100534514 | 177 |
| 1724 | 3300021377 | Ga0213874_10007273 | Ga0213874_100072735 | 177 |
| 1725 | 3300021384 | Ga0213876_10076608 | Ga0213876_100766082 | 177 |
| 1726 | 3300021388 | Ga0213875_10069901 | Ga0213875_100699012 | 177 |
| 1727 | 3300021388 | Ga0213875_10173625 | Ga0213875_101736252 | 177 |
| 1728 | 3300021441 | Ga0213871_10039050 | Ga0213871_100390503 | 177 |
| 1729 | 3300022739 | Ga0228711_1000015 | Ga0228711_100001524 | 177 |
| 1730 | 3300022740 | Ga0228710_1000015 | Ga0228710_1000015124 | 177 |
| 1731 | 3300025206 | Ga0209435_100024 | Ga0209435_100024200 | 177 |
| 1732 | 3300025208 | Ga0209436_100747 | Ga0209436_10074714 | 177 |
| 1733 | 3300025208 | Ga0209436_102829 | Ga0209436_1028295 | 177 |
| 1734 | 3300025208 | Ga0209436_113709 | Ga0209436_1137093 | 177 |
| 1735 | 3300025230 | Ga0209563_105579 | Ga0209563_1055793 | 177 |
| 1736 | 3300025231 | Ga0207427_104571 | Ga0207427_1045714 | 177 |
| 1737 | 3300025233 | Ga0209437_100969 | Ga0209437_10096912 | 177 |
| 1738 | 3300025233 | Ga0209437_100970 | Ga0209437_10097012 | 177 |
| 1739 | 3300025245 | Ga0207425_1000010 | Ga0207425_10000102 | 177 |
| 1740 | 3300025245 | Ga0207425_1010336 | Ga0207425_10103362 | 177 |
| 1741 | 3300025245 | Ga0207425_1027304 | Ga0207425_10273042 | 177 |
| 1742 | 3300025245 | Ga0207425_1028939 | Ga0207425_10289391 | 177 |
| 1743 | 3300025245 | Ga0207425_1059856 | Ga0207425_10598561 | 177 |
| 1744 | 3300025245 | Ga0207425_1063179 | Ga0207425_10631791 | 177 |
| 1745 | 3300025246 | Ga0209646_1000064 | Ga0209646_1000064200 | 177 |
| 1746 | 3300025246 | Ga0209646_1008880 | Ga0209646_10088801 | 177 |
| 1747 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002480 | 177 |
| 1748 | 3300025250 | Ga0209026_1000053 | Ga0209026_1000053200 | 177 |
| 1749 | 3300025253 | Ga0209677_102830 | Ga0209677_1028307 | 177 |
| 1750 | 3300025254 | Ga0209148_1000038 | Ga0209148_100003869 | 177 |
| 1751 | 3300025254 | Ga0209148_1018493 | Ga0209148_10184932 | 177 |
| 1752 | 3300025256 | Ga0209759_1000042 | Ga0209759_1000042200 | 177 |
| 1753 | 3300025256 | Ga0209759_1000119 | Ga0209759_100011918 | 177 |
| 1754 | 3300025258 | Ga0209129_1003311 | Ga0209129_10033118 | 177 |
| 1755 | 3300025258 | Ga0209129_1003860 | Ga0209129_100386010 | 177 |
| 1756 | 3300025258 | Ga0209129_1004622 | Ga0209129_10046228 | 177 |
| 1757 | 3300025258 | Ga0209129_1009973 | Ga0209129_10099735 | 177 |
| 1758 | 3300025258 | Ga0209129_1013981 | Ga0209129_10139813 | 177 |
| 1759 | 3300025258 | Ga0209129_1021010 | Ga0209129_10210102 | 177 |
| 1760 | 3300025258 | Ga0209129_1035221 | Ga0209129_10352212 | 177 |
| 1761 | 3300025261 | Ga0209233_1000188 | Ga0209233_100018842 | 177 |
| 1762 | 3300025261 | Ga0209233_1003053 | Ga0209233_10030536 | 177 |
| 1763 | 3300025261 | Ga0209233_1006179 | Ga0209233_10061797 | 177 |
| 1764 | 3300025261 | Ga0209233_1007083 | Ga0209233_10070834 | 177 |
| 1765 | 3300025261 | Ga0209233_1011270 | Ga0209233_10112706 | 177 |
| 1766 | 3300025261 | Ga0209233_1013455 | Ga0209233_10134553 | 177 |
| 1767 | 3300025261 | Ga0209233_1050210 | Ga0209233_10502101 | 177 |
| 1768 | 3300025263 | Ga0209565_1019241 | Ga0209565_10192413 | 177 |
| 1769 | 3300025263 | Ga0209565_1021440 | Ga0209565_10214403 | 177 |
| 1770 | 3300025271 | Ga0207666_1004017 | Ga0207666_10040172 | 177 |
| 1771 | 3300025272 | Ga0209455_1000204 | Ga0209455_100020418 | 177 |
| 1772 | 3300025273 | Ga0209673_1000825 | Ga0209673_100082518 | 177 |
| 1773 | 3300025273 | Ga0209673_1000864 | Ga0209673_100086435 | 177 |
| 1774 | 3300025273 | Ga0209673_1001977 | Ga0209673_100197717 | 177 |
| 1775 | 3300025273 | Ga0209673_1012038 | Ga0209673_10120385 | 177 |
| 1776 | 3300025273 | Ga0209673_1014347 | Ga0209673_10143475 | 177 |
| 1777 | 3300025273 | Ga0209673_1029006 | Ga0209673_10290062 | 177 |
| 1778 | 3300025284 | Ga0209130_1000006 | Ga0209130_1000006283 | 177 |
| 1779 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007337 | 177 |
| 1780 | 3300025284 | Ga0209130_1001130 | Ga0209130_100113017 | 177 |
| 1781 | 3300025284 | Ga0209130_1021190 | Ga0209130_10211903 | 177 |
| 1782 | 3300025284 | Ga0209130_1022665 | Ga0209130_10226653 | 177 |
| 1783 | 3300025290 | Ga0207673_1001859 | Ga0207673_10018593 | 177 |
| 1784 | 3300025292 | Ga0209676_1001545 | Ga0209676_100154515 | 177 |
| 1785 | 3300025292 | Ga0209676_1002955 | Ga0209676_10029556 | 177 |
| 1786 | 3300025292 | Ga0209676_1029437 | Ga0209676_10294374 | 177 |
| 1787 | 3300025294 | Ga0209025_1000022 | Ga0209025_1000022580 | 177 |
| 1788 | 3300025294 | Ga0209025_1000303 | Ga0209025_100030310 | 177 |
| 1789 | 3300025294 | Ga0209025_1018223 | Ga0209025_10182236 | 177 |
| 1790 | 3300025294 | Ga0209025_1035969 | Ga0209025_10359694 | 177 |
| 1791 | 3300025294 | Ga0209025_1076174 | Ga0209025_10761742 | 177 |
| 1792 | 3300025294 | Ga0209025_1108888 | Ga0209025_11088882 | 177 |
| 1793 | 3300025294 | Ga0209025_1114335 | Ga0209025_11143352 | 177 |
| 1794 | 3300025294 | Ga0209025_1158082 | Ga0209025_11580821 | 177 |
| 1795 | 3300025295 | Ga0209564_1000140 | Ga0209564_1000140161 | 177 |
| 1796 | 3300025295 | Ga0209564_1002708 | Ga0209564_10027089 | 177 |
| 1797 | 3300025295 | Ga0209564_1006724 | Ga0209564_10067246 | 177 |
| 1798 | 3300025295 | Ga0209564_1028708 | Ga0209564_10287082 | 177 |
| 1799 | 3300025295 | Ga0209564_1028709 | Ga0209564_10287092 | 177 |
| 1800 | 3300025295 | Ga0209564_1038119 | Ga0209564_10381193 | 177 |
| 1801 | 3300025295 | Ga0209564_1044462 | Ga0209564_10444622 | 177 |
| 1802 | 3300025295 | Ga0209564_1059134 | Ga0209564_10591342 | 177 |
| 1803 | 3300025295 | Ga0209564_1060915 | Ga0209564_10609152 | 177 |
| 1804 | 3300025297 | Ga0209758_1000584 | Ga0209758_10005842 | 177 |
| 1805 | 3300025297 | Ga0209758_1005081 | Ga0209758_10050814 | 177 |
| 1806 | 3300025297 | Ga0209758_1006057 | Ga0209758_10060579 | 177 |
| 1807 | 3300025297 | Ga0209758_1007716 | Ga0209758_10077163 | 177 |
| 1808 | 3300025297 | Ga0209758_1007810 | Ga0209758_10078103 | 177 |
| 1809 | 3300025297 | Ga0209758_1067228 | Ga0209758_10672283 | 177 |
| 1810 | 3300025297 | Ga0209758_1094800 | Ga0209758_10948002 | 177 |
| 1811 | 3300025297 | Ga0209758_1101405 | Ga0209758_11014051 | 177 |
| 1812 | 3300025297 | Ga0209758_1103555 | Ga0209758_11035552 | 177 |
| 1813 | 3300025297 | Ga0209758_1111129 | Ga0209758_11111291 | 177 |
| 1814 | 3300025298 | Ga0209050_1002103 | Ga0209050_100210318 | 177 |
| 1815 | 3300025298 | Ga0209050_1003219 | Ga0209050_100321918 | 177 |
| 1816 | 3300025299 | Ga0209256_1002683 | Ga0209256_100268310 | 177 |
| 1817 | 3300025299 | Ga0209256_1004555 | Ga0209256_100455518 | 177 |
| 1818 | 3300025299 | Ga0209256_1005314 | Ga0209256_10053143 | 177 |
| 1819 | 3300025299 | Ga0209256_1015662 | Ga0209256_10156622 | 177 |
| 1820 | 3300025299 | Ga0209256_1026985 | Ga0209256_10269853 | 177 |
| 1821 | 3300025299 | Ga0209256_1044054 | Ga0209256_10440542 | 177 |
| 1822 | 3300025299 | Ga0209256_1074909 | Ga0209256_10749091 | 177 |
| 1823 | 3300025302 | Ga0207426_1000003 | Ga0207426_10000031144 | 177 |
| 1824 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044406 | 177 |
| 1825 | 3300025302 | Ga0207426_1000064 | Ga0207426_1000064337 | 177 |
| 1826 | 3300025302 | Ga0207426_1003449 | Ga0207426_100344910 | 177 |
| 1827 | 3300025302 | Ga0207426_1004394 | Ga0207426_100439410 | 177 |
| 1828 | 3300025302 | Ga0207426_1033419 | Ga0207426_10334192 | 177 |
| 1829 | 3300025303 | Ga0209051_1000914 | Ga0209051_100091429 | 177 |
| 1830 | 3300025303 | Ga0209051_1002149 | Ga0209051_100214918 | 177 |
| 1831 | 3300025303 | Ga0209051_1049570 | Ga0209051_10495703 | 177 |
| 1832 | 3300025303 | Ga0209051_1058167 | Ga0209051_10581673 | 177 |
| 1833 | 3300025303 | Ga0209051_1092745 | Ga0209051_10927452 | 177 |
| 1834 | 3300025303 | Ga0209051_1100821 | Ga0209051_11008212 | 177 |
| 1835 | 3300025303 | Ga0209051_1101244 | Ga0209051_11012442 | 177 |
| 1836 | 3300025304 | Ga0209257_1000817 | Ga0209257_100081715 | 177 |
| 1837 | 3300025304 | Ga0209257_1002507 | Ga0209257_100250715 | 177 |
| 1838 | 3300025304 | Ga0209257_1014551 | Ga0209257_10145512 | 177 |
| 1839 | 3300025304 | Ga0209257_1081649 | Ga0209257_10816492 | 177 |
| 1840 | 3300025304 | Ga0209257_1087031 | Ga0209257_10870312 | 177 |
| 1841 | 3300025315 | Ga0207697_10183153 | Ga0207697_101831531 | 177 |
| 1842 | 3300025321 | Ga0207656_10169352 | Ga0207656_101693522 | 177 |
| 1843 | 3300025711 | Ga0207696_1059111 | Ga0207696_10591112 | 177 |
| 1844 | 3300025711 | Ga0207696_1066851 | Ga0207696_10668512 | 177 |
| 1845 | 3300025885 | Ga0207653_10002069 | Ga0207653_1000206913 | 177 |
| 1846 | 3300025893 | Ga0207682_10188622 | Ga0207682_101886221 | 177 |
| 1847 | 3300025898 | Ga0207692_10143795 | Ga0207692_101437952 | 177 |
| 1848 | 3300025898 | Ga0207692_10182104 | Ga0207692_101821042 | 177 |
| 1849 | 3300025898 | Ga0207692_10251460 | Ga0207692_102514602 | 177 |
| 1850 | 3300025899 | Ga0207642_10153786 | Ga0207642_101537863 | 177 |
| 1851 | 3300025900 | Ga0207710_10066137 | Ga0207710_100661374 | 177 |
| 1852 | 3300025900 | Ga0207710_10118810 | Ga0207710_101188103 | 177 |
| 1853 | 3300025901 | Ga0207688_10036755 | Ga0207688_100367554 | 177 |
| 1854 | 3300025901 | Ga0207688_10170052 | Ga0207688_101700523 | 177 |
| 1855 | 3300025903 | Ga0207680_10268268 | Ga0207680_102682683 | 177 |
| 1856 | 3300025903 | Ga0207680_10269652 | Ga0207680_102696522 | 177 |
| 1857 | 3300025903 | Ga0207680_10678482 | Ga0207680_106784822 | 177 |
| 1858 | 3300025904 | Ga0207647_10020923 | Ga0207647_100209234 | 177 |
| 1859 | 3300025904 | Ga0207647_10123459 | Ga0207647_101234593 | 177 |
| 1860 | 3300025904 | Ga0207647_10167943 | Ga0207647_101679431 | 177 |
| 1861 | 3300025905 | Ga0207685_10075648 | Ga0207685_100756482 | 177 |
| 1862 | 3300025906 | Ga0207699_10048434 | Ga0207699_100484342 | 177 |
| 1863 | 3300025906 | Ga0207699_10747762 | Ga0207699_107477622 | 177 |
| 1864 | 3300025907 | Ga0207645_10216210 | Ga0207645_102162102 | 177 |
| 1865 | 3300025907 | Ga0207645_10345962 | Ga0207645_103459622 | 177 |
| 1866 | 3300025908 | Ga0207643_10012061 | Ga0207643_100120613 | 177 |
| 1867 | 3300025909 | Ga0207705_10424032 | Ga0207705_104240321 | 177 |
| 1868 | 3300025911 | Ga0207654_10111792 | Ga0207654_101117922 | 177 |
| 1869 | 3300025911 | Ga0207654_10162516 | Ga0207654_101625163 | 177 |
| 1870 | 3300025911 | Ga0207654_10243499 | Ga0207654_102434992 | 177 |
| 1871 | 3300025912 | Ga0207707_10091218 | Ga0207707_100912185 | 177 |
| 1872 | 3300025912 | Ga0207707_10110359 | Ga0207707_101103595 | 177 |
| 1873 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011896 | 177 |
| 1874 | 3300025913 | Ga0207695_10000599 | Ga0207695_1000059977 | 177 |
| 1875 | 3300025913 | Ga0207695_10185740 | Ga0207695_101857403 | 177 |
| 1876 | 3300025913 | Ga0207695_10347578 | Ga0207695_103475782 | 177 |
| 1877 | 3300025913 | Ga0207695_10602979 | Ga0207695_106029792 | 177 |
| 1878 | 3300025913 | Ga0207695_10916655 | Ga0207695_109166551 | 177 |
| 1879 | 3300025914 | Ga0207671_10001852 | Ga0207671_1000185221 | 177 |
| 1880 | 3300025914 | Ga0207671_10041691 | Ga0207671_100416913 | 177 |
| 1881 | 3300025914 | Ga0207671_10074646 | Ga0207671_100746464 | 177 |
| 1882 | 3300025914 | Ga0207671_10137222 | Ga0207671_101372223 | 177 |
| 1883 | 3300025914 | Ga0207671_10169506 | Ga0207671_101695063 | 177 |
| 1884 | 3300025914 | Ga0207671_10262894 | Ga0207671_102628942 | 177 |
| 1885 | 3300025915 | Ga0207693_10001926 | Ga0207693_1000192611 | 177 |
| 1886 | 3300025915 | Ga0207693_10022819 | Ga0207693_1002281910 | 177 |
| 1887 | 3300025915 | Ga0207693_10896374 | Ga0207693_108963742 | 177 |
| 1888 | 3300025916 | Ga0207663_10000218 | Ga0207663_1000021822 | 177 |
| 1889 | 3300025916 | Ga0207663_10278254 | Ga0207663_102782542 | 177 |
| 1890 | 3300025916 | Ga0207663_10633030 | Ga0207663_106330302 | 177 |
| 1891 | 3300025917 | Ga0207660_10125797 | Ga0207660_101257974 | 177 |
| 1892 | 3300025917 | Ga0207660_10196644 | Ga0207660_101966442 | 177 |
| 1893 | 3300025917 | Ga0207660_10719386 | Ga0207660_107193861 | 177 |
| 1894 | 3300025917 | Ga0207660_10980937 | Ga0207660_109809371 | 177 |
| 1895 | 3300025918 | Ga0207662_10029232 | Ga0207662_100292326 | 177 |
| 1896 | 3300025919 | Ga0207657_10011937 | Ga0207657_100119372 | 177 |
| 1897 | 3300025919 | Ga0207657_10042894 | Ga0207657_100428942 | 177 |
| 1898 | 3300025919 | Ga0207657_10184754 | Ga0207657_101847542 | 177 |
| 1899 | 3300025920 | Ga0207649_10278021 | Ga0207649_102780212 | 177 |
| 1900 | 3300025920 | Ga0207649_10295983 | Ga0207649_102959832 | 177 |
| 1901 | 3300025920 | Ga0207649_10745714 | Ga0207649_107457142 | 177 |
| 1902 | 3300025921 | Ga0207652_10014975 | Ga0207652_100149759 | 177 |
| 1903 | 3300025921 | Ga0207652_10051466 | Ga0207652_100514662 | 177 |
| 1904 | 3300025921 | Ga0207652_10178552 | Ga0207652_101785522 | 177 |
| 1905 | 3300025921 | Ga0207652_10247386 | Ga0207652_102473862 | 177 |
| 1906 | 3300025922 | Ga0207646_10024544 | Ga0207646_100245443 | 177 |
| 1907 | 3300025923 | Ga0207681_10583279 | Ga0207681_105832792 | 177 |
| 1908 | 3300025923 | Ga0207681_10624399 | Ga0207681_106243992 | 177 |
| 1909 | 3300025924 | Ga0207694_10017395 | Ga0207694_100173958 | 177 |
| 1910 | 3300025924 | Ga0207694_10058951 | Ga0207694_100589516 | 177 |
| 1911 | 3300025924 | Ga0207694_10577698 | Ga0207694_105776981 | 177 |
| 1912 | 3300025924 | Ga0207694_10581697 | Ga0207694_105816972 | 177 |
| 1913 | 3300025924 | Ga0207694_10582934 | Ga0207694_105829342 | 177 |
| 1914 | 3300025925 | Ga0207650_10002132 | Ga0207650_1000213213 | 177 |
| 1915 | 3300025927 | Ga0207687_10174946 | Ga0207687_101749462 | 177 |
| 1916 | 3300025927 | Ga0207687_10312348 | Ga0207687_103123482 | 177 |
| 1917 | 3300025928 | Ga0207700_10028497 | Ga0207700_100284976 | 177 |
| 1918 | 3300025928 | Ga0207700_10162421 | Ga0207700_101624213 | 177 |
| 1919 | 3300025929 | Ga0207664_10008551 | Ga0207664_100085511 | 177 |
| 1920 | 3300025929 | Ga0207664_10019269 | Ga0207664_100192697 | 177 |
| 1921 | 3300025929 | Ga0207664_10842846 | Ga0207664_108428461 | 177 |
| 1922 | 3300025931 | Ga0207644_10052527 | Ga0207644_100525273 | 177 |
| 1923 | 3300025931 | Ga0207644_10362620 | Ga0207644_103626201 | 177 |
| 1924 | 3300025931 | Ga0207644_10588068 | Ga0207644_105880681 | 177 |
| 1925 | 3300025933 | Ga0207706_10017336 | Ga0207706_100173361 | 177 |
| 1926 | 3300025933 | Ga0207706_10024819 | Ga0207706_100248195 | 177 |
| 1927 | 3300025933 | Ga0207706_10177321 | Ga0207706_101773212 | 177 |
| 1928 | 3300025933 | Ga0207706_10691664 | Ga0207706_106916641 | 177 |
| 1929 | 3300025935 | Ga0207709_10125723 | Ga0207709_101257233 | 177 |
| 1930 | 3300025935 | Ga0207709_10479660 | Ga0207709_104796602 | 177 |
| 1931 | 3300025936 | Ga0207670_10765472 | Ga0207670_107654721 | 177 |
