F497267

General Info

Members Datasets Scaffolds Average Seq Length
3257 1818 2190 175

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0001953|Ga0500568_0001953_4513_5127
Length 204
Sequence VNGEPALSAIHHFTIHHSQQFGKKETKMSRIGKKPVKVPAGVTASVDGQTVSAKGPKGELKFVVNDDVLVKMENGEIAVQPRDQTKTARSKWGMSRTQIVNILEGVTKGFEKKLEINGVGYRAAMQGKNLQLALGFSHDVIYETPHGITIAVPKPTEITVSGIDKQAVGQTAAEIREYRGPEPYKGKGVKYAGERIVRKEGKKK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501050 Microvirga lupini Lut6 Isolate Nodule
6 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
7 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
8 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
9 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
10 2509276019 Ensifer aridi TW10 Isolate Nodule
11 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
12 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
13 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
14 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
15 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
16 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
17 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
18 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
19 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
20 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
21 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
22 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
23 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
24 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
25 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
26 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
27 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
28 2512875024 Mesorhizobium loti R88b Isolate Nodule
29 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
30 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
31 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
32 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
33 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
34 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
35 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
36 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
37 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
38 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
39 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
40 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
41 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
42 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
43 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
44 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
45 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
46 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
47 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
48 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
49 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
50 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
51 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
52 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
53 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
54 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
55 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
56 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
57 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
58 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
59 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
60 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
61 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
62 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
63 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
64 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
65 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
66 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
67 2516143018 Ensifer sp. BR816 Isolate Nodule
68 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
69 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
70 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
71 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
72 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
73 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
74 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
75 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
76 2519899620 Rhizobium sp. Pop5 Isolate Nodule
77 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
78 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
79 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
80 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
81 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
82 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
83 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
84 2534681786 Brucella suis 92/29 Isolate Unclassified
85 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
86 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
87 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
88 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
89 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
90 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
91 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
92 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
93 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
94 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
95 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
96 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
97 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
98 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
99 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
100 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
101 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
102 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
103 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
104 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
105 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
106 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
107 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
108 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
109 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
110 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
111 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
112 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
113 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
114 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
115 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
116 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
117 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
118 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
119 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
120 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
121 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
122 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
123 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
124 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
125 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
126 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
127 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
128 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
129 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
130 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
131 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
132 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
133 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
134 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
135 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
136 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
137 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
138 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
139 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
140 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
141 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
142 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
143 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
144 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
145 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
146 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
147 2643221557 Ensifer sp. Root558 Isolate Unclassified
148 2643221558 Rhizobium sp. Root149 Isolate Unclassified
149 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
150 2643221568 Rhizobium sp. Root564 Isolate Unclassified
151 2643221582 Rhizobium sp. Root651 Isolate Unclassified
152 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
153 2643221599 Rhizobium sp. Root708 Isolate Unclassified
154 2643221607 Rhizobium sp. Root73 Isolate Unclassified
155 2643221610 Ensifer sp. Root74 Isolate Unclassified
156 2643221618 Ensifer sp. Root231 Isolate Unclassified
157 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
158 2643221626 Ensifer sp. Root31 Isolate Unclassified
159 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
160 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
161 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
162 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
163 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
164 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
165 2643221655 Ensifer sp. Root1252 Isolate Unclassified
166 2643221659 Ensifer sp. Root127 Isolate Unclassified
167 2643221668 Ensifer sp. Root423 Isolate Unclassified
168 2643221675 Ensifer sp. Root1298 Isolate Unclassified
169 2643221680 Ensifer sp. Root1312 Isolate Unclassified
170 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
171 2643221688 Rhizobium sp. Root482 Isolate Unclassified
172 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
173 2643221693 Rhizobium sp. Root491 Isolate Unclassified
174 2643221698 Ensifer sp. Root142 Isolate Unclassified
175 2643221712 Ensifer sp. Root258 Isolate Unclassified
176 2643221718 Rhizobium sp. Root268 Isolate Unclassified
177 2643221719 Rhizobium sp. Root274 Isolate Unclassified
178 2643221723 Ensifer sp. Root278 Isolate Unclassified
179 2643221726 Ensifer sp. Root954 Isolate Unclassified
180 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
181 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
182 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
183 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
184 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
185 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
186 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
187 2718217882 Rhizobium sp. N741 Isolate Nodule
188 2718217927 Rhizobium sp. N324 Isolate Nodule
189 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
190 2718218009 Rhizobium sp. N561 Isolate Nodule
191 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
192 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
193 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
194 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
195 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
196 2718218363 Rhizobium sp. N113 Isolate Nodule
197 2718218365 Rhizobium sp. N731 Isolate Nodule
198 2718218366 Rhizobium sp. N621 Isolate Nodule
199 2718218423 Rhizobium sp. N941 Isolate Nodule
200 2721755514 Rhizobium sp. N6212 Isolate Nodule
201 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
202 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
203 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
204 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
205 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
206 2721755809 Rhizobium sp. N541 Isolate Nodule
207 2721755810 Rhizobium sp. N871 Isolate Nodule
208 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
209 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
210 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
211 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
212 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
213 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
214 2728369365 Rhizobium sp. N1341 Isolate Nodule
215 2728369397 Rhizobium sp. N1314 Isolate Nodule
216 2738541293 Rhizobium sp. GV031 Isolate Unclassified
217 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
218 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
219 2738543024 Aminobacter sp. AP02 Isolate Unclassified
220 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
221 2751185800 Brucella pituitosa AA2 Isolate Unclassified
222 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
223 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
224 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
225 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
226 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
227 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
228 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
229 2773857925 Microvirga vignae BR3299 Isolate Unclassified
230 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
231 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
232 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
233 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
234 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
235 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
236 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
237 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
238 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
239 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
240 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
241 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
242 2791355199
243 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
244 2791355256 Rhizobium sp. M10 Isolate Nodule
245 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
246 2791355260 Rhizobium sp. L9 Isolate Nodule
247 2791355261 Rhizobium sp. J15 Isolate Nodule
248 2791355262 Rhizobium sp. M1 Isolate Nodule
249 2791355263 Rhizobium chutanense C5 Isolate Nodule
250 2791355264 Rhizobium sp. S9 Isolate Nodule
251 2791355265 Rhizobium sp. H4 Isolate Nodule
252 2791355266 Rhizobium sp. L43 Isolate Nodule
253 2791355267 Rhizobium sp. L18 Isolate Nodule
254 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
255 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
256 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
257 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
258 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
259 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
260 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
261 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
262 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
263 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
264 2802429633 Rhizobium anhuiense J3 Isolate Nodule
265 2802429634 Rhizobium anhuiense S10 Isolate Nodule
266 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
267 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
268 2802429637 Rhizobium anhuiense C15 Isolate Nodule
269 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
270 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
271 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
272 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
273 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
274 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
275 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
276 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
277 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
278 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
279 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
280 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
281 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
282 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
283 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
284 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
285 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
286 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
287 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
288 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
289 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
290 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
291 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
292 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
293 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
294 2838048938 Rhizobium pisi 27/80 Isolate Nodule
295 2838061910 Rhizobium phaseoli L15 Isolate Nodule
296 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
297 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
298 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
299 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
300 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
301 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
302 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
303 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
304 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
305 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
306 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
307 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
308 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
309 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
310 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
311 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
312 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
313 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
314 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
315 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
316 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
317 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
318 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
319 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
320 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
321 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
322 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
323 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
324 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
325 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
326 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
327 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
328 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
329 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
330 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
331 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
332 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
333 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
334 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
335 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
336 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
337 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
338 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
339 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
340 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
341 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
342 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
343 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
344 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
345 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
346 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
347 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
348 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
349 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
350 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
351 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
352 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
353 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
354 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
355 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
356 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
357 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
358 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
359 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
360 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
361 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
362 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
363 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
364 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
365 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
366 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
367 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
368 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
369 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
370 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
371 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
372 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
373 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
374 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
375 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
376 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
377 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
378 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
379 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
380 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
381 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
382 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
383 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
384 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
385 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
386 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
387 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
388 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
389 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
390 2844163670 Ensifer sp. 1H6 Isolate Unclassified
391 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
392 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
393 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
394 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
395 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
396 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
397 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
398 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
399 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
400 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
401 2854911287 Brucella lupini LUP21 Isolate Unclassified
402 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
403 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
404 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
405 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
406 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
407 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
408 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
409 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
410 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
411 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
412 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