| 1932 | 3300025936 | Ga0207670_10838880 | Ga0207670_108388801 | 177 |
| 1933 | 3300025937 | Ga0207669_10129274 | Ga0207669_101292742 | 177 |
| 1934 | 3300025937 | Ga0207669_10148688 | Ga0207669_101486881 | 177 |
| 1935 | 3300025937 | Ga0207669_10977420 | Ga0207669_109774201 | 177 |
| 1936 | 3300025939 | Ga0207665_10005572 | Ga0207665_100055726 | 177 |
| 1937 | 3300025939 | Ga0207665_10096951 | Ga0207665_100969512 | 177 |
| 1938 | 3300025939 | Ga0207665_10626583 | Ga0207665_106265832 | 177 |
| 1939 | 3300025939 | Ga0207665_10896494 | Ga0207665_108964941 | 177 |
| 1940 | 3300025939 | Ga0207665_10998136 | Ga0207665_109981362 | 177 |
| 1941 | 3300025940 | Ga0207691_10213024 | Ga0207691_102130241 | 177 |
| 1942 | 3300025940 | Ga0207691_10676163 | Ga0207691_106761632 | 177 |
| 1943 | 3300025940 | Ga0207691_10815269 | Ga0207691_108152691 | 177 |
| 1944 | 3300025941 | Ga0207711_10724750 | Ga0207711_107247502 | 177 |
| 1945 | 3300025944 | Ga0207661_10202043 | Ga0207661_102020433 | 177 |
| 1946 | 3300025949 | Ga0207667_10012912 | Ga0207667_100129125 | 177 |
| 1947 | 3300025949 | Ga0207667_10708426 | Ga0207667_107084262 | 177 |
| 1948 | 3300025949 | Ga0207667_11025820 | Ga0207667_110258201 | 177 |
| 1949 | 3300025949 | Ga0207667_11056972 | Ga0207667_110569722 | 177 |
| 1950 | 3300025961 | Ga0207712_10265973 | Ga0207712_102659733 | 177 |
| 1951 | 3300025961 | Ga0207712_10377846 | Ga0207712_103778462 | 177 |
| 1952 | 3300025961 | Ga0207712_10439966 | Ga0207712_104399661 | 177 |
| 1953 | 3300025961 | Ga0207712_10563146 | Ga0207712_105631461 | 177 |
| 1954 | 3300025961 | Ga0207712_10836207 | Ga0207712_108362072 | 177 |
| 1955 | 3300025961 | Ga0207712_11447523 | Ga0207712_114475231 | 177 |
| 1956 | 3300025972 | Ga0207668_10034259 | Ga0207668_100342592 | 177 |
| 1957 | 3300025972 | Ga0207668_10115150 | Ga0207668_101151503 | 177 |
| 1958 | 3300025972 | Ga0207668_10335973 | Ga0207668_103359732 | 177 |
| 1959 | 3300025981 | Ga0207640_10095376 | Ga0207640_100953762 | 177 |
| 1960 | 3300025981 | Ga0207640_10290151 | Ga0207640_102901513 | 177 |
| 1961 | 3300025981 | Ga0207640_10576471 | Ga0207640_105764712 | 177 |
| 1962 | 3300025986 | Ga0207658_10537705 | Ga0207658_105377052 | 177 |
| 1963 | 3300026023 | Ga0207677_11066392 | Ga0207677_110663922 | 177 |
| 1964 | 3300026023 | Ga0207677_11403137 | Ga0207677_114031371 | 177 |
| 1965 | 3300026035 | Ga0207703_10082720 | Ga0207703_100827205 | 177 |
| 1966 | 3300026035 | Ga0207703_10215009 | Ga0207703_102150092 | 177 |
| 1967 | 3300026035 | Ga0207703_10437335 | Ga0207703_104373352 | 177 |
| 1968 | 3300026035 | Ga0207703_10568359 | Ga0207703_105683592 | 177 |
| 1969 | 3300026035 | Ga0207703_10735320 | Ga0207703_107353202 | 177 |
| 1970 | 3300026041 | Ga0207639_10032054 | Ga0207639_100320546 | 177 |
| 1971 | 3300026041 | Ga0207639_10060119 | Ga0207639_100601193 | 177 |
| 1972 | 3300026041 | Ga0207639_10226993 | Ga0207639_102269931 | 177 |
| 1973 | 3300026067 | Ga0207678_10014673 | Ga0207678_100146736 | 177 |
| 1974 | 3300026067 | Ga0207678_10105086 | Ga0207678_101050866 | 177 |
| 1975 | 3300026067 | Ga0207678_10116776 | Ga0207678_101167763 | 177 |
| 1976 | 3300026067 | Ga0207678_10931100 | Ga0207678_109311002 | 177 |
| 1977 | 3300026075 | Ga0207708_10809324 | Ga0207708_108093241 | 177 |
| 1978 | 3300026078 | Ga0207702_10417925 | Ga0207702_104179252 | 177 |
| 1979 | 3300026078 | Ga0207702_10498187 | Ga0207702_104981872 | 177 |
| 1980 | 3300026078 | Ga0207702_11162490 | Ga0207702_111624901 | 177 |
| 1981 | 3300026088 | Ga0207641_10040588 | Ga0207641_100405885 | 177 |
| 1982 | 3300026088 | Ga0207641_10591440 | Ga0207641_105914403 | 177 |
| 1983 | 3300026088 | Ga0207641_10889212 | Ga0207641_108892122 | 177 |
| 1984 | 3300026089 | Ga0207648_10011030 | Ga0207648_100110301 | 177 |
| 1985 | 3300026095 | Ga0207676_10568268 | Ga0207676_105682681 | 177 |
| 1986 | 3300026095 | Ga0207676_11301193 | Ga0207676_113011931 | 177 |
| 1987 | 3300026116 | Ga0207674_10068821 | Ga0207674_100688214 | 177 |
| 1988 | 3300026116 | Ga0207674_10188280 | Ga0207674_101882802 | 177 |
| 1989 | 3300026118 | Ga0207675_100040050 | Ga0207675_10004005010 | 177 |
| 1990 | 3300026118 | Ga0207675_100604527 | Ga0207675_1006045273 | 177 |
| 1991 | 3300026121 | Ga0207683_10053025 | Ga0207683_100530256 | 177 |
| 1992 | 3300026142 | Ga0207698_10583192 | Ga0207698_105831922 | 177 |
| 1993 | 3300026142 | Ga0207698_11598754 | Ga0207698_115987542 | 177 |
| 1994 | 3300027111 | Ga0209281_1000573 | Ga0209281_100057319 | 177 |
| 1995 | 3300027111 | Ga0209281_1001498 | Ga0209281_100149810 | 177 |
| 1996 | 3300027296 | Ga0209389_1002002 | Ga0209389_100200210 | 177 |
| 1997 | 3300027312 | Ga0209371_1002385 | Ga0209371_100238519 | 177 |
| 1998 | 3300027312 | Ga0209371_1058949 | Ga0209371_10589491 | 177 |
| 1999 | 3300027357 | Ga0209589_1000009 | Ga0209589_100000922 | 177 |
| 2000 | 3300027357 | Ga0209589_1000300 | Ga0209589_100030034 | 177 |
| 2001 | 3300027361 | Ga0209489_100010 | Ga0209489_100010249 | 177 |
| 2002 | 3300027363 | Ga0209700_100017 | Ga0209700_100017249 | 177 |
| 2003 | 3300027512 | Ga0209179_1017049 | Ga0209179_10170491 | 177 |
| 2004 | 3300027512 | Ga0209179_1059062 | Ga0209179_10590622 | 177 |
| 2005 | 3300027666 | Ga0209282_1000054 | Ga0209282_1000054109 | 177 |
| 2006 | 3300027866 | Ga0209813_10036049 | Ga0209813_100360493 | 177 |
| 2007 | 3300027866 | Ga0209813_10049896 | Ga0209813_100498962 | 177 |
| 2008 | 3300027866 | Ga0209813_10153312 | Ga0209813_101533122 | 177 |
| 2009 | 3300027866 | Ga0209813_10227598 | Ga0209813_102275981 | 177 |
| 2010 | 3300027876 | Ga0209974_10092975 | Ga0209974_100929752 | 177 |
| 2011 | 3300027876 | Ga0209974_10123372 | Ga0209974_101233722 | 177 |
| 2012 | 3300028379 | Ga0268266_10012436 | Ga0268266_100124367 | 177 |
| 2013 | 3300028379 | Ga0268266_10014157 | Ga0268266_100141579 | 177 |
| 2014 | 3300028379 | Ga0268266_10020829 | Ga0268266_100208292 | 177 |
| 2015 | 3300028379 | Ga0268266_10073688 | Ga0268266_100736883 | 177 |
| 2016 | 3300028379 | Ga0268266_10163131 | Ga0268266_101631313 | 177 |
| 2017 | 3300028379 | Ga0268266_10247200 | Ga0268266_102472001 | 177 |
| 2018 | 3300028379 | Ga0268266_10532816 | Ga0268266_105328162 | 177 |
| 2019 | 3300028379 | Ga0268266_10790242 | Ga0268266_107902422 | 177 |
| 2020 | 3300028379 | Ga0268266_11139255 | Ga0268266_111392551 | 177 |
| 2021 | 3300028379 | Ga0268266_11248062 | Ga0268266_112480622 | 177 |
| 2022 | 3300028380 | Ga0268265_10198713 | Ga0268265_101987133 | 177 |
| 2023 | 3300028380 | Ga0268265_10366074 | Ga0268265_103660742 | 177 |
| 2024 | 3300028381 | Ga0268264_10000655 | Ga0268264_1000065510 | 177 |
| 2025 | 3300028558 | Ga0265326_10001795 | Ga0265326_1000179512 | 177 |
| 2026 | 3300028563 | Ga0265319_1001825 | Ga0265319_100182518 | 177 |
| 2027 | 3300028573 | Ga0265334_10000469 | Ga0265334_100004697 | 177 |
| 2028 | 3300028577 | Ga0265318_10007417 | Ga0265318_100074177 | 177 |
| 2029 | 3300028653 | Ga0265323_10001237 | Ga0265323_1000123719 | 177 |
| 2030 | 3300028666 | Ga0265336_10000535 | Ga0265336_1000053512 | 177 |
| 2031 | 3300028786 | Ga0307517_10000125 | Ga0307517_1000012512 | 177 |
| 2032 | 3300028794 | Ga0307515_10001393 | Ga0307515_1000139357 | 177 |
| 2033 | 3300028794 | Ga0307515_10040194 | Ga0307515_1004019411 | 177 |
| 2034 | 3300028794 | Ga0307515_10065844 | Ga0307515_100658442 | 177 |
| 2035 | 3300028794 | Ga0307515_10100071 | Ga0307515_101000714 | 177 |
| 2036 | 3300028794 | Ga0307515_10182119 | Ga0307515_101821193 | 177 |
| 2037 | 3300028794 | Ga0307515_10398804 | Ga0307515_103988042 | 177 |
| 2038 | 3300028800 | Ga0265338_10000131 | Ga0265338_1000013198 | 177 |
| 2039 | 3300028800 | Ga0265338_10168673 | Ga0265338_101686732 | 177 |
| 2040 | 3300029277 | Ga0311001_1103890 | Ga0311001_11038903 | 177 |
| 2041 | 3300029285 | Ga0310981_1004097 | Ga0310981_10040973 | 177 |
| 2042 | 3300029957 | Ga0265324_10001269 | Ga0265324_1000126922 | 177 |
| 2043 | 3300030500 | Ga0268256_1002127 | Ga0268256_100212719 | 177 |
| 2044 | 3300030500 | Ga0268256_1072371 | Ga0268256_10723711 | 177 |
| 2045 | 3300030521 | Ga0307511_10071057 | Ga0307511_100710573 | 177 |
| 2046 | 3300031235 | Ga0265330_10313325 | Ga0265330_103133251 | 177 |
| 2047 | 3300031238 | Ga0265332_10026568 | Ga0265332_100265682 | 177 |
| 2048 | 3300031241 | Ga0265325_10057917 | Ga0265325_100579172 | 177 |
| 2049 | 3300031249 | Ga0265339_10030677 | Ga0265339_100306775 | 177 |
| 2050 | 3300031344 | Ga0265316_10148533 | Ga0265316_101485333 | 177 |
| 2051 | 3300031344 | Ga0265316_10187162 | Ga0265316_101871622 | 177 |
| 2052 | 3300031456 | Ga0307513_10005182 | Ga0307513_1000518217 | 177 |
| 2053 | 3300031456 | Ga0307513_10143103 | Ga0307513_101431032 | 177 |
| 2054 | 3300031456 | Ga0307513_10304695 | Ga0307513_103046952 | 177 |
| 2055 | 3300031456 | Ga0307513_10327399 | Ga0307513_103273991 | 177 |
| 2056 | 3300031456 | Ga0307513_10580817 | Ga0307513_105808172 | 177 |
| 2057 | 3300031507 | Ga0307509_10041031 | Ga0307509_100410316 | 177 |
| 2058 | 3300031507 | Ga0307509_10353192 | Ga0307509_103531922 | 177 |
| 2059 | 3300031548 | Ga0307408_100012729 | Ga0307408_10001272912 | 177 |
| 2060 | 3300031548 | Ga0307408_100016332 | Ga0307408_1000163323 | 177 |
| 2061 | 3300031548 | Ga0307408_100027626 | Ga0307408_1000276264 | 177 |
| 2062 | 3300031548 | Ga0307408_100038322 | Ga0307408_1000383226 | 177 |
| 2063 | 3300031548 | Ga0307408_100776864 | Ga0307408_1007768642 | 177 |
| 2064 | 3300031595 | Ga0265313_10003614 | Ga0265313_1000361418 | 177 |
| 2065 | 3300031616 | Ga0307508_10000378 | Ga0307508_1000037834 | 177 |
| 2066 | 3300031616 | Ga0307508_10044639 | Ga0307508_100446396 | 177 |
| 2067 | 3300031616 | Ga0307508_10096553 | Ga0307508_100965535 | 177 |
| 2068 | 3300031616 | Ga0307508_10117010 | Ga0307508_101170103 | 177 |
| 2069 | 3300031616 | Ga0307508_10189157 | Ga0307508_101891574 | 177 |
| 2070 | 3300031616 | Ga0307508_10326929 | Ga0307508_103269292 | 177 |
| 2071 | 3300031665 | Ga0316575_10144645 | Ga0316575_101446451 | 177 |
| 2072 | 3300031711 | Ga0265314_10017878 | Ga0265314_100178787 | 177 |
| 2073 | 3300031712 | Ga0265342_10020769 | Ga0265342_100207696 | 177 |
| 2074 | 3300031730 | Ga0307516_10114735 | Ga0307516_101147353 | 177 |
| 2075 | 3300031730 | Ga0307516_10174401 | Ga0307516_101744012 | 177 |
| 2076 | 3300031730 | Ga0307516_10207509 | Ga0307516_102075093 | 177 |
| 2077 | 3300031731 | Ga0307405_10050000 | Ga0307405_100500002 | 177 |
| 2078 | 3300031731 | Ga0307405_10083046 | Ga0307405_100830464 | 177 |
| 2079 | 3300031731 | Ga0307405_10113053 | Ga0307405_101130533 | 177 |
| 2080 | 3300031731 | Ga0307405_10192671 | Ga0307405_101926712 | 177 |
| 2081 | 3300031731 | Ga0307405_10199654 | Ga0307405_101996543 | 177 |
| 2082 | 3300031731 | Ga0307405_10381714 | Ga0307405_103817142 | 177 |
| 2083 | 3300031824 | Ga0307413_10126131 | Ga0307413_101261312 | 177 |
| 2084 | 3300031824 | Ga0307413_10253244 | Ga0307413_102532442 | 177 |
| 2085 | 3300031852 | Ga0307410_10007156 | Ga0307410_100071569 | 177 |
| 2086 | 3300031852 | Ga0307410_10201000 | Ga0307410_102010001 | 177 |
| 2087 | 3300031852 | Ga0307410_10316483 | Ga0307410_103164831 | 177 |
| 2088 | 3300031852 | Ga0307410_10508370 | Ga0307410_105083702 | 177 |
| 2089 | 3300031901 | Ga0307406_10036624 | Ga0307406_100366244 | 177 |
| 2090 | 3300031901 | Ga0307406_10251323 | Ga0307406_102513232 | 177 |
| 2091 | 3300031901 | Ga0307406_10419198 | Ga0307406_104191982 | 177 |
| 2092 | 3300031901 | Ga0307406_10447080 | Ga0307406_104470802 | 177 |
| 2093 | 3300031903 | Ga0307407_10011518 | Ga0307407_100115183 | 177 |
| 2094 | 3300031903 | Ga0307407_10662297 | Ga0307407_106622971 | 177 |
| 2095 | 3300031911 | Ga0307412_10041042 | Ga0307412_100410423 | 177 |
| 2096 | 3300031911 | Ga0307412_10076697 | Ga0307412_100766972 | 177 |
| 2097 | 3300031911 | Ga0307412_10118477 | Ga0307412_101184772 | 177 |
| 2098 | 3300031911 | Ga0307412_10137880 | Ga0307412_101378803 | 177 |
| 2099 | 3300031911 | Ga0307412_10163888 | Ga0307412_101638882 | 177 |
| 2100 | 3300031911 | Ga0307412_10241880 | Ga0307412_102418802 | 177 |
| 2101 | 3300031967 | Ga0315914_1000013 | Ga0315914_100001324 | 177 |
| 2102 | 3300031995 | Ga0307409_100004876 | Ga0307409_10000487615 | 177 |
| 2103 | 3300031995 | Ga0307409_100045054 | Ga0307409_1000450543 | 177 |
| 2104 | 3300031995 | Ga0307409_101947674 | Ga0307409_1019476741 | 177 |
| 2105 | 3300032002 | Ga0307416_100010349 | Ga0307416_1000103496 | 177 |
| 2106 | 3300032002 | Ga0307416_100047875 | Ga0307416_1000478755 | 177 |
| 2107 | 3300032002 | Ga0307416_100221340 | Ga0307416_1002213403 | 177 |
| 2108 | 3300032002 | Ga0307416_100334228 | Ga0307416_1003342283 | 177 |
| 2109 | 3300032002 | Ga0307416_100433393 | Ga0307416_1004333931 | 177 |
| 2110 | 3300032002 | Ga0307416_100456649 | Ga0307416_1004566492 | 177 |
| 2111 | 3300032002 | Ga0307416_100729760 | Ga0307416_1007297602 | 177 |
| 2112 | 3300032002 | Ga0307416_100909837 | Ga0307416_1009098372 | 177 |
| 2113 | 3300032002 | Ga0307416_101763188 | Ga0307416_1017631881 | 177 |
| 2114 | 3300032004 | Ga0307414_10022676 | Ga0307414_100226765 | 177 |
| 2115 | 3300032004 | Ga0307414_10023691 | Ga0307414_100236912 | 177 |
| 2116 | 3300032004 | Ga0307414_10367138 | Ga0307414_103671383 | 177 |
| 2117 | 3300032004 | Ga0307414_11500318 | Ga0307414_115003181 | 177 |
| 2118 | 3300032126 | Ga0307415_100010922 | Ga0307415_1000109227 | 177 |
| 2119 | 3300032126 | Ga0307415_100102687 | Ga0307415_1001026874 | 177 |
| 2120 | 3300032126 | Ga0307415_100194833 | Ga0307415_1001948331 | 177 |
| 2121 | 3300032126 | Ga0307415_100212815 | Ga0307415_1002128152 | 177 |
| 2122 | 3300032126 | Ga0307415_100442306 | Ga0307415_1004423062 | 177 |
| 2123 | 3300032126 | Ga0307415_100475817 | Ga0307415_1004758172 | 177 |
| 2124 | 3300032168 | Ga0316593_10011301 | Ga0316593_100113011 | 177 |
| 2125 | 3300032168 | Ga0316593_10155232 | Ga0316593_101552321 | 177 |
| 2126 | 3300033179 | Ga0307507_10023232 | Ga0307507_100232326 | 177 |
| 2127 | 3300033179 | Ga0307507_10309089 | Ga0307507_103090891 | 177 |
| 2128 | 3300033180 | Ga0307510_10075120 | Ga0307510_100751203 | 177 |
| 2129 | 3300033180 | Ga0307510_10227413 | Ga0307510_102274133 | 177 |
| 2130 | 3300033430 | Ga0315913_1000097 | Ga0315913_100009724 | 177 |
| 2131 | 3300033442 | Ga0315911_1000009 | Ga0315911_100000987 | 177 |
| 2132 | 3300033464 | Ga0315915_1000001 | Ga0315915_100000124 | 177 |
| 2133 | 3300033527 | Ga0316586_1022492 | Ga0316586_10224922 | 177 |
| 2134 | 3300033544 | Ga0316215_1006608 | Ga0316215_10066083 | 177 |
| 2135 | 3300033544 | Ga0316215_1007336 | Ga0316215_10073362 | 177 |
| 2136 | 3300033545 | Ga0316214_1003835 | Ga0316214_10038352 | 177 |
| 2137 | 3300034816 | Ga0373930_0060467 | Ga0373930_0060467_201_734 | 177 |
| 2138 | 3300035083 | Ga0373926_0183521 | Ga0373926_0183521_108_641 | 177 |
| 2139 | 3300035086 | Ga0373934_0038719 | Ga0373934_0038719_882_1415 | 177 |
| 2140 | 3300035090 | Ga0373949_0023572 | Ga0373949_0023572_186_719 | 177 |
| 2141 | 3300035111 | Ga0373923_0070704 | Ga0373923_0070704_273_806 | 177 |
| 2142 | 3300035113 | Ga0373936_0113018 | Ga0373936_0113018_601_1134 | 177 |
| 2143 | 3300035113 | Ga0373936_0130018 | Ga0373936_0130018_153_686 | 177 |
| 2144 | 3300035116 | Ga0373945_0009397 | Ga0373945_0009397_728_1261 | 177 |
| 2145 | 3300035117 | Ga0373953_0089085 | Ga0373953_0089085_416_949 | 177 |
| 2146 | 3300035118 | Ga0373954_0000100 | Ga0373954_0000100_26750_27283 | 177 |
| 2147 | 3300035118 | Ga0373954_0012064 | Ga0373954_0012064_597_1130 | 177 |
| 2148 | 3300035118 | Ga0373954_0180527 | Ga0373954_0180527_175_708 | 177 |
| 2149 | 3300035119 | Ga0373956_0015818 | Ga0373956_0015818_391_924 | 177 |
| 2150 | 3300035119 | Ga0373956_0061795 | Ga0373956_0061795_610_1143 | 177 |
| 2151 | 3300035170 | Ga0373943_0013859 | Ga0373943_0013859_2084_2617 | 177 |
| 2152 | 3300035170 | Ga0373943_0125965 | Ga0373943_0125965_535_1068 | 177 |
| 2153 | 3300035171 | Ga0373946_0005668 | Ga0373946_0005668_2302_2835 | 177 |
| 2154 | 3300035171 | Ga0373946_0029093 | Ga0373946_0029093_1158_1691 | 177 |
| 2155 | 3300035172 | Ga0373955_0003141 | Ga0373955_0003141_6441_6974 | 177 |
| 2156 | 3300035172 | Ga0373955_0154665 | Ga0373955_0154665_390_923 | 177 |
| 2157 | 3300035242 | Ga0373962_0119763 | Ga0373962_0119763_205_738 | 177 |
| 2158 | 3300035398 | Ga0316574_0310493 | Ga0316574_0310493_378_911 | 177 |
| 2159 | 3300035410 | Ga0373924_0002732 | Ga0373924_0002732_3674_4207 | 177 |
| 2160 | 3300035410 | Ga0373924_0070831 | Ga0373924_0070831_673_1206 | 177 |
| 2161 | 3300035692 | Ga0373935_0010090 | Ga0373935_0010090_2833_3366 | 177 |
| 2162 | 3300035692 | Ga0373935_0047345 | Ga0373935_0047345_1614_2147 | 177 |
| 2163 | 3300035692 | Ga0373935_0069246 | Ga0373935_0069246_248_781 | 177 |
| 2164 | 3300035692 | Ga0373935_0080178 | Ga0373935_0080178_1456_1989 | 177 |
| 2165 | 3300035692 | Ga0373935_0101688 | Ga0373935_0101688_1050_1583 | 177 |
| 2166 | 3300035695 | Ga0373927_0019967 | Ga0373927_0019967_1874_2407 | 177 |
| 2167 | 3300035695 | Ga0373927_0025263 | Ga0373927_0025263_1533_2066 | 177 |
| 2168 | 3300035695 | Ga0373927_0050046 | Ga0373927_0050046_334_867 | 177 |
| 2169 | 3300035695 | Ga0373927_0210714 | Ga0373927_0210714_596_1129 | 177 |
| 2170 | 3300035724 | Ga0373933_0032326 | Ga0373933_0032326_2189_2722 | 177 |
| 2171 | 3300035724 | Ga0373933_0158464 | Ga0373933_0158464_87_620 | 177 |
| 2172 | 3300035725 | Ga0373947_0005298 | Ga0373947_0005298_4944_5477 | 177 |
| 2173 | 3300035725 | Ga0373947_0015233 | Ga0373947_0015233_249_782 | 177 |
| 2174 | 3300036242 | Ga0310104_00079 | Ga0310104_00079_601_1134 | 177 |
| 2175 | 3300036401 | Ga0373937_0372659 | Ga0373937_0372659_87_620 | 177 |
| 2176 | 3300036401 | Ga0373937_0870788 | Ga0373937_0870788_219_752 | 177 |
| 2177 | 3300036458 | Ga0310112_018869 | Ga0310112_018869_84_617 | 177 |
| 2178 | 3300037068 | Ga0373925_0008352 | Ga0373925_0008352_2491_3024 | 177 |
| 2179 | 3300037068 | Ga0373925_0045136 | Ga0373925_0045136_2519_3052 | 177 |
| 2180 | 3300037068 | Ga0373925_0298656 | Ga0373925_0298656_702_1235 | 177 |
| 2181 | 3300037068 | Ga0373925_0385728 | Ga0373925_0385728_279_812 | 177 |
| 2182 | 3300037068 | Ga0373925_0464376 | Ga0373925_0464376_252_785 | 177 |
| 2183 | 3300037068 | Ga0373925_0600591 | Ga0373925_0600591_26_559 | 177 |
| 2184 | 3300037312 | Ga0395899_0181581 | Ga0395899_0181581_874_1407 | 177 |
| 2185 | 3300037312 | Ga0395899_0215112 | Ga0395899_0215112_80_613 | 177 |
| 2186 | 3300037418 | Ga0395900_0012290 | Ga0395900_0012290_400_933 | 177 |
| 2187 | 3300037418 | Ga0395900_0031276 | Ga0395900_0031276_604_1137 | 177 |
| 2188 | 3300037418 | Ga0395900_0128904 | Ga0395900_0128904_1057_1590 | 177 |
| 2189 | 3300037418 | Ga0395900_0298104 | Ga0395900_0298104_123_656 | 177 |
| 2190 | 3300037418 | Ga0395900_0880864 | Ga0395900_0880864_124_657 | 177 |
| 2191 | 3300037466 | Ga0395898_0029950 | Ga0395898_0029950_4863_5396 | 177 |
| 2192 | 3300037466 | Ga0395898_0639357 | Ga0395898_0639357_40_573 | 177 |
| 2193 | 3300037471 | Ga0395905_0012867 | Ga0395905_0012867_6996_7529 | 177 |
| 2194 | 3300037471 | Ga0395905_0032064 | Ga0395905_0032064_3831_4364 | 177 |
| 2195 | 3300037471 | Ga0395905_0033796 | Ga0395905_0033796_361_894 | 177 |
| 2196 | 3300037471 | Ga0395905_0145663 | Ga0395905_0145663_1132_1665 | 177 |
| 2197 | 3300037471 | Ga0395905_0167375 | Ga0395905_0167375_486_1019 | 177 |
| 2198 | 3300037471 | Ga0395905_0212637 | Ga0395905_0212637_1168_1701 | 177 |
| 2199 | 3300037471 | Ga0395905_0329762 | Ga0395905_0329762_638_1171 | 177 |
| 2200 | 3300037853 | Ga0436364_1550501 | Ga0436364_1550501_626_1159 | 177 |
| 2201 | 3300038443 | Ga0395901_0052439 | Ga0395901_0052439_3688_4221 | 177 |
| 2202 | 3300038443 | Ga0395901_0091387 | Ga0395901_0091387_1659_2192 | 177 |
| 2203 | 3300038443 | Ga0395901_0179544 | Ga0395901_0179544_971_1504 | 177 |
| 2204 | 3300038443 | Ga0395901_0262534 | Ga0395901_0262534_977_1510 | 177 |
| 2205 | 3300038443 | Ga0395901_0391260 | Ga0395901_0391260_124_657 | 177 |
| 2206 | 3300038443 | Ga0395901_0403424 | Ga0395901_0403424_706_1239 | 177 |
| 2207 | 3300039437 | Ga0436365_0334854 | Ga0436365_0334854_518_1051 | 177 |
| 2208 | 3300039438 | Ga0436360_0077529 | Ga0436360_0077529_129_662 | 177 |
| 2209 | 3300039450 | Ga0436363_1140251 | Ga0436363_1140251_677_1210 | 177 |
| 2210 | 3300039450 | Ga0436363_1416214 | Ga0436363_1416214_783_1316 | 177 |
| 2211 | 3300041404 | Ga0439436_0020046 | Ga0439436_0020046_470_1006 | 177 |
| 2212 | 3300041404 | Ga0439436_0143939 | Ga0439436_0143939_29_562 | 177 |
| 2213 | 3300041406 | Ga0439439_0012516 | Ga0439439_0012516_869_1405 | 177 |
| 2214 | 3300041407 | Ga0439447_049450 | Ga0439447_049450_188_724 | 177 |
| 2215 | 3300041413 | Ga0439465_0015249 | Ga0439465_0015249_1620_2153 | 177 |
| 2216 | 3300041413 | Ga0439465_0199717 | Ga0439465_0199717_58_591 | 177 |
| 2217 | 3300041413 | Ga0439465_0228722 | Ga0439465_0228722_61_594 | 177 |
| 2218 | 3300041413 | Ga0439465_0255743 | Ga0439465_0255743_105_638 | 177 |
| 2219 | 3300041444 | Ga0451790_40977 | Ga0451790_40977_64_597 | 177 |
| 2220 | 3300041444 | Ga0451790_43748 | Ga0451790_43748_60_593 | 177 |
| 2221 | 3300041446 | Ga0451794_06620 | Ga0451794_06620_85_618 | 177 |
| 2222 | 3300041446 | Ga0451794_19747 | Ga0451794_19747_327_860 | 177 |
| 2223 | 3300041446 | Ga0451794_30427 | Ga0451794_30427_33_566 | 177 |
| 2224 | 3300041451 | Ga0451791_0540605 | Ga0451791_0540605_307_840 | 177 |
| 2225 | 3300041452 | Ga0451793_0500431 | Ga0451793_0500431_165_698 | 177 |
| 2226 | 3300041452 | Ga0451793_1332179 | Ga0451793_1332179_161_694 | 177 |
| 2227 | 3300041453 | Ga0451797_0261817 | Ga0451797_0261817_381_914 | 177 |
| 2228 | 3300041459 | Ga0451800_1614829 | Ga0451800_1614829_567_1100 | 177 |
| 2229 | 3300041460 | Ga0451802_0387222 | Ga0451802_0387222_314_847 | 177 |
| 2230 | 3300041461 | Ga0451805_093557 | Ga0451805_093557_130_663 | 177 |
| 2231 | 3300041461 | Ga0451805_105019 | Ga0451805_105019_442_975 | 177 |
| 2232 | 3300041486 | Ga0451807_1614199 | Ga0451807_1614199_104_637 | 177 |
| 2233 | 3300041491 | Ga0451833_0705110 | Ga0451833_0705110_2464_2997 | 177 |
| 2234 | 3300041494 | Ga0451837_1342466 | Ga0451837_1342466_147_680 | 177 |
| 2235 | 3300041496 | Ga0451839_0023059 | Ga0451839_0023059_2222_2755 | 177 |
| 2236 | 3300041497 | Ga0451840_02584 | Ga0451840_02584_1181_1714 | 177 |
| 2237 | 3300041498 | Ga0451841_0087010 | Ga0451841_0087010_258_791 | 177 |
| 2238 | 3300041498 | Ga0451841_0468289 | Ga0451841_0468289_23_556 | 177 |
| 2239 | 3300041500 | Ga0451844_06822 | Ga0451844_06822_334_867 | 177 |
| 2240 | 3300041501 | Ga0451845_0062342 | Ga0451845_0062342_656_1189 | 177 |
| 2241 | 3300041501 | Ga0451845_0910627 | Ga0451845_0910627_10_543 | 177 |
| 2242 | 3300041502 | Ga0451846_01205 | Ga0451846_01205_1870_2403 | 177 |
| 2243 | 3300041503 | Ga0451847_0040601 | Ga0451847_0040601_3983_4516 | 177 |
| 2244 | 3300041503 | Ga0451847_0230433 | Ga0451847_0230433_87_620 | 177 |
| 2245 | 3300041504 | Ga0451848_20644 | Ga0451848_20644_1075_1608 | 177 |
| 2246 | 3300041505 | Ga0451849_0364808 | Ga0451849_0364808_1047_1580 | 177 |
| 2247 | 3300041507 | Ga0451851_0450253 | Ga0451851_0450253_33_566 | 177 |
| 2248 | 3300041509 | Ga0451843_0956766 | Ga0451843_0956766_1119_1652 | 177 |
| 2249 | 3300041510 | Ga0451854_09647 | Ga0451854_09647_4212_4745 | 177 |
| 2250 | 3300041512 | Ga0451853_2317430 | Ga0451853_2317430_656_1189 | 177 |
| 2251 | 3300041907 | Ga0452268_20544 | Ga0452268_20544_632_1165 | 177 |
| 2252 | 3300041907 | Ga0452268_47665 | Ga0452268_47665_228_761 | 177 |
| 2253 | 3300041909 | Ga0452270_1255 | Ga0452270_1255_12_545 | 177 |
| 2254 | 3300041999 | Ga0439433_0013404 | Ga0439433_0013404_145_681 | 177 |
| 2255 | 3300042002 | Ga0439442_038874 | Ga0439442_038874_255_791 | 177 |
| 2256 | 3300042007 | Ga0439449_0006732 | Ga0439449_0006732_2502_3035 | 177 |
| 2257 | 3300042007 | Ga0439449_0054575 | Ga0439449_0054575_535_1071 | 177 |
| 2258 | 3300042007 | Ga0439449_0101230 | Ga0439449_0101230_488_1021 | 177 |
| 2259 | 3300042010 | Ga0439452_028778 | Ga0439452_028778_822_1355 | 177 |
| 2260 | 3300042014 | Ga0439457_036043 | Ga0439457_036043_547_1080 | 177 |
| 2261 | 3300042015 | Ga0439462_0114593 | Ga0439462_0114593_195_731 | 177 |
| 2262 | 3300042122 | Ga0450920_009054 | Ga0450920_009054_889_1425 | 177 |
| 2263 | 3300042125 | Ga0450923_033863 | Ga0450923_033863_32_568 | 177 |
| 2264 | 3300042145 | Ga0450906_006379 | Ga0450906_006379_273_809 | 177 |
| 2265 | 3300042145 | Ga0450906_034473 | Ga0450906_034473_97_630 | 177 |
| 2266 | 3300042147 | Ga0450910_024747 | Ga0450910_024747_342_878 | 177 |
| 2267 | 3300042156 | Ga0439446_0139922 | Ga0439446_0139922_120_656 | 177 |
| 2268 | 3300042157 | Ga0439458_0114002 | Ga0439458_0114002_83_616 | 177 |
| 2269 | 3300042185 | Ga0450909_014549 | Ga0450909_014549_417_953 | 177 |
| 2270 | 3300042438 | Ga0439459_0065768 | Ga0439459_0065768_55_588 | 177 |
| 2271 | 3300042531 | Ga0450918_002411 | Ga0450918_002411_244_780 | 177 |
| 2272 | 3300044658 | Ga0466972_0009543 | Ga0466972_0009543_659_1192 | 177 |
| 2273 | 3300044658 | Ga0466972_0010313 | Ga0466972_0010313_684_1217 | 177 |
| 2274 | 3300044683 | Ga0466965_0043824 | Ga0466965_0043824_1044_1577 | 177 |
| 2275 | 3300044684 | Ga0466966_0328826 | Ga0466966_0328826_235_768 | 177 |
| 2276 | 3300044694 | Ga0466963_0571417 | Ga0466963_0571417_226_759 | 177 |
| 2277 | 3300044719 | Ga0466971_0267720 | Ga0466971_0267720_134_667 | 177 |
| 2278 | 3300044735 | Ga0466968_0039813 | Ga0466968_0039813_1293_1826 | 177 |
| 2279 | 3300044735 | Ga0466968_0500013 | Ga0466968_0500013_27_560 | 177 |
| 2280 | 3300044765 | Ga0466970_0120853 | Ga0466970_0120853_212_745 | 177 |
| 2281 | 3300044765 | Ga0466970_0280446 | Ga0466970_0280446_232_765 | 177 |
| 2282 | 3300044765 | Ga0466970_0398052 | Ga0466970_0398052_15_548 | 177 |
| 2283 | 3300044842 | Ga0466957_0183247 | Ga0466957_0183247_750_1283 | 177 |
| 2284 | 3300044901 | Ga0466960_0306295 | Ga0466960_0306295_220_753 | 177 |
| 2285 | 3300044901 | Ga0466960_0333658 | Ga0466960_0333658_24_557 | 177 |
| 2286 | 3300045051 | Ga0451576_0268673 | Ga0451576_0268673_391_924 | 177 |
| 2287 | 3300045976 | Ga0466967_0116210 | Ga0466967_0116210_544_1077 | 177 |
| 2288 | 3300045976 | Ga0466967_0504747 | Ga0466967_0504747_564_1097 | 177 |
| 2289 | 3300046452 | Ga0495617_051710 | Ga0495617_051710_759_1292 | 177 |
| 2290 | 3300046452 | Ga0495617_120064 | Ga0495617_120064_111_644 | 177 |
| 2291 | 3300046452 | Ga0495617_191278 | Ga0495617_191278_56_589 | 177 |
| 2292 | 3300046453 | Ga0495627_027112 | Ga0495627_027112_383_916 | 177 |
| 2293 | 3300046453 | Ga0495627_091553 | Ga0495627_091553_150_683 | 177 |
| 2294 | 3300046453 | Ga0495627_127225 | Ga0495627_127225_132_665 | 177 |
| 2295 | 3300046454 | Ga0495592_0052463 | Ga0495592_0052463_2136_2669 | 177 |
| 2296 | 3300046454 | Ga0495592_0066229 | Ga0495592_0066229_359_892 | 177 |
| 2297 | 3300046454 | Ga0495592_0653508 | Ga0495592_0653508_11_544 | 177 |
| 2298 | 3300046455 | Ga0495603_0055263 | Ga0495603_0055263_376_909 | 177 |
| 2299 | 3300046455 | Ga0495603_0125496 | Ga0495603_0125496_360_893 | 177 |
| 2300 | 3300046455 | Ga0495603_0294904 | Ga0495603_0294904_178_711 | 177 |
| 2301 | 3300046457 | Ga0495590_0019220 | Ga0495590_0019220_847_1380 | 177 |
| 2302 | 3300046457 | Ga0495590_0095975 | Ga0495590_0095975_162_695 | 177 |
| 2303 | 3300046457 | Ga0495590_0110661 | Ga0495590_0110661_152_685 | 177 |
| 2304 | 3300046457 | Ga0495590_0167563 | Ga0495590_0167563_98_631 | 177 |
| 2305 | 3300046458 | Ga0495591_015562 | Ga0495591_015562_1380_1913 | 177 |
| 2306 | 3300046459 | Ga0495629_0007179 | Ga0495629_0007179_5189_5722 | 177 |
| 2307 | 3300046459 | Ga0495629_0020113 | Ga0495629_0020113_4184_4717 | 177 |
| 2308 | 3300046459 | Ga0495629_0083222 | Ga0495629_0083222_1530_2063 | 177 |
| 2309 | 3300046459 | Ga0495629_0099061 | Ga0495629_0099061_707_1240 | 177 |
| 2310 | 3300046460 | Ga0495638_0021308 | Ga0495638_0021308_3365_3898 | 177 |
| 2311 | 3300046460 | Ga0495638_0077879 | Ga0495638_0077879_239_772 | 177 |
| 2312 | 3300046460 | Ga0495638_0118477 | Ga0495638_0118477_386_919 | 177 |
| 2313 | 3300046460 | Ga0495638_0139171 | Ga0495638_0139171_170_703 | 177 |
| 2314 | 3300046461 | Ga0495641_0111870 | Ga0495641_0111870_394_927 | 177 |
| 2315 | 3300046462 | Ga0495651_0000990 | Ga0495651_0000990_359_892 | 177 |
| 2316 | 3300046462 | Ga0495651_0013306 | Ga0495651_0013306_5556_6089 | 177 |
| 2317 | 3300046462 | Ga0495651_0418928 | Ga0495651_0418928_324_857 | 177 |
| 2318 | 3300046463 | Ga0495653_0000149 | Ga0495653_0000149_22606_23139 | 177 |
| 2319 | 3300046463 | Ga0495653_0349662 | Ga0495653_0349662_118_651 | 177 |
| 2320 | 3300046471 | Ga0495650_0143717 | Ga0495650_0143717_140_673 | 177 |
| 2321 | 3300046473 | Ga0495582_0015152 | Ga0495582_0015152_59_592 | 177 |
| 2322 | 3300046473 | Ga0495582_0116912 | Ga0495582_0116912_552_1085 | 177 |
| 2323 | 3300046474 | Ga0495605_0027351 | Ga0495605_0027351_206_739 | 177 |
| 2324 | 3300046474 | Ga0495605_0064266 | Ga0495605_0064266_135_668 | 177 |
| 2325 | 3300046474 | Ga0495605_0233506 | Ga0495605_0233506_19_552 | 177 |
| 2326 | 3300046474 | Ga0495605_0234254 | Ga0495605_0234254_107_640 | 177 |
| 2327 | 3300046475 | Ga0495639_0134033 | Ga0495639_0134033_176_709 | 177 |
| 2328 | 3300046476 | Ga0495662_0156979 | Ga0495662_0156979_521_1054 | 177 |