413 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
414 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
415 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
416 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
417 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
418 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
419 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
420 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
421 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
422 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
423 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
424 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
425 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
426 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
427 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
428 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
429 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
430 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
431 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
432 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
433 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
434 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
435 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
436 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
437 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
438 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
439 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
440 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
441 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
442 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
443 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
444 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
445 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
446 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
447 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
448 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
449 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
450 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
451 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
452 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
453 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
454 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
455 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
456 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
457 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
458 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
459 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
460 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
461 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
462 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
463 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
464 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
465 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
466 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
467 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
468 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
469 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
470 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
471 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
472 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
473 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
474 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
475 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
476 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
477 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
478 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
479 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
480 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
481 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
482 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
483 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
484 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
485 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
486 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
487 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
488 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
489 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
490 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
491 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
492 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
493 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
494 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
495 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
496 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
497 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
498 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
499 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
500 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
501 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
502 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
503 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
504 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
505 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
506 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
507 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
508 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
509 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
510 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
511 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
512 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
513 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
514 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
515 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
516 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
517 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
518 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
519 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
520 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
521 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
522 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
523 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
524 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
525 2904699407
526 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
527 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
528 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
529 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
530 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
531 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
532 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
533 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
534 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
535 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
536 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
537 2906610324
538 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
539 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
540 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
541 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
542 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
543 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
544 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
545 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
546 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
547 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
548 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
549 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
550 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
551 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
552 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
553 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
554 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
555 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
556 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
557 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
558 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
559 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
560 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
561 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
562 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
563 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
564 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
565 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
566 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
567 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
568 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
569 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
570 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
571 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
572 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
573 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
574 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
575 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
576 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
577 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
578 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
579 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
580 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
581 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
582 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
583 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
584 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
585 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
586 2922368715
587 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
588 2922425934
589 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
590 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
591 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
592 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
593 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
594 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
595 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
596 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
597 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
598 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
599 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
600 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
601 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
602 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
603 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
604 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
605 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
606 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
607 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
608 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
609 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
610 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
611 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
612 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
613 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
614 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
615 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
616 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
617 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
618 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
619 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
620 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
621 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
622 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
623 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
624 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
625 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
626 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
627 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
628 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
629 2933599457 Rhizobium phaseoli M3 Isolate Nodule
630 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
631 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
632 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
633 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
634 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
635 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
636 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
637 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
638 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
639 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
640 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
641 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
642 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
643 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
644 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
645 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
646 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
647 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
648 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
649 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
650 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
651 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
652 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
653 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
654 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
655 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
656 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
657 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
658 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
659 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
660 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
661 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
662 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
663 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
664 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
665 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
666 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
667 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
668 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
669 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
670 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
671 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
672 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
673 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
674 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
675 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
676 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
677 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
678 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
679 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
680 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
681 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
682 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
683 2936381700 Rhizobium chutanense C16 Isolate Unclassified
684 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
685 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
686 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
687 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
688 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
689 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
690 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
691 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
692 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
693 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
694 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
695 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
696 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
697 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
698 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
699 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
700 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
701 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
702 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
703 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
704 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
705 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
706 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
707 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
708 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
709 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
710 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
711 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
712 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
713 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
714 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
715 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
716 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
717 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
718 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
719 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
720 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
721 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
722 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
723 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
724 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
725 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
726 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
727 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
728 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
729 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
730 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
731 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
732 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
733 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
734 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
735 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
736 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
737 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
738 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
739 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
740 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
741 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
742 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
743 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
744 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
745 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
746 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
747 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
748 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
749 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
750 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
751 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
752 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
753 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
754 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
755 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
756 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
757 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
758 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
759 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
760 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
761 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
762 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
763 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
764 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
765 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
766 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
767 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
768 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
769 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
770 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
771 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
772 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
773 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
774 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
775 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
776 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
777 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
778 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
779 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
780 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
781 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
782 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
783 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
784 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
785 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
786 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
787 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
788 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
789 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
790 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
791 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
792 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
793 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
794 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
795 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
796 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
797 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
798 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
799 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
800 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
801 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
802 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
803 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
804 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
805 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
806 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
807 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
808 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
809 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
810 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
811 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
812 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
813 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
814 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
815 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
816 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
817 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
818 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
819 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
820 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
821 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
822 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