| 2329 | 3300046477 | Ga0495664_0034135 | Ga0495664_0034135_1588_2121 | 177 |
| 2330 | 3300046492 | Ga0495585_0101819 | Ga0495585_0101819_756_1289 | 177 |
| 2331 | 3300046492 | Ga0495585_0105082 | Ga0495585_0105082_64_597 | 177 |
| 2332 | 3300046492 | Ga0495585_0162916 | Ga0495585_0162916_415_948 | 177 |
| 2333 | 3300046492 | Ga0495585_0356567 | Ga0495585_0356567_46_579 | 177 |
| 2334 | 3300046499 | Ga0495594_0177180 | Ga0495594_0177180_554_1087 | 177 |
| 2335 | 3300046500 | Ga0495596_0142130 | Ga0495596_0142130_312_845 | 177 |
| 2336 | 3300046501 | Ga0495607_0014002 | Ga0495607_0014002_722_1255 | 177 |
| 2337 | 3300046501 | Ga0495607_0110814 | Ga0495607_0110814_356_889 | 177 |
| 2338 | 3300046501 | Ga0495607_0155712 | Ga0495607_0155712_197_730 | 177 |
| 2339 | 3300046501 | Ga0495607_0273367 | Ga0495607_0273367_100_633 | 177 |
| 2340 | 3300046506 | Ga0495583_0090017 | Ga0495583_0090017_48_581 | 177 |
| 2341 | 3300046506 | Ga0495583_0138755 | Ga0495583_0138755_157_690 | 177 |
| 2342 | 3300046506 | Ga0495583_0167313 | Ga0495583_0167313_276_809 | 177 |
| 2343 | 3300046506 | Ga0495583_0185398 | Ga0495583_0185398_229_762 | 177 |
| 2344 | 3300046507 | Ga0495606_0004034 | Ga0495606_0004034_7048_7581 | 177 |
| 2345 | 3300046507 | Ga0495606_0027177 | Ga0495606_0027177_2730_3263 | 177 |
| 2346 | 3300046507 | Ga0495606_0036411 | Ga0495606_0036411_2048_2581 | 177 |
| 2347 | 3300046507 | Ga0495606_0037805 | Ga0495606_0037805_261_794 | 177 |
| 2348 | 3300046507 | Ga0495606_0111077 | Ga0495606_0111077_114_647 | 177 |
| 2349 | 3300046507 | Ga0495606_0217061 | Ga0495606_0217061_272_805 | 177 |
| 2350 | 3300046507 | Ga0495606_0244632 | Ga0495606_0244632_445_978 | 177 |
| 2351 | 3300046507 | Ga0495606_0279877 | Ga0495606_0279877_264_797 | 177 |
| 2352 | 3300046511 | Ga0495608_0006327 | Ga0495608_0006327_954_1487 | 177 |
| 2353 | 3300046511 | Ga0495608_0239568 | Ga0495608_0239568_61_594 | 177 |
| 2354 | 3300046511 | Ga0495608_0300374 | Ga0495608_0300374_445_978 | 177 |
| 2355 | 3300046511 | Ga0495608_0375591 | Ga0495608_0375591_10_543 | 177 |
| 2356 | 3300046512 | Ga0495610_0021518 | Ga0495610_0021518_2613_3146 | 177 |
| 2357 | 3300046512 | Ga0495610_0073233 | Ga0495610_0073233_789_1322 | 177 |
| 2358 | 3300046512 | Ga0495610_0092046 | Ga0495610_0092046_494_1027 | 177 |
| 2359 | 3300046512 | Ga0495610_0138990 | Ga0495610_0138990_413_946 | 177 |
| 2360 | 3300046512 | Ga0495610_0140822 | Ga0495610_0140822_405_938 | 177 |
| 2361 | 3300046512 | Ga0495610_0143034 | Ga0495610_0143034_252_785 | 177 |
| 2362 | 3300046513 | Ga0495616_0003845 | Ga0495616_0003845_3009_3542 | 177 |
| 2363 | 3300046514 | Ga0495618_0099764 | Ga0495618_0099764_363_896 | 177 |
| 2364 | 3300046514 | Ga0495618_0324938 | Ga0495618_0324938_271_804 | 177 |
| 2365 | 3300046515 | Ga0495620_0008766 | Ga0495620_0008766_4343_4876 | 177 |
| 2366 | 3300046515 | Ga0495620_0011590 | Ga0495620_0011590_2515_3048 | 177 |
| 2367 | 3300046515 | Ga0495620_0140987 | Ga0495620_0140987_349_882 | 177 |
| 2368 | 3300046515 | Ga0495620_0199183 | Ga0495620_0199183_221_754 | 177 |
| 2369 | 3300046516 | Ga0495628_0053224 | Ga0495628_0053224_102_635 | 177 |
| 2370 | 3300046516 | Ga0495628_0215453 | Ga0495628_0215453_210_743 | 177 |
| 2371 | 3300046517 | Ga0495630_0029804 | Ga0495630_0029804_1049_1582 | 177 |
| 2372 | 3300046518 | Ga0495631_0007141 | Ga0495631_0007141_3625_4158 | 177 |
| 2373 | 3300046518 | Ga0495631_0050633 | Ga0495631_0050633_339_872 | 177 |
| 2374 | 3300046518 | Ga0495631_0061512 | Ga0495631_0061512_704_1237 | 177 |
| 2375 | 3300046519 | Ga0495632_0053677 | Ga0495632_0053677_726_1259 | 177 |
| 2376 | 3300046519 | Ga0495632_0069504 | Ga0495632_0069504_353_886 | 177 |
| 2377 | 3300046519 | Ga0495632_0097889 | Ga0495632_0097889_588_1121 | 177 |
| 2378 | 3300046519 | Ga0495632_0113199 | Ga0495632_0113199_334_867 | 177 |
| 2379 | 3300046520 | Ga0495637_0063527 | Ga0495637_0063527_504_1037 | 177 |
| 2380 | 3300046522 | Ga0495643_0010467 | Ga0495643_0010467_3294_3827 | 177 |
| 2381 | 3300046522 | Ga0495643_0011617 | Ga0495643_0011617_1529_2062 | 177 |
| 2382 | 3300046522 | Ga0495643_0071765 | Ga0495643_0071765_391_924 | 177 |
| 2383 | 3300046522 | Ga0495643_0128976 | Ga0495643_0128976_219_752 | 177 |
| 2384 | 3300046523 | Ga0495644_0074077 | Ga0495644_0074077_432_965 | 177 |
| 2385 | 3300046523 | Ga0495644_0277617 | Ga0495644_0277617_40_573 | 177 |
| 2386 | 3300046524 | Ga0495648_0001935 | Ga0495648_0001935_14386_14919 | 177 |
| 2387 | 3300046524 | Ga0495648_0008251 | Ga0495648_0008251_55_588 | 177 |
| 2388 | 3300046524 | Ga0495648_0015480 | Ga0495648_0015480_4410_4943 | 177 |
| 2389 | 3300046524 | Ga0495648_0086535 | Ga0495648_0086535_903_1436 | 177 |
| 2390 | 3300046524 | Ga0495648_0361201 | Ga0495648_0361201_20_553 | 177 |
| 2391 | 3300046525 | Ga0495663_0047321 | Ga0495663_0047321_184_717 | 177 |
| 2392 | 3300046529 | Ga0495652_0004067 | Ga0495652_0004067_2457_2990 | 177 |
| 2393 | 3300046529 | Ga0495652_0169584 | Ga0495652_0169584_413_946 | 177 |
| 2394 | 3300046530 | Ga0495654_0000169 | Ga0495654_0000169_57498_58031 | 177 |
| 2395 | 3300046530 | Ga0495654_0008744 | Ga0495654_0008744_3494_4027 | 177 |
| 2396 | 3300046530 | Ga0495654_0063133 | Ga0495654_0063133_255_788 | 177 |
| 2397 | 3300046530 | Ga0495654_0088680 | Ga0495654_0088680_188_721 | 177 |
| 2398 | 3300046533 | Ga0495640_0007699 | Ga0495640_0007699_7377_7910 | 177 |
| 2399 | 3300046533 | Ga0495640_0016564 | Ga0495640_0016564_4708_5241 | 177 |
| 2400 | 3300046533 | Ga0495640_0044682 | Ga0495640_0044682_1854_2387 | 177 |
| 2401 | 3300046533 | Ga0495640_0102873 | Ga0495640_0102873_794_1327 | 177 |
| 2402 | 3300046533 | Ga0495640_0146627 | Ga0495640_0146627_26_559 | 177 |
| 2403 | 3300046535 | Ga0495586_0030573 | Ga0495586_0030573_344_877 | 177 |
| 2404 | 3300046536 | Ga0495587_0149435 | Ga0495587_0149435_765_1298 | 177 |
| 2405 | 3300046536 | Ga0495587_0434788 | Ga0495587_0434788_108_641 | 177 |
| 2406 | 3300046537 | Ga0495598_0228688 | Ga0495598_0228688_131_664 | 177 |
| 2407 | 3300046538 | Ga0495609_0039691 | Ga0495609_0039691_802_1335 | 177 |
| 2408 | 3300046538 | Ga0495609_0160948 | Ga0495609_0160948_53_586 | 177 |
| 2409 | 3300046538 | Ga0495609_0310991 | Ga0495609_0310991_61_594 | 177 |
| 2410 | 3300046539 | Ga0495621_0013886 | Ga0495621_0013886_738_1271 | 177 |
| 2411 | 3300046542 | Ga0495597_0009306 | Ga0495597_0009306_660_1193 | 177 |
| 2412 | 3300046542 | Ga0495597_0024609 | Ga0495597_0024609_1995_2528 | 177 |
| 2413 | 3300046542 | Ga0495597_0075007 | Ga0495597_0075007_874_1407 | 177 |
| 2414 | 3300046542 | Ga0495597_0128654 | Ga0495597_0128654_164_697 | 177 |
| 2415 | 3300046542 | Ga0495597_0190657 | Ga0495597_0190657_48_581 | 177 |
| 2416 | 3300046543 | Ga0495645_0187257 | Ga0495645_0187257_846_1379 | 177 |
| 2417 | 3300046543 | Ga0495645_0313988 | Ga0495645_0313988_427_960 | 177 |
| 2418 | 3300046543 | Ga0495645_0746600 | Ga0495645_0746600_38_571 | 177 |
| 2419 | 3300046557 | Ga0495622_0020195 | Ga0495622_0020195_1425_1958 | 177 |
| 2420 | 3300046557 | Ga0495622_0032660 | Ga0495622_0032660_1258_1791 | 177 |
| 2421 | 3300046557 | Ga0495622_0084171 | Ga0495622_0084171_861_1394 | 177 |
| 2422 | 3300046557 | Ga0495622_0094497 | Ga0495622_0094497_62_595 | 177 |
| 2423 | 3300046557 | Ga0495622_0318953 | Ga0495622_0318953_26_559 | 177 |
| 2424 | 3300046558 | Ga0495633_0055449 | Ga0495633_0055449_786_1322 | 177 |
| 2425 | 3300046558 | Ga0495633_0070701 | Ga0495633_0070701_893_1426 | 177 |
| 2426 | 3300046558 | Ga0495633_0115593 | Ga0495633_0115593_130_663 | 177 |
| 2427 | 3300046558 | Ga0495633_0132887 | Ga0495633_0132887_498_1031 | 177 |
| 2428 | 3300046559 | Ga0495667_0016440 | Ga0495667_0016440_2009_2542 | 177 |
| 2429 | 3300046559 | Ga0495667_0271969 | Ga0495667_0271969_81_614 | 177 |
| 2430 | 3300046615 | Ga0495656_0070658 | Ga0495656_0070658_943_1476 | 177 |
| 2431 | 3300046615 | Ga0495656_0163017 | Ga0495656_0163017_451_984 | 177 |
| 2432 | 3300046615 | Ga0495656_0204799 | Ga0495656_0204799_212_745 | 177 |
| 2433 | 3300046615 | Ga0495656_0207938 | Ga0495656_0207938_217_753 | 177 |
| 2434 | 3300046616 | Ga0495668_0009874 | Ga0495668_0009874_710_1243 | 177 |
| 2435 | 3300046616 | Ga0495668_0063697 | Ga0495668_0063697_1104_1637 | 177 |
| 2436 | 3300046616 | Ga0495668_0095153 | Ga0495668_0095153_939_1472 | 177 |
| 2437 | 3300046616 | Ga0495668_0271703 | Ga0495668_0271703_345_878 | 177 |
| 2438 | 3300046616 | Ga0495668_0283076 | Ga0495668_0283076_163_696 | 177 |
| 2439 | 3300046616 | Ga0495668_0488217 | Ga0495668_0488217_72_605 | 177 |
| 2440 | 3300046642 | Ga0495634_0044824 | Ga0495634_0044824_375_908 | 177 |
| 2441 | 3300046642 | Ga0495634_0050558 | Ga0495634_0050558_1665_2198 | 177 |
| 2442 | 3300046642 | Ga0495634_0366988 | Ga0495634_0366988_238_771 | 177 |
| 2443 | 3300046642 | Ga0495634_0417166 | Ga0495634_0417166_49_582 | 177 |
| 2444 | 3300046648 | Ga0495611_0053779 | Ga0495611_0053779_308_841 | 177 |
| 2445 | 3300046648 | Ga0495611_0057726 | Ga0495611_0057726_677_1210 | 177 |
| 2446 | 3300046660 | Ga0495625_0027395 | Ga0495625_0027395_929_1462 | 177 |
| 2447 | 3300046660 | Ga0495625_0036051 | Ga0495625_0036051_1686_2219 | 177 |
| 2448 | 3300046660 | Ga0495625_0064552 | Ga0495625_0064552_358_891 | 177 |
| 2449 | 3300046660 | Ga0495625_0125448 | Ga0495625_0125448_517_1050 | 177 |
| 2450 | 3300046660 | Ga0495625_0233111 | Ga0495625_0233111_440_973 | 177 |
| 2451 | 3300046660 | Ga0495625_0667476 | Ga0495625_0667476_32_565 | 177 |
| 2452 | 3300046663 | Ga0495635_0009893 | Ga0495635_0009893_282_815 | 177 |
| 2453 | 3300046663 | Ga0495635_0102905 | Ga0495635_0102905_685_1218 | 177 |
| 2454 | 3300046663 | Ga0495635_0479966 | Ga0495635_0479966_247_780 | 177 |
| 2455 | 3300046663 | Ga0495635_0578370 | Ga0495635_0578370_132_665 | 177 |
| 2456 | 3300046664 | Ga0495659_0100765 | Ga0495659_0100765_191_724 | 177 |
| 2457 | 3300046665 | Ga0495661_0152638 | Ga0495661_0152638_347_880 | 177 |
| 2458 | 3300046674 | Ga0495588_0025858 | Ga0495588_0025858_623_1156 | 177 |
| 2459 | 3300046674 | Ga0495588_0052266 | Ga0495588_0052266_357_890 | 177 |
| 2460 | 3300046674 | Ga0495588_0059100 | Ga0495588_0059100_1142_1678 | 177 |
| 2461 | 3300046674 | Ga0495588_0064395 | Ga0495588_0064395_91_624 | 177 |
| 2462 | 3300046674 | Ga0495588_0081997 | Ga0495588_0081997_714_1247 | 177 |
| 2463 | 3300046674 | Ga0495588_0104250 | Ga0495588_0104250_236_769 | 177 |
| 2464 | 3300046674 | Ga0495588_0349138 | Ga0495588_0349138_22_555 | 177 |
| 2465 | 3300046675 | Ga0495657_0020577 | Ga0495657_0020577_2457_2990 | 177 |
| 2466 | 3300046675 | Ga0495657_0088229 | Ga0495657_0088229_751_1284 | 177 |
| 2467 | 3300046678 | Ga0495599_0006010 | Ga0495599_0006010_6362_6895 | 177 |
| 2468 | 3300046679 | Ga0495623_0078486 | Ga0495623_0078486_507_1040 | 177 |
| 2469 | 3300046679 | Ga0495623_0134558 | Ga0495623_0134558_301_834 | 177 |
| 2470 | 3300046679 | Ga0495623_0200184 | Ga0495623_0200184_350_883 | 177 |
| 2471 | 3300046679 | Ga0495623_0264429 | Ga0495623_0264429_10_543 | 177 |
| 2472 | 3300046680 | Ga0495646_0002026 | Ga0495646_0002026_11102_11635 | 177 |
| 2473 | 3300046681 | Ga0495647_0184717 | Ga0495647_0184717_324_857 | 177 |
| 2474 | 3300046681 | Ga0495647_0222830 | Ga0495647_0222830_275_808 | 177 |
| 2475 | 3300046683 | Ga0495658_0024761 | Ga0495658_0024761_887_1420 | 177 |
| 2476 | 3300046683 | Ga0495658_0117919 | Ga0495658_0117919_63_596 | 177 |
| 2477 | 3300046684 | Ga0495669_0187682 | Ga0495669_0187682_189_722 | 177 |
| 2478 | 3300046689 | Ga0495613_0033309 | Ga0495613_0033309_1417_1950 | 177 |
| 2479 | 3300046689 | Ga0495613_0222981 | Ga0495613_0222981_57_590 | 177 |
| 2480 | 3300046689 | Ga0495613_0292012 | Ga0495613_0292012_500_1033 | 177 |
| 2481 | 3300046690 | Ga0495624_0019695 | Ga0495624_0019695_2333_2866 | 177 |
| 2482 | 3300046690 | Ga0495624_0257636 | Ga0495624_0257636_219_752 | 177 |
| 2483 | 3300046691 | Ga0495670_0019785 | Ga0495670_0019785_2729_3262 | 177 |
| 2484 | 3300046691 | Ga0495670_0067647 | Ga0495670_0067647_756_1289 | 177 |
| 2485 | 3300046691 | Ga0495670_0227925 | Ga0495670_0227925_168_701 | 177 |
| 2486 | 3300046691 | Ga0495670_0284616 | Ga0495670_0284616_90_623 | 177 |
| 2487 | 3300046692 | Ga0495671_0020389 | Ga0495671_0020389_470_1003 | 177 |
| 2488 | 3300046692 | Ga0495671_0098045 | Ga0495671_0098045_842_1375 | 177 |
| 2489 | 3300046692 | Ga0495671_0106435 | Ga0495671_0106435_391_924 | 177 |
| 2490 | 3300046692 | Ga0495671_0119333 | Ga0495671_0119333_573_1106 | 177 |
| 2491 | 3300046694 | Ga0495649_0056016 | Ga0495649_0056016_1509_2042 | 177 |
| 2492 | 3300046694 | Ga0495649_0128244 | Ga0495649_0128244_714_1247 | 177 |
| 2493 | 3300046694 | Ga0495649_0402130 | Ga0495649_0402130_117_650 | 177 |
| 2494 | 3300046694 | Ga0495649_0450401 | Ga0495649_0450401_46_579 | 177 |
| 2495 | 3300046794 | Ga0495589_0086867 | Ga0495589_0086867_693_1226 | 177 |
| 2496 | 3300046794 | Ga0495589_0108956 | Ga0495589_0108956_77_610 | 177 |
| 2497 | 3300046794 | Ga0495589_0440352 | Ga0495589_0440352_17_550 | 177 |
| 2498 | 3300046809 | Ga0495600_0001328 | Ga0495600_0001328_2457_2990 | 177 |
| 2499 | 3300046809 | Ga0495600_0200756 | Ga0495600_0200756_174_707 | 177 |
| 2500 | 3300046809 | Ga0495600_0249391 | Ga0495600_0249391_93_626 | 177 |
| 2501 | 3300046810 | Ga0495660_0003610 | Ga0495660_0003610_3088_3621 | 177 |
| 2502 | 3300046810 | Ga0495660_0216181 | Ga0495660_0216181_213_746 | 177 |
| 2503 | 3300047315 | Ga0495581_0046393 | Ga0495581_0046393_523_1056 | 177 |
| 2504 | 3300047315 | Ga0495581_0443387 | Ga0495581_0443387_68_601 | 177 |
| 2505 | 3300047317 | Ga0495604_0024237 | Ga0495604_0024237_2029_2562 | 177 |
| 2506 | 3300047317 | Ga0495604_0038744 | Ga0495604_0038744_3131_3664 | 177 |
| 2507 | 3300047317 | Ga0495604_0056047 | Ga0495604_0056047_1330_1863 | 177 |
| 2508 | 3300047317 | Ga0495604_0154622 | Ga0495604_0154622_273_806 | 177 |
| 2509 | 3300047318 | Ga0495636_0254486 | Ga0495636_0254486_211_744 | 177 |
| 2510 | 3300047318 | Ga0495636_0372624 | Ga0495636_0372624_74_607 | 177 |
| 2511 | 3300047319 | Ga0495674_0033963 | Ga0495674_0033963_3292_3825 | 177 |
| 2512 | 3300047319 | Ga0495674_0084213 | Ga0495674_0084213_1695_2228 | 177 |
| 2513 | 3300047319 | Ga0495674_0133161 | Ga0495674_0133161_190_723 | 177 |
| 2514 | 3300047319 | Ga0495674_0881304 | Ga0495674_0881304_85_618 | 177 |
| 2515 | 3300047320 | Ga0495672_0072639 | Ga0495672_0072639_142_675 | 177 |
| 2516 | 3300047320 | Ga0495672_0118367 | Ga0495672_0118367_196_729 | 177 |
| 2517 | 3300047320 | Ga0495672_0151289 | Ga0495672_0151289_202_735 | 177 |
| 2518 | 3300047321 | Ga0495676_0267319 | Ga0495676_0267319_394_927 | 177 |
| 2519 | 3300047321 | Ga0495676_0425480 | Ga0495676_0425480_145_678 | 177 |