823 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
824 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
825 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
826 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
827 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
828 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
829 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
830 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
831 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
832 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
833 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
834 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
835 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
836 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
837 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
838 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
839 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
840 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
841 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
842 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
843 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
844 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
845 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
846 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
847 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
848 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
849 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
850 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
851 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
852 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
853 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
854 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
855 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
856 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
857 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
858 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
859 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
860 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
861 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
862 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
863 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
864 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
865 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
866 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
867 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
868 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
869 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
870 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
871 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
872 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
873 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
874 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
875 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
876 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
877 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
878 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
879 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
880 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
881 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
882 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
883 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
884 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
885 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
886 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
887 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
888 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
889 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
890 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
891 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
892 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
893 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
894 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
895 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
896 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
897 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
898 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
899 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
900 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
901 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
902 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
903 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
904 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
905 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
906 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
907 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
908 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
909 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
910 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
911 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
912 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
913 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
914 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
915 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
916 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
917 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
918 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
919 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
920 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
921 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
922 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
923 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
924 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
925 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
926 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
927 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
928 2996887358 Rhizobium sp. R711 Isolate Nodule
929 2996893221 Rhizobium sp. R635 Isolate Nodule
930 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
931 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
932 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
933 3004167301 Mesorhizobium loti 582 Isolate Unclassified
934 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
935 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
936 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
937 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
938 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
939 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
940 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
941 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
942 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
943 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
944 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
945 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
946 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
947 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
948 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
949 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
950 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
951 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
952 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
953 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
954 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
955 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
956 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
957 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
958 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
959 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
960 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
961 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
962 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
963 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
964 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
965 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
966 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
967 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
968 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
969 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
970 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
971 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
972 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
973 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
974 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
975 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
976 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
977 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
978 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
979 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
980 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
981 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
982 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
983 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
984 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
985 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
986 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
987 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
988 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
989 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
990 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
991 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
992 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
993 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
994 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
995 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
996 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
997 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
998 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
999 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
1000 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
1001 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
1002 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
1003 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
1004 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
1005 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
1006 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
1007 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
1008 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
1009 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
1010 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
1011 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
1012 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
1013 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
1014 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
1015 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
1016 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
1017 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
1018 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
1019 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
1020 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
1021 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
1022 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
1023 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
1024 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
1025 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
1026 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
1027 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
1028 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
1029 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
1030 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
1031 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
1032 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
1033 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
1034 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
1035 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
1036 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
1037 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
1038 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
1039 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
1040 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
1041 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
1042 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
1043 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
1044 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
1045 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
1046 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
1047 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
1048 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
1049 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
1050 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
1051 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
1052 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
1053 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
1054 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
1055 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
1056 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
1057 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
1058 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
1059 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
1060 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
1061 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
1062 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
1063 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
1064 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
1065 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
1066 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
1067 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
1068 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
1069 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
1070 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
1071 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
1072 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
1073 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
1074 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
1075 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
1076 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
1077 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
1078 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
1079 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
1080 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
1081 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
1082 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
1083 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
1084 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
1085 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
1086 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
1087 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
1088 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
1089 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
1090 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
1091 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
1092 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
1093 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
1094 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
1095 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
1096 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
1097 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
1098 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
1099 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
1100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
1101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
1102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
1103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
1104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
1105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
1106 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
1107 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
1108 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
1109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
1110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
1111 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
1112 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
1113 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
1114 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
1115 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
1116 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
1117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
1118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
1119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
1120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
1121 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
1122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
1123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
1124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
1125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
1126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
1127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
1129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
1130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
1132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
1133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
1134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
1135 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1137 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1138 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1139 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
1141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
1142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
1143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
1144 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1145 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1146 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
1147 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
1153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
1160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1164 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
1165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1177 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1185 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1237 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1238 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1239 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1240 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1241 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1242 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1243 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
1244 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1250 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
1251 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
1252 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
1253 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
1254 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
1255 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1256 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1257 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1258 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1259 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
1260 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
1261 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1262 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1263 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
1265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1266 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1267 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1268 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1269 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1270 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1272 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1274 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1277 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1284 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1289 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1290 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
1291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1292 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1293 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
1294 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1295 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1296 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
1297 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
1298 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
1299 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1300 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
1301 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
1302 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
1303 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1304 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1305 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
1306 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1307 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1308 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
1309 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1310 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
1311 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
1312 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
1313 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
1314 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1315 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1316 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1317 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
1318 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1319 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1320 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1321 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1322 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1323 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
1324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1325 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
1326 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1327 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1328 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1329 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1331 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1332 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1333 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1334 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1335 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1336 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1337 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1338 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
1339 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1340 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
1341 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
1342 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1343 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
1344 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
1345 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
1346 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
1347 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
1348 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
1349 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
1350 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1351 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1352 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1353 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
1354 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1355 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
1356 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1357 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1358 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1359 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
1360 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1361 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1362 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1363 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
1364 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1365 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1366 3300041909 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT_extra_run Metatranscriptome Unclassified
1367 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
1368 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
1369 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
1370 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1371 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
1372 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
1373 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
1374 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
1375 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1376 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
1377 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1378 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
1379 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
1380 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1381 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
1382 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
1383 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1384 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1385 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1386 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1387 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1388 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
1389 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1390 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1391 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1392 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1393 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1394 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1395 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1396 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1397 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1398 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1399 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1400 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
1401 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1402 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1403 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1404 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1405 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1406 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1407 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1408 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1409 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1410 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1411 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1412 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1413 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1414 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1415 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1416 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1417 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1418 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1419 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1420 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1421 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1422 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1423 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1424 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1425 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1426 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1427 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1428 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1429 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1430 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1431 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1432 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1433 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1434 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1435 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1436 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1437 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1438 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1439 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1440 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1441 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1442 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
1443 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1444 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1445 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1446 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1447 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1448 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1449 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1450 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1451 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1452 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1453 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1454 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1455 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1456 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1457 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1458 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1459 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1460 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1461 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1462 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1463 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1464 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1465 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1466 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1467 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1468 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1469 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1470 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1471 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1472 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1473 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1474 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1475 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1476 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1477 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1478 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1479 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1480 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1481 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1482 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1483 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1484 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1485 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1486 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1488 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1489 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1490 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1491 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1492 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1493 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1494 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1495 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1496 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1497 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1498 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1499 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1500 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1501 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1502 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1503 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1504 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1505 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1506 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1507 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1508 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1509 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1510 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1511 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1512 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1513 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1514 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1515 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1516 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1517 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1518 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1519 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1520 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1521 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1522 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1523 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1524 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1525 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1526 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1527 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1528 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1529 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1530 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1531 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1532 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1533 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1534 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1535 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1536 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1537 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1538 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1539 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1540 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1541 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1542 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1543 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1544 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1545 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1546 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1547 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1548 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1549 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1550 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1551 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1552 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1553 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1554 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1555 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1556 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1557 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1558 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1559 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1560 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1561 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1562 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1563 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1564 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1565 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1566 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
1567 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1568 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1569 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1570 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1571 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1572 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
1573 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1574 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1575 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1576 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1577 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
1578 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1579 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1580 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1581 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1582 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1583 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1584 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1585 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1586 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1587 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1588 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1589 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1590 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1591 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1592 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1593 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1594 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1595 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1596 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1597 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1598 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1599 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1600 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1601 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1602 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1603 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
1604 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1605 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1606 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1607 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
1608 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1609 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1610 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
1611 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
1612 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1613 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1614 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1615 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1616 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1617 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1618 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1619 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1620 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1621 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
1622 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1623 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
1624 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1625 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
1626 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
1627 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1628 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
1629 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1630 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1631 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1632 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
1633 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1634 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1635 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1636 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
1637 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1638 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
1639 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1640 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
1641 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1642 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1643 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
1644 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1645 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1646 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1647 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1648 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
1649 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1650 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1651 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
1652 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1653 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1654 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1655 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
1656 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1657 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1658 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1659 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
1660 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
1661 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1662 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1663 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1664 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1665 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1666 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1667 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1668 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1669 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1670 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1671 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1672 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1673 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1674 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1675 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1676 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1677 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1678 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1679 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1680 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1681 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1682 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1683 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1684 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1685 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1686 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1687 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1688 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1689 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1690 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1691 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1692 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1693 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1694 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1695 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1696 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1697 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1698 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1699 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1700 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1701 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1702 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1703 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1704 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1705 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1706 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1707 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1708 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1709 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1710 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1711 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1712 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1713 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1714 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1715 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1716 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1717 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1718 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1719 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1720 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1721 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1722 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1723 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1724 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1725 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1726 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1727 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1728 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1729 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1730 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1731 8005258706 Rhizobium sp. R693 Isolate Nodule
1732 8005275841 Rhizobium sp. N4311 Isolate Nodule
1733 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1734 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1735 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1736 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1737 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1738 8005321885 Rhizobium sp. R72 Isolate Nodule
1739 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1740 8005382845 Rhizobium sp. R634 Isolate Nodule
1741 8005395548 Rhizobium sp. R339 Isolate Nodule