| 2520 | 3300047322 | Ga0495680_0026837 | Ga0495680_0026837_1752_2285 | 177 |
| 2521 | 3300047322 | Ga0495680_0636489 | Ga0495680_0636489_114_647 | 177 |
| 2522 | 3300047323 | Ga0495683_0094699 | Ga0495683_0094699_508_1041 | 177 |
| 2523 | 3300047323 | Ga0495683_0106493 | Ga0495683_0106493_114_647 | 177 |
| 2524 | 3300047443 | Ga0495687_047418 | Ga0495687_047418_1189_1722 | 177 |
| 2525 | 3300047444 | Ga0495675_0009679 | Ga0495675_0009679_4135_4668 | 177 |
| 2526 | 3300047444 | Ga0495675_0467629 | Ga0495675_0467629_108_641 | 177 |
| 2527 | 3300047447 | Ga0495685_058639 | Ga0495685_058639_84_617 | 177 |
| 2528 | 3300047469 | Ga0495673_0054337 | Ga0495673_0054337_324_857 | 177 |
| 2529 | 3300047469 | Ga0495673_0060972 | Ga0495673_0060972_855_1388 | 177 |
| 2530 | 3300047469 | Ga0495673_0084303 | Ga0495673_0084303_520_1053 | 177 |
| 2531 | 3300047470 | Ga0495681_0111401 | Ga0495681_0111401_173_706 | 177 |
| 2532 | 3300047470 | Ga0495681_0164393 | Ga0495681_0164393_237_770 | 177 |
| 2533 | 3300047471 | Ga0495684_0003854 | Ga0495684_0003854_4252_4785 | 177 |
| 2534 | 3300047471 | Ga0495684_0063489 | Ga0495684_0063489_253_786 | 177 |
| 2535 | 3300047471 | Ga0495684_0068141 | Ga0495684_0068141_602_1135 | 177 |
| 2536 | 3300047472 | Ga0495686_0012709 | Ga0495686_0012709_347_880 | 177 |
| 2537 | 3300047472 | Ga0495686_0020367 | Ga0495686_0020367_1586_2119 | 177 |
| 2538 | 3300047472 | Ga0495686_0053911 | Ga0495686_0053911_808_1341 | 177 |
| 2539 | 3300047472 | Ga0495686_0070208 | Ga0495686_0070208_1300_1833 | 177 |
| 2540 | 3300047472 | Ga0495686_0113885 | Ga0495686_0113885_964_1497 | 177 |
| 2541 | 3300047472 | Ga0495686_0115126 | Ga0495686_0115126_845_1378 | 177 |
| 2542 | 3300047472 | Ga0495686_0117960 | Ga0495686_0117960_873_1406 | 177 |
| 2543 | 3300047472 | Ga0495686_0136673 | Ga0495686_0136673_780_1313 | 177 |
| 2544 | 3300047673 | Ga0495593_0012224 | Ga0495593_0012224_544_1077 | 177 |
| 2545 | 3300047673 | Ga0495593_0056011 | Ga0495593_0056011_577_1110 | 177 |
| 2546 | 3300048088 | Ga0495602_0368581 | Ga0495602_0368581_407_940 | 177 |
| 2547 | 3300048088 | Ga0495602_0547652 | Ga0495602_0547652_167_700 | 177 |
| 2548 | 3300048088 | Ga0495602_0549525 | Ga0495602_0549525_50_583 | 177 |
| 2549 | 3300048089 | Ga0495614_0160820 | Ga0495614_0160820_415_948 | 177 |
| 2550 | 3300048090 | Ga0495615_0018125 | Ga0495615_0018125_558_1091 | 177 |
| 2551 | 3300048090 | Ga0495615_0077871 | Ga0495615_0077871_299_832 | 177 |
| 2552 | 3300048091 | Ga0495626_0008866 | Ga0495626_0008866_3954_4487 | 177 |
| 2553 | 3300048091 | Ga0495626_0009507 | Ga0495626_0009507_2599_3132 | 177 |
| 2554 | 3300048091 | Ga0495626_0078153 | Ga0495626_0078153_647_1180 | 177 |
| 2555 | 3300048091 | Ga0495626_0232172 | Ga0495626_0232172_166_699 | 177 |
| 2556 | 3300048903 | Ga0496100_0304033 | Ga0496100_0304033_641_1174 | 177 |
| 2557 | 3300048903 | Ga0496100_0700908 | Ga0496100_0700908_152_685 | 177 |
| 2558 | 3300048904 | Ga0496101_0218582 | Ga0496101_0218582_227_760 | 177 |
| 2559 | 3300048904 | Ga0496101_0664100 | Ga0496101_0664100_233_766 | 177 |
| 2560 | 3300048904 | Ga0496101_0758557 | Ga0496101_0758557_171_704 | 177 |
| 2561 | 3300048905 | Ga0496102_0275494 | Ga0496102_0275494_157_690 | 177 |
| 2562 | 3300048905 | Ga0496102_0401030 | Ga0496102_0401030_358_891 | 177 |
| 2563 | 3300048905 | Ga0496102_0488810 | Ga0496102_0488810_72_605 | 177 |
| 2564 | 3300048905 | Ga0496102_1348092 | Ga0496102_1348092_22_555 | 177 |
| 2565 | 3300048905 | Ga0496102_1607049 | Ga0496102_1607049_18_551 | 177 |
| 2566 | 3300048906 | Ga0496103_0169291 | Ga0496103_0169291_246_779 | 177 |
| 2567 | 3300048906 | Ga0496103_0420846 | Ga0496103_0420846_140_673 | 177 |
| 2568 | 3300048907 | Ga0496104_0038871 | Ga0496104_0038871_2659_3192 | 177 |
| 2569 | 3300048907 | Ga0496104_0117685 | Ga0496104_0117685_593_1126 | 177 |
| 2570 | 3300048907 | Ga0496104_0245933 | Ga0496104_0245933_730_1263 | 177 |
| 2571 | 3300048908 | Ga0496105_0005725 | Ga0496105_0005725_5737_6270 | 177 |
| 2572 | 3300048908 | Ga0496105_0100695 | Ga0496105_0100695_23_556 | 177 |
| 2573 | 3300048908 | Ga0496105_0203046 | Ga0496105_0203046_728_1261 | 177 |
| 2574 | 3300048908 | Ga0496105_0579954 | Ga0496105_0579954_166_699 | 177 |
| 2575 | 3300048909 | Ga0496106_0287189 | Ga0496106_0287189_749_1282 | 177 |
| 2576 | 3300048909 | Ga0496106_0592345 | Ga0496106_0592345_190_723 | 177 |
| 2577 | 3300048909 | Ga0496106_0675079 | Ga0496106_0675079_190_723 | 177 |
| 2578 | 3300048910 | Ga0496107_0146618 | Ga0496107_0146618_235_768 | 177 |
| 2579 | 3300048910 | Ga0496107_0931367 | Ga0496107_0931367_51_584 | 177 |
| 2580 | 3300048911 | Ga0496108_0065562 | Ga0496108_0065562_301_834 | 177 |
| 2581 | 3300048911 | Ga0496108_0093770 | Ga0496108_0093770_1828_2361 | 177 |
| 2582 | 3300048911 | Ga0496108_0407426 | Ga0496108_0407426_77_610 | 177 |
| 2583 | 3300048911 | Ga0496108_0605644 | Ga0496108_0605644_159_692 | 177 |
| 2584 | 3300048912 | Ga0496109_0694864 | Ga0496109_0694864_134_667 | 177 |
| 2585 | 3300048913 | Ga0496110_0072438 | Ga0496110_0072438_2368_2901 | 177 |
| 2586 | 3300048913 | Ga0496110_0225558 | Ga0496110_0225558_669_1202 | 177 |
| 2587 | 3300048913 | Ga0496110_0457335 | Ga0496110_0457335_68_601 | 177 |
| 2588 | 3300048913 | Ga0496110_0618696 | Ga0496110_0618696_311_844 | 177 |
| 2589 | 3300048914 | Ga0496111_0010053 | Ga0496111_0010053_4242_4775 | 177 |
| 2590 | 3300048914 | Ga0496111_0065502 | Ga0496111_0065502_2063_2596 | 177 |
| 2591 | 3300048914 | Ga0496111_0470529 | Ga0496111_0470529_148_681 | 177 |
| 2592 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_7517_8050 | 177 |
| 2593 | 3300048915 | Ga0496112_0049260 | Ga0496112_0049260_37_570 | 177 |
| 2594 | 3300048915 | Ga0496112_0110610 | Ga0496112_0110610_1431_1964 | 177 |
| 2595 | 3300048915 | Ga0496112_0116362 | Ga0496112_0116362_561_1094 | 177 |
| 2596 | 3300048915 | Ga0496112_0126745 | Ga0496112_0126745_180_713 | 177 |
| 2597 | 3300048915 | Ga0496112_1395192 | Ga0496112_1395192_39_572 | 177 |
| 2598 | 3300048916 | Ga0496113_0212481 | Ga0496113_0212481_720_1253 | 177 |
| 2599 | 3300048916 | Ga0496113_0243254 | Ga0496113_0243254_111_644 | 177 |
| 2600 | 3300048916 | Ga0496113_0435358 | Ga0496113_0435358_171_704 | 177 |
| 2601 | 3300048916 | Ga0496113_0704217 | Ga0496113_0704217_34_567 | 177 |
| 2602 | 3300048916 | Ga0496113_0917896 | Ga0496113_0917896_50_583 | 177 |
| 2603 | 3300048917 | Ga0496114_0089784 | Ga0496114_0089784_1761_2294 | 177 |
| 2604 | 3300048917 | Ga0496114_0189609 | Ga0496114_0189609_487_1020 | 177 |
| 2605 | 3300048917 | Ga0496114_0230803 | Ga0496114_0230803_896_1429 | 177 |
| 2606 | 3300048917 | Ga0496114_0346523 | Ga0496114_0346523_178_711 | 177 |
| 2607 | 3300048917 | Ga0496114_0613657 | Ga0496114_0613657_273_806 | 177 |
| 2608 | 3300048918 | Ga0496115_0004922 | Ga0496115_0004922_3098_3631 | 177 |
| 2609 | 3300048918 | Ga0496115_0063129 | Ga0496115_0063129_596_1129 | 177 |
| 2610 | 3300048918 | Ga0496115_0161711 | Ga0496115_0161711_755_1288 | 177 |
| 2611 | 3300048918 | Ga0496115_0397682 | Ga0496115_0397682_528_1061 | 177 |
| 2612 | 3300048918 | Ga0496115_0707357 | Ga0496115_0707357_241_774 | 177 |
| 2613 | 3300048918 | Ga0496115_0906199 | Ga0496115_0906199_22_555 | 177 |
| 2614 | 3300048919 | Ga0496116_0016936 | Ga0496116_0016936_2573_3106 | 177 |
| 2615 | 3300048919 | Ga0496116_0020299 | Ga0496116_0020299_1640_2173 | 177 |
| 2616 | 3300048919 | Ga0496116_0090144 | Ga0496116_0090144_592_1125 | 177 |
| 2617 | 3300048919 | Ga0496116_0150213 | Ga0496116_0150213_580_1113 | 177 |
| 2618 | 3300048919 | Ga0496116_0246987 | Ga0496116_0246987_73_606 | 177 |
| 2619 | 3300048919 | Ga0496116_0266409 | Ga0496116_0266409_153_686 | 177 |
| 2620 | 3300048920 | Ga0496117_0036203 | Ga0496117_0036203_2617_3150 | 177 |
| 2621 | 3300048920 | Ga0496117_0039434 | Ga0496117_0039434_1299_1832 | 177 |
| 2622 | 3300048920 | Ga0496117_0079630 | Ga0496117_0079630_253_786 | 177 |
| 2623 | 3300048920 | Ga0496117_0113384 | Ga0496117_0113384_255_788 | 177 |
| 2624 | 3300048920 | Ga0496117_0131919 | Ga0496117_0131919_635_1168 | 177 |
| 2625 | 3300048921 | Ga0496118_0010277 | Ga0496118_0010277_6339_6872 | 177 |
| 2626 | 3300048921 | Ga0496118_0047138 | Ga0496118_0047138_2353_2886 | 177 |
| 2627 | 3300048921 | Ga0496118_0048277 | Ga0496118_0048277_701_1234 | 177 |
| 2628 | 3300048921 | Ga0496118_0083225 | Ga0496118_0083225_1510_2043 | 177 |
| 2629 | 3300048921 | Ga0496118_0115246 | Ga0496118_0115246_848_1381 | 177 |
| 2630 | 3300048921 | Ga0496118_0154123 | Ga0496118_0154123_585_1118 | 177 |
| 2631 | 3300048921 | Ga0496118_0193744 | Ga0496118_0193744_314_847 | 177 |
| 2632 | 3300048921 | Ga0496118_0345288 | Ga0496118_0345288_101_634 | 177 |
| 2633 | 3300048921 | Ga0496118_0419965 | Ga0496118_0419965_98_631 | 177 |
| 2634 | 3300048922 | Ga0496119_0022470 | Ga0496119_0022470_1435_1968 | 177 |
| 2635 | 3300048922 | Ga0496119_0026500 | Ga0496119_0026500_268_801 | 177 |
| 2636 | 3300048922 | Ga0496119_0049927 | Ga0496119_0049927_787_1320 | 177 |
| 2637 | 3300048922 | Ga0496119_0132438 | Ga0496119_0132438_117_650 | 177 |
| 2638 | 3300048922 | Ga0496119_0192824 | Ga0496119_0192824_157_690 | 177 |
| 2639 | 3300048922 | Ga0496119_0195203 | Ga0496119_0195203_51_584 | 177 |
| 2640 | 3300048922 | Ga0496119_0314293 | Ga0496119_0314293_104_637 | 177 |
| 2641 | 3300048923 | Ga0496120_0003668 | Ga0496120_0003668_10163_10696 | 177 |
| 2642 | 3300048923 | Ga0496120_0014732 | Ga0496120_0014732_2715_3248 | 177 |
| 2643 | 3300048923 | Ga0496120_0067605 | Ga0496120_0067605_421_954 | 177 |
| 2644 | 3300048923 | Ga0496120_0120324 | Ga0496120_0120324_238_771 | 177 |
| 2645 | 3300048923 | Ga0496120_0136578 | Ga0496120_0136578_406_939 | 177 |
| 2646 | 3300048923 | Ga0496120_0236970 | Ga0496120_0236970_161_694 | 177 |
| 2647 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_231827_232360 | 177 |
| 2648 | 3300048924 | Ga0496121_0002196 | Ga0496121_0002196_14467_15000 | 177 |
| 2649 | 3300048924 | Ga0496121_0012437 | Ga0496121_0012437_6245_6778 | 177 |
| 2650 | 3300048924 | Ga0496121_0015937 | Ga0496121_0015937_6724_7257 | 177 |
| 2651 | 3300048924 | Ga0496121_0018961 | Ga0496121_0018961_6195_6728 | 177 |
| 2652 | 3300048924 | Ga0496121_0059739 | Ga0496121_0059739_1246_1779 | 177 |
| 2653 | 3300048924 | Ga0496121_0074250 | Ga0496121_0074250_1783_2316 | 177 |
| 2654 | 3300048924 | Ga0496121_0091959 | Ga0496121_0091959_330_863 | 177 |
| 2655 | 3300048924 | Ga0496121_0133823 | Ga0496121_0133823_1239_1772 | 177 |
| 2656 | 3300048924 | Ga0496121_0136963 | Ga0496121_0136963_356_889 | 177 |
| 2657 | 3300048924 | Ga0496121_0145522 | Ga0496121_0145522_385_918 | 177 |
| 2658 | 3300048924 | Ga0496121_0181295 | Ga0496121_0181295_231_764 | 177 |
| 2659 | 3300048924 | Ga0496121_0198020 | Ga0496121_0198020_643_1176 | 177 |
| 2660 | 3300048924 | Ga0496121_0213609 | Ga0496121_0213609_249_782 | 177 |
| 2661 | 3300048924 | Ga0496121_0385665 | Ga0496121_0385665_102_635 | 177 |
| 2662 | 3300048924 | Ga0496121_0410174 | Ga0496121_0410174_143_676 | 177 |
| 2663 | 3300048924 | Ga0496121_0510997 | Ga0496121_0510997_118_651 | 177 |
| 2664 | 3300048925 | Ga0496122_0000179 | Ga0496122_0000179_7804_8337 | 177 |
| 2665 | 3300048925 | Ga0496122_0037393 | Ga0496122_0037393_2758_3291 | 177 |
| 2666 | 3300048925 | Ga0496122_0049928 | Ga0496122_0049928_2296_2829 | 177 |
| 2667 | 3300048925 | Ga0496122_0085161 | Ga0496122_0085161_1529_2062 | 177 |
| 2668 | 3300048925 | Ga0496122_0090444 | Ga0496122_0090444_392_925 | 177 |
| 2669 | 3300048925 | Ga0496122_0172441 | Ga0496122_0172441_579_1112 | 177 |
| 2670 | 3300048925 | Ga0496122_0209271 | Ga0496122_0209271_363_896 | 177 |
| 2671 | 3300048925 | Ga0496122_0262012 | Ga0496122_0262012_322_855 | 177 |
| 2672 | 3300048925 | Ga0496122_0326762 | Ga0496122_0326762_178_711 | 177 |
| 2673 | 3300048926 | Ga0496123_0000305 | Ga0496123_0000305_5749_6282 | 177 |
| 2674 | 3300048926 | Ga0496123_0017503 | Ga0496123_0017503_2096_2629 | 177 |
| 2675 | 3300048926 | Ga0496123_0029976 | Ga0496123_0029976_2886_3419 | 177 |
| 2676 | 3300048926 | Ga0496123_0041395 | Ga0496123_0041395_206_739 | 177 |
| 2677 | 3300048926 | Ga0496123_0100858 | Ga0496123_0100858_370_903 | 177 |
| 2678 | 3300048926 | Ga0496123_0135023 | Ga0496123_0135023_579_1112 | 177 |
| 2679 | 3300048926 | Ga0496123_0166396 | Ga0496123_0166396_586_1119 | 177 |
| 2680 | 3300048927 | Ga0496124_0004199 | Ga0496124_0004199_2011_2544 | 177 |
| 2681 | 3300048927 | Ga0496124_0004355 | Ga0496124_0004355_8068_8601 | 177 |
| 2682 | 3300048927 | Ga0496124_0004631 | Ga0496124_0004631_7411_7944 | 177 |
| 2683 | 3300048927 | Ga0496124_0051261 | Ga0496124_0051261_1232_1765 | 177 |
| 2684 | 3300048927 | Ga0496124_0116377 | Ga0496124_0116377_245_778 | 177 |
| 2685 | 3300048927 | Ga0496124_0177566 | Ga0496124_0177566_224_757 | 177 |
| 2686 | 3300048927 | Ga0496124_0180285 | Ga0496124_0180285_55_588 | 177 |
| 2687 | 3300048927 | Ga0496124_0182153 | Ga0496124_0182153_751_1284 | 177 |
| 2688 | 3300048927 | Ga0496124_0203903 | Ga0496124_0203903_269_802 | 177 |
| 2689 | 3300048927 | Ga0496124_0205157 | Ga0496124_0205157_809_1342 | 177 |
| 2690 | 3300048927 | Ga0496124_0235980 | Ga0496124_0235980_589_1122 | 177 |
| 2691 | 3300048927 | Ga0496124_0293249 | Ga0496124_0293249_543_1076 | 177 |
| 2692 | 3300048927 | Ga0496124_0293752 | Ga0496124_0293752_402_935 | 177 |
| 2693 | 3300048927 | Ga0496124_0507002 | Ga0496124_0507002_173_706 | 177 |
| 2694 | 3300048927 | Ga0496124_0731920 | Ga0496124_0731920_41_574 | 177 |
| 2695 | 3300048928 | Ga0496125_0000141 | Ga0496125_0000141_152663_153196 | 177 |
| 2696 | 3300048928 | Ga0496125_0063176 | Ga0496125_0063176_264_797 | 177 |
| 2697 | 3300048928 | Ga0496125_0103317 | Ga0496125_0103317_249_782 | 177 |
| 2698 | 3300048928 | Ga0496125_0114457 | Ga0496125_0114457_1021_1554 | 177 |
| 2699 | 3300048928 | Ga0496125_0126066 | Ga0496125_0126066_889_1422 | 177 |
| 2700 | 3300048928 | Ga0496125_0164647 | Ga0496125_0164647_768_1301 | 177 |
| 2701 | 3300048928 | Ga0496125_0165868 | Ga0496125_0165868_222_755 | 177 |
| 2702 | 3300048928 | Ga0496125_0234291 | Ga0496125_0234291_58_591 | 177 |
| 2703 | 3300048928 | Ga0496125_0289968 | Ga0496125_0289968_439_972 | 177 |
| 2704 | 3300048928 | Ga0496125_0327707 | Ga0496125_0327707_307_840 | 177 |
| 2705 | 3300048928 | Ga0496125_0435865 | Ga0496125_0435865_89_622 | 177 |
| 2706 | 3300048928 | Ga0496125_0499966 | Ga0496125_0499966_48_581 | 177 |
| 2707 | 3300048928 | Ga0496125_0526708 | Ga0496125_0526708_42_575 | 177 |
| 2708 | 3300048929 | Ga0496126_0027348 | Ga0496126_0027348_3089_3622 | 177 |
| 2709 | 3300048929 | Ga0496126_0106083 | Ga0496126_0106083_1585_2118 | 177 |
| 2710 | 3300048929 | Ga0496126_0157376 | Ga0496126_0157376_668_1201 | 177 |