1742 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1743 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1744 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1745 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1746 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1747 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1748 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1749 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1750 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1751 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1752 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1753 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1754 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1755 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1756 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1757 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1758 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1759 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
1760 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
1761 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
1762 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
1763 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
1764 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1765 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1766 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1767 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1768 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1769 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1770 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1771 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1772 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
1773 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1774 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
1775 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1776 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1777 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1778 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1779 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1780 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1781 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1782 8018176218 Rhizobium sp. N122 Isolate Nodule
1783 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1784 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1785 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1786 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
1787 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
1788 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1789 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
1790 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1791 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1792 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
1793 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1794 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1795 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1796 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1797 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1798 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
1799 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1800 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1801 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1802 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1803 8024501048 Rhizobium sp. H4 Isolate Nodule
1804 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1805 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1806 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1807 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1808 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1809 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1810 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1811 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1812 8056382006 Rhizobium croatiense 13T Isolate Nodule
1813 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
1814 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1815 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1816 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1817 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1818 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.76
Metatranscriptomes 6.58
Isolates 32.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 14.28
Nodule 25.61
Rhizoplane 3.1
Rhizosphere 45.26
Stem 0
Stem Tuber 0
Unclassified 11.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1019970 3300000546 Bacteria 715
2 JGI24746J21847_1014539 3300001977 Bacteria 1137
3 JGI24740J21852_10005876 3300001979 Bacteria 5144
4 JGI24740J21852_10038834 3300001979 Bacteria 1457
5 JGI24739J22299_10023100 3300001989 Bacteria 2200
6 JGI24737J22298_10014566 3300001990 Bacteria 2551
7 JGI24735J21928_10008865 3300002067 Bacteria 3244
8 JGI24750J21931_1002476 3300002070 Bacteria 2226
9 JGI24748J21848_1006619 3300002074 Bacteria 1351
10 JGI24744J21845_10011648 3300002077 Bacteria 1796
11 JGI24742J22300_10008938 3300002244 Bacteria 1653
12 JGI25155J39150_1000061 3300002704 Bacteria 71144
13 JGI25156J39149_1001959 3300002705 Bacteria 7933
14 JGI25162J39368_1009004 3300002737 Bacteria 1372
15 JGI25162J39368_1009005 3300002737 Bacteria 1372
16 JGI25154J39366_1002042 3300002738 Bacteria 5800
17 JGI25158J39367_1002239 3300002739 Bacteria 3210
18 JGI25157J39369_1000106 3300002741 Bacteria 71144
19 JGI25157J39369_1002241 3300002741 Bacteria 5220
20 JGI25152J39213_1035375 3300002773 Bacteria 738
21 JGI25152J39213_1043016 3300002773 Bacteria 623
22 JGI25152J39213_1043464 3300002773 Bacteria 617
23 JGI25152J39213_1047518 3300002773 Bacteria 572
24 JGI25150J39212_1009762 3300002774 Bacteria 1813
25 JGI25150J39212_1014332 3300002774 Bacteria 1349
26 JGI25150J39212_1018199 3300002774 Bacteria 1121
27 JGI25150J39212_1041666 3300002774 Bacteria 591
28 JGI25159J45721_1001742 3300002987 Bacteria 8761
29 JGI25159J45721_1001758 3300002987 Bacteria 8715
30 JGI25159J45721_1001854 3300002987 Bacteria 8451
31 Ga0006778J45830_1043587 3300003162 Bacteria 3758
32 Ga0006778J45830_1078890 3300003162 Bacteria 1068
33 JGI25151J46595_10033134 3300003187 Bacteria 1994
34 JGI25151J46595_10051541 3300003187 Bacteria 1392
35 JGI25151J46595_10094552 3300003187 Bacteria 822
36 JGI25151J46595_10095923 3300003187 Bacteria 812
37 JGI25151J46595_10097329 3300003187 Bacteria 802
38 JGI25406J46586_10001918 3300003203 Bacteria 9806
39 JGI25165J46597_1001303 3300003214 Bacteria 14268
40 JGI25165J46597_1008576 3300003214 Bacteria 1593
41 JGI25165J46597_1009987 3300003214 Bacteria 1399
42 JGI25153J46596_10001601 3300003215 Bacteria 13411
43 JGI25153J46596_10013209 3300003215 Bacteria 3507
44 JGI25153J46596_10022281 3300003215 Bacteria 2340
45 JGI25153J46596_10080670 3300003215 Bacteria 812
46 JGI25153J46596_10086554 3300003215 Bacteria 767
47 JGI25153J46596_10114136 3300003215 Bacteria 617
48 JGI25153J46596_10127048 3300003215 Bacteria 568
49 Ga0006758J48902_1009309 3300003300 Bacteria 6323
50 rootH2_10008940 3300003320 Bacteria 20037
51 rootL2_10037314 3300003322 Bacteria 2608
52 JGI25160J50197_1000711 3300003354 Bacteria 18324
53 JGI25160J50197_1002401 3300003354 Bacteria 8731
54 JGI25160J50197_1010180 3300003354 Bacteria 3420
55 JGI25160J50197_1020369 3300003354 Bacteria 2003
56 JGI25160J50197_1023262 3300003354 Bacteria 1793
57 JGI25160J50197_1062080 3300003354 Bacteria 742
58 JGI25160J50197_1065297 3300003354 Bacteria 712
59 JGI25161J50226_1001504 3300003374 Bacteria 6915
60 JGI25161J50226_1005101 3300003374 Bacteria 2617
61 JGI25161J50226_1005181 3300003374 Bacteria 2581
62 Ga0007417J51691_1064787 3300003544 Bacteria 932
63 Ga0007427J51700_119959 3300003559 Bacteria 667
64 Ga0007409J51694_1066553 3300003575 Bacteria 1490
65 Ga0006562J51391_1040260 3300003578 Bacteria 2118
66 Ga0007429J51699_1060640 3300003579 Bacteria 1671
67 Ga0007429J51699_1080175 3300003579 Bacteria 1406
68 Ga0032354_1024703 3300003693 Bacteria 11216
69 Ga0055539_1004785 3300003752 Bacteria 1788
70 Ga0055542_1001882 3300003762 Bacteria 8351
71 Ga0055542_1002921 3300003762 Bacteria 5036
72 Ga0055529_1004418 3300003763 Bacteria 2143
73 Ga0055526_1003723 3300003771 Bacteria 9520
74 Ga0055526_1035691 3300003771 Bacteria 1334
75 Ga0055526_1064369 3300003771 Bacteria 767
76 Ga0055524_1036623 3300003775 Bacteria 1315
77 Ga0055524_1044107 3300003775 Bacteria 1088
78 Ga0055524_1050093 3300003775 Bacteria 956
79 Ga0055524_1066669 3300003775 Bacteria 714
80 Ga0055536_1001886 3300003781 Bacteria 12178
81 Ga0055536_1002273 3300003781 Bacteria 10907
82 Ga0055536_1006942 3300003781 Bacteria 5160
83 Ga0055528_1021587 3300003790 Bacteria 2036
84 Ga0055528_1056056 3300003790 Bacteria 767
85 Ga0055528_1076269 3300003790 Bacteria 596
86 Ga0055528_1076384 3300003790 Bacteria 596
87 Ga0055530_10009225 3300003791 Bacteria 3825
88 Ga0055530_10024067 3300003791 Bacteria 1736
89 Ga0055540_1004614 3300003792 Bacteria 6119
90 Ga0055540_1064046 3300003792 Bacteria 729
91 Ga0055540_1065134 3300003792 Bacteria 721
92 Ga0055540_1077922 3300003792 Bacteria 639
93 Ga0055540_1085533 3300003792 Bacteria 600
94 Ga0055531_10006947 3300003794 Bacteria 6302
95 Ga0055531_10017723 3300003794 Bacteria 2987
96 Ga0055531_10080310 3300003794 Bacteria 720
97 Ga0055543_1000156 3300004625 Bacteria 57199
98 Ga0055543_1000856 3300004625 Bacteria 14666
99 Ga0055543_1000880 3300004625 Bacteria 14315
100 Ga0055543_1001602 3300004625 Bacteria 8686
101 Ga0058859_11714120 3300004798 Bacteria 715
102 Ga0058860_10018536 3300004801 Bacteria 1559
103 Ga0058860_11771056 3300004801 Bacteria 1188
104 Ga0065165_1002620 3300005262 Bacteria 14666
105 Ga0065165_1002688 3300005262 Bacteria 14315
106 Ga0065165_1008206 3300005262 Bacteria 4947
107 Ga0065165_1014496 3300005262 Bacteria 3057
108 Ga0065165_1019265 3300005262 Bacteria 2444
109 Ga0065165_1020288 3300005262 Bacteria 2344
110 Ga0065704_10166257 3300005289 Bacteria 1320
111 Ga0065707_10012753 3300005295 Bacteria 1674
112 Ga0070658_10092435 3300005327 Bacteria 2494
113 Ga0070658_10129002 3300005327 Bacteria 2106
114 Ga0070676_10175790 3300005328 Bacteria 1388
115 Ga0070676_10812915 3300005328 Bacteria 690
116 Ga0070670_100003237 3300005331 Bacteria 13450
117 Ga0070670_100139598 3300005331 Bacteria 2095
118 Ga0070666_10353481 3300005335 Bacteria 1052
119 Ga0070666_10461003 3300005335 Bacteria 918
120 Ga0070666_10739099 3300005335 Bacteria 723
121 Ga0070666_10788376 3300005335 Bacteria 699
122 Ga0070682_100060292 3300005337 Bacteria 2399
123 Ga0070682_100106402 3300005337 Bacteria 1861
124 Ga0070682_100644370 3300005337 Bacteria 842
125 Ga0070682_101449987 3300005337 Bacteria 588
126 Ga0070660_100228895 3300005339 Bacteria 1512
127 Ga0070660_100286912 3300005339 Bacteria 1347
128 Ga0070689_100395279 3300005340 Bacteria 1167
129 Ga0070689_101175664 3300005340 Bacteria 688
130 Ga0070687_100950748 3300005343 Bacteria 619
131 Ga0070661_100490127 3300005344 Bacteria 983
132 Ga0070692_10549122 3300005345 Bacteria 756
133 Ga0070668_100162574 3300005347 Bacteria 1812
134 Ga0070668_100167991 3300005347 Bacteria 1784
135 Ga0070668_100231234 3300005347 Bacteria 1528
136 Ga0070668_100334546 3300005347 Bacteria 1278
137 Ga0070668_100927361 3300005347 Bacteria 779
138 Ga0070669_100178786 3300005353 Bacteria 1658
139 Ga0070669_100237958 3300005353 Bacteria 1445
140 Ga0070669_100279858 3300005353 Bacteria 1336
141 Ga0070669_100311739 3300005353 Bacteria 1268
142 Ga0070669_100440199 3300005353 Bacteria 1073
143 Ga0070675_100903392 3300005354 Bacteria 809
144 Ga0070671_100016669 3300005355 Bacteria 5941
145 Ga0070671_100177196 3300005355 Bacteria 1804
146 Ga0070671_100329945 3300005355 Bacteria 1300
147 Ga0070671_101149589 3300005355 Bacteria 682
148 Ga0070671_101211801 3300005355 Bacteria 664
149 Ga0070674_100224686 3300005356 Bacteria 1462
150 Ga0070674_100422934 3300005356 Bacteria 1093
151 Ga0070673_100870080 3300005364 Bacteria 835
152 Ga0070688_100220798 3300005365 Bacteria 1335
153 Ga0070688_100350601 3300005365 Bacteria 1080
154 Ga0070659_100093075 3300005366 Bacteria 2418
155 Ga0070659_100100837 3300005366 Bacteria 2323
156 Ga0070667_100244954 3300005367 Bacteria 1601
157 Ga0070667_100967783 3300005367 Bacteria 793
158 Ga0070667_101192686 3300005367 Bacteria 712
159 Ga0070667_101453121 3300005367 Bacteria 643
160 Ga0070703_10123651 3300005406 Bacteria 942
161 Ga0070709_10004324 3300005434 Bacteria 7659
162 Ga0070709_10499759 3300005434 Bacteria 923
163 Ga0070714_100059218 3300005435 Bacteria 3283
164 Ga0070714_100112402 3300005435 Bacteria 2413
165 Ga0070713_100027784 3300005436 Bacteria 4460
166 Ga0070713_100030565 3300005436 Bacteria 4278
167 Ga0070713_100187641 3300005436 Bacteria 1861
168 Ga0070713_101186952 3300005436 Bacteria 739
169 Ga0070713_101663701 3300005436 Bacteria 620
170 Ga0070710_10003270 3300005437 Bacteria 7682
171 Ga0070710_10033673 3300005437 Bacteria 2783
172 Ga0070710_10211874 3300005437 Bacteria 1228
173 Ga0070711_100007497 3300005439 Bacteria 6640
174 Ga0070711_100123070 3300005439 Bacteria 1921
175 Ga0070711_100126700 3300005439 Bacteria 1896
176 Ga0070711_100201995 3300005439 Bacteria 1534
177 Ga0070711_100357588 3300005439 Bacteria 1175
178 Ga0070694_100180173 3300005444 Bacteria 1562
179 Ga0070708_100035098 3300005445 Bacteria 4367
180 Ga0070663_100146891 3300005455 Bacteria 1805
181 Ga0070663_100254636 3300005455 Bacteria 1390
182 Ga0070663_100816616 3300005455 Bacteria 800
183 Ga0070678_100023343 3300005456 Bacteria 4120
184 Ga0070662_100524098 3300005457 Bacteria 990
185 Ga0070681_10018722 3300005458 Bacteria 6929
186 Ga0070681_10068789 3300005458 Bacteria 3507
187 Ga0070685_10472265 3300005466 Bacteria 882
188 Ga0070685_10917889 3300005466 Bacteria 653
189 Ga0070706_100045185 3300005467 Bacteria 4069
190 Ga0070706_100246691 3300005467 Bacteria 1667
191 Ga0070706_101013047 3300005467 Bacteria 766
192 Ga0070707_100065254 3300005468 Bacteria 3497
193 Ga0070698_100298640 3300005471 Bacteria 1541
194 Ga0070698_100327715 3300005471 Bacteria 1462
195 Ga0070698_101101846 3300005471 Bacteria 743
196 Ga0070679_100237155 3300005530 Bacteria 1782
197 Ga0070679_100305294 3300005530 Bacteria 1542
198 Ga0070679_100329362 3300005530 Bacteria 1476
199 Ga0070684_100792115 3300005535 Bacteria 886
200 Ga0070684_100911036 3300005535 Bacteria 824
201 Ga0070684_101120991 3300005535 Bacteria 739
202 Ga0070697_100102676 3300005536 Bacteria 2376
203 Ga0070697_100279312 3300005536 Bacteria 1432
204 Ga0068853_100027914 3300005539 Bacteria 4746
205 Ga0068853_100087278 3300005539 Bacteria 2737
206 Ga0068853_100159771 3300005539 Bacteria 2033
207 Ga0068853_100495158 3300005539 Bacteria 1153
208 Ga0068853_101187741 3300005539 Bacteria 736
209 Ga0068853_101444864 3300005539 Bacteria 665
210 Ga0070672_100153802 3300005543 Bacteria 1904
211 Ga0070672_100921346 3300005543 Bacteria 772
212 Ga0070686_100291835 3300005544 Bacteria 1206
213 Ga0070696_100105177 3300005546 Bacteria 2027
214 Ga0070693_100556937 3300005547 Bacteria 821
215 Ga0070665_100006166 3300005548 Bacteria 12264
216 Ga0070665_100149739 3300005548 Bacteria 2336
217 Ga0070665_100189603 3300005548 Bacteria 2057
218 Ga0070665_100578965 3300005548 Bacteria 1135
219 Ga0070665_100588727 3300005548 Bacteria 1125
220 Ga0070665_100658220 3300005548 Bacteria 1060
221 Ga0070704_100474375 3300005549 Bacteria 1081
222 Ga0068855_100017220 3300005563 Bacteria 8696
223 Ga0068855_100324040 3300005563 Bacteria 1702
224 Ga0068855_100408666 3300005563 Bacteria 1487
225 Ga0068855_100516500 3300005563 Bacteria 1296
226 Ga0068855_100528959 3300005563 Bacteria 1278
227 Ga0068855_100748333 3300005563 Bacteria 1042
228 Ga0068855_100860885 3300005563 Bacteria 960
229 Ga0068855_101690612 3300005563 Bacteria 646
230 Ga0070664_100444593 3300005564 Bacteria 1189
231 Ga0070664_101316078 3300005564 Bacteria 682
232 Ga0068857_100250838 3300005577 Bacteria 1622
233 Ga0068857_100788810 3300005577 Bacteria 907
234 Ga0068854_100289438 3300005578 Bacteria 1321
235 Ga0068854_100367640 3300005578 Bacteria 1182
236 Ga0068854_100767970 3300005578 Bacteria 837
237 Ga0068856_100055880 3300005614 Bacteria 3895
238 Ga0068856_100137388 3300005614 Bacteria 2450
239 Ga0068856_100156445 3300005614 Bacteria 2289
240 Ga0068856_100489690 3300005614 Bacteria 1250
241 Ga0068856_100700160 3300005614 Bacteria 1033
242 Ga0068856_100817239 3300005614 Bacteria 951
243 Ga0070702_100640463 3300005615 Bacteria 802
244 Ga0068852_100626597 3300005616 Bacteria 1081
245 Ga0068852_101350716 3300005616 Bacteria 734
246 Ga0068852_101864462 3300005616 Bacteria 623
247 Ga0068859_100087579 3300005617 Bacteria 3162
248 Ga0068859_101045611 3300005617 Bacteria 897
249 Ga0068864_100514273 3300005618 Bacteria 1153
250 Ga0068864_101231776 3300005618 Bacteria 747
251 Ga0068866_10315407 3300005718 Bacteria 981
252 Ga0068861_100287874 3300005719 Bacteria 1417
253 Ga0068851_10105812 3300005834 Bacteria 1498
254 Ga0068851_10382695 3300005834 Bacteria 825
255 Ga0068858_100044764 3300005842 Bacteria 4102
256 Ga0068858_100281378 3300005842 Bacteria 1584
257 Ga0068858_100401297 3300005842 Bacteria 1317
258 Ga0068858_100622112 3300005842 Bacteria 1048
259 Ga0068858_100653539 3300005842 Bacteria 1022
260 Ga0068860_100078148 3300005843 Bacteria 3147
261 Ga0068860_100138904 3300005843 Bacteria 2334
262 Ga0068860_100671828 3300005843 Bacteria 1044
263 Ga0068862_100434499 3300005844 Bacteria 1234
264 Ga0081455_10011724 3300005937 Bacteria 8787
265 Ga0081540_1002663 3300005983 Bacteria 14523
266 Ga0081540_1014636 3300005983 Bacteria 5014
267 Ga0081540_1072665 3300005983 Bacteria 1584
268 Ga0081540_1186647 3300005983 Bacteria 769
269 Ga0081539_10000273 3300005985 Bacteria 117936
270 Ga0081539_10004419 3300005985 Bacteria 15563
271 Ga0081539_10038639 3300005985 Bacteria 2826
272 Ga0070717_10023212 3300006028 Bacteria 4912
273 Ga0070717_10257030 3300006028 Bacteria 1545
274 Ga0070717_11382128 3300006028 Bacteria 640
275 Ga0075365_10004647 3300006038 Bacteria 7309
276 Ga0075365_10027241 3300006038 Bacteria 3634
277 Ga0075365_10057229 3300006038 Bacteria 2593
278 Ga0075365_10062221 3300006038 Bacteria 2496
279 Ga0075365_10089365 3300006038 Bacteria 2097
280 Ga0075365_10121312 3300006038 Bacteria 1803
281 Ga0075365_10168486 3300006038 Bacteria 1528
282 Ga0075365_10206089 3300006038 Bacteria 1378
283 Ga0075365_10235649 3300006038 Bacteria 1285
284 Ga0075365_10255350 3300006038 Bacteria 1232
285 Ga0075365_10264031 3300006038 Bacteria 1210
286 Ga0075365_10626635 3300006038 Bacteria 760
287 Ga0075365_10747840 3300006038 Bacteria 690
288 Ga0075368_10085252 3300006042 Bacteria 1288
289 Ga0075368_10106170 3300006042 Bacteria 1155
290 Ga0075368_10117777 3300006042 Bacteria 1098
291 Ga0075368_10127719 3300006042 Bacteria 1055
292 Ga0075368_10203279 3300006042 Bacteria 838
293 Ga0075368_10240025 3300006042 Bacteria 773
294 Ga0075368_10410777 3300006042 Bacteria 595
295 Ga0075363_100073492 3300006048 Bacteria 1860
296 Ga0075363_100099958 3300006048 Bacteria 1604
297 Ga0075363_100141538 3300006048 Bacteria 1354
298 Ga0075363_100351063 3300006048 Bacteria 861
299 Ga0075363_100776260 3300006048 Bacteria 582
300 Ga0075364_10010552 3300006051 Bacteria 5585
301 Ga0075364_10036710 3300006051 Bacteria 3169
302 Ga0075364_10042063 3300006051 Bacteria 2968
303 Ga0075364_10119377 3300006051 Bacteria 1764
304 Ga0075364_10254910 3300006051 Bacteria 1192
305 Ga0075364_10316047 3300006051 Bacteria 1063
306 Ga0075364_10426515 3300006051 Bacteria 905
307 Ga0075364_10447344 3300006051 Bacteria 882
308 Ga0075364_10641372 3300006051 Bacteria 725
309 Ga0070715_10001968 3300006163 Bacteria 6192
310 Ga0070715_10011442 3300006163 Bacteria 3196
311 Ga0070715_10330699 3300006163 Bacteria 825
312 Ga0070716_100272909 3300006173 Bacteria 1163
313 Ga0070716_100470612 3300006173 Bacteria 920
314 Ga0070716_100473025 3300006173 Bacteria 918
315 Ga0070712_100025062 3300006175 Bacteria 3960
316 Ga0070712_100056366 3300006175 Bacteria 2756
317 Ga0070712_100060765 3300006175 Bacteria 2666
318 Ga0075362_10079775 3300006177 Bacteria 1507
319 Ga0075362_10110162 3300006177 Bacteria 1295
320 Ga0075362_10153066 3300006177 Bacteria 1107
321 Ga0075367_10033189 3300006178 Bacteria 2974
322 Ga0075367_10037524 3300006178 Bacteria 2816
323 Ga0075367_10054062 3300006178 Bacteria 2380
324 Ga0075367_10065439 3300006178 Bacteria 2177
325 Ga0075367_10308575 3300006178 Bacteria 996
326 Ga0075367_10586198 3300006178 Bacteria 708
327 Ga0075367_10691774 3300006178 Bacteria 648
328 Ga0075369_10014487 3300006186 Bacteria 3150
329 Ga0075369_10020381 3300006186 Bacteria 2715
330 Ga0075369_10037612 3300006186 Bacteria 2062
331 Ga0075369_10307634 3300006186 Bacteria 740
332 Ga0075369_10375803 3300006186 Bacteria 668
333 Ga0075366_10131212 3300006195 Bacteria 1512
334 Ga0075366_10138136 3300006195 Bacteria 1472
335 Ga0075366_10174089 3300006195 Bacteria 1306
336 Ga0075366_10355545 3300006195 Bacteria 899
337 Ga0075366_10807706 3300006195 Bacteria 583
338 Ga0097621_100292431 3300006237 Bacteria 1436
339 Ga0097621_100639187 3300006237 Bacteria 975
340 Ga0097621_101368845 3300006237 Bacteria 669
341 Ga0075370_10039567 3300006353 Bacteria 2657
342 Ga0075370_10062119 3300006353 Bacteria 2128
343 Ga0075370_10122384 3300006353 Bacteria 1515
344 Ga0075370_10161654 3300006353 Bacteria 1314
345 Ga0075370_10179770 3300006353 Bacteria 1245
346 Ga0075370_10187626 3300006353 Bacteria 1218
347 Ga0075370_10347804 3300006353 Bacteria 885
348 Ga0075370_10367753 3300006353 Bacteria 860
349 Ga0075370_10371994 3300006353 Bacteria 855
350 Ga0075370_10705560 3300006353 Bacteria 613
351 Ga0068871_100185062 3300006358 Bacteria 1791
352 Ga0068871_100308486 3300006358 Bacteria 1391
353 Ga0068871_100474415 3300006358 Bacteria 1124
354 Ga0075428_101573100 3300006844 Bacteria 688
355 Ga0075430_100224662 3300006846 Bacteria 1557
356 Ga0068865_101156479 3300006881 Bacteria 683
357 Ga0097620_100087577 3300006931 Bacteria 3162
358 Ga0097620_101045554 3300006931 Bacteria 897
359 Ga0099824_1018607 3300006942 Bacteria 5652
360 Ga0099824_1032925 3300006942 Bacteria 1803
361 Ga0099822_1005414 3300006943 Bacteria 16662
362 Ga0079104_1000547 3300006946 Bacteria 39191
363 Ga0079104_1065570 3300006946 Bacteria 772
364 Ga0079104_1065575 3300006946 Bacteria 772
365 Ga0075435_100092843 3300007076 Bacteria 2493
366 Ga0075435_100655224 3300007076 Bacteria 911
367 Ga0099794_10106923 3300007265 Bacteria 1399
368 Ga0099794_10477110 3300007265 Bacteria 655
369 Ga0099794_10550597 3300007265 Bacteria 609
370 Ga0099794_10556276 3300007265 Bacteria 606
371 Ga0099795_10055043 3300007788 Bacteria 1460
372 Ga0099795_10060930 3300007788 Bacteria 1400
373 Ga0105244_10078483 3300009036 Bacteria 1637
374 Ga0105250_10074943 3300009092 Bacteria 1369
375 Ga0105250_10164015 3300009092 Bacteria 928
376 Ga0105240_10000005 3300009093 Bacteria 702630
377 Ga0105240_10015249 3300009093 Bacteria 10455
378 Ga0105240_10349884 3300009093 Bacteria 1677
379 Ga0105240_10398679 3300009093 Bacteria 1550
380 Ga0105240_10501863 3300009093 Bacteria 1349
381 Ga0105240_10788852 3300009093 Bacteria 1030
382 Ga0105240_11016121 3300009093 Bacteria 886
383 Ga0105240_12181467 3300009093 Bacteria 574
384 Ga0111539_11432011 3300009094 Bacteria 801
385 Ga0105245_10811286 3300009098 Bacteria 974
386 Ga0105247_10042031 3300009101 Bacteria 2797
387 Ga0105247_10158943 3300009101 Bacteria 1495
388 Ga0105247_10183825 3300009101 Bacteria 1396
389 Ga0105247_10641537 3300009101 Bacteria 792
390 Ga0105247_10651234 3300009101 Bacteria 787
391 Ga0114129_10803025 3300009147 Bacteria 1200
392 Ga0105243_10336891 3300009148 Bacteria 1380
393 Ga0105243_10571340 3300009148 Bacteria 1084
394 Ga0105241_10145737 3300009174 Bacteria 1932
395 Ga0105241_10251998 3300009174 Bacteria 1497
396 Ga0105241_10421547 3300009174 Bacteria 1175
397 Ga0105241_10497460 3300009174 Bacteria 1086
398 Ga0105241_10721348 3300009174 Bacteria 912
399 Ga0105242_10350072 3300009176 Bacteria 1364
400 Ga0105242_10376779 3300009176 Bacteria 1318
401 Ga0105248_10284816 3300009177 Bacteria 1860
402 Ga0105237_10001070 3300009545 Bacteria 36790
403 Ga0105237_10054286 3300009545 Bacteria 4015
404 Ga0105237_10219809 3300009545 Bacteria 1900
405 Ga0105237_10745415 3300009545 Bacteria 986
406 Ga0105237_10896931 3300009545 Bacteria 893
407 Ga0105237_11112702 3300009545 Bacteria 797
408 Ga0105237_11633537 3300009545 Bacteria 651
409 Ga0105238_10012597 3300009551 Bacteria 8537
410 Ga0105238_10026677 3300009551 Bacteria 5890
411 Ga0105238_10144804 3300009551 Bacteria 2352
412 Ga0105238_11115291 3300009551 Bacteria 812
413 Ga0105238_11215300 3300009551 Bacteria 778
414 Ga0105249_10147904 3300009553 Bacteria 2259
415 Ga0105249_10154860 3300009553 Bacteria 2209
416 Ga0105249_10357884 3300009553 Bacteria 1480
417 Ga0105249_10359397 3300009553 Bacteria 1477
418 Ga0105249_10406344 3300009553 Bacteria 1393
419 Ga0105249_11188666 3300009553 Bacteria 833
420 Ga0123340_1058714 3300009763 Bacteria 1164
421 Ga0123341_1005490 3300009765 Bacteria 11313
422 Ga0123341_1017290 3300009765 Bacteria 6322
423 Ga0123342_1018253 3300009766 Bacteria 5633
424 Ga0123342_1019698 3300009766 Bacteria 5085
425 Ga0105239_10008784 3300010375 Bacteria 11435
426 Ga0105239_10501837 3300010375 Bacteria 1379
427 Ga0105239_10530800 3300010375 Bacteria 1339
428 Ga0105239_10687690 3300010375 Bacteria 1169
429 Ga0105239_10707819 3300010375 Bacteria 1152
430 Ga0105239_11224442 3300010375 Bacteria 865
431 Ga0105239_11811102 3300010375 Bacteria 707
432 Ga0105246_10278490 3300011119 Bacteria 1341
433 Ga0105246_10860944 3300011119 Bacteria 809
434 Ga0157336_1011556 3300012477 Bacteria 688
435 Ga0157337_1004344 3300012483 Bacteria 900
436 Ga0157322_1011849 3300012490 Bacteria 725
437 Ga0157335_1017071 3300012492 Bacteria 654
438 Ga0157341_1003500 3300012494 Bacteria 1098
439 Ga0157326_1004470 3300012513 Bacteria 1469
440 Ga0157373_10011316 3300013100 Bacteria 6560
441 Ga0157373_10235722 3300013100 Bacteria 1293
442 Ga0157371_10221421 3300013102 Bacteria 1359
443 Ga0157371_10269063 3300013102 Bacteria 1229
444 Ga0157370_10235560 3300013104 Bacteria 1694
445 Ga0157370_10280834 3300013104 Bacteria 1539
446 Ga0157369_10030062 3300013105 Bacteria 5994
447 Ga0157369_10066010 3300013105 Bacteria 3894
448 Ga0157369_10592128 3300013105 Bacteria 1145
449 Ga0171463_1011 3300013249 Bacteria 230603
450 Ga0157378_11749985 3300013297 Bacteria 669
451 Ga0163162_10420389 3300013306 Bacteria 1469
452 Ga0163162_10599872 3300013306 Bacteria 1227
453 Ga0163162_10601306 3300013306 Bacteria 1226
454 Ga0163162_11570527 3300013306 Bacteria 750
455 Ga0157372_10252779 3300013307 Bacteria 2046
456 Ga0157372_11662276 3300013307 Bacteria 735
457 Ga0157375_10809287 3300013308 Bacteria 1085
458 Ga0163163_10283279 3300014325 Bacteria 1709
459 Ga0163163_11277198 3300014325 Bacteria 796
460 Ga0163163_12127994 3300014325 Bacteria 621
461 Ga0163163_12210041 3300014325 Bacteria 609
462 Ga0157380_10906414 3300014326 Bacteria 908
463 Ga0182008_10702647 3300014497 Bacteria 578
464 Ga0157377_10577928 3300014745 Bacteria 798
465 Ga0157379_10555742 3300014968 Bacteria 1068
466 Ga0157379_10845111 3300014968 Bacteria 866
467 Ga0157379_11039853 3300014968 Bacteria 782
468 Ga0157379_11435066 3300014968 Bacteria 670
469 Ga0157376_10329717 3300014969 Bacteria 1454
470 Ga0157376_10360807 3300014969 Bacteria 1393
471 Ga0182006_1076059 3300015261 Bacteria 1234
472 Ga0182007_10070537 3300015262 Bacteria 1145
473 Ga0182005_1065239 3300015265 Bacteria 996
474 Ga0183363_1121 3300015690 Bacteria 20584
475 Ga0163161_11005207 3300017792 Bacteria 712
476 Ga0163161_11196992 3300017792 Bacteria 657
477 Ga0214544_1002211 3300021320 Bacteria 40993
478 Ga0214542_1002553 3300021321 Bacteria 37593
479 Ga0214542_1023288 3300021321 Bacteria 3746
480 Ga0214543_1000032 3300021327 Bacteria 200766
481 Ga0214543_1005345 3300021327 Bacteria 23734
482 Ga0213874_10007273 3300021377 Bacteria 2651
483 Ga0213876_10076608 3300021384 Bacteria 1766
484 Ga0213875_10069901 3300021388 Bacteria 1639
485 Ga0213875_10173625 3300021388 Bacteria 1012
486 Ga0213871_10039050 3300021441 Bacteria 1269
487 Ga0228711_1000015 3300022739 Bacteria 126974
488 Ga0228710_1000015 3300022740 Bacteria 133640
489 Ga0209435_100024 3300025206 Bacteria 199665
490 Ga0209436_100747 3300025208 Bacteria 13472
491 Ga0209436_102829 3300025208 Bacteria 4929
492 Ga0209436_113709 3300025208 Bacteria 1314
493 Ga0209563_105579 3300025230 Bacteria 2258
494 Ga0207427_104571 3300025231 Bacteria 2268
495 Ga0209437_100969 3300025233 Bacteria 10256
496 Ga0209437_100970 3300025233 Bacteria 10253
497 Ga0207425_1000010 3300025245 Bacteria 572898
498 Ga0207425_1010336 3300025245 Bacteria 2277
499 Ga0207425_1027304 3300025245 Bacteria 1165
500 Ga0207425_1028939 3300025245 Bacteria 1120
501 Ga0207425_1059856 3300025245 Bacteria 674
502 Ga0207425_1063179 3300025245 Bacteria 649
503 Ga0209646_1000064 3300025246 Bacteria 246524
504 Ga0209646_1008880 3300025246 Bacteria 1606
505 Ga0209026_1000002 3300025250 Bacteria 1136158
506 Ga0209026_1000053 3300025250 Bacteria 246524
507 Ga0209677_100816 3300025253 Bacteria 15575
508 Ga0209677_102830 3300025253 Bacteria 6135
509 Ga0209148_1000038 3300025254 Bacteria 493744
510 Ga0209148_1018493 3300025254 Bacteria 1169
511 Ga0209759_1000042 3300025256 Bacteria 246524
512 Ga0209759_1000119 3300025256 Bacteria 141051
513 Ga0209129_1003311 3300025258 Bacteria 7110
514 Ga0209129_1003860 3300025258 Bacteria 6244
515 Ga0209129_1004622 3300025258 Bacteria 5273
516 Ga0209129_1009973 3300025258 Bacteria 2423
517 Ga0209129_1013981 3300025258 Bacteria 1732
518 Ga0209129_1021010 3300025258 Bacteria 1204
519 Ga0209129_1035221 3300025258 Bacteria 815
520 Ga0209233_1000188 3300025261 Bacteria 132904
521 Ga0209233_1000925 3300025261 Bacteria 12809
522 Ga0209233_1003053 3300025261 Bacteria 5953
523 Ga0209233_1006179 3300025261 Bacteria 3881
524 Ga0209233_1007083 3300025261 Bacteria 3577
525 Ga0209233_1011270 3300025261 Bacteria 2639
526 Ga0209233_1013455 3300025261 Bacteria 2336
527 Ga0209233_1050210 3300025261 Bacteria 853
528 Ga0209565_1019241 3300025263 Bacteria 1462
529 Ga0209565_1021440 3300025263 Bacteria 1351
530 Ga0207666_1004017 3300025271 Bacteria 1830
531 Ga0209455_1000204 3300025272 Bacteria 85420
532 Ga0209673_1000825 3300025273 Bacteria 40781
533 Ga0209673_1000864 3300025273 Bacteria 39329
534 Ga0209673_1001977 3300025273 Bacteria 15950
535 Ga0209673_1012038 3300025273 Bacteria 3516
536 Ga0209673_1014347 3300025273 Bacteria 3068
537 Ga0209673_1029006 3300025273 Bacteria 1769
538 Ga0209130_1000006 3300025284 Bacteria 596528
539 Ga0209130_1000007 3300025284 Bacteria 591584
540 Ga0209130_1001130 3300025284 Bacteria 19559
541 Ga0209130_1021190 3300025284 Bacteria 1472
542 Ga0209130_1022665 3300025284 Bacteria 1396
543 Ga0207673_1001859 3300025290 Bacteria 2351
544 Ga0209676_1001545 3300025292 Bacteria 20721
545 Ga0209676_1002955 3300025292 Bacteria 11087
546 Ga0209676_1029437 3300025292 Bacteria 1695
547 Ga0209025_1000022 3300025294 Bacteria 574487
548 Ga0209025_1000303 3300025294 Bacteria 110086
549 Ga0209025_1018223 3300025294 Bacteria 3999
550 Ga0209025_1035969 3300025294 Bacteria 2226
551 Ga0209025_1076174 3300025294 Bacteria 1163
552 Ga0209025_1108888 3300025294 Bacteria 856
553 Ga0209025_1114335 3300025294 Bacteria 821
554 Ga0209025_1158082 3300025294 Bacteria 615
555 Ga0209564_1000140 3300025295 Bacteria 179856
556 Ga0209564_1002708 3300025295 Bacteria 13379
557 Ga0209564_1006724 3300025295 Bacteria 6113
558 Ga0209564_1028708 3300025295 Bacteria 1769
559 Ga0209564_1028709 3300025295 Bacteria 1769
560 Ga0209564_1038119 3300025295 Bacteria 1342
561 Ga0209564_1044462 3300025295 Bacteria 1152
562 Ga0209564_1059134 3300025295 Bacteria 871
563 Ga0209564_1060915 3300025295 Bacteria 844
564 Ga0209758_1000584 3300025297 Bacteria 56878
565 Ga0209758_1005081 3300025297 Bacteria 10418
566 Ga0209758_1005457 3300025297 Bacteria 9780
567 Ga0209758_1006057 3300025297 Bacteria 8913
568 Ga0209758_1007716 3300025297 Bacteria 7224
569 Ga0209758_1007810 3300025297 Bacteria 7143
570 Ga0209758_1067228 3300025297 Bacteria 1147
571 Ga0209758_1094800 3300025297 Bacteria 864
572 Ga0209758_1101405 3300025297 Bacteria 818
573 Ga0209758_1103555 3300025297 Bacteria 803
574 Ga0209758_1111129 3300025297 Bacteria 758
575 Ga0209050_1002103 3300025298 Bacteria 18193
576 Ga0209050_1003219 3300025298 Bacteria 12352
577 Ga0209256_1002683 3300025299 Bacteria 13954
578 Ga0209256_1004555 3300025299 Bacteria 8604
579 Ga0209256_1005314 3300025299 Bacteria 7491
580 Ga0209256_1015662 3300025299 Bacteria 2637
581 Ga0209256_1026985 3300025299 Bacteria 1644
582 Ga0209256_1044054 3300025299 Bacteria 1116
583 Ga0209256_1074909 3300025299 Bacteria 752
584 Ga0207426_1000003 3300025302 Bacteria 1063212
585 Ga0207426_1000044 3300025302 Bacteria 428043
586 Ga0207426_1000064 3300025302 Bacteria 358276
587 Ga0207426_1000605 3300025302 Bacteria 46505
588 Ga0207426_1003449 3300025302 Bacteria 8580
589 Ga0207426_1004394 3300025302 Bacteria 6901
590 Ga0207426_1033419 3300025302 Bacteria 1658
591 Ga0207426_1102888 3300025302 Bacteria 734
592 Ga0209051_1000914 3300025303 Bacteria 29357
593 Ga0209051_1002149 3300025303 Bacteria 14647
594 Ga0209051_1049570 3300025303 Bacteria 1413
595 Ga0209051_1058167 3300025303 Bacteria 1234
596 Ga0209051_1092745 3300025303 Bacteria 835
597 Ga0209051_1100821 3300025303 Bacteria 777
598 Ga0209051_1101244 3300025303 Bacteria 774
599 Ga0209257_1000817 3300025304 Bacteria 45150
600 Ga0209257_1002507 3300025304 Bacteria 18088
601 Ga0209257_1014551 3300025304 Bacteria 3371
602 Ga0209257_1081649 3300025304 Bacteria 828
603 Ga0209257_1087031 3300025304 Bacteria 788
604 Ga0207697_10183153 3300025315 Bacteria 918
605 Ga0207656_10169352 3300025321 Bacteria 1043
606 Ga0207696_1059111 3300025711 Bacteria 1081
607 Ga0207696_1066851 3300025711 Bacteria 1004
608 Ga0207653_10002069 3300025885 Bacteria 6392
609 Ga0207682_10188622 3300025893 Bacteria 944
610 Ga0207692_10143795 3300025898 Bacteria 1359
611 Ga0207692_10182104 3300025898 Bacteria 1224
612 Ga0207692_10251460 3300025898 Bacteria 1059
613 Ga0207642_10153786 3300025899 Bacteria 1228
614 Ga0207642_10154579 3300025899 Bacteria 1225
615 Ga0207710_10066137 3300025900 Bacteria 1649
616 Ga0207710_10118810 3300025900 Bacteria 1261
617 Ga0207688_10036755 3300025901 Bacteria 2715
618 Ga0207688_10170052 3300025901 Bacteria 1295
619 Ga0207680_10151154 3300025903 Bacteria 1548
620 Ga0207680_10268268 3300025903 Bacteria 1183
621 Ga0207680_10269652 3300025903 Bacteria 1180
622 Ga0207680_10678482 3300025903 Bacteria 738
623 Ga0207647_10020923 3300025904 Bacteria 4377
624 Ga0207647_10123459 3300025904 Bacteria 1526
625 Ga0207647_10167943 3300025904 Bacteria 1278
626 Ga0207685_10075648 3300025905 Bacteria 1378
627 Ga0207699_10048434 3300025906 Bacteria 2497
628 Ga0207699_10747762 3300025906 Bacteria 717
629 Ga0207645_10216210 3300025907 Bacteria 1263
630 Ga0207645_10345962 3300025907 Bacteria 994
631 Ga0207643_10012061 3300025908 Bacteria 4668
632 Ga0207705_10424032 3300025909 Bacteria 1030
633 Ga0207705_10897083 3300025909 Bacteria 687
634 Ga0207654_10111792 3300025911 Bacteria 1701
635 Ga0207654_10162516 3300025911 Bacteria 1444
636 Ga0207654_10243499 3300025911 Bacteria 1203
637 Ga0207707_10091218 3300025912 Bacteria 2663
638 Ga0207707_10110359 3300025912 Bacteria 2404
639 Ga0207695_10000011 3300025913 Bacteria 910221
640 Ga0207695_10000599 3300025913 Bacteria 72238
641 Ga0207695_10185740 3300025913 Bacteria 1998
642 Ga0207695_10347578 3300025913 Bacteria 1371
643 Ga0207695_10602979 3300025913 Bacteria 979
644 Ga0207695_10916655 3300025913 Bacteria 756
645 Ga0207671_10001852 3300025914 Bacteria 23614
646 Ga0207671_10041691 3300025914 Bacteria 3398
647 Ga0207671_10074646 3300025914 Bacteria 2535
648 Ga0207671_10137222 3300025914 Bacteria 1882
649 Ga0207671_10169506 3300025914 Bacteria 1695
650 Ga0207671_10262894 3300025914 Bacteria 1358
651 Ga0207671_10307566 3300025914 Bacteria 1253
652 Ga0207693_10001926 3300025915 Bacteria 18180
653 Ga0207693_10022819 3300025915 Bacteria 4968
654 Ga0207693_10896374 3300025915 Bacteria 681
655 Ga0207663_10000218 3300025916 Bacteria 25518
656 Ga0207663_10278254 3300025916 Bacteria 1242
657 Ga0207663_10633030 3300025916 Bacteria 843
658 Ga0207660_10125797 3300025917 Bacteria 1946
659 Ga0207660_10196644 3300025917 Bacteria 1573
660 Ga0207660_10719386 3300025917 Bacteria 814
661 Ga0207660_10980937 3300025917 Bacteria 689
662 Ga0207662_10029232 3300025918 Bacteria 3192
663 Ga0207657_10011937 3300025919 Bacteria 8597
664 Ga0207657_10042894 3300025919 Bacteria 3988
665 Ga0207657_10184754 3300025919 Bacteria 1684
666 Ga0207649_10278021 3300025920 Bacteria 1216
667 Ga0207649_10295983 3300025920 Bacteria 1182
668 Ga0207649_10745714 3300025920 Bacteria 762
669 Ga0207652_10014975 3300025921 Bacteria 6291
670 Ga0207652_10051466 3300025921 Bacteria 3531
671 Ga0207652_10178552 3300025921 Bacteria 1907
672 Ga0207652_10247386 3300025921 Bacteria 1608
673 Ga0207646_10024544 3300025922 Bacteria 5523
674 Ga0207681_10583279 3300025923 Bacteria 922
675 Ga0207681_10624399 3300025923 Bacteria 892
676 Ga0207694_10017395 3300025924 Bacteria 5436
677 Ga0207694_10058951 3300025924 Bacteria 2986
678 Ga0207694_10577698 3300025924 Bacteria 944
679 Ga0207694_10581697 3300025924 Bacteria 941
680 Ga0207694_10582934 3300025924 Bacteria 940
681 Ga0207650_10002132 3300025925 Bacteria 13834
682 Ga0207687_10174946 3300025927 Bacteria 1659
683 Ga0207687_10312348 3300025927 Bacteria 1270
684 Ga0207700_10028497 3300025928 Bacteria 3927
685 Ga0207700_10162421 3300025928 Bacteria 1856
686 Ga0207664_10008551 3300025929 Bacteria 7147
687 Ga0207664_10019269 3300025929 Bacteria 5040
688 Ga0207664_10842846 3300025929 Bacteria 824
689 Ga0207644_10052527 3300025931 Bacteria 2929
690 Ga0207644_10362620 3300025931 Bacteria 1179
691 Ga0207644_10588068 3300025931 Bacteria 923
692 Ga0207690_10180895 3300025932 Bacteria 1587
693 Ga0207706_10017336 3300025933 Bacteria 6487
694 Ga0207706_10024819 3300025933 Bacteria 5373
695 Ga0207706_10177321 3300025933 Bacteria 1872
696 Ga0207706_10691664 3300025933 Bacteria 872
697 Ga0207686_10113572 3300025934 Bacteria 1831
698 Ga0207709_10125723 3300025935 Bacteria 1739
699 Ga0207709_10213516 3300025935 Bacteria 1387
700 Ga0207709_10479660 3300025935 Bacteria 967
701 Ga0207670_10765472 3300025936 Bacteria 803
702 Ga0207670_10838880 3300025936 Bacteria 767
703 Ga0207669_10129274 3300025937 Bacteria 1732
704 Ga0207669_10148688 3300025937 Bacteria 1637
705 Ga0207669_10977420 3300025937 Bacteria 710
706 Ga0207665_10005572 3300025939 Bacteria 8396
707 Ga0207665_10096951 3300025939 Bacteria 2052
708 Ga0207665_10626583 3300025939 Bacteria 841
709 Ga0207665_10896494 3300025939 Bacteria 703
710 Ga0207665_10998136 3300025939 Bacteria 666
711 Ga0207691_10213024 3300025940 Bacteria 1677
712 Ga0207691_10676163 3300025940 Bacteria 871
713 Ga0207691_10815269 3300025940 Bacteria 784
714 Ga0207711_10724750 3300025941 Bacteria 927
715 Ga0207661_10202043 3300025944 Bacteria 1747
716 Ga0207667_10012912 3300025949 Bacteria 9594
717 Ga0207667_10374831 3300025949 Bacteria 1450
718 Ga0207667_10708426 3300025949 Bacteria 1009
719 Ga0207667_11025820 3300025949 Bacteria 811
720 Ga0207667_11056972 3300025949 Bacteria 797
721 Ga0207712_10265973 3300025961 Bacteria 1393
722 Ga0207712_10377846 3300025961 Bacteria 1185
723 Ga0207712_10439966 3300025961 Bacteria 1104
724 Ga0207712_10563146 3300025961 Bacteria 982
725 Ga0207712_10836207 3300025961 Bacteria 811
726 Ga0207712_11447523 3300025961 Bacteria 615
727 Ga0207668_10034259 3300025972 Bacteria 3371
728 Ga0207668_10115150 3300025972 Bacteria 2025
729 Ga0207668_10335973 3300025972 Bacteria 1258
730 Ga0207640_10082080 3300025981 Bacteria 2206
731 Ga0207640_10095376 3300025981 Bacteria 2071
732 Ga0207640_10290151 3300025981 Bacteria 1289
733 Ga0207640_10576471 3300025981 Bacteria 949
734 Ga0207658_10537705 3300025986 Bacteria 1044
735 Ga0207677_11066392 3300026023 Bacteria 735
736 Ga0207677_11403137 3300026023 Bacteria 643
737 Ga0207703_10082720 3300026035 Bacteria 2680
738 Ga0207703_10215009 3300026035 Bacteria 1716
739 Ga0207703_10437335 3300026035 Bacteria 1220
740 Ga0207703_10568359 3300026035 Bacteria 1070
741 Ga0207703_10735320 3300026035 Bacteria 939
742 Ga0207639_10032054 3300026041 Bacteria 3866
743 Ga0207639_10060119 3300026041 Bacteria 2931
744 Ga0207639_10226993 3300026041 Bacteria 1616
745 Ga0207678_10014673 3300026067 Bacteria 6894
746 Ga0207678_10105086 3300026067 Bacteria 2409
747 Ga0207678_10116776 3300026067 Bacteria 2277
748 Ga0207678_10931100 3300026067 Bacteria 769
749 Ga0207708_10809324 3300026075 Bacteria 807
750 Ga0207702_10417925 3300026078 Bacteria 1296
751 Ga0207702_10498187 3300026078 Bacteria 1187
752 Ga0207702_11162490 3300026078 Bacteria 766
753 Ga0207641_10040588 3300026088 Bacteria 3898
754 Ga0207641_10591440 3300026088 Bacteria 1085
755 Ga0207641_10889212 3300026088 Bacteria 884
756 Ga0207648_10011030 3300026089 Bacteria 8530
757 Ga0207676_10568268 3300026095 Bacteria 1085
758 Ga0207676_11301193 3300026095 Bacteria 722
759 Ga0207674_10068821 3300026116 Bacteria 3562
760 Ga0207674_10151658 3300026116 Bacteria 2275
761 Ga0207674_10188280 3300026116 Bacteria 2014
762 Ga0207675_100040050 3300026118 Bacteria 4372
763 Ga0207675_100604527 3300026118 Bacteria 1100
764 Ga0207683_10053025 3300026121 Bacteria 3555
765 Ga0207698_10583192 3300026142 Bacteria 1100
766 Ga0207698_11598754 3300026142 Bacteria 667
767 Ga0209281_1000573 3300027111 Bacteria 43668
768 Ga0209281_1001498 3300027111 Bacteria 13357
769 Ga0209389_1002002 3300027296 Bacteria 15108
770 Ga0209371_1002385 3300027312 Bacteria 10609
771 Ga0209371_1058949 3300027312 Bacteria 710
772 Ga0209589_1000009 3300027357 Bacteria 252104
773 Ga0209589_1000300 3300027357 Bacteria 63625
774 Ga0209489_100010 3300027361 Bacteria 252139
775 Ga0209700_100017 3300027363 Bacteria 252104
776 Ga0209179_1017049 3300027512 Bacteria 1371
777 Ga0209179_1059062 3300027512 Bacteria 831
778 Ga0209282_1000054 3300027666 Bacteria 101427
779 Ga0209813_10036049 3300027866 Bacteria 1484
780 Ga0209813_10049896 3300027866 Bacteria 1304
781 Ga0209813_10153312 3300027866 Bacteria 827
782 Ga0209813_10227598 3300027866 Bacteria 700
783 Ga0209974_10092975 3300027876 Bacteria 1047
784 Ga0209974_10123372 3300027876 Bacteria 919
785 Ga0268266_10012436 3300028379 Bacteria 7358
786 Ga0268266_10014157 3300028379 Bacteria 6863
787 Ga0268266_10020829 3300028379 Bacteria 5592
788 Ga0268266_10073688 3300028379 Bacteria 2963
789 Ga0268266_10163131 3300028379 Bacteria 2017
790 Ga0268266_10247200 3300028379 Bacteria 1649
791 Ga0268266_10532816 3300028379 Bacteria 1124
792 Ga0268266_10790242 3300028379 Bacteria 916
793 Ga0268266_11139255 3300028379 Bacteria 754
794 Ga0268266_11248062 3300028379 Bacteria 718
795 Ga0268265_10198713 3300028380 Bacteria 1737
796 Ga0268265_10366074 3300028380 Bacteria 1321
797 Ga0268264_10000655 3300028381 Bacteria 40734
798 Ga0268264_10447926 3300028381 Bacteria 1250
799 Ga0265326_10001795 3300028558 Bacteria 7402
800 Ga0265319_1001825 3300028563 Bacteria 12143
801 Ga0265334_10000469 3300028573 Bacteria 20809
802 Ga0265318_10007417 3300028577 Bacteria 4956
803 Ga0265323_10001237 3300028653 Bacteria 12839
804 Ga0265336_10000535 3300028666 Bacteria 21804
805 Ga0307517_10000125 3300028786 Bacteria 115466
806 Ga0307515_10001393 3300028794 Bacteria 54715
807 Ga0307515_10040194 3300028794 Bacteria 7404
808 Ga0307515_10065844 3300028794 Bacteria 5032
809 Ga0307515_10100071 3300028794 Bacteria 3513
810 Ga0307515_10182119 3300028794 Bacteria 2046
811 Ga0307515_10398804 3300028794 Bacteria 1002
812 Ga0265338_10000131 3300028800 Bacteria 137627
813 Ga0265338_10168673 3300028800 Bacteria 1682
814 Ga0311001_1103890 3300029277 Bacteria 1796
815 Ga0310981_1004097 3300029285 Bacteria 1425
816 Ga0265324_10001269 3300029957 Bacteria 14862
817 Ga0268256_1002127 3300030500 Bacteria 10559
818 Ga0268256_1072371 3300030500 Bacteria 661
819 Ga0307511_10071057 3300030521 Bacteria 2542
820 Ga0265330_10313325 3300031235 Bacteria 662
821 Ga0265332_10026568 3300031238 Bacteria 2539
822 Ga0265325_10057917 3300031241 Bacteria 1975
823 Ga0265339_10030677 3300031249 Bacteria 3043
824 Ga0265316_10148533 3300031344 Bacteria 1757
825 Ga0265316_10187162 3300031344 Bacteria 1540
826 Ga0307513_10005182 3300031456 Bacteria 17271
827 Ga0307513_10143103 3300031456 Bacteria 2314
828 Ga0307513_10304695 3300031456 Bacteria 1358
829 Ga0307513_10327399 3300031456 Bacteria 1288
830 Ga0307513_10580817 3300031456 Bacteria 831
831 Ga0307513_10585943 3300031456 Bacteria 825
832 Ga0307509_10041031 3300031507 Bacteria 5027
833 Ga0307509_10353192 3300031507 Bacteria 1192
834 Ga0307408_100012729 3300031548 Bacteria 5578
835 Ga0307408_100016332 3300031548 Bacteria 4953
836 Ga0307408_100027626 3300031548 Bacteria 3913
837 Ga0307408_100038322 3300031548 Bacteria 3381
838 Ga0307408_100776864 3300031548 Bacteria 867
839 Ga0265313_10003614 3300031595 Bacteria 12415
840 Ga0307508_10000378 3300031616 Bacteria 53801
841 Ga0307508_10044639 3300031616 Bacteria 3962
842 Ga0307508_10096553 3300031616 Bacteria 2547
843 Ga0307508_10117010 3300031616 Bacteria 2267
844 Ga0307508_10189157 3300031616 Bacteria 1660
845 Ga0307508_10326929 3300031616 Bacteria 1125
846 Ga0316575_10144645 3300031665 Bacteria 979
847 Ga0265314_10017878 3300031711 Bacteria 5552
848 Ga0265342_10020769 3300031712 Bacteria 4203
849 Ga0307516_10114735 3300031730 Bacteria 2491
850 Ga0307516_10174401 3300031730 Bacteria 1888
851 Ga0307516_10207509 3300031730 Bacteria 1675
852 Ga0307405_10050000 3300031731 Bacteria 2586
853 Ga0307405_10083046 3300031731 Bacteria 2099
854 Ga0307405_10113053 3300031731 Bacteria 1843
855 Ga0307405_10192671 3300031731 Bacteria 1474
856 Ga0307405_10199654 3300031731 Bacteria 1451
857 Ga0307405_10381714 3300031731 Bacteria 1097
858 Ga0307413_10126131 3300031824 Bacteria 1743
859 Ga0307413_10253244 3300031824 Bacteria 1307
860 Ga0307410_10007156 3300031852 Bacteria 6085
861 Ga0307410_10201000 3300031852 Bacteria 1521
862 Ga0307410_10316483 3300031852 Bacteria 1237
863 Ga0307410_10508370 3300031852 Bacteria 992
864 Ga0307406_10036624 3300031901 Bacteria 3024
865 Ga0307406_10251323 3300031901 Bacteria 1332
866 Ga0307406_10419198 3300031901 Bacteria 1066
867 Ga0307406_10447080 3300031901 Bacteria 1036
868 Ga0307407_10011518 3300031903 Bacteria 4213
869 Ga0307407_10662297 3300031903 Bacteria 783
870 Ga0307412_10041042 3300031911 Bacteria 2996
871 Ga0307412_10076697 3300031911 Bacteria 2297
872 Ga0307412_10118477 3300031911 Bacteria 1902
873 Ga0307412_10137880 3300031911 Bacteria 1782
874 Ga0307412_10163888 3300031911 Bacteria 1655
875 Ga0307412_10241880 3300031911 Bacteria 1396
876 Ga0315914_1000013 3300031967 Bacteria 133640
877 Ga0307409_100004876 3300031995 Bacteria 7628
878 Ga0307409_100045054 3300031995 Bacteria 3327
879 Ga0307409_101062512 3300031995 Bacteria 830
880 Ga0307409_101947674 3300031995 Bacteria 617
881 Ga0307416_100010349 3300032002 Bacteria 6157
882 Ga0307416_100047875 3300032002 Bacteria 3388
883 Ga0307416_100221340 3300032002 Bacteria 1815
884 Ga0307416_100334228 3300032002 Bacteria 1524
885 Ga0307416_100433393 3300032002 Bacteria 1362
886 Ga0307416_100456649 3300032002 Bacteria 1331
887 Ga0307416_100729760 3300032002 Bacteria 1082
888 Ga0307416_100909837 3300032002 Bacteria 980
889 Ga0307416_101763188 3300032002 Bacteria 723
890 Ga0307414_10022676 3300032004 Bacteria 3966
891 Ga0307414_10023691 3300032004 Bacteria 3898