| 2711 | 3300048929 | Ga0496126_0179786 | Ga0496126_0179786_342_875 | 177 |
| 2712 | 3300048929 | Ga0496126_0195531 | Ga0496126_0195531_600_1133 | 177 |
| 2713 | 3300048929 | Ga0496126_0209361 | Ga0496126_0209361_762_1295 | 177 |
| 2714 | 3300048929 | Ga0496126_0218163 | Ga0496126_0218163_469_1002 | 177 |
| 2715 | 3300048929 | Ga0496126_0311670 | Ga0496126_0311670_339_872 | 177 |
| 2716 | 3300048929 | Ga0496126_0315366 | Ga0496126_0315366_177_710 | 177 |
| 2717 | 3300048929 | Ga0496126_0370688 | Ga0496126_0370688_91_624 | 177 |
| 2718 | 3300048929 | Ga0496126_0426882 | Ga0496126_0426882_271_804 | 177 |
| 2719 | 3300048929 | Ga0496126_0568184 | Ga0496126_0568184_285_818 | 177 |
| 2720 | 3300048929 | Ga0496126_0627878 | Ga0496126_0627878_33_566 | 177 |
| 2721 | 3300048929 | Ga0496126_0683432 | Ga0496126_0683432_83_616 | 177 |
| 2722 | 3300049127 | Ga0501306_000444 | Ga0501306_000444_422_955 | 177 |
| 2723 | 3300049127 | Ga0501306_007899 | Ga0501306_007899_155_688 | 177 |
| 2724 | 3300049127 | Ga0501306_039073 | Ga0501306_039073_62_595 | 177 |
| 2725 | 3300049128 | Ga0501308_002370 | Ga0501308_002370_1098_1631 | 177 |
| 2726 | 3300049129 | Ga0501309_000912 | Ga0501309_000912_54_587 | 177 |
| 2727 | 3300049129 | Ga0501309_004872 | Ga0501309_004872_699_1232 | 177 |
| 2728 | 3300049130 | Ga0501310_010190 | Ga0501310_010190_170_703 | 177 |
| 2729 | 3300049130 | Ga0501310_011449 | Ga0501310_011449_165_698 | 177 |
| 2730 | 3300049130 | Ga0501310_013612 | Ga0501310_013612_323_856 | 177 |
| 2731 | 3300049130 | Ga0501310_032438 | Ga0501310_032438_27_560 | 177 |
| 2732 | 3300049160 | Ga0501304_003511 | Ga0501304_003511_284_817 | 177 |
| 2733 | 3300049161 | Ga0501305_003020 | Ga0501305_003020_885_1418 | 177 |
| 2734 | 3300049161 | Ga0501305_003176 | Ga0501305_003176_499_1032 | 177 |
| 2735 | 3300049161 | Ga0501305_009509 | Ga0501305_009509_698_1231 | 177 |
| 2736 | 3300049162 | Ga0501307_034945 | Ga0501307_034945_119_652 | 177 |
| 2737 | 3300049459 | Ga0495678_057051 | Ga0495678_057051_187_720 | 177 |
| 2738 | 3300049459 | Ga0495678_152901 | Ga0495678_152901_73_606 | 177 |
| 2739 | 3300049459 | Ga0495678_162925 | Ga0495678_162925_63_596 | 177 |
| 2740 | 3300049527 | Ga0501311_000194 | Ga0501311_000194_446_979 | 177 |
| 2741 | 3300049527 | Ga0501311_006601 | Ga0501311_006601_174_707 | 177 |
| 2742 | 3300049529 | Ga0501313_009901 | Ga0501313_009901_28_561 | 177 |
| 2743 | 3300049530 | Ga0501314_002564 | Ga0501314_002564_533_1066 | 177 |
| 2744 | 3300049530 | Ga0501314_002648 | Ga0501314_002648_208_741 | 177 |
| 2745 | 3300049530 | Ga0501314_008466 | Ga0501314_008466_184_717 | 177 |
| 2746 | 3300049531 | Ga0501315_000060 | Ga0501315_000060_857_1390 | 177 |
| 2747 | 3300049531 | Ga0501315_001308 | Ga0501315_001308_1518_2051 | 177 |
| 2748 | 3300049531 | Ga0501315_014320 | Ga0501315_014320_274_807 | 177 |
| 2749 | 3300049532 | Ga0501316_000132 | Ga0501316_000132_2709_3242 | 177 |
| 2750 | 3300049532 | Ga0501316_001097 | Ga0501316_001097_891_1424 | 177 |
| 2751 | 3300049533 | Ga0501317_000084 | Ga0501317_000084_1920_2453 | 177 |
| 2752 | 3300049533 | Ga0501317_000409 | Ga0501317_000409_1118_1651 | 177 |
| 2753 | 3300049533 | Ga0501317_017769 | Ga0501317_017769_136_669 | 177 |
| 2754 | 3300049534 | Ga0501318_000193 | Ga0501318_000193_1724_2257 | 177 |
| 2755 | 3300049535 | Ga0501319_005724 | Ga0501319_005724_185_718 | 177 |
| 2756 | 3300049535 | Ga0501319_006566 | Ga0501319_006566_25_558 | 177 |
| 2757 | 3300049536 | Ga0501320_005669 | Ga0501320_005669_599_1132 | 177 |
| 2758 | 3300049537 | Ga0501321_010209 | Ga0501321_010209_324_857 | 177 |
| 2759 | 3300049537 | Ga0501321_025502 | Ga0501321_025502_50_583 | 177 |
| 2760 | 3300049538 | Ga0501322_000140 | Ga0501322_000140_630_1163 | 177 |
| 2761 | 3300049539 | Ga0501323_006869 | Ga0501323_006869_215_748 | 177 |
| 2762 | 3300049540 | Ga0501324_013699 | Ga0501324_013699_160_693 | 177 |
| 2763 | 3300049540 | Ga0501324_014661 | Ga0501324_014661_135_668 | 177 |
| 2764 | 3300049550 | Ga0501334_06607 | Ga0501334_06607_217_750 | 177 |
| 2765 | 3300049568 | Ga0501031_0000651 | Ga0501031_0000651_12483_13016 | 177 |
| 2766 | 3300049568 | Ga0501031_0002703 | Ga0501031_0002703_2646_3179 | 177 |
| 2767 | 3300049568 | Ga0501031_0004402 | Ga0501031_0004402_2911_3444 | 177 |
| 2768 | 3300049568 | Ga0501031_0007624 | Ga0501031_0007624_1017_1550 | 177 |
| 2769 | 3300049568 | Ga0501031_0095082 | Ga0501031_0095082_1097_1630 | 177 |
| 2770 | 3300049569 | Ga0501032_0000111 | Ga0501032_0000111_7532_8065 | 177 |
| 2771 | 3300049569 | Ga0501032_0003488 | Ga0501032_0003488_4002_4535 | 177 |
| 2772 | 3300049569 | Ga0501032_0006160 | Ga0501032_0006160_2781_3314 | 177 |
| 2773 | 3300049569 | Ga0501032_0066026 | Ga0501032_0066026_1834_2367 | 177 |
| 2774 | 3300049569 | Ga0501032_0233067 | Ga0501032_0233067_593_1126 | 177 |
| 2775 | 3300049569 | Ga0501032_0319882 | Ga0501032_0319882_49_582 | 177 |
| 2776 | 3300049569 | Ga0501032_0686129 | Ga0501032_0686129_59_592 | 177 |
| 2777 | 3300049570 | Ga0501033_0000121 | Ga0501033_0000121_45850_46383 | 177 |
| 2778 | 3300049570 | Ga0501033_0006462 | Ga0501033_0006462_4863_5396 | 177 |
| 2779 | 3300049570 | Ga0501033_0007122 | Ga0501033_0007122_1506_2039 | 177 |
| 2780 | 3300049570 | Ga0501033_0010287 | Ga0501033_0010287_6149_6682 | 177 |
| 2781 | 3300049570 | Ga0501033_0011172 | Ga0501033_0011172_3693_4226 | 177 |
| 2782 | 3300049570 | Ga0501033_0015204 | Ga0501033_0015204_4763_5296 | 177 |
| 2783 | 3300049570 | Ga0501033_0079988 | Ga0501033_0079988_1780_2334 | 177 |
| 2784 | 3300049570 | Ga0501033_0080471 | Ga0501033_0080471_1103_1636 | 177 |
| 2785 | 3300049570 | Ga0501033_0087475 | Ga0501033_0087475_1696_2229 | 177 |
| 2786 | 3300049570 | Ga0501033_0511846 | Ga0501033_0511846_213_746 | 177 |
| 2787 | 3300049571 | Ga0501034_0000298 | Ga0501034_0000298_80135_80668 | 177 |
| 2788 | 3300049571 | Ga0501034_0004897 | Ga0501034_0004897_1758_2291 | 177 |
| 2789 | 3300049571 | Ga0501034_0006180 | Ga0501034_0006180_10265_10798 | 177 |
| 2790 | 3300049571 | Ga0501034_0009013 | Ga0501034_0009013_9135_9668 | 177 |
| 2791 | 3300049571 | Ga0501034_0012627 | Ga0501034_0012627_4435_4968 | 177 |
| 2792 | 3300049571 | Ga0501034_0014685 | Ga0501034_0014685_2371_2904 | 177 |
| 2793 | 3300049571 | Ga0501034_0030885 | Ga0501034_0030885_1302_1835 | 177 |
| 2794 | 3300049571 | Ga0501034_0031298 | Ga0501034_0031298_2407_2940 | 177 |
| 2795 | 3300049571 | Ga0501034_0073278 | Ga0501034_0073278_1784_2317 | 177 |
| 2796 | 3300049571 | Ga0501034_0209490 | Ga0501034_0209490_57_590 | 177 |
| 2797 | 3300049571 | Ga0501034_0386571 | Ga0501034_0386571_178_711 | 177 |
| 2798 | 3300049571 | Ga0501034_0420618 | Ga0501034_0420618_156_689 | 177 |
| 2799 | 3300049572 | Ga0501036_0000724 | Ga0501036_0000724_16727_17260 | 177 |
| 2800 | 3300049572 | Ga0501036_0002605 | Ga0501036_0002605_6159_6692 | 177 |
| 2801 | 3300049572 | Ga0501036_0025540 | Ga0501036_0025540_2370_2903 | 177 |
| 2802 | 3300049572 | Ga0501036_0194494 | Ga0501036_0194494_446_979 | 177 |
| 2803 | 3300049572 | Ga0501036_0236449 | Ga0501036_0236449_194_727 | 177 |
| 2804 | 3300049572 | Ga0501036_0256206 | Ga0501036_0256206_333_866 | 177 |
| 2805 | 3300049572 | Ga0501036_1008151 | Ga0501036_1008151_31_564 | 177 |
| 2806 | 3300049573 | Ga0501037_0000131 | Ga0501037_0000131_61738_62271 | 177 |
| 2807 | 3300049573 | Ga0501037_0000191 | Ga0501037_0000191_48813_49346 | 177 |
| 2808 | 3300049573 | Ga0501037_0000195 | Ga0501037_0000195_51040_51573 | 177 |
| 2809 | 3300049573 | Ga0501037_0006435 | Ga0501037_0006435_1798_2331 | 177 |
| 2810 | 3300049573 | Ga0501037_0270062 | Ga0501037_0270062_61_594 | 177 |
| 2811 | 3300049573 | Ga0501037_0838005 | Ga0501037_0838005_35_568 | 177 |
| 2812 | 3300049574 | Ga0501038_0000109 | Ga0501038_0000109_61738_62271 | 177 |
| 2813 | 3300049574 | Ga0501038_0001882 | Ga0501038_0001882_11302_11835 | 177 |
| 2814 | 3300049574 | Ga0501038_0005274 | Ga0501038_0005274_4002_4535 | 177 |
| 2815 | 3300049574 | Ga0501038_0047294 | Ga0501038_0047294_2219_2752 | 177 |
| 2816 | 3300049574 | Ga0501038_0158498 | Ga0501038_0158498_144_677 | 177 |
| 2817 | 3300049574 | Ga0501038_0468144 | Ga0501038_0468144_21_554 | 177 |
| 2818 | 3300049574 | Ga0501038_0702777 | Ga0501038_0702777_50_583 | 177 |
| 2819 | 3300049574 | Ga0501038_0757002 | Ga0501038_0757002_32_565 | 177 |
| 2820 | 3300049575 | Ga0501039_0000080 | Ga0501039_0000080_64500_65033 | 177 |
| 2821 | 3300049575 | Ga0501039_0002279 | Ga0501039_0002279_7532_8065 | 177 |
| 2822 | 3300049575 | Ga0501039_0032207 | Ga0501039_0032207_2082_2615 | 177 |
| 2823 | 3300049575 | Ga0501039_0077058 | Ga0501039_0077058_974_1507 | 177 |
| 2824 | 3300049575 | Ga0501039_0216355 | Ga0501039_0216355_25_558 | 177 |
| 2825 | 3300049575 | Ga0501039_0279144 | Ga0501039_0279144_70_603 | 177 |
| 2826 | 3300049575 | Ga0501039_0752592 | Ga0501039_0752592_190_723 | 177 |
| 2827 | 3300049576 | Ga0501040_0008666 | Ga0501040_0008666_3502_4035 | 177 |
| 2828 | 3300049576 | Ga0501040_0046602 | Ga0501040_0046602_1297_1830 | 177 |
| 2829 | 3300049576 | Ga0501040_0498267 | Ga0501040_0498267_237_770 | 177 |
| 2830 | 3300049577 | Ga0501041_0053535 | Ga0501041_0053535_990_1523 | 177 |
| 2831 | 3300049578 | Ga0501042_0060942 | Ga0501042_0060942_243_776 | 177 |
| 2832 | 3300049579 | Ga0501043_0000080 | Ga0501043_0000080_7494_8027 | 177 |
| 2833 | 3300049579 | Ga0501043_0004023 | Ga0501043_0004023_7487_8020 | 177 |
| 2834 | 3300049579 | Ga0501043_0015219 | Ga0501043_0015219_4780_5313 | 177 |
| 2835 | 3300049579 | Ga0501043_0024392 | Ga0501043_0024392_1798_2331 | 177 |
| 2836 | 3300049579 | Ga0501043_0052836 | Ga0501043_0052836_1211_1765 | 177 |
| 2837 | 3300049579 | Ga0501043_0256680 | Ga0501043_0256680_338_871 | 177 |
| 2838 | 3300049579 | Ga0501043_0574453 | Ga0501043_0574453_230_763 | 177 |
| 2839 | 3300049579 | Ga0501043_0712068 | Ga0501043_0712068_46_579 | 177 |
| 2840 | 3300049580 | Ga0501046_0018165 | Ga0501046_0018165_2550_3083 | 177 |
| 2841 | 3300049580 | Ga0501046_0048594 | Ga0501046_0048594_570_1124 | 177 |
| 2842 | 3300049580 | Ga0501046_0363102 | Ga0501046_0363102_305_838 | 177 |
| 2843 | 3300049581 | Ga0501047_0011259 | Ga0501047_0011259_6136_6669 | 177 |
| 2844 | 3300049581 | Ga0501047_0017299 | Ga0501047_0017299_232_765 | 177 |
| 2845 | 3300049581 | Ga0501047_0025104 | Ga0501047_0025104_427_960 | 177 |
| 2846 | 3300049581 | Ga0501047_0040375 | Ga0501047_0040375_65_598 | 177 |
| 2847 | 3300049581 | Ga0501047_0080199 | Ga0501047_0080199_1799_2332 | 177 |
| 2848 | 3300049581 | Ga0501047_0106587 | Ga0501047_0106587_1322_1855 | 177 |
| 2849 | 3300049581 | Ga0501047_0135845 | Ga0501047_0135845_570_1124 | 177 |
| 2850 | 3300049581 | Ga0501047_0224418 | Ga0501047_0224418_326_859 | 177 |
| 2851 | 3300049581 | Ga0501047_0235624 | Ga0501047_0235624_208_741 | 177 |
| 2852 | 3300049581 | Ga0501047_0549634 | Ga0501047_0549634_230_763 | 177 |
| 2853 | 3300049581 | Ga0501047_0911058 | Ga0501047_0911058_87_620 | 177 |
| 2854 | 3300049582 | Ga0501048_0030318 | Ga0501048_0030318_180_713 | 177 |
| 2855 | 3300049582 | Ga0501048_0235219 | Ga0501048_0235219_24_557 | 177 |
| 2856 | 3300049582 | Ga0501048_0639197 | Ga0501048_0639197_52_606 | 177 |
| 2857 | 3300049583 | Ga0501067_0054293 | Ga0501067_0054293_1588_2121 | 177 |
| 2858 | 3300049583 | Ga0501067_0059220 | Ga0501067_0059220_806_1339 | 177 |
| 2859 | 3300049583 | Ga0501067_0211083 | Ga0501067_0211083_207_740 | 177 |
| 2860 | 3300049584 | Ga0501068_0022655 | Ga0501068_0022655_2369_2902 | 177 |
| 2861 | 3300049584 | Ga0501068_0211224 | Ga0501068_0211224_449_982 | 177 |
| 2862 | 3300049585 | Ga0501069_0000172 | Ga0501069_0000172_25998_26531 | 177 |
| 2863 | 3300049585 | Ga0501069_0045997 | Ga0501069_0045997_809_1342 | 177 |
| 2864 | 3300049585 | Ga0501069_0059883 | Ga0501069_0059883_1076_1609 | 177 |
| 2865 | 3300049585 | Ga0501069_0157705 | Ga0501069_0157705_186_719 | 177 |
| 2866 | 3300049586 | Ga0501070_0001286 | Ga0501070_0001286_9393_9926 | 177 |
| 2867 | 3300049586 | Ga0501070_0006301 | Ga0501070_0006301_2103_2636 | 177 |
| 2868 | 3300049586 | Ga0501070_0015591 | Ga0501070_0015591_1162_1695 | 177 |
| 2869 | 3300049586 | Ga0501070_0018655 | Ga0501070_0018655_4404_4937 | 177 |
| 2870 | 3300049586 | Ga0501070_0052211 | Ga0501070_0052211_882_1415 | 177 |
| 2871 | 3300049586 | Ga0501070_0296563 | Ga0501070_0296563_696_1229 | 177 |
| 2872 | 3300049586 | Ga0501070_0634142 | Ga0501070_0634142_292_825 | 177 |
| 2873 | 3300049586 | Ga0501070_0798960 | Ga0501070_0798960_110_643 | 177 |
| 2874 | 3300049586 | Ga0501070_0897266 | Ga0501070_0897266_129_662 | 177 |
| 2875 | 3300049587 | Ga0501071_0050678 | Ga0501071_0050678_1416_1949 | 177 |
| 2876 | 3300049588 | Ga0501072_0117144 | Ga0501072_0117144_764_1297 | 177 |
| 2877 | 3300049589 | Ga0501073_0018884 | Ga0501073_0018884_1947_2480 | 177 |
| 2878 | 3300049589 | Ga0501073_0032628 | Ga0501073_0032628_2934_3467 | 177 |
| 2879 | 3300049589 | Ga0501073_0047706 | Ga0501073_0047706_2419_2952 | 177 |
| 2880 | 3300049589 | Ga0501073_0392284 | Ga0501073_0392284_151_684 | 177 |
| 2881 | 3300049590 | Ga0501074_0002583 | Ga0501074_0002583_7473_8006 | 177 |
| 2882 | 3300049590 | Ga0501074_0040640 | Ga0501074_0040640_1284_1817 | 177 |
| 2883 | 3300049590 | Ga0501074_0368918 | Ga0501074_0368918_337_870 | 177 |
| 2884 | 3300049590 | Ga0501074_0528040 | Ga0501074_0528040_85_618 | 177 |
| 2885 | 3300049592 | Ga0501076_0588821 | Ga0501076_0588821_214_747 | 177 |
| 2886 | 3300049671 | Ga0501238_015849 | Ga0501238_015849_224_757 | 177 |
| 2887 | 3300049741 | Ga0501079_0143858 | Ga0501079_0143858_140_673 | 177 |
| 2888 | 3300049742 | Ga0501080_0003453 | Ga0501080_0003453_2166_2699 | 177 |
| 2889 | 3300049742 | Ga0501080_0004752 | Ga0501080_0004752_3448_3981 | 177 |
| 2890 | 3300049742 | Ga0501080_0020715 | Ga0501080_0020715_290_823 | 177 |
| 2891 | 3300049742 | Ga0501080_0603270 | Ga0501080_0603270_411_944 | 177 |
| 2892 | 3300049742 | Ga0501080_0681820 | Ga0501080_0681820_252_785 | 177 |
| 2893 | 3300049744 | Ga0501083_0001214 | Ga0501083_0001214_9425_9958 | 177 |
| 2894 | 3300049744 | Ga0501083_0012045 | Ga0501083_0012045_5271_5804 | 177 |
| 2895 | 3300049744 | Ga0501083_0027007 | Ga0501083_0027007_799_1332 | 177 |
| 2896 | 3300049744 | Ga0501083_0366141 | Ga0501083_0366141_155_709 | 177 |
| 2897 | 3300049758 | Ga0501241_009543 | Ga0501241_009543_224_757 | 177 |
| 2898 | 3300049776 | Ga0501280_003866 | Ga0501280_003866_1660_2193 | 177 |
| 2899 | 3300049822 | Ga0501035_0000160 | Ga0501035_0000160_7477_8010 | 177 |
| 2900 | 3300049822 | Ga0501035_0000167 | Ga0501035_0000167_2572_3105 | 177 |
| 2901 | 3300049822 | Ga0501035_0000347 | Ga0501035_0000347_51079_51612 | 177 |
| 2902 | 3300049822 | Ga0501035_0002188 | Ga0501035_0002188_11302_11835 | 177 |
| 2903 | 3300049822 | Ga0501035_0005457 | Ga0501035_0005457_11327_11860 | 177 |
| 2904 | 3300049822 | Ga0501035_0009004 | Ga0501035_0009004_5107_5640 | 177 |
| 2905 | 3300049822 | Ga0501035_0009166 | Ga0501035_0009166_4944_5477 | 177 |
| 2906 | 3300049822 | Ga0501035_0022061 | Ga0501035_0022061_798_1331 | 177 |
| 2907 | 3300049822 | Ga0501035_0093710 | Ga0501035_0093710_449_982 | 177 |
| 2908 | 3300049822 | Ga0501035_0174152 | Ga0501035_0174152_1084_1617 | 177 |
| 2909 | 3300049822 | Ga0501035_0190500 | Ga0501035_0190500_154_687 | 177 |
| 2910 | 3300049822 | Ga0501035_0208235 | Ga0501035_0208235_701_1234 | 177 |
| 2911 | 3300049822 | Ga0501035_0508070 | Ga0501035_0508070_318_851 | 177 |
| 2912 | 3300049822 | Ga0501035_0851207 | Ga0501035_0851207_59_592 | 177 |
| 2913 | 3300049823 | Ga0501044_0000234 | Ga0501044_0000234_61738_62271 | 177 |
| 2914 | 3300049823 | Ga0501044_0000544 | Ga0501044_0000544_40888_41421 | 177 |
| 2915 | 3300049823 | Ga0501044_0009229 | Ga0501044_0009229_7564_8097 | 177 |
| 2916 | 3300049823 | Ga0501044_0022577 | Ga0501044_0022577_3649_4182 | 177 |
| 2917 | 3300049823 | Ga0501044_0050656 | Ga0501044_0050656_655_1188 | 177 |
| 2918 | 3300049823 | Ga0501044_0059863 | Ga0501044_0059863_878_1411 | 177 |
| 2919 | 3300049823 | Ga0501044_0062595 | Ga0501044_0062595_949_1482 | 177 |
| 2920 | 3300049823 | Ga0501044_0076474 | Ga0501044_0076474_1852_2385 | 177 |
| 2921 | 3300049823 | Ga0501044_0092919 | Ga0501044_0092919_17_550 | 177 |
| 2922 | 3300049823 | Ga0501044_0106357 | Ga0501044_0106357_207_740 | 177 |
| 2923 | 3300049823 | Ga0501044_0229111 | Ga0501044_0229111_25_558 | 177 |
| 2924 | 3300049823 | Ga0501044_0233590 | Ga0501044_0233590_220_753 | 177 |
| 2925 | 3300049823 | Ga0501044_0463333 | Ga0501044_0463333_33_566 | 177 |
| 2926 | 3300049823 | Ga0501044_0644986 | Ga0501044_0644986_129_662 | 177 |
| 2927 | 3300049824 | Ga0501045_0001715 | Ga0501045_0001715_8949_9482 | 177 |
| 2928 | 3300049824 | Ga0501045_0334010 | Ga0501045_0334010_254_787 | 177 |
| 2929 | 3300049824 | Ga0501045_0786164 | Ga0501045_0786164_156_689 | 177 |
| 2930 | 3300049850 | Ga0501204_025851 | Ga0501204_025851_73_606 | 177 |
| 2931 | 3300050489 | nmdc:mga03683_177435_c1 | nmdc:mga03683_177435_c1_84_617 | 177 |
| 2932 | 3300050489 | nmdc:mga03683_25558_c1 | nmdc:mga03683_25558_c1_811_1344 | 177 |
| 2933 | 3300050489 | nmdc:mga03683_348988_c1 | nmdc:mga03683_348988_c1_13_546 | 177 |
| 2934 | 3300050490 | nmdc:mga03n38_15142_c1 | nmdc:mga03n38_15142_c1_1855_2388 | 177 |
| 2935 | 3300050490 | nmdc:mga03n38_167867_c1 | nmdc:mga03n38_167867_c1_190_723 | 177 |
| 2936 | 3300050490 | nmdc:mga03n38_408113_c1 | nmdc:mga03n38_408113_c1_168_701 | 177 |
| 2937 | 3300050490 | nmdc:mga03n38_564306_c1 | nmdc:mga03n38_564306_c1_49_582 | 177 |
| 2938 | 3300050490 | nmdc:mga03n38_83412_c2 | nmdc:mga03n38_83412_c2_84_617 | 177 |
| 2939 | 3300050491 | nmdc:mga00v17_1284_c1 | nmdc:mga00v17_1284_c1_9988_10521 | 177 |
| 2940 | 3300050491 | nmdc:mga00v17_243765_c1 | nmdc:mga00v17_243765_c1_576_1109 | 177 |
| 2941 | 3300050491 | nmdc:mga00v17_257607_c1 | nmdc:mga00v17_257607_c1_379_912 | 177 |
| 2942 | 3300050491 | nmdc:mga00v17_26923_c1 | nmdc:mga00v17_26923_c1_1042_1575 | 177 |
| 2943 | 3300050491 | nmdc:mga00v17_818324_c1 | nmdc:mga00v17_818324_c1_35_568 | 177 |
| 2944 | 3300050492 | nmdc:mga0yw44_126980_c1 | nmdc:mga0yw44_126980_c1_573_1106 | 177 |
| 2945 | 3300050492 | nmdc:mga0yw44_167639_c1 | nmdc:mga0yw44_167639_c1_144_677 | 177 |
| 2946 | 3300050492 | nmdc:mga0yw44_174646_c1 | nmdc:mga0yw44_174646_c1_505_1038 | 177 |
| 2947 | 3300050492 | nmdc:mga0yw44_175118_c1 | nmdc:mga0yw44_175118_c1_251_784 | 177 |
| 2948 | 3300050492 | nmdc:mga0yw44_231648_c1 | nmdc:mga0yw44_231648_c1_551_1084 | 177 |
| 2949 | 3300050492 | nmdc:mga0yw44_24060_c1 | nmdc:mga0yw44_24060_c1_2498_3031 | 177 |
| 2950 | 3300050492 | nmdc:mga0yw44_29953_c1 | nmdc:mga0yw44_29953_c1_2077_2610 | 177 |
| 2951 | 3300050492 | nmdc:mga0yw44_3148_c2 | nmdc:mga0yw44_3148_c2_936_1469 | 177 |
| 2952 | 3300050492 | nmdc:mga0yw44_53959_c1 | nmdc:mga0yw44_53959_c1_953_1486 | 177 |
| 2953 | 3300050492 | nmdc:mga0yw44_57394_c1 | nmdc:mga0yw44_57394_c1_104_637 | 177 |
| 2954 | 3300050492 | nmdc:mga0yw44_622060_c1 | nmdc:mga0yw44_622060_c1_174_707 | 177 |
| 2955 | 3300050492 | nmdc:mga0yw44_68829_c1 | nmdc:mga0yw44_68829_c1_529_1062 | 177 |
| 2956 | 3300050493 | nmdc:mga0k408_20070_c1 | nmdc:mga0k408_20070_c1_1667_2200 | 177 |
| 2957 | 3300050493 | nmdc:mga0k408_240627_c1 | nmdc:mga0k408_240627_c1_495_1028 | 177 |
| 2958 | 3300050493 | nmdc:mga0k408_263196_c1 | nmdc:mga0k408_263196_c1_469_1002 | 177 |
| 2959 | 3300050493 | nmdc:mga0k408_439977_c1 | nmdc:mga0k408_439977_c1_166_699 | 177 |
| 2960 | 3300050494 | nmdc:mga06z11_118295_c1 | nmdc:mga06z11_118295_c1_867_1400 | 177 |
| 2961 | 3300050494 | nmdc:mga06z11_167200_c1 | nmdc:mga06z11_167200_c1_173_706 | 177 |
| 2962 | 3300050494 | nmdc:mga06z11_384457_c1 | nmdc:mga06z11_384457_c1_88_621 | 177 |
| 2963 | 3300050494 | nmdc:mga06z11_471270_c1 | nmdc:mga06z11_471270_c1_144_677 | 177 |
| 2964 | 3300050494 | nmdc:mga06z11_70427_c1 | nmdc:mga06z11_70427_c1_518_1051 | 177 |
| 2965 | 3300050494 | nmdc:mga06z11_76642_c2 | nmdc:mga06z11_76642_c2_846_1379 | 177 |
| 2966 | 3300050495 | nmdc:mga04h51_20498_c1 | nmdc:mga04h51_20498_c1_928_1461 | 177 |
| 2967 | 3300050495 | nmdc:mga04h51_40208_c1 | nmdc:mga04h51_40208_c1_904_1437 | 177 |
| 2968 | 3300050495 | nmdc:mga04h51_80770_c1 | nmdc:mga04h51_80770_c1_448_981 | 177 |
| 2969 | 3300050496 | nmdc:mga07m45_187182_c1 | nmdc:mga07m45_187182_c1_26_559 | 177 |
| 2970 | 3300050496 | nmdc:mga07m45_199906_c1 | nmdc:mga07m45_199906_c1_86_619 | 177 |
| 2971 | 3300050496 | nmdc:mga07m45_292431_c1 | nmdc:mga07m45_292431_c1_355_888 | 177 |
| 2972 | 3300050496 | nmdc:mga07m45_480802_c1 | nmdc:mga07m45_480802_c1_130_663 | 177 |
| 2973 | 3300050496 | nmdc:mga07m45_65659_c1 | nmdc:mga07m45_65659_c1_609_1142 | 177 |
| 2974 | 3300050496 | nmdc:mga07m45_68266_c1 | nmdc:mga07m45_68266_c1_885_1418 | 177 |
| 2975 | 3300050496 | nmdc:mga07m45_87948_c1 | nmdc:mga07m45_87948_c1_175_708 | 177 |
| 2976 | 3300050508 | nmdc:mga09592_1193976_c1 | nmdc:mga09592_1193976_c1_33_566 | 177 |
| 2977 | 3300050509 | nmdc:mga0qj67_328369_c1 | nmdc:mga0qj67_328369_c1_657_1190 | 177 |
| 2978 | 3300050512 | nmdc:mga0n895_442643_c1 | nmdc:mga0n895_442643_c1_121_654 | 177 |
| 2979 | 3300050512 | nmdc:mga0n895_5268_c1 | nmdc:mga0n895_5268_c1_345_878 | 177 |
| 2980 | 3300050513 | nmdc:mga0rr50_615796_c1 | nmdc:mga0rr50_615796_c1_324_857 | 177 |
| 2981 | 3300050516 | nmdc:mga0sz30_130156_c1 | nmdc:mga0sz30_130156_c1_378_911 | 177 |
| 2982 | 3300050516 | nmdc:mga0sz30_132964_c1 | nmdc:mga0sz30_132964_c1_362_895 | 177 |
| 2983 | 3300050516 | nmdc:mga0sz30_146402_c1 | nmdc:mga0sz30_146402_c1_48_581 | 177 |
| 2984 | 3300050516 | nmdc:mga0sz30_17788_c1 | nmdc:mga0sz30_17788_c1_685_1218 | 177 |
| 2985 | 3300050516 | nmdc:mga0sz30_236683_c1 | nmdc:mga0sz30_236683_c1_136_669 | 177 |
| 2986 | 3300050516 | nmdc:mga0sz30_24769_c1 | nmdc:mga0sz30_24769_c1_1145_1678 | 177 |
| 2987 | 3300053077 | Ga0495601_0056376 | Ga0495601_0056376_898_1431 | 177 |
| 2988 | 3300053077 | Ga0495601_0158728 | Ga0495601_0158728_910_1443 | 177 |
| 2989 | 3300053077 | Ga0495601_0234530 | Ga0495601_0234530_130_663 | 177 |
| 2990 | 3300053078 | Ga0495612_0052075 | Ga0495612_0052075_249_782 | 177 |
| 2991 | 3300053078 | Ga0495612_0137090 | Ga0495612_0137090_66_599 | 177 |
| 2992 | 3300053079 | Ga0500610_0086740 | Ga0500610_0086740_809_1342 | 177 |
| 2993 | 3300053079 | Ga0500610_0102190 | Ga0500610_0102190_445_978 | 177 |
| 2994 | 3300053080 | Ga0500635_0095247 | Ga0500635_0095247_243_776 | 177 |
| 2995 | 3300053083 | Ga0495655_0013054 | Ga0495655_0013054_1002_1535 | 177 |
| 2996 | 3300053083 | Ga0495655_0033255 | Ga0495655_0033255_64_597 | 177 |
| 2997 | 3300053084 | Ga0495595_0006801 | Ga0495595_0006801_122_655 | 177 |
| 2998 | 3300053085 | Ga0495619_0001443 | Ga0495619_0001443_13238_13771 | 177 |
| 2999 | 3300053086 | Ga0500578_0014351 | Ga0500578_0014351_116_649 | 177 |
| 3000 | 3300053086 | Ga0500578_0015697 | Ga0500578_0015697_388_921 | 177 |
| 3001 | 3300053086 | Ga0500578_0084328 | Ga0500578_0084328_996_1529 | 177 |
| 3002 | 3300053086 | Ga0500578_0178822 | Ga0500578_0178822_187_720 | 177 |
| 3003 | 3300053087 | Ga0500643_021452 | Ga0500643_021452_194_727 | 177 |
| 3004 | 3300053088 | Ga0500644_0008515 | Ga0500644_0008515_1842_2375 | 177 |
| 3005 | 3300053088 | Ga0500644_0268444 | Ga0500644_0268444_29_562 | 177 |
| 3006 | 3300053090 | Ga0500646_0013276 | Ga0500646_0013276_94_627 | 177 |
| 3007 | 3300053090 | Ga0500646_0187275 | Ga0500646_0187275_60_593 | 177 |
| 3008 | 3300053091 | Ga0500647_0082642 | Ga0500647_0082642_593_1126 | 177 |
| 3009 | 3300053092 | Ga0500583_0251208 | Ga0500583_0251208_278_811 | 177 |
| 3010 | 3300053093 | Ga0500651_0021718 | Ga0500651_0021718_1180_1713 | 177 |
| 3011 | 3300053093 | Ga0500651_0224117 | Ga0500651_0224117_311_844 | 177 |
| 3012 | 3300053093 | Ga0500651_0268116 | Ga0500651_0268116_130_663 | 177 |
| 3013 | 3300053093 | Ga0500651_0286415 | Ga0500651_0286415_73_606 | 177 |
| 3014 | 3300053094 | Ga0500566_0000320 | Ga0500566_0000320_17540_18073 | 177 |
| 3015 | 3300053094 | Ga0500566_0361817 | Ga0500566_0361817_17_550 | 177 |
| 3016 | 3300053095 | Ga0500640_031882 | Ga0500640_031882_632_1165 | 177 |
| 3017 | 3300053096 | Ga0500641_0003415 | Ga0500641_0003415_3449_3982 | 177 |
| 3018 | 3300053098 | Ga0500650_0001944 | Ga0500650_0001944_1134_1667 | 177 |
| 3019 | 3300053098 | Ga0500650_0275431 | Ga0500650_0275431_120_653 | 177 |
| 3020 | 3300053099 | Ga0500654_132521 | Ga0500654_132521_271_807 | 177 |
| 3021 | 3300053102 | Ga0500554_085161 | Ga0500554_085161_496_1029 | 177 |
| 3022 | 3300053102 | Ga0500554_103480 | Ga0500554_103480_396_929 | 177 |
| 3023 | 3300053103 | Ga0500555_030794 | Ga0500555_030794_320_853 | 177 |
| 3024 | 3300053103 | Ga0500555_096216 | Ga0500555_096216_38_574 | 177 |
| 3025 | 3300053104 | Ga0500556_0000125 | Ga0500556_0000125_57706_58239 | 177 |
| 3026 | 3300053104 | Ga0500556_0301825 | Ga0500556_0301825_49_582 | 177 |
| 3027 | 3300053105 | Ga0500557_156065 | Ga0500557_156065_88_621 | 177 |
| 3028 | 3300053108 | Ga0500562_029407 | Ga0500562_029407_347_880 | 177 |
| 3029 | 3300053108 | Ga0500562_051142 | Ga0500562_051142_188_721 | 177 |
| 3030 | 3300053109 | Ga0500569_015781 | Ga0500569_015781_369_902 | 177 |
| 3031 | 3300053109 | Ga0500569_123083 | Ga0500569_123083_139_672 | 177 |
| 3032 | 3300053111 | Ga0500572_001453 | Ga0500572_001453_527_1060 | 177 |
| 3033 | 3300053111 | Ga0500572_003008 | Ga0500572_003008_819_1352 | 177 |
| 3034 | 3300053111 | Ga0500572_004079 | Ga0500572_004079_549_1082 | 177 |
| 3035 | 3300053116 | Ga0500592_012356 | Ga0500592_012356_520_1053 | 177 |
| 3036 | 3300053118 | Ga0500594_0003742 | Ga0500594_0003742_1232_1765 | 177 |
| 3037 | 3300053118 | Ga0500594_0128286 | Ga0500594_0128286_50_583 | 177 |
| 3038 | 3300053119 | Ga0500595_016409 | Ga0500595_016409_817_1350 | 177 |
| 3039 | 3300053119 | Ga0500595_029914 | Ga0500595_029914_1119_1652 | 177 |
| 3040 | 3300053119 | Ga0500595_070086 | Ga0500595_070086_438_971 | 177 |
| 3041 | 3300053121 | Ga0500607_099409 | Ga0500607_099409_477_1010 | 177 |
| 3042 | 3300053122 | Ga0500608_075094 | Ga0500608_075094_898_1431 | 177 |
| 3043 | 3300053123 | Ga0500614_014604 | Ga0500614_014604_598_1131 | 177 |
| 3044 | 3300053123 | Ga0500614_148761 | Ga0500614_148761_91_624 | 177 |
| 3045 | 3300053125 | Ga0500618_007381 | Ga0500618_007381_63_596 | 177 |
| 3046 | 3300053125 | Ga0500618_021998 | Ga0500618_021998_830_1363 | 177 |
| 3047 | 3300053125 | Ga0500618_048846 | Ga0500618_048846_128_661 | 177 |
| 3048 | 3300053128 | Ga0500626_191428 | Ga0500626_191428_272_805 | 177 |
| 3049 | 3300053130 | Ga0500642_0000105 | Ga0500642_0000105_7571_8104 | 177 |
| 3050 | 3300053131 | Ga0500652_000301 | Ga0500652_000301_11352_11885 | 177 |
| 3051 | 3300053133 | Ga0500655_069503 | Ga0500655_069503_136_669 | 177 |
| 3052 | 3300053134 | Ga0500658_0041978 | Ga0500658_0041978_905_1438 | 177 |
| 3053 | 3300053134 | Ga0500658_0132638 | Ga0500658_0132638_326_859 | 177 |
| 3054 | 3300053134 | Ga0500658_0163884 | Ga0500658_0163884_377_910 | 177 |
| 3055 | 3300053136 | Ga0500559_0002803 | Ga0500559_0002803_2435_2968 | 177 |
| 3056 | 3300053136 | Ga0500559_0004117 | Ga0500559_0004117_5621_6154 | 177 |
| 3057 | 3300053136 | Ga0500559_0094839 | Ga0500559_0094839_230_763 | 177 |
| 3058 | 3300053138 | Ga0500564_189623 | Ga0500564_189623_44_577 | 177 |
| 3059 | 3300053139 | Ga0500568_0001953 | Ga0500568_0001953_4513_5127 | 177 |
| 3060 | 3300053139 | Ga0500568_0003848 | Ga0500568_0003848_3720_4253 | 177 |
| 3061 | 3300053139 | Ga0500568_0050784 | Ga0500568_0050784_856_1389 | 177 |
| 3062 | 3300053139 | Ga0500568_0054507 | Ga0500568_0054507_247_780 | 177 |
| 3063 | 3300053139 | Ga0500568_0060124 | Ga0500568_0060124_48_581 | 177 |
| 3064 | 3300053140 | Ga0500573_0051024 | Ga0500573_0051024_1131_1664 | 177 |
| 3065 | 3300053142 | Ga0500577_0083822 | Ga0500577_0083822_711_1244 | 177 |
| 3066 | 3300053145 | Ga0500586_000283 | Ga0500586_000283_2641_3174 | 177 |
| 3067 | 3300053146 | Ga0500588_0027678 | Ga0500588_0027678_763_1296 | 177 |
| 3068 | 3300053148 | Ga0500590_019927 | Ga0500590_019927_1710_2243 | 177 |
| 3069 | 3300053148 | Ga0500590_082463 | Ga0500590_082463_80_613 | 177 |
| 3070 | 3300053150 | Ga0500603_009617 | Ga0500603_009617_632_1165 | 177 |
| 3071 | 3300053151 | Ga0500604_0036252 | Ga0500604_0036252_372_905 | 177 |
| 3072 | 3300053151 | Ga0500604_0049762 | Ga0500604_0049762_15_548 | 177 |
| 3073 | 3300053153 | Ga0500616_0000876 | Ga0500616_0000876_25064_25597 | 177 |
| 3074 | 3300053153 | Ga0500616_0004053 | Ga0500616_0004053_7761_8294 | 177 |
| 3075 | 3300053153 | Ga0500616_0015762 | Ga0500616_0015762_337_870 | 177 |
| 3076 | 3300053153 | Ga0500616_0023156 | Ga0500616_0023156_1062_1595 | 177 |
| 3077 | 3300053153 | Ga0500616_0037795 | Ga0500616_0037795_393_926 | 177 |
| 3078 | 3300053153 | Ga0500616_0091357 | Ga0500616_0091357_146_679 | 177 |
| 3079 | 3300053153 | Ga0500616_0140697 | Ga0500616_0140697_153_686 | 177 |
| 3080 | 3300053155 | Ga0500620_001784 | Ga0500620_001784_2386_2919 | 177 |
| 3081 | 3300053155 | Ga0500620_106040 | Ga0500620_106040_299_832 | 177 |
| 3082 | 3300053156 | Ga0500622_0001277 | Ga0500622_0001277_16468_17001 | 177 |
| 3083 | 3300053156 | Ga0500622_0004034 | Ga0500622_0004034_5819_6352 | 177 |
| 3084 | 3300053156 | Ga0500622_0071766 | Ga0500622_0071766_863_1396 | 177 |