892 Ga0307414_10367138 3300032004 Bacteria 1240
893 Ga0307414_11500318 3300032004 Bacteria 627
894 Ga0307415_100010922 3300032126 Bacteria 5167
895 Ga0307415_100102687 3300032126 Bacteria 2101
896 Ga0307415_100194833 3300032126 Bacteria 1602
897 Ga0307415_100212815 3300032126 Bacteria 1543
898 Ga0307415_100442306 3300032126 Bacteria 1121
899 Ga0307415_100475817 3300032126 Bacteria 1086
900 Ga0316593_10011301 3300032168 Bacteria 2590
901 Ga0316593_10155232 3300032168 Bacteria 834
902 Ga0307507_10023232 3300033179 Bacteria 6813
903 Ga0307507_10309089 3300033179 Bacteria 962
904 Ga0307510_10019223 3300033180 Bacteria 8016
905 Ga0307510_10075120 3300033180 Bacteria 3334
906 Ga0307510_10227413 3300033180 Bacteria 1371
907 Ga0315913_1000097 3300033430 Bacteria 51051
908 Ga0315911_1000009 3300033442 Bacteria 379354
909 Ga0315915_1000001 3300033464 Bacteria 481518
910 Ga0316586_1022492 3300033527 Bacteria 1048
911 Ga0316215_1006608 3300033544 Bacteria 1125
912 Ga0316215_1007336 3300033544 Bacteria 1074
913 Ga0316214_1003835 3300033545 Bacteria 1910
914 Ga0373930_0060467 3300034816 Bacteria 844
915 Ga0373926_0068693 3300035083 Bacteria 1299
916 Ga0373926_0183521 3300035083 Bacteria 802
917 Ga0373934_0038719 3300035086 Bacteria 1878
918 Ga0373940_0085362 3300035088 Bacteria 939
919 Ga0373944_0024464 3300035089 Bacteria 1771
920 Ga0373949_0023572 3300035090 Bacteria 1426
921 Ga0373952_0007333 3300035092 Bacteria 2065
922 Ga0373923_0070704 3300035111 Bacteria 1498
923 Ga0373936_0022605 3300035113 Bacteria 2448
924 Ga0373936_0113018 3300035113 Bacteria 1154
925 Ga0373936_0130018 3300035113 Bacteria 1081
926 Ga0373945_0009397 3300035116 Bacteria 3203
927 Ga0373953_0089085 3300035117 Bacteria 1289
928 Ga0373954_0000100 3300035118 Bacteria 28999
929 Ga0373954_0012064 3300035118 Bacteria 3839
930 Ga0373954_0180527 3300035118 Bacteria 1035
931 Ga0373956_0015818 3300035119 Bacteria 3163
932 Ga0373956_0061795 3300035119 Bacteria 1697
933 Ga0373943_0003463 3300035170 Bacteria 7175
934 Ga0373943_0013859 3300035170 Bacteria 3645
935 Ga0373943_0125965 3300035170 Bacteria 1366
936 Ga0373946_0005668 3300035171 Bacteria 4513
937 Ga0373946_0029093 3300035171 Bacteria 2197
938 Ga0373955_0003141 3300035172 Bacteria 7226
939 Ga0373955_0154665 3300035172 Bacteria 1351
940 Ga0373955_0368936 3300035172 Bacteria 870
941 Ga0373961_0124000 3300035241 Bacteria 859
942 Ga0373962_0119763 3300035242 Bacteria 838
943 Ga0316574_0310493 3300035398 Bacteria 1002
944 Ga0373924_0002732 3300035410 Bacteria 5961
945 Ga0373924_0070831 3300035410 Bacteria 1470
946 Ga0373931_0051137 3300035691 Bacteria 2200
947 Ga0373935_0006317 3300035692 Bacteria 7061
948 Ga0373935_0010090 3300035692 Bacteria 5657
949 Ga0373935_0047345 3300035692 Bacteria 2718
950 Ga0373935_0069246 3300035692 Bacteria 2272
951 Ga0373935_0080178 3300035692 Bacteria 2120
952 Ga0373935_0101688 3300035692 Bacteria 1896
953 Ga0373935_1310739 3300035692 Bacteria 541
954 Ga0373927_0019967 3300035695 Bacteria 4394
955 Ga0373927_0025263 3300035695 Bacteria 3882
956 Ga0373927_0025754 3300035695 Bacteria 3845
957 Ga0373927_0050046 3300035695 Bacteria 2701
958 Ga0373927_0210714 3300035695 Bacteria 1276
959 Ga0373933_0032326 3300035724 Bacteria 3041
960 Ga0373933_0153266 3300035724 Bacteria 1460
961 Ga0373933_0158464 3300035724 Bacteria 1436
962 Ga0373947_0005298 3300035725 Bacteria 7541
963 Ga0373947_0015233 3300035725 Bacteria 4414
964 Ga0310104_00079 3300036242 Bacteria 4049
965 Ga0373937_0372659 3300036401 Bacteria 1353
966 Ga0373937_0870788 3300036401 Bacteria 849
967 Ga0310112_018869 3300036458 Bacteria 972
968 Ga0373925_0005636 3300037068 Bacteria 9315
969 Ga0373925_0008352 3300037068 Bacteria 7539
970 Ga0373925_0045136 3300037068 Bacteria 3273
971 Ga0373925_0298656 3300037068 Bacteria 1300
972 Ga0373925_0385728 3300037068 Bacteria 1141
973 Ga0373925_0464376 3300037068 Bacteria 1037
974 Ga0373925_0600591 3300037068 Bacteria 906
975 Ga0395899_0181581 3300037312 Bacteria 1477
976 Ga0395899_0215112 3300037312 Bacteria 1334
977 Ga0395900_0012290 3300037418 Bacteria 8757
978 Ga0395900_0031276 3300037418 Bacteria 5467
979 Ga0395900_0050005 3300037418 Bacteria 4306
980 Ga0395900_0128904 3300037418 Bacteria 2593
981 Ga0395900_0298104 3300037418 Bacteria 1599
982 Ga0395900_0880864 3300037418 Bacteria 819
983 Ga0395898_0029950 3300037466 Bacteria 5449
984 Ga0395898_0104107 3300037466 Bacteria 2722
985 Ga0395898_0639357 3300037466 Bacteria 1006
986 Ga0395905_0012867 3300037471 Bacteria 8042
987 Ga0395905_0032064 3300037471 Bacteria 4942
988 Ga0395905_0033796 3300037471 Bacteria 4803
989 Ga0395905_0122200 3300037471 Bacteria 2448
990 Ga0395905_0145663 3300037471 Bacteria 2228
991 Ga0395905_0167375 3300037471 Bacteria 2065
992 Ga0395905_0212637 3300037471 Bacteria 1811
993 Ga0395905_0329762 3300037471 Bacteria 1416
994 Ga0395905_0546988 3300037471 Bacteria 1059
995 Ga0436364_0877349 3300037853 Bacteria 964
996 Ga0436364_1550501 3300037853 Bacteria 2024
997 Ga0395901_0052439 3300038443 Bacteria 4239
998 Ga0395901_0091387 3300038443 Bacteria 3186
999 Ga0395901_0179544 3300038443 Bacteria 2220
1000 Ga0395901_0262534 3300038443 Bacteria 1797
1001 Ga0395901_0391260 3300038443 Bacteria 1429
1002 Ga0395901_0403424 3300038443 Bacteria 1404
1003 Ga0436365_0334854 3300039437 Bacteria 1102
1004 Ga0436360_0077529 3300039438 Bacteria 699
1005 Ga0436363_1140251 3300039450 Bacteria 1259
1006 Ga0436363_1416214 3300039450 Bacteria 3509
1007 Ga0439436_0020046 3300041404 Bacteria 1992
1008 Ga0439436_0143939 3300041404 Bacteria 671
1009 Ga0439439_0012516 3300041406 Bacteria 2052
1010 Ga0439447_049450 3300041407 Bacteria 1007
1011 Ga0439465_0015249 3300041413 Bacteria 2397
1012 Ga0439465_0199717 3300041413 Bacteria 728
1013 Ga0439465_0228722 3300041413 Bacteria 683
1014 Ga0439465_0255743 3300041413 Bacteria 648
1015 Ga0451790_40977 3300041444 Bacteria 707
1016 Ga0451790_43748 3300041444 Bacteria 639
1017 Ga0451794_06620 3300041446 Bacteria 656
1018 Ga0451794_19747 3300041446 Bacteria 972
1019 Ga0451794_30427 3300041446 Bacteria 1200
1020 Ga0451791_0540605 3300041451 Bacteria 1020
1021 Ga0451793_0500431 3300041452 Bacteria 846
1022 Ga0451793_1332179 3300041452 Bacteria 1491
1023 Ga0451797_0261817 3300041453 Bacteria 1412
1024 Ga0451800_1614829 3300041459 Bacteria 1534
1025 Ga0451802_0387222 3300041460 Bacteria 1179
1026 Ga0451805_093557 3300041461 Bacteria 686
1027 Ga0451805_105019 3300041461 Bacteria 1527
1028 Ga0451804_0446889 3300041463 Bacteria 1590
1029 Ga0451807_1614199 3300041486 Bacteria 648
1030 Ga0451833_0705110 3300041491 Bacteria 3395
1031 Ga0451837_1342466 3300041494 Bacteria 970
1032 Ga0451839_0023059 3300041496 Bacteria 2901
1033 Ga0451840_02584 3300041497 Bacteria 1864
1034 Ga0451841_0087010 3300041498 Bacteria 4773
1035 Ga0451841_0468289 3300041498 Bacteria 1809
1036 Ga0451844_06822 3300041500 Bacteria 890
1037 Ga0451845_0062342 3300041501 Bacteria 6073
1038 Ga0451845_0910627 3300041501 Bacteria 729
1039 Ga0451846_01205 3300041502 Bacteria 8545
1040 Ga0451847_0040601 3300041503 Bacteria 5858
1041 Ga0451847_0230433 3300041503 Bacteria 681
1042 Ga0451848_20644 3300041504 Bacteria 1845
1043 Ga0451849_0364808 3300041505 Bacteria 1946
1044 Ga0451851_0450253 3300041507 Bacteria 964
1045 Ga0451843_0956766 3300041509 Bacteria 1885
1046 Ga0451854_09647 3300041510 Bacteria 5803
1047 Ga0451853_2317430 3300041512 Bacteria 8180
1048 Ga0452268_20544 3300041907 Bacteria 1265
1049 Ga0452268_47665 3300041907 Bacteria 809
1050 Ga0452270_1255 3300041909 Bacteria 975
1051 Ga0439433_0013404 3300041999 Bacteria 1800
1052 Ga0439442_038874 3300042002 Bacteria 997
1053 Ga0439445_0195117 3300042004 Bacteria 597
1054 Ga0439449_0006732 3300042007 Bacteria 4386
1055 Ga0439449_0054575 3300042007 Bacteria 1476
1056 Ga0439449_0101230 3300042007 Bacteria 1065
1057 Ga0439452_028778 3300042010 Bacteria 1383
1058 Ga0439454_004038 3300042011 Bacteria 1668
1059 Ga0439457_036043 3300042014 Bacteria 1100
1060 Ga0439462_0114593 3300042015 Bacteria 747
1061 Ga0450920_009054 3300042122 Bacteria 1831
1062 Ga0450923_033863 3300042125 Bacteria 1052
1063 Ga0450906_006379 3300042145 Bacteria 2383
1064 Ga0450906_034473 3300042145 Bacteria 894
1065 Ga0450910_024747 3300042147 Bacteria 922
1066 Ga0439446_0139922 3300042156 Bacteria 790
1067 Ga0439458_0024387 3300042157 Bacteria 1414
1068 Ga0439458_0114002 3300042157 Bacteria 708
1069 Ga0450909_014549 3300042185 Bacteria 1158
1070 Ga0439459_0065768 3300042438 Bacteria 829
1071 Ga0439459_0149042 3300042438 Bacteria 610
1072 Ga0450918_002411 3300042531 Bacteria 3533
1073 Ga0466972_0009543 3300044658 Bacteria 4874
1074 Ga0466972_0010313 3300044658 Bacteria 4691
1075 Ga0466965_0043824 3300044683 Bacteria 2210
1076 Ga0466966_0328826 3300044684 Bacteria 918
1077 Ga0466963_0571417 3300044694 Bacteria 798
1078 Ga0466971_0267720 3300044719 Bacteria 816
1079 Ga0466968_0039813 3300044735 Bacteria 1979
1080 Ga0466968_0500013 3300044735 Bacteria 606
1081 Ga0466970_0120853 3300044765 Bacteria 1434
1082 Ga0466970_0280446 3300044765 Bacteria 937
1083 Ga0466970_0398052 3300044765 Bacteria 785
1084 Ga0466957_0183247 3300044842 Bacteria 1368
1085 Ga0466960_0306295 3300044901 Bacteria 896
1086 Ga0466960_0333658 3300044901 Bacteria 861
1087 Ga0451576_0268673 3300045051 Bacteria 1783
1088 Ga0466967_0116210 3300045976 Bacteria 2465
1089 Ga0466967_0504747 3300045976 Bacteria 1187
1090 Ga0495617_051710 3300046452 Bacteria 1365
1091 Ga0495617_120064 3300046452 Bacteria 847
1092 Ga0495617_191278 3300046452 Bacteria 642
1093 Ga0495627_027112 3300046453 Bacteria 1841
1094 Ga0495627_091553 3300046453 Bacteria 874
1095 Ga0495627_127225 3300046453 Bacteria 718
1096 Ga0495592_0052463 3300046454 Bacteria 3028
1097 Ga0495592_0066229 3300046454 Bacteria 2643
1098 Ga0495592_0076879 3300046454 Bacteria 2421
1099 Ga0495592_0653508 3300046454 Bacteria 636
1100 Ga0495603_0007442 3300046455 Bacteria 6584
1101 Ga0495603_0055263 3300046455 Bacteria 2352
1102 Ga0495603_0125496 3300046455 Bacteria 1496
1103 Ga0495603_0294904 3300046455 Bacteria 931
1104 Ga0495590_0019220 3300046457 Bacteria 2436
1105 Ga0495590_0095975 3300046457 Bacteria 1051
1106 Ga0495590_0110661 3300046457 Bacteria 980
1107 Ga0495590_0167563 3300046457 Bacteria 800
1108 Ga0495591_015562 3300046458 Bacteria 2681
1109 Ga0495629_0007179 3300046459 Bacteria 8209
1110 Ga0495629_0016778 3300046459 Bacteria 5255
1111 Ga0495629_0020113 3300046459 Bacteria 4766
1112 Ga0495629_0083222 3300046459 Bacteria 2233
1113 Ga0495629_0099061 3300046459 Bacteria 2034
1114 Ga0495638_0021308 3300046460 Bacteria 4273
1115 Ga0495638_0077879 3300046460 Bacteria 2017
1116 Ga0495638_0118477 3300046460 Bacteria 1566
1117 Ga0495638_0139171 3300046460 Bacteria 1418
1118 Ga0495638_0360000 3300046460 Bacteria 765
1119 Ga0495641_0012494 3300046461 Bacteria 4745
1120 Ga0495641_0111870 3300046461 Bacteria 1218
1121 Ga0495651_0000990 3300046462 Bacteria 22041
1122 Ga0495651_0013306 3300046462 Bacteria 6364
1123 Ga0495651_0418928 3300046462 Bacteria 871
1124 Ga0495653_0000149 3300046463 Bacteria 58288
1125 Ga0495653_0104959 3300046463 Bacteria 2041
1126 Ga0495653_0349662 3300046463 Bacteria 951
1127 Ga0495650_0143717 3300046471 Bacteria 861
1128 Ga0495650_0143952 3300046471 Bacteria 860
1129 Ga0495580_0022295 3300046472 Bacteria 4661
1130 Ga0495580_0243520 3300046472 Bacteria 1232
1131 Ga0495582_0000163 3300046473 Bacteria 35979
1132 Ga0495582_0015152 3300046473 Bacteria 4241
1133 Ga0495582_0116912 3300046473 Bacteria 1500
1134 Ga0495605_0027351 3300046474 Bacteria 2956
1135 Ga0495605_0064266 3300046474 Bacteria 1748
1136 Ga0495605_0201719 3300046474 Bacteria 866
1137 Ga0495605_0233506 3300046474 Bacteria 791
1138 Ga0495605_0234254 3300046474 Bacteria 790
1139 Ga0495639_0000873 3300046475 Bacteria 13634
1140 Ga0495639_0036968 3300046475 Bacteria 2188
1141 Ga0495639_0134033 3300046475 Bacteria 1187
1142 Ga0495662_0000285 3300046476 Bacteria 21823
1143 Ga0495662_0156979 3300046476 Bacteria 1120
1144 Ga0495664_0005138 3300046477 Bacteria 7181
1145 Ga0495664_0034135 3300046477 Bacteria 2992
1146 Ga0495585_0101819 3300046492 Bacteria 1535
1147 Ga0495585_0105082 3300046492 Bacteria 1506
1148 Ga0495585_0162916 3300046492 Bacteria 1156
1149 Ga0495585_0356567 3300046492 Bacteria 710
1150 Ga0495594_0002164 3300046499 Bacteria 10224
1151 Ga0495594_0177180 3300046499 Bacteria 1213
1152 Ga0495596_0142130 3300046500 Bacteria 932
1153 Ga0495607_0014002 3300046501 Bacteria 5237
1154 Ga0495607_0110814 3300046501 Bacteria 1455
1155 Ga0495607_0155712 3300046501 Bacteria 1165
1156 Ga0495607_0273367 3300046501 Bacteria 804
1157 Ga0495583_0090017 3300046506 Bacteria 1322
1158 Ga0495583_0092005 3300046506 Bacteria 1304
1159 Ga0495583_0138755 3300046506 Bacteria 1013
1160 Ga0495583_0167313 3300046506 Bacteria 905
1161 Ga0495583_0185398 3300046506 Bacteria 850
1162 Ga0495606_0004034 3300046507 Bacteria 14975
1163 Ga0495606_0027177 3300046507 Bacteria 4063
1164 Ga0495606_0036411 3300046507 Bacteria 3351
1165 Ga0495606_0037805 3300046507 Bacteria 3274
1166 Ga0495606_0111077 3300046507 Bacteria 1653
1167 Ga0495606_0217061 3300046507 Bacteria 1080
1168 Ga0495606_0244632 3300046507 Bacteria 998
1169 Ga0495606_0279877 3300046507 Bacteria 912
1170 Ga0495608_0006327 3300046511 Bacteria 8397
1171 Ga0495608_0239568 3300046511 Bacteria 1134
1172 Ga0495608_0300374 3300046511 Bacteria 994
1173 Ga0495608_0375591 3300046511 Bacteria 872
1174 Ga0495610_0021518 3300046512 Bacteria 3545
1175 Ga0495610_0049985 3300046512 Bacteria 2043
1176 Ga0495610_0073233 3300046512 Bacteria 1592
1177 Ga0495610_0092046 3300046512 Bacteria 1373
1178 Ga0495610_0138990 3300046512 Bacteria 1047
1179 Ga0495610_0140822 3300046512 Bacteria 1038
1180 Ga0495610_0143034 3300046512 Bacteria 1027
1181 Ga0495616_0003845 3300046513 Bacteria 9570
1182 Ga0495618_0034866 3300046514 Bacteria 3158
1183 Ga0495618_0099764 3300046514 Bacteria 1858
1184 Ga0495618_0324938 3300046514 Bacteria 952
1185 Ga0495620_0008766 3300046515 Bacteria 5412
1186 Ga0495620_0011590 3300046515 Bacteria 4593
1187 Ga0495620_0041601 3300046515 Bacteria 2014
1188 Ga0495620_0140987 3300046515 Bacteria 942
1189 Ga0495620_0199183 3300046515 Bacteria 770
1190 Ga0495628_0053224 3300046516 Bacteria 3195
1191 Ga0495628_0106321 3300046516 Bacteria 2161
1192 Ga0495628_0215453 3300046516 Bacteria 1443
1193 Ga0495630_0027680 3300046517 Bacteria 4208
1194 Ga0495630_0029804 3300046517 Bacteria 4057
1195 Ga0495631_0007141 3300046518 Bacteria 5707
1196 Ga0495631_0050633 3300046518 Bacteria 1816
1197 Ga0495631_0061512 3300046518 Bacteria 1628
1198 Ga0495631_0163607 3300046518 Bacteria 954
1199 Ga0495632_0053677 3300046519 Bacteria 1978
1200 Ga0495632_0069504 3300046519 Bacteria 1695
1201 Ga0495632_0097889 3300046519 Bacteria 1384
1202 Ga0495632_0113199 3300046519 Bacteria 1272
1203 Ga0495632_0148294 3300046519 Bacteria 1085
1204 Ga0495632_0406026 3300046519 Bacteria 594
1205 Ga0495637_0063527 3300046520 Bacteria 1508
1206 Ga0495643_0010467 3300046522 Bacteria 5707
1207 Ga0495643_0011617 3300046522 Bacteria 5353
1208 Ga0495643_0071765 3300046522 Bacteria 1816
1209 Ga0495643_0120853 3300046522 Bacteria 1323
1210 Ga0495643_0128976 3300046522 Bacteria 1271
1211 Ga0495644_0074077 3300046523 Bacteria 1280
1212 Ga0495644_0277617 3300046523 Bacteria 653
1213 Ga0495648_0001935 3300046524 Bacteria 19722
1214 Ga0495648_0008251 3300046524 Bacteria 8213
1215 Ga0495648_0015480 3300046524 Bacteria 5537
1216 Ga0495648_0086535 3300046524 Bacteria 1767
1217 Ga0495648_0361201 3300046524 Bacteria 660
1218 Ga0495663_0047321 3300046525 Bacteria 1324
1219 Ga0495666_0057685 3300046526 Bacteria 1858
1220 Ga0495666_0057810 3300046526 Bacteria 1856
1221 Ga0495652_0004067 3300046529 Bacteria 14128
1222 Ga0495652_0091173 3300046529 Bacteria 2492
1223 Ga0495652_0169584 3300046529 Bacteria 1686
1224 Ga0495654_0000169 3300046530 Bacteria 64210
1225 Ga0495654_0008744 3300046530 Bacteria 5576
1226 Ga0495654_0063133 3300046530 Bacteria 1774
1227 Ga0495654_0088680 3300046530 Bacteria 1438
1228 Ga0495654_0202547 3300046530 Bacteria 848
1229 Ga0495665_0004495 3300046531 Bacteria 7527
1230 Ga0495640_0007699 3300046533 Bacteria 8474
1231 Ga0495640_0016564 3300046533 Bacteria 5511
1232 Ga0495640_0017722 3300046533 Bacteria 5299
1233 Ga0495640_0044682 3300046533 Bacteria 3079
1234 Ga0495640_0102873 3300046533 Bacteria 1874
1235 Ga0495640_0146627 3300046533 Bacteria 1518
1236 Ga0495586_0030573 3300046535 Bacteria 2882
1237 Ga0495587_0149435 3300046536 Bacteria 1331
1238 Ga0495587_0434788 3300046536 Bacteria 727
1239 Ga0495598_0228688 3300046537 Bacteria 681
1240 Ga0495598_0263375 3300046537 Bacteria 642
1241 Ga0495609_0039691 3300046538 Bacteria 2118
1242 Ga0495609_0160948 3300046538 Bacteria 951
1243 Ga0495609_0169871 3300046538 Bacteria 921
1244 Ga0495609_0310991 3300046538 Bacteria 640
1245 Ga0495621_0013886 3300046539 Bacteria 2539
1246 Ga0495597_0009306 3300046542 Bacteria 4863
1247 Ga0495597_0024609 3300046542 Bacteria 2777
1248 Ga0495597_0075007 3300046542 Bacteria 1452
1249 Ga0495597_0128654 3300046542 Bacteria 1051
1250 Ga0495597_0190657 3300046542 Bacteria 825
1251 Ga0495645_0187257 3300046543 Bacteria 1413
1252 Ga0495645_0313988 3300046543 Bacteria 1020
1253 Ga0495645_0592660 3300046543 Bacteria 683
1254 Ga0495645_0746600 3300046543 Bacteria 591
1255 Ga0495622_0020195 3300046557 Bacteria 3102
1256 Ga0495622_0032660 3300046557 Bacteria 2430
1257 Ga0495622_0084171 3300046557 Bacteria 1463
1258 Ga0495622_0094497 3300046557 Bacteria 1372
1259 Ga0495622_0318953 3300046557 Bacteria 675
1260 Ga0495633_0055449 3300046558 Bacteria 1863
1261 Ga0495633_0070701 3300046558 Bacteria 1628
1262 Ga0495633_0115593 3300046558 Bacteria 1243
1263 Ga0495633_0132887 3300046558 Bacteria 1151
1264 Ga0495667_0016440 3300046559 Bacteria 4998
1265 Ga0495667_0032383 3300046559 Bacteria 3504
1266 Ga0495667_0271969 3300046559 Bacteria 1076
1267 Ga0495656_0070658 3300046615 Bacteria 1549
1268 Ga0495656_0163017 3300046615 Bacteria 1085
1269 Ga0495656_0204799 3300046615 Bacteria 980
1270 Ga0495656_0207938 3300046615 Bacteria 974
1271 Ga0495668_0009874 3300046616 Bacteria 5822
1272 Ga0495668_0063697 3300046616 Bacteria 2030
1273 Ga0495668_0095153 3300046616 Bacteria 1630
1274 Ga0495668_0201897 3300046616 Bacteria 1088
1275 Ga0495668_0271703 3300046616 Bacteria 928
1276 Ga0495668_0283076 3300046616 Bacteria 908
1277 Ga0495668_0488217 3300046616 Bacteria 678
1278 Ga0495634_0044824 3300046642 Bacteria 2991
1279 Ga0495634_0050558 3300046642 Bacteria 2790
1280 Ga0495634_0366988 3300046642 Bacteria 860
1281 Ga0495634_0417166 3300046642 Bacteria 795
1282 Ga0495611_0053779 3300046648 Bacteria 1818
1283 Ga0495611_0057726 3300046648 Bacteria 1759
1284 Ga0495611_0234501 3300046648 Bacteria 852
1285 Ga0495625_0027395 3300046660 Bacteria 4291
1286 Ga0495625_0036051 3300046660 Bacteria 3639
1287 Ga0495625_0064552 3300046660 Bacteria 2582
1288 Ga0495625_0125448 3300046660 Bacteria 1743
1289 Ga0495625_0233111 3300046660 Bacteria 1201
1290 Ga0495625_0667476 3300046660 Bacteria 617
1291 Ga0495635_0009893 3300046663 Bacteria 6666
1292 Ga0495635_0036862 3300046663 Bacteria 3386
1293 Ga0495635_0102905 3300046663 Bacteria 1951
1294 Ga0495635_0479966 3300046663 Bacteria 820
1295 Ga0495635_0578370 3300046663 Bacteria 735
1296 Ga0495659_0100765 3300046664 Bacteria 1118
1297 Ga0495661_0152638 3300046665 Bacteria 1246
1298 Ga0495588_0025858 3300046674 Bacteria 2928
1299 Ga0495588_0052266 3300046674 Bacteria 2105
1300 Ga0495588_0059100 3300046674 Bacteria 1982
1301 Ga0495588_0064395 3300046674 Bacteria 1902
1302 Ga0495588_0079565 3300046674 Bacteria 1710
1303 Ga0495588_0081997 3300046674 Bacteria 1684
1304 Ga0495588_0104250 3300046674 Bacteria 1492
1305 Ga0495588_0349138 3300046674 Bacteria 777
1306 Ga0495657_0020577 3300046675 Bacteria 4741
1307 Ga0495657_0088229 3300046675 Bacteria 1995
1308 Ga0495599_0006010 3300046678 Bacteria 7303
1309 Ga0495623_0078486 3300046679 Bacteria 2046
1310 Ga0495623_0134558 3300046679 Bacteria 1476
1311 Ga0495623_0200184 3300046679 Bacteria 1148
1312 Ga0495623_0264429 3300046679 Bacteria 962
1313 Ga0495646_0002026 3300046680 Bacteria 12277
1314 Ga0495646_0009353 3300046680 Bacteria 6217
1315 Ga0495647_0006072 3300046681 Bacteria 3982
1316 Ga0495647_0085938 3300046681 Bacteria 1282
1317 Ga0495647_0184717 3300046681 Bacteria 908
1318 Ga0495647_0222830 3300046681 Bacteria 833
1319 Ga0495658_0001480 3300046683 Bacteria 12346
1320 Ga0495658_0024761 3300046683 Bacteria 3201
1321 Ga0495658_0117919 3300046683 Bacteria 1602
1322 Ga0495669_0071622 3300046684 Bacteria 1581
1323 Ga0495669_0187682 3300046684 Bacteria 986
1324 Ga0495613_0033309 3300046689 Bacteria 3829
1325 Ga0495613_0068299 3300046689 Bacteria 2592
1326 Ga0495613_0222981 3300046689 Bacteria 1323
1327 Ga0495613_0292012 3300046689 Bacteria 1130
1328 Ga0495624_0004478 3300046690 Bacteria 10223
1329 Ga0495624_0019695 3300046690 Bacteria 4498
1330 Ga0495624_0257636 3300046690 Bacteria 1054
1331 Ga0495670_0019785 3300046691 Bacteria 3317
1332 Ga0495670_0067647 3300046691 Bacteria 1804
1333 Ga0495670_0227925 3300046691 Bacteria 990
1334 Ga0495670_0284616 3300046691 Bacteria 884
1335 Ga0495671_0020389 3300046692 Bacteria 3493
1336 Ga0495671_0066997 3300046692 Bacteria 1766
1337 Ga0495671_0098045 3300046692 Bacteria 1433
1338 Ga0495671_0106435 3300046692 Bacteria 1369
1339 Ga0495671_0119333 3300046692 Bacteria 1287
1340 Ga0495649_0056016 3300046694 Bacteria 2129
1341 Ga0495649_0128244 3300046694 Bacteria 1339
1342 Ga0495649_0402130 3300046694 Bacteria 687
1343 Ga0495649_0450401 3300046694 Bacteria 643
1344 Ga0495589_0086867 3300046794 Bacteria 1519
1345 Ga0495589_0108956 3300046794 Bacteria 1337
1346 Ga0495589_0440352 3300046794 Bacteria 597
1347 Ga0495600_0001328 3300046809 Bacteria 13642
1348 Ga0495600_0200756 3300046809 Bacteria 1280
1349 Ga0495600_0249391 3300046809 Bacteria 1129
1350 Ga0495660_0003610 3300046810 Bacteria 9536
1351 Ga0495660_0216181 3300046810 Bacteria 906
1352 Ga0495581_0004107 3300047315 Bacteria 8377
1353 Ga0495581_0046393 3300047315 Bacteria 2511
1354 Ga0495581_0443387 3300047315 Bacteria 756
1355 Ga0495604_0024237 3300047317 Bacteria 4841
1356 Ga0495604_0038744 3300047317 Bacteria 3750
1357 Ga0495604_0056047 3300047317 Bacteria 3035
1358 Ga0495604_0154622 3300047317 Bacteria 1626
1359 Ga0495604_0298678 3300047317 Bacteria 1082
1360 Ga0495636_0254486 3300047318 Bacteria 813
1361 Ga0495636_0372624 3300047318 Bacteria 676
1362 Ga0495674_0033963 3300047319 Bacteria 4615
1363 Ga0495674_0081704 3300047319 Bacteria 2771
1364 Ga0495674_0084213 3300047319 Bacteria 2725
1365 Ga0495674_0133161 3300047319 Bacteria 2093
1366 Ga0495674_0881304 3300047319 Bacteria 692
1367 Ga0495672_0072639 3300047320 Bacteria 1942
1368 Ga0495672_0118367 3300047320 Bacteria 1412
1369 Ga0495672_0151289 3300047320 Bacteria 1203
1370 Ga0495672_0215848 3300047320 Bacteria 950
1371 Ga0495672_0224259 3300047320 Bacteria 926
1372 Ga0495676_0267319 3300047321 Bacteria 1161
1373 Ga0495676_0425480 3300047321 Bacteria 878
1374 Ga0495676_0522864 3300047321 Bacteria 777
1375 Ga0495680_0026837 3300047322 Bacteria 4741
1376 Ga0495680_0636489 3300047322 Bacteria 710
1377 Ga0495683_0094699 3300047323 Bacteria 1443
1378 Ga0495683_0106493 3300047323 Bacteria 1343
1379 Ga0495687_047418 3300047443 Bacteria 1849
1380 Ga0495675_0009679 3300047444 Bacteria 6007
1381 Ga0495675_0467629 3300047444 Bacteria 727
1382 Ga0495685_058639 3300047447 Bacteria 1299
1383 Ga0495673_0054337 3300047469 Bacteria 1742
1384 Ga0495673_0060972 3300047469 Bacteria 1616
1385 Ga0495673_0084303 3300047469 Bacteria 1310
1386 Ga0495673_0206468 3300047469 Bacteria 732
1387 Ga0495681_0111401 3300047470 Bacteria 1185
1388 Ga0495681_0164393 3300047470 Bacteria 922
1389 Ga0495684_0003854 3300047471 Bacteria 11683
1390 Ga0495684_0063489 3300047471 Bacteria 2807
1391 Ga0495684_0068141 3300047471 Bacteria 2706
1392 Ga0495686_0012709 3300047472 Bacteria 5880
1393 Ga0495686_0020367 3300047472 Bacteria 4423
1394 Ga0495686_0053911 3300047472 Bacteria 2519
1395 Ga0495686_0070208 3300047472 Bacteria 2158
1396 Ga0495686_0113885 3300047472 Bacteria 1619
1397 Ga0495686_0115126 3300047472 Bacteria 1608
1398 Ga0495686_0117960 3300047472 Bacteria 1585
1399 Ga0495686_0136673 3300047472 Bacteria 1449
1400 Ga0495593_0003980 3300047673 Bacteria 8815
1401 Ga0495593_0012224 3300047673 Bacteria 4907
1402 Ga0495593_0056011 3300047673 Bacteria 2073
1403 Ga0495602_0368581 3300048088 Bacteria 1032
1404 Ga0495602_0547652 3300048088 Bacteria 802
1405 Ga0495602_0549525 3300048088 Bacteria 800
1406 Ga0495614_0096077 3300048089 Bacteria 1292
1407 Ga0495614_0160820 3300048089 Bacteria 1005
1408 Ga0495615_0018125 3300048090 Bacteria 1545
1409 Ga0495615_0077871 3300048090 Bacteria 904
1410 Ga0495626_0008866 3300048091 Bacteria 5467
1411 Ga0495626_0009507 3300048091 Bacteria 5253
1412 Ga0495626_0078153 3300048091 Bacteria 1474
1413 Ga0495626_0232172 3300048091 Bacteria 745
1414 Ga0496100_0304033 3300048903 Bacteria 1194
1415 Ga0496100_0700908 3300048903 Bacteria 790
1416 Ga0496100_1082482 3300048903 Bacteria 631
1417 Ga0496100_1423029 3300048903 Bacteria 547
1418 Ga0496101_0218582 3300048904 Bacteria 1478
1419 Ga0496101_0664100 3300048904 Bacteria 823
1420 Ga0496101_0758557 3300048904 Bacteria 765
1421 Ga0496102_0275494 3300048905 Bacteria 1586
1422 Ga0496102_0401030 3300048905 Bacteria 1289
1423 Ga0496102_0488810 3300048905 Bacteria 1152
1424 Ga0496102_0597617 3300048905 Bacteria 1026
1425 Ga0496102_1348092 3300048905 Bacteria 632
1426 Ga0496102_1607049 3300048905 Bacteria 568
1427 Ga0496103_0169291 3300048906 Bacteria 1402
1428 Ga0496103_0420846 3300048906 Bacteria 857
1429 Ga0496104_0038871 3300048907 Bacteria 4454
1430 Ga0496104_0117685 3300048907 Bacteria 2550
1431 Ga0496104_0134355 3300048907 Bacteria 2376
1432 Ga0496104_0245933 3300048907 Bacteria 1701
1433 Ga0496104_0424340 3300048907 Bacteria 1242
1434 Ga0496105_0005725 3300048908 Bacteria 9460
1435 Ga0496105_0068020 3300048908 Bacteria 2941
1436 Ga0496105_0100695 3300048908 Bacteria 2386
1437 Ga0496105_0203046 3300048908 Bacteria 1617
1438 Ga0496105_0579954 3300048908 Bacteria 872
1439 Ga0496106_0012368 3300048909 Bacteria 6300
1440 Ga0496106_0287189 3300048909 Bacteria 1319
1441 Ga0496106_0592345 3300048909 Bacteria 888
1442 Ga0496106_0675079 3300048909 Bacteria 824
1443 Ga0496107_0146618 3300048910 Bacteria 1745
1444 Ga0496107_0195912 3300048910 Bacteria 1501
1445 Ga0496107_0931367 3300048910 Bacteria 632
1446 Ga0496108_0065562 3300048911 Bacteria 3061
1447 Ga0496108_0093770 3300048911 Bacteria 2554
1448 Ga0496108_0407426 3300048911 Bacteria 1187
1449 Ga0496108_0605644 3300048911 Bacteria 954
1450 Ga0496109_0052420 3300048912 Bacteria 3718
1451 Ga0496109_0694864 3300048912 Bacteria 955
1452 Ga0496110_0072438 3300048913 Bacteria 3057
1453 Ga0496110_0225558 3300048913 Bacteria 1704
1454 Ga0496110_0457335 3300048913 Bacteria 1163
1455 Ga0496110_0618696 3300048913 Bacteria 981
1456 Ga0496110_0893074 3300048913 Bacteria 794
1457 Ga0496111_0010053 3300048914 Bacteria 6330
1458 Ga0496111_0065502 3300048914 Bacteria 2637
1459 Ga0496111_0470529 3300048914 Bacteria 926
1460 Ga0496112_0000021 3300048915 Bacteria 156561
1461 Ga0496112_0049260 3300048915 Bacteria 4129
1462 Ga0496112_0065915 3300048915 Bacteria 3573
1463 Ga0496112_0110610 3300048915 Bacteria 2717
1464 Ga0496112_0116362 3300048915 Bacteria 2644
1465 Ga0496112_0126745 3300048915 Bacteria 2523
1466 Ga0496112_1395192 3300048915 Bacteria 615
1467 Ga0496113_0212481 3300048916 Bacteria 1540
1468 Ga0496113_0243254 3300048916 Bacteria 1436
1469 Ga0496113_0435358 3300048916 Bacteria 1053
1470 Ga0496113_0704217 3300048916 Bacteria 806
1471 Ga0496113_0917896 3300048916 Bacteria 692
1472 Ga0496113_1280684 3300048916 Bacteria 570
1473 Ga0496114_0089784 3300048917 Bacteria 2608
1474 Ga0496114_0189609 3300048917 Bacteria 1798
1475 Ga0496114_0202573 3300048917 Bacteria 1738
1476 Ga0496114_0230803 3300048917 Bacteria 1626
1477 Ga0496114_0346523 3300048917 Bacteria 1314
1478 Ga0496114_0613657 3300048917 Bacteria 959
1479 Ga0496115_0004922 3300048918 Bacteria 9702
1480 Ga0496115_0063129 3300048918 Bacteria 2988
1481 Ga0496115_0161711 3300048918 Bacteria 1850
1482 Ga0496115_0224324 3300048918 Bacteria 1550
1483 Ga0496115_0397682 3300048918 Bacteria 1118
1484 Ga0496115_0707357 3300048918 Bacteria 791
1485 Ga0496115_0906199 3300048918 Bacteria 679
1486 Ga0496116_0016936 3300048919 Bacteria 5681
1487 Ga0496116_0020299 3300048919 Bacteria 5049
1488 Ga0496116_0087897 3300048919 Bacteria 1901
1489 Ga0496116_0090144 3300048919 Bacteria 1867
1490 Ga0496116_0150213 3300048919 Bacteria 1295
1491 Ga0496116_0246987 3300048919 Bacteria 891
1492 Ga0496116_0266409 3300048919 Bacteria 840
1493 Ga0496117_0036203 3300048920 Bacteria 3696
1494 Ga0496117_0039434 3300048920 Bacteria 3486
1495 Ga0496117_0079630 3300048920 Bacteria 2157
1496 Ga0496117_0113384 3300048920 Bacteria 1683
1497 Ga0496117_0131919 3300048920 Bacteria 1512
1498 Ga0496118_0010277 3300048921 Bacteria 9286
1499 Ga0496118_0038146 3300048921 Bacteria 3855
1500 Ga0496118_0047138 3300048921 Bacteria 3345
1501 Ga0496118_0048277 3300048921 Bacteria 3290
1502 Ga0496118_0083225 3300048921 Bacteria 2238
1503 Ga0496118_0115246 3300048921 Bacteria 1769
1504 Ga0496118_0154123 3300048921 Bacteria 1432
1505 Ga0496118_0193744 3300048921 Bacteria 1212
1506 Ga0496118_0345288 3300048921 Bacteria 795
1507 Ga0496118_0419965 3300048921 Bacteria 688
1508 Ga0496119_0022470 3300048922 Bacteria 4514
1509 Ga0496119_0026500 3300048922 Bacteria 4017
1510 Ga0496119_0049927 3300048922 Bacteria 2582
1511 Ga0496119_0132438 3300048922 Bacteria 1357
1512 Ga0496119_0192824 3300048922 Bacteria 1060
1513 Ga0496119_0195203 3300048922 Bacteria 1052
1514 Ga0496119_0314293 3300048922 Bacteria 768
1515 Ga0496120_0003668 3300048923 Bacteria 13738
1516 Ga0496120_0014732 3300048923 Bacteria 5192
1517 Ga0496120_0067605 3300048923 Bacteria 1973
1518 Ga0496120_0120324 3300048923 Bacteria 1358
1519 Ga0496120_0136578 3300048923 Bacteria 1249
1520 Ga0496120_0236970 3300048923 Bacteria 863
1521 Ga0496121_0000003 3300048924 Bacteria 1191431
1522 Ga0496121_0002196 3300048924 Bacteria 30506
1523 Ga0496121_0012437 3300048924 Bacteria 9278
1524 Ga0496121_0015937 3300048924 Bacteria 7805
1525 Ga0496121_0018961 3300048924 Bacteria 6903
1526 Ga0496121_0059739 3300048924 Bacteria 3141
1527 Ga0496121_0071016 3300048924 Bacteria 2801
1528 Ga0496121_0074250 3300048924 Bacteria 2721
1529 Ga0496121_0091959 3300048924 Bacteria 2366
1530 Ga0496121_0133823 3300048924 Bacteria 1850
1531 Ga0496121_0136963 3300048924 Bacteria 1822
1532 Ga0496121_0145522 3300048924 Bacteria 1751
1533 Ga0496121_0181295 3300048924 Bacteria 1520
1534 Ga0496121_0198020 3300048924 Bacteria 1434
1535 Ga0496121_0213609 3300048924 Bacteria 1364
1536 Ga0496121_0385665 3300048924 Bacteria 922
1537 Ga0496121_0410174 3300048924 Bacteria 884
1538 Ga0496121_0510997 3300048924 Bacteria 760
1539 Ga0496122_0000179 3300048925 Bacteria 149332
1540 Ga0496122_0037393 3300048925 Bacteria 3908
1541 Ga0496122_0049928 3300048925 Bacteria 3195
1542 Ga0496122_0085161 3300048925 Bacteria 2182
1543 Ga0496122_0090444 3300048925 Bacteria 2088
1544 Ga0496122_0172441 3300048925 Bacteria 1301
1545 Ga0496122_0209271 3300048925 Bacteria 1131
1546 Ga0496122_0262012 3300048925 Bacteria 958
1547 Ga0496122_0326762 3300048925 Bacteria 812
1548 Ga0496123_0000305 3300048926 Bacteria 95376
1549 Ga0496123_0017503 3300048926 Bacteria 5761
1550 Ga0496123_0029976 3300048926 Bacteria 3992
1551 Ga0496123_0041395 3300048926 Bacteria 3194
1552 Ga0496123_0100858 3300048926 Bacteria 1680
1553 Ga0496123_0130297 3300048926 Bacteria 1395
1554 Ga0496123_0135023 3300048926 Bacteria 1359
1555 Ga0496123_0166396 3300048926 Bacteria 1168
1556 Ga0496123_0180592 3300048926 Bacteria 1103
1557 Ga0496124_0004199 3300048927 Bacteria 16960
1558 Ga0496124_0004355 3300048927 Bacteria 16569
1559 Ga0496124_0004631 3300048927 Bacteria 15936
1560 Ga0496124_0051261 3300048927 Bacteria 3512
1561 Ga0496124_0116377 3300048927 Bacteria 2143
1562 Ga0496124_0177566 3300048927 Bacteria 1642
1563 Ga0496124_0180285 3300048927 Bacteria 1626
1564 Ga0496124_0182153 3300048927 Bacteria 1615
1565 Ga0496124_0203903 3300048927 Bacteria 1501
1566 Ga0496124_0205157 3300048927 Bacteria 1495
1567 Ga0496124_0235980 3300048927 Bacteria 1363
1568 Ga0496124_0293249 3300048927 Bacteria 1179
1569 Ga0496124_0293752 3300048927 Bacteria 1178
1570 Ga0496124_0507002 3300048927 Bacteria 807
1571 Ga0496124_0731920 3300048927 Bacteria 622
1572 Ga0496125_0000141 3300048928 Bacteria 158991
1573 Ga0496125_0063176 3300048928 Bacteria 2954
1574 Ga0496125_0103317 3300048928 Bacteria 2091
1575 Ga0496125_0114457 3300048928 Bacteria 1943
1576 Ga0496125_0126066 3300048928 Bacteria 1814
1577 Ga0496125_0164647 3300048928 Bacteria 1500
1578 Ga0496125_0165868 3300048928 Bacteria 1492
1579 Ga0496125_0234291 3300048928 Bacteria 1171
1580 Ga0496125_0289968 3300048928 Bacteria 1008
1581 Ga0496125_0327707 3300048928 Bacteria 925
1582 Ga0496125_0435865 3300048928 Bacteria 755
1583 Ga0496125_0499966 3300048928 Bacteria 684
1584 Ga0496125_0526708 3300048928 Bacteria 659
1585 Ga0496126_0027348 3300048929 Bacteria 5449
1586 Ga0496126_0055514 3300048929 Bacteria 3583
1587 Ga0496126_0106083 3300048929 Bacteria 2452
1588 Ga0496126_0157376 3300048929 Bacteria 1944
1589 Ga0496126_0179786 3300048929 Bacteria 1797
1590 Ga0496126_0195531 3300048929 Bacteria 1710
1591 Ga0496126_0209361 3300048929 Bacteria 1642
1592 Ga0496126_0218163 3300048929 Bacteria 1604
1593 Ga0496126_0311670 3300048929 Bacteria 1295
1594 Ga0496126_0315366 3300048929 Bacteria 1287
1595 Ga0496126_0370688 3300048929 Bacteria 1167
1596 Ga0496126_0426882 3300048929 Bacteria 1070
1597 Ga0496126_0568184 3300048929 Bacteria 897
1598 Ga0496126_0627878 3300048929 Bacteria 843
1599 Ga0496126_0683432 3300048929 Bacteria 799
1600 Ga0501306_000444 3300049127 Bacteria 3135
1601 Ga0501306_007899 3300049127 Bacteria 1284
1602 Ga0501306_039073 3300049127 Bacteria 730
1603 Ga0501308_002370 3300049128 Bacteria 1648
1604 Ga0501309_000912 3300049129 Bacteria 2663
1605 Ga0501309_004872 3300049129 Bacteria 1579
1606 Ga0501310_010190 3300049130 Bacteria 1045
1607 Ga0501310_011449 3300049130 Bacteria 1004
1608 Ga0501310_013612 3300049130 Bacteria 946
1609 Ga0501310_032438 3300049130 Bacteria 699
1610 Ga0501304_003511 3300049160 Bacteria 1152
1611 Ga0501305_003020 3300049161 Bacteria 1871
1612 Ga0501305_003176 3300049161 Bacteria 1843
1613 Ga0501305_009509 3300049161 Bacteria 1279
1614 Ga0501307_034945 3300049162 Bacteria 712
1615 Ga0495678_057051 3300049459 Bacteria 1481
1616 Ga0495678_114186 3300049459 Bacteria 916
1617 Ga0495678_152901 3300049459 Bacteria 743
1618 Ga0495678_162925 3300049459 Bacteria 711
1619 Ga0495682_0114243 3300049460 Bacteria 967
1620 Ga0501311_000194 3300049527 Bacteria 3556
1621 Ga0501311_006601 3300049527 Bacteria 1311
1622 Ga0501313_009901 3300049529 Bacteria 1078
1623 Ga0501314_002564 3300049530 Bacteria 1414
1624 Ga0501314_002648 3300049530 Bacteria 1399
1625 Ga0501314_008466 3300049530 Bacteria 930
1626 Ga0501315_000060 3300049531 Bacteria 4828
1627 Ga0501315_001308 3300049531 Bacteria 2090
1628 Ga0501315_014320 3300049531 Bacteria 1004
1629 Ga0501316_000132 3300049532 Bacteria 3939
1630 Ga0501316_001097 3300049532 Bacteria 2191
1631 Ga0501317_000084 3300049533 Bacteria 4633
1632 Ga0501317_000409 3300049533 Bacteria 2945
1633 Ga0501317_017769 3300049533 Bacteria 935
1634 Ga0501318_000193 3300049534 Bacteria 3208
1635 Ga0501319_005724 3300049535 Bacteria 899
1636 Ga0501319_006566 3300049535 Bacteria 861
1637 Ga0501320_005669 3300049536 Bacteria 1146
1638 Ga0501321_010209 3300049537 Bacteria 1026
1639 Ga0501321_025502 3300049537 Bacteria 762
1640 Ga0501322_000140 3300049538 Bacteria 2796
1641 Ga0501323_006869 3300049539 Bacteria 1283
1642 Ga0501324_013699 3300049540 Bacteria 771
1643 Ga0501324_014661 3300049540 Bacteria 753
1644 Ga0501334_06607 3300049550 Bacteria 786
1645 Ga0501031_0000651 3300049568 Bacteria 20547
1646 Ga0501031_0002703 3300049568 Bacteria 11283
1647 Ga0501031_0004402 3300049568 Bacteria 9129
1648 Ga0501031_0007624 3300049568 Bacteria 7048
1649 Ga0501031_0095082 3300049568 Bacteria 1944
1650 Ga0501032_0000111 3300049569 Bacteria 69802
1651 Ga0501032_0003488 3300049569 Bacteria 12021
1652 Ga0501032_0006160 3300049569 Bacteria 8827
1653 Ga0501032_0066026 3300049569 Bacteria 2418
1654 Ga0501032_0233067 3300049569 Bacteria 1197
1655 Ga0501032_0319882 3300049569 Bacteria 1001
1656 Ga0501032_0686129 3300049569 Bacteria 650
1657 Ga0501033_0000121 3300049570 Bacteria 75242
1658 Ga0501033_0006462 3300049570 Bacteria 9172
1659 Ga0501033_0007122 3300049570 Bacteria 8728
1660 Ga0501033_0010287 3300049570 Bacteria 7177
1661 Ga0501033_0011172 3300049570 Bacteria 6877
1662 Ga0501033_0015204 3300049570 Bacteria 5842
1663 Ga0501033_0079988 3300049570 Bacteria 2398
1664 Ga0501033_0080471 3300049570 Bacteria 2390
1665 Ga0501033_0087475 3300049570 Bacteria 2280
1666 Ga0501033_0511846 3300049570 Bacteria 830
1667 Ga0501034_0000298 3300049571 Bacteria 88154
1668 Ga0501034_0004897 3300049571 Bacteria 14760
1669 Ga0501034_0006180 3300049571 Bacteria 12912
1670 Ga0501034_0009013 3300049571 Bacteria 10479
1671 Ga0501034_0012627 3300049571 Bacteria 8716
1672 Ga0501034_0014685 3300049571 Bacteria 8064
1673 Ga0501034_0030885 3300049571 Bacteria 5444
1674 Ga0501034_0031298 3300049571 Bacteria 5404
1675 Ga0501034_0073278 3300049571 Bacteria 3433
1676 Ga0501034_0209490 3300049571 Bacteria 1905
1677 Ga0501034_0386571 3300049571 Bacteria 1324
1678 Ga0501034_0420618 3300049571 Bacteria 1257
1679 Ga0501036_0000724 3300049572 Bacteria 24360
1680 Ga0501036_0002605 3300049572 Bacteria 14223
1681 Ga0501036_0025540 3300049572 Bacteria 4984
1682 Ga0501036_0194494 3300049572 Bacteria 1706
1683 Ga0501036_0236449 3300049572 Bacteria 1532
1684 Ga0501036_0256206 3300049572 Bacteria 1466
1685 Ga0501036_1008151 3300049572 Bacteria 681
1686 Ga0501037_0000131 3300049573 Bacteria 69802
1687 Ga0501037_0000191 3300049573 Bacteria 56839
1688 Ga0501037_0000195 3300049573 Bacteria 55440
1689 Ga0501037_0006435 3300049573 Bacteria 8594
1690 Ga0501037_0270062 3300049573 Bacteria 1187
1691 Ga0501037_0838005 3300049573 Bacteria 605
1692 Ga0501038_0000109 3300049574 Bacteria 69802
1693 Ga0501038_0001882 3300049574 Bacteria 19398
1694 Ga0501038_0005274 3300049574 Bacteria 12021
1695 Ga0501038_0047294 3300049574 Bacteria 3727
1696 Ga0501038_0158498 3300049574 Bacteria 1841
1697 Ga0501038_0468144 3300049574 Bacteria 967
1698 Ga0501038_0702777 3300049574 Bacteria 757
1699 Ga0501038_0757002 3300049574 Bacteria 724
1700 Ga0501039_0000080 3300049575 Bacteria 72519
1701 Ga0501039_0002279 3300049575 Bacteria 14235
1702 Ga0501039_0032207 3300049575 Bacteria 4040
1703 Ga0501039_0077058 3300049575 Bacteria 2593
1704 Ga0501039_0216355 3300049575 Bacteria 1506
1705 Ga0501039_0279144 3300049575 Bacteria 1313
1706 Ga0501039_0752592 3300049575 Bacteria 761
1707 Ga0501040_0008666 3300049576 Bacteria 6603
1708 Ga0501040_0046602 3300049576 Bacteria 2959
1709 Ga0501040_0185433 3300049576 Bacteria 1476
1710 Ga0501040_0498267 3300049576 Bacteria 878
1711 Ga0501041_0053535 3300049577 Bacteria 2462
1712 Ga0501042_0060942 3300049578 Bacteria 2695
1713 Ga0501042_0490992 3300049578 Bacteria 891
1714 Ga0501043_0000080 3300049579 Bacteria 85372
1715 Ga0501043_0004023 3300049579 Bacteria 12021
1716 Ga0501043_0015219 3300049579 Bacteria 6023
1717 Ga0501043_0024392 3300049579 Bacteria 4746
1718 Ga0501043_0052836 3300049579 Bacteria 3191
1719 Ga0501043_0256680 3300049579 Bacteria 1345
1720 Ga0501043_0574453 3300049579 Bacteria 835
1721 Ga0501043_0712068 3300049579 Bacteria 732
1722 Ga0501046_0018165 3300049580 Bacteria 5856
1723 Ga0501046_0048594 3300049580 Bacteria 3359
1724 Ga0501046_0363102 3300049580 Bacteria 1050
1725 Ga0501047_0011259 3300049581 Bacteria 8466
1726 Ga0501047_0017299 3300049581 Bacteria 6904
1727 Ga0501047_0025104 3300049581 Bacteria 5725
1728 Ga0501047_0040375 3300049581 Bacteria 4513
1729 Ga0501047_0080199 3300049581 Bacteria 3137
1730 Ga0501047_0106587 3300049581 Bacteria 2683
1731 Ga0501047_0135845 3300049581 Bacteria 2339
1732 Ga0501047_0224418 3300049581 Bacteria 1734
1733 Ga0501047_0235624 3300049581 Bacteria 1682
1734 Ga0501047_0549634 3300049581 Bacteria 979
1735 Ga0501047_0911058 3300049581 Bacteria 692
1736 Ga0501048_0030318 3300049582 Bacteria 3913
1737 Ga0501048_0235219 3300049582 Bacteria 1300
1738 Ga0501048_0639197 3300049582 Bacteria 764
1739 Ga0501067_0054293 3300049583 Bacteria 2220
1740 Ga0501067_0059220 3300049583 Bacteria 2120
1741 Ga0501067_0211083 3300049583 Bacteria 1081
1742 Ga0501068_0022655 3300049584 Bacteria 3674
1743 Ga0501068_0211224 3300049584 Bacteria 1232
1744 Ga0501069_0000172 3300049585 Bacteria 29114
1745 Ga0501069_0045997 3300049585 Bacteria 2419
1746 Ga0501069_0059883 3300049585 Bacteria 2125
1747 Ga0501069_0157705 3300049585 Bacteria 1306
1748 Ga0501070_0001286 3300049586 Bacteria 22525
1749 Ga0501070_0006301 3300049586 Bacteria 10097
1750 Ga0501070_0015591 3300049586 Bacteria 6390
1751 Ga0501070_0018655 3300049586 Bacteria 5820
1752 Ga0501070_0052211 3300049586 Bacteria 3393
1753 Ga0501070_0296563 3300049586 Bacteria 1317
1754 Ga0501070_0634142 3300049586 Bacteria 850
1755 Ga0501070_0798960 3300049586 Bacteria 741
1756 Ga0501070_0897266 3300049586 Bacteria 692
1757 Ga0501071_0050678 3300049587 Bacteria 2990
1758 Ga0501072_0117144 3300049588 Bacteria 2122
1759 Ga0501073_0018884 3300049589 Bacteria 4983
1760 Ga0501073_0032628 3300049589 Bacteria 3713
1761 Ga0501073_0047706 3300049589 Bacteria 3009
1762 Ga0501073_0392284 3300049589 Bacteria 959
1763 Ga0501074_0002583 3300049590 Bacteria 12638
1764 Ga0501074_0040640 3300049590 Bacteria 3368
1765 Ga0501074_0368918 3300049590 Bacteria 1018
1766 Ga0501074_0528040 3300049590 Bacteria 836
1767 Ga0501076_0588821 3300049592 Bacteria 917
1768 Ga0501202_125437 3300049652 Bacteria 649
1769 Ga0501238_015849 3300049671 Bacteria 1041
1770 Ga0501079_0143858 3300049741 Bacteria 1858
1771 Ga0501080_0003453 3300049742 Bacteria 13951
1772 Ga0501080_0004752 3300049742 Bacteria 12113
1773 Ga0501080_0020715 3300049742 Bacteria 6091
1774 Ga0501080_0214502 3300049742 Bacteria 1763
1775 Ga0501080_0603270 3300049742 Bacteria 974
1776 Ga0501080_0681820 3300049742 Bacteria 907
1777 Ga0501080_1012279 3300049742 Bacteria 720
1778 Ga0501081_0373523 3300049743 Bacteria 1053
1779 Ga0501083_0001214 3300049744 Bacteria 17447
1780 Ga0501083_0012045 3300049744 Bacteria 6055
1781 Ga0501083_0027007 3300049744 Bacteria 3964
1782 Ga0501083_0366141 3300049744 Bacteria 937
1783 Ga0501241_009543 3300049758 Bacteria 1767
1784 Ga0501280_003866 3300049776 Bacteria 2252
1785 Ga0501035_0000160 3300049822 Bacteria 82214
1786 Ga0501035_0000167 3300049822 Bacteria 80102
1787 Ga0501035_0000347 3300049822 Bacteria 53369
1788 Ga0501035_0002188 3300049822 Bacteria 19398
1789 Ga0501035_0005457 3300049822 Bacteria 12026
1790 Ga0501035_0009004 3300049822 Bacteria 9284
1791 Ga0501035_0009166 3300049822 Bacteria 9204
1792 Ga0501035_0022061 3300049822 Bacteria 5849
1793 Ga0501035_0093710 3300049822 Bacteria 2642
1794 Ga0501035_0174152 3300049822 Bacteria 1857
1795 Ga0501035_0190500 3300049822 Bacteria 1763
1796 Ga0501035_0208235 3300049822 Bacteria 1674
1797 Ga0501035_0508070 3300049822 Bacteria 991
1798 Ga0501035_0851207 3300049822 Bacteria 725
1799 Ga0501044_0000234 3300049823 Bacteria 69802
1800 Ga0501044_0000544 3300049823 Bacteria 45911
1801 Ga0501044_0009229 3300049823 Bacteria 10770
1802 Ga0501044_0022577 3300049823 Bacteria 6704
1803 Ga0501044_0050656 3300049823 Bacteria 4283
1804 Ga0501044_0059863 3300049823 Bacteria 3901
1805 Ga0501044_0062595 3300049823 Bacteria 3803
1806 Ga0501044_0076474 3300049823 Bacteria 3397
1807 Ga0501044_0092919 3300049823 Bacteria 3042
1808 Ga0501044_0106357 3300049823 Bacteria 2818
1809 Ga0501044_0229111 3300049823 Bacteria 1806
1810 Ga0501044_0233590 3300049823 Bacteria 1785
1811 Ga0501044_0463333 3300049823 Bacteria 1172
1812 Ga0501044_0644986 3300049823 Bacteria 948
1813 Ga0501045_0001715 3300049824 Bacteria 14765
1814 Ga0501045_0334010 3300049824 Bacteria 1128
1815 Ga0501045_0786164 3300049824 Bacteria 701
1816 Ga0501204_025851 3300049850 Bacteria 792
1817 nmdc:mga03683_177435_c1 3300050489 Bacteria 971
1818 nmdc:mga03683_25558_c1 3300050489 Bacteria 2322
1819 nmdc:mga03683_348988_c1 3300050489 Bacteria 700
1820 nmdc:mga03n38_15142_c1 3300050490 Bacteria 2972
1821 nmdc:mga03n38_167867_c1 3300050490 Bacteria 1116
1822 nmdc:mga03n38_408113_c1 3300050490 Bacteria 749
1823 nmdc:mga03n38_564306_c1 3300050490 Bacteria 645
1824 nmdc:mga03n38_83412_c2 3300050490 Bacteria 1064
1825 nmdc:mga00v17_1284_c1 3300050491 Bacteria 13184
1826 nmdc:mga00v17_243765_c1 3300050491 Bacteria 1165
1827 nmdc:mga00v17_257607_c1 3300050491 Bacteria 1132
1828 nmdc:mga00v17_26923_c1 3300050491 Bacteria 3354
1829 nmdc:mga00v17_818324_c1 3300050491 Bacteria 593
1830 nmdc:mga0yw44_126980_c1 3300050492 Bacteria 1648
1831 nmdc:mga0yw44_158476_c1 3300050492 Bacteria 1481
1832 nmdc:mga0yw44_167639_c1 3300050492 Bacteria 1441
1833 nmdc:mga0yw44_174646_c1 3300050492 Bacteria 1412
1834 nmdc:mga0yw44_175118_c1 3300050492 Bacteria 1410
1835 nmdc:mga0yw44_231648_c1 3300050492 Bacteria 1226
1836 nmdc:mga0yw44_24060_c1 3300050492 Bacteria 3441
1837 nmdc:mga0yw44_29953_c1 3300050492 Bacteria 3148
1838 nmdc:mga0yw44_3148_c2 3300050492 Bacteria 3283
1839 nmdc:mga0yw44_53959_c1 3300050492 Bacteria 2442
1840 nmdc:mga0yw44_57394_c1 3300050492 Bacteria 2375
1841 nmdc:mga0yw44_622060_c1 3300050492 Bacteria 734
1842 nmdc:mga0yw44_68829_c1 3300050492 Bacteria 2191
1843 nmdc:mga0k408_20070_c1 3300050493 Bacteria 3739
1844 nmdc:mga0k408_240627_c1 3300050493 Bacteria 1081
1845 nmdc:mga0k408_263196_c1 3300050493 Bacteria 1030
1846 nmdc:mga0k408_439977_c1 3300050493 Bacteria 775
1847 nmdc:mga0k408_579178_c1 3300050493 Bacteria 663
1848 nmdc:mga06z11_118295_c1 3300050494 Bacteria 1476
1849 nmdc:mga06z11_149729_c1 3300050494 Bacteria 1326
1850 nmdc:mga06z11_167200_c1 3300050494 Bacteria 1261
1851 nmdc:mga06z11_384457_c1 3300050494 Bacteria 843
1852 nmdc:mga06z11_471270_c1 3300050494 Bacteria 760
1853 nmdc:mga06z11_640924_c1 3300050494 Bacteria 647
1854 nmdc:mga06z11_70427_c1 3300050494 Bacteria 1849
1855 nmdc:mga06z11_76642_c2 3300050494 Bacteria 1437
1856 nmdc:mga04h51_20498_c1 3300050495 Bacteria 1975
1857 nmdc:mga04h51_40208_c1 3300050495 Bacteria 1523
1858 nmdc:mga04h51_80770_c1 3300050495 Bacteria 1153
1859 nmdc:mga07m45_187182_c1 3300050496 Bacteria 1204
1860 nmdc:mga07m45_199906_c1 3300050496 Bacteria 1163
1861 nmdc:mga07m45_292431_c1 3300050496 Bacteria 948
1862 nmdc:mga07m45_480802_c1 3300050496 Bacteria 720
1863 nmdc:mga07m45_65659_c1 3300050496 Bacteria 2060
1864 nmdc:mga07m45_68266_c1 3300050496 Bacteria 2021
1865 nmdc:mga07m45_87948_c1 3300050496 Bacteria 1778
1866 nmdc:mga05p37_107787_c1 3300050507 Bacteria 3427
1867 nmdc:mga09592_1193976_c1 3300050508 Bacteria 629
1868 nmdc:mga0qj67_328369_c1 3300050509 Bacteria 1238
1869 nmdc:mga0n895_442643_c1 3300050512 Bacteria 1313
1870 nmdc:mga0n895_5268_c1 3300050512 Bacteria 10768
1871 nmdc:mga0rr50_615796_c1 3300050513 Bacteria 926
1872 nmdc:mga0sz30_130156_c1 3300050516 Bacteria 1109
1873 nmdc:mga0sz30_132964_c1 3300050516 Bacteria 1097
1874 nmdc:mga0sz30_135357_c1 3300050516 Bacteria 1087
1875 nmdc:mga0sz30_146402_c1 3300050516 Bacteria 1044
1876 nmdc:mga0sz30_17788_c1 3300050516 Bacteria 2838
1877 nmdc:mga0sz30_236683_c1 3300050516 Bacteria 813
1878 nmdc