| 3085 | 3300053157 | Ga0500624_003843 | Ga0500624_003843_1090_1623 | 177 |
| 3086 | 3300053157 | Ga0500624_014638 | Ga0500624_014638_458_994 | 177 |
| 3087 | 3300053158 | Ga0500627_0004443 | Ga0500627_0004443_1984_2517 | 177 |
| 3088 | 3300053158 | Ga0500627_0057865 | Ga0500627_0057865_546_1079 | 177 |
| 3089 | 3300053158 | Ga0500627_0064661 | Ga0500627_0064661_723_1256 | 177 |
| 3090 | 3300053158 | Ga0500627_0075227 | Ga0500627_0075227_257_790 | 177 |
| 3091 | 3300053158 | Ga0500627_0228549 | Ga0500627_0228549_164_697 | 177 |
| 3092 | 3300053159 | Ga0500630_030399 | Ga0500630_030399_444_977 | 177 |
| 3093 | 3300053160 | Ga0500633_0133711 | Ga0500633_0133711_51_584 | 177 |
| 3094 | 3300053160 | Ga0500633_0148145 | Ga0500633_0148145_113_646 | 177 |
| 3095 | 3300053161 | Ga0500634_0094521 | Ga0500634_0094521_654_1187 | 177 |
| 3096 | 3300053162 | Ga0500638_135474 | Ga0500638_135474_478_1011 | 177 |
| 3097 | 3300053162 | Ga0500638_202755 | Ga0500638_202755_222_755 | 177 |
| 3098 | 3300053163 | Ga0500639_002134 | Ga0500639_002134_3939_4472 | 177 |
| 3099 | 3300053163 | Ga0500639_099603 | Ga0500639_099603_645_1178 | 177 |
| 3100 | 3300053177 | Ga0500636_0004057 | Ga0500636_0004057_6794_7327 | 177 |
| 3101 | 3300053177 | Ga0500636_0105133 | Ga0500636_0105133_126_659 | 177 |
| 3102 | 3300053177 | Ga0500636_0122353 | Ga0500636_0122353_829_1362 | 177 |
| 3103 | 3300053177 | Ga0500636_0210649 | Ga0500636_0210649_408_941 | 177 |
| 3104 | 3300053177 | Ga0500636_0241209 | Ga0500636_0241209_45_578 | 177 |
| 3105 | 3300053178 | Ga0500637_0022986 | Ga0500637_0022986_1262_1795 | 177 |
| 3106 | 3300053178 | Ga0500637_0073848 | Ga0500637_0073848_1406_1939 | 177 |
| 3107 | 3300053723 | Ga0500567_099548 | Ga0500567_099548_249_782 | 177 |
| 3108 | 3300053727 | Ga0500611_000533 | Ga0500611_000533_2942_3475 | 177 |
| 3109 | 3300053727 | Ga0500611_017745 | Ga0500611_017745_191_724 | 177 |
| 3110 | 3300053730 | Ga0500645_012887 | Ga0500645_012887_425_958 | 177 |
| 3111 | 3300053730 | Ga0500645_095920 | Ga0500645_095920_103_636 | 177 |
| 3112 | 3300053730 | Ga0500645_100114 | Ga0500645_100114_75_686 | 177 |
| 3113 | 3300053731 | Ga0500609_001189 | Ga0500609_001189_1157_1690 | 177 |
| 3114 | 3300053731 | Ga0500609_012600 | Ga0500609_012600_273_806 | 177 |
| 3115 | 3300053733 | Ga0500552_001810 | Ga0500552_001810_1242_1775 | 177 |
| 3116 | 3300053735 | Ga0500596_002522 | Ga0500596_002522_1514_2047 | 177 |
| 3117 | 3300053735 | Ga0500596_002612 | Ga0500596_002612_18_551 | 177 |
| 3118 | 3300053735 | Ga0500596_005669 | Ga0500596_005669_497_1030 | 177 |
| 3119 | 3300053737 | Ga0500601_000668 | Ga0500601_000668_845_1378 | 177 |
| 3120 | 3300054114 | Ga0501084_0208952 | Ga0501084_0208952_21_554 | 177 |
| 3121 | 3300059477 | Ga0587084_002030 | Ga0587084_002030_1450_1983 | 177 |
| 3122 | 3300059477 | Ga0587084_020477 | Ga0587084_020477_107_640 | 177 |
| 3123 | 3300059477 | Ga0587084_027157 | Ga0587084_027157_52_585 | 177 |
| 3124 | 3300059477 | Ga0587084_065251 | Ga0587084_065251_25_558 | 177 |
| 3125 | 3300059478 | Ga0587093_006135 | Ga0587093_006135_352_885 | 177 |
| 3126 | 3300059478 | Ga0587093_025816 | Ga0587093_025816_140_673 | 177 |
| 3127 | 3300059490 | Ga0587066_016961 | Ga0587066_016961_99_632 | 177 |
| 3128 | 3300059490 | Ga0587066_025694 | Ga0587066_025694_223_756 | 177 |
| 3129 | 3300059490 | Ga0587066_049213 | Ga0587066_049213_36_569 | 177 |
| 3130 | 3300059490 | Ga0587066_092013 | Ga0587066_092013_27_560 | 177 |
| 3131 | 3300059491 | Ga0587070_003021 | Ga0587070_003021_958_1491 | 177 |
| 3132 | 3300059491 | Ga0587070_021067 | Ga0587070_021067_221_754 | 177 |
| 3133 | 3300059491 | Ga0587070_028503 | Ga0587070_028503_268_801 | 177 |
| 3134 | 3300059491 | Ga0587070_050158 | Ga0587070_050158_58_591 | 177 |
| 3135 | 3300059492 | Ga0587073_0002863 | Ga0587073_0002863_102_635 | 177 |
| 3136 | 3300059492 | Ga0587073_0003501 | Ga0587073_0003501_667_1200 | 177 |
| 3137 | 3300059492 | Ga0587073_0020094 | Ga0587073_0020094_547_1080 | 177 |
| 3138 | 3300059492 | Ga0587073_0077065 | Ga0587073_0077065_263_796 | 177 |
| 3139 | 3300059493 | Ga0587077_000009 | Ga0587077_000009_1848_2381 | 177 |
| 3140 | 3300059493 | Ga0587077_000966 | Ga0587077_000966_1788_2321 | 177 |
| 3141 | 3300059493 | Ga0587077_001192 | Ga0587077_001192_1975_2508 | 177 |
| 3142 | 3300059493 | Ga0587077_007037 | Ga0587077_007037_975_1508 | 177 |
| 3143 | 3300059493 | Ga0587077_084584 | Ga0587077_084584_87_620 | 177 |
| 3144 | 3300059493 | Ga0587077_086847 | Ga0587077_086847_96_629 | 177 |
| 3145 | 3300059493 | Ga0587077_100241 | Ga0587077_100241_76_609 | 177 |
| 3146 | 3300059503 | Ga0587080_001548 | Ga0587080_001548_1450_1983 | 177 |
| 3147 | 3300059503 | Ga0587080_025000 | Ga0587080_025000_384_917 | 177 |
| 3148 | 3300059503 | Ga0587080_030585 | Ga0587080_030585_245_778 | 177 |
| 3149 | 3300059503 | Ga0587080_046042 | Ga0587080_046042_97_630 | 177 |
| 3150 | 3300059503 | Ga0587080_055123 | Ga0587080_055123_132_665 | 177 |
| 3151 | 3300059503 | Ga0587080_073464 | Ga0587080_073464_114_647 | 177 |
| 3152 | 3300059503 | Ga0587080_080642 | Ga0587080_080642_47_580 | 177 |
| 3153 | 3300059504 | Ga0587082_002172 | Ga0587082_002172_1542_2075 | 177 |
| 3154 | 3300059504 | Ga0587082_010331 | Ga0587082_010331_97_630 | 177 |
| 3155 | 3300059504 | Ga0587082_011836 | Ga0587082_011836_613_1146 | 177 |
| 3156 | 3300059504 | Ga0587082_018124 | Ga0587082_018124_205_738 | 177 |
| 3157 | 3300059504 | Ga0587082_060319 | Ga0587082_060319_38_571 | 177 |
| 3158 | 3300059505 | Ga0587083_0000779 | Ga0587083_0000779_1422_1955 | 177 |
| 3159 | 3300059505 | Ga0587083_0005010 | Ga0587083_0005010_1022_1555 | 177 |
| 3160 | 3300059505 | Ga0587083_0009643 | Ga0587083_0009643_64_597 | 177 |
| 3161 | 3300059505 | Ga0587083_0048563 | Ga0587083_0048563_144_677 | 177 |
| 3162 | 3300059505 | Ga0587083_0063068 | Ga0587083_0063068_217_750 | 177 |
| 3163 | 3300059505 | Ga0587083_0070597 | Ga0587083_0070597_18_551 | 177 |
| 3164 | 3300059505 | Ga0587083_0143102 | Ga0587083_0143102_44_577 | 177 |
| 3165 | 3300059507 | Ga0587086_012441 | Ga0587086_012441_208_741 | 177 |
| 3166 | 3300059507 | Ga0587086_019666 | Ga0587086_019666_189_722 | 177 |
| 3167 | 3300059507 | Ga0587086_025772 | Ga0587086_025772_200_733 | 177 |
| 3168 | 3300059508 | Ga0587088_003238 | Ga0587088_003238_887_1420 | 177 |
| 3169 | 3300059508 | Ga0587088_005796 | Ga0587088_005796_414_947 | 177 |
| 3170 | 3300059508 | Ga0587088_092060 | Ga0587088_092060_84_617 | 177 |
| 3171 | 3300059509 | Ga0587089_014607 | Ga0587089_014607_19_552 | 177 |
| 3172 | 3300059510 | Ga0587090_014809 | Ga0587090_014809_188_721 | 177 |
| 3173 | 3300059510 | Ga0587090_033265 | Ga0587090_033265_198_731 | 177 |
| 3174 | 3300059510 | Ga0587090_044553 | Ga0587090_044553_28_561 | 177 |
| 3175 | 3300059511 | Ga0587091_002706 | Ga0587091_002706_1135_1668 | 177 |
| 3176 | 3300059511 | Ga0587091_030088 | Ga0587091_030088_331_864 | 177 |
| 3177 | 3300059511 | Ga0587091_069227 | Ga0587091_069227_188_721 | 177 |
| 3178 | 3300059511 | Ga0587091_123639 | Ga0587091_123639_61_594 | 177 |
| 3179 | 3300059512 | Ga0587092_030647 | Ga0587092_030647_216_749 | 177 |
| 3180 | 3300059513 | Ga0587094_003207 | Ga0587094_003207_473_1006 | 177 |
| 3181 | 3300059513 | Ga0587094_010537 | Ga0587094_010537_288_821 | 177 |
| 3182 | 3300059513 | Ga0587094_025919 | Ga0587094_025919_150_683 | 177 |
| 3183 | 3300059514 | Ga0587095_001259 | Ga0587095_001259_469_1002 | 177 |
| 3184 | 3300059605 | Ga0587106_000532 | Ga0587106_000532_97_630 | 177 |
| 3185 | 3300059605 | Ga0587106_001821 | Ga0587106_001821_962_1495 | 177 |
| 3186 | 3300059605 | Ga0587106_032656 | Ga0587106_032656_51_584 | 177 |
| 3187 | 3300059605 | Ga0587106_048323 | Ga0587106_048323_64_597 | 177 |
| 3188 | 3300059605 | Ga0587106_065610 | Ga0587106_065610_33_566 | 177 |
| 3189 | 3300059607 | Ga0587125_000201 | Ga0587125_000201_1187_1720 | 177 |
| 3190 | 3300059622 | Ga0587099_000819 | Ga0587099_000819_1409_1942 | 177 |
| 3191 | 3300059623 | Ga0587101_000083 | Ga0587101_000083_342_875 | 177 |
| 3192 | 3300059623 | Ga0587101_001406 | Ga0587101_001406_1089_1622 | 177 |
| 3193 | 3300059623 | Ga0587101_001709 | Ga0587101_001709_57_590 | 177 |
| 3194 | 3300059623 | Ga0587101_026514 | Ga0587101_026514_88_621 | 177 |
| 3195 | 3300059623 | Ga0587101_033032 | Ga0587101_033032_237_770 | 177 |
| 3196 | 3300059625 | Ga0587113_018961 | Ga0587113_018961_92_625 | 177 |
| 3197 | 3300059627 | Ga0587117_001509 | Ga0587117_001509_1116_1649 | 177 |
| 3198 | 3300059630 | Ga0587128_001043 | Ga0587128_001043_471_1004 | 177 |
| 3199 | 3300059630 | Ga0587128_002525 | Ga0587128_002525_1187_1720 | 177 |
| 3200 | 3300059630 | Ga0587128_014831 | Ga0587128_014831_252_785 | 177 |
| 3201 | 3300059639 | Ga0587062_001045 | Ga0587062_001045_201_734 | 177 |
| 3202 | 3300059640 | Ga0587067_000579 | Ga0587067_000579_1494_2027 | 177 |
| 3203 | 3300059640 | Ga0587067_002914 | Ga0587067_002914_1305_1838 | 177 |
| 3204 | 3300059640 | Ga0587067_020253 | Ga0587067_020253_188_721 | 177 |
| 3205 | 3300059640 | Ga0587067_040989 | Ga0587067_040989_254_787 | 177 |
| 3206 | 3300059641 | Ga0587068_004710 | Ga0587068_004710_1096_1629 | 177 |
| 3207 | 3300059641 | Ga0587068_005189 | Ga0587068_005189_543_1076 | 177 |
| 3208 | 3300059641 | Ga0587068_017886 | Ga0587068_017886_84_617 | 177 |
| 3209 | 3300059641 | Ga0587068_027314 | Ga0587068_027314_143_676 | 177 |
| 3210 | 3300059642 | Ga0587069_000933 | Ga0587069_000933_1414_1947 | 177 |
| 3211 | 3300059642 | Ga0587069_007649 | Ga0587069_007649_169_702 | 177 |
| 3212 | 3300059642 | Ga0587069_066102 | Ga0587069_066102_98_631 | 177 |
| 3213 | 3300059643 | Ga0587072_001084 | Ga0587072_001084_1168_1701 | 177 |
| 3214 | 3300059643 | Ga0587072_023890 | Ga0587072_023890_120_653 | 177 |
| 3215 | 3300059643 | Ga0587072_057239 | Ga0587072_057239_19_552 | 177 |
| 3216 | 3300059644 | Ga0587075_007386 | Ga0587075_007386_761_1294 | 177 |
| 3217 | 3300059644 | Ga0587075_045319 | Ga0587075_045319_167_700 | 177 |
| 3218 | 3300059645 | Ga0587076_001067 | Ga0587076_001067_1258_1791 | 177 |
| 3219 | 3300059645 | Ga0587076_002866 | Ga0587076_002866_1327_1860 | 177 |
| 3220 | 3300059645 | Ga0587076_006339 | Ga0587076_006339_114_647 | 177 |
| 3221 | 3300059645 | Ga0587076_012964 | Ga0587076_012964_453_986 | 177 |
| 3222 | 3300059645 | Ga0587076_013372 | Ga0587076_013372_455_988 | 177 |
| 3223 | 3300059645 | Ga0587076_040978 | Ga0587076_040978_27_560 | 177 |
| 3224 | 3300059645 | Ga0587076_047296 | Ga0587076_047296_100_633 | 177 |
| 3225 | 3300059646 | Ga0587078_001949 | Ga0587078_001949_60_593 | 177 |
| 3226 | 3300059646 | Ga0587078_003530 | Ga0587078_003530_787_1320 | 177 |
| 3227 | 3300059646 | Ga0587078_011343 | Ga0587078_011343_189_722 | 177 |
| 3228 | 3300059646 | Ga0587078_025263 | Ga0587078_025263_60_593 | 177 |
| 3229 | 3300059647 | Ga0587079_001640 | Ga0587079_001640_1512_2045 | 177 |
| 3230 | 3300059647 | Ga0587079_001675 | Ga0587079_001675_1695_2228 | 177 |
| 3231 | 3300059647 | Ga0587079_035708 | Ga0587079_035708_254_787 | 177 |
| 3232 | 3300059647 | Ga0587079_081662 | Ga0587079_081662_28_561 | 177 |
| 3233 | 3300059648 | Ga0587100_000435 | Ga0587100_000435_321_854 | 177 |
| 3234 | 3300059648 | Ga0587100_009027 | Ga0587100_009027_12_545 | 177 |
| 3235 | 3300059649 | Ga0587102_001812 | Ga0587102_001812_472_1005 | 177 |
| 3236 | 3300059649 | Ga0587102_013443 | Ga0587102_013443_206_739 | 177 |
| 3237 | 3300059650 | Ga0587104_000880 | Ga0587104_000880_320_853 | 177 |
| 3238 | 3300059651 | Ga0587105_000231 | Ga0587105_000231_1457_1990 | 177 |
| 3239 | 3300059652 | Ga0587107_000246 | Ga0587107_000246_1175_1708 | 177 |
| 3240 | 3300059652 | Ga0587107_011972 | Ga0587107_011972_199_732 | 177 |
| 3241 | 3300059652 | Ga0587107_026748 | Ga0587107_026748_25_558 | 177 |
| 3242 | 3300059652 | Ga0587107_030915 | Ga0587107_030915_199_732 | 177 |
| 3243 | 3300059652 | Ga0587107_032044 | Ga0587107_032044_109_642 | 177 |
| 3244 | 3300059652 | Ga0587107_050262 | Ga0587107_050262_109_642 | 177 |
| 3245 | 3300059652 | Ga0587107_063701 | Ga0587107_063701_27_560 | 177 |
| 3246 | 3300059654 | Ga0587110_003745 | Ga0587110_003745_564_1097 | 177 |
| 3247 | 3300059655 | Ga0587114_015371 | Ga0587114_015371_19_552 | 177 |
| 3248 | 3300059657 | Ga0587118_01321 | Ga0587118_01321_833_1366 | 177 |
| 3249 | 3300059660 | Ga0587124_001062 | Ga0587124_001062_984_1517 | 177 |
| 3250 | 3300060344 | Ga0587071_004370 | Ga0587071_004370_100_633 | 177 |
| 3251 | 3300060344 | Ga0587071_038692 | Ga0587071_038692_223_756 | 177 |
| 3252 | 3300060344 | Ga0587071_039260 | Ga0587071_039260_264_797 | 177 |
| 3253 | 3300060344 | Ga0587071_084729 | Ga0587071_084729_65_598 | 177 |
| 3254 | 3300060346 | Ga0587111_0008874 | Ga0587111_0008874_976_1509 | 177 |
| 3255 | 3300060346 | Ga0587111_0021561 | Ga0587111_0021561_63_596 | 177 |
| 3256 | 3300060346 | Ga0587111_0026461 | Ga0587111_0026461_271_804 | 177 |
| 3257 | 3300060353 | Ga0501082_0077674 | Ga0501082_0077674_1281_1814 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 487d-assembly1.cif.gz_J | seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution | 0.9368 | 8 | 165 |
| 6boh-assembly2.cif.gz_NB | antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome | 0.9334 | 7 | 171 |
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.9272 | 10 | 167 |
| 5imq-assembly1.cif.gz_e | structure of ribosome bound to cofactor at 3.8 angstrom resolution | 0.9212 | 8 | 163 |
| 6v3b-assembly1.cif.gz_G | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9197 | 7 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q25814_82_167_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9239 | 83 | 160 | 3.90.930.12 |
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9159 | 83 | 168 | 3.90.930.12 |
| af_P54042_8_87_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9112 | 7 | 83 | 3.90.930.12 |
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9064 | 3 | 82 | 3.90.930.12 |
| af_O21037_77_170_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9031 | 83 | 173 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356S592-F1-model_v4 | 50S ribosomal protein L6 | 0.9593 | 8 | 79 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A436W0A1-F1-model_v4 | 50S ribosomal protein L6 | 0.9382 | 1 | 79 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G0LBH2-F1-model_v4 | 50S ribosomal protein L6 | 0.9349 | 8 | 79 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A356S592-F1-model_v4 | 50S ribosomal protein L6 | 0.9344 | 8 | 79 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7X0FNZ1-F1-model_v4 | 50S ribosomal protein L6 | 0.9341 | 16 | 171 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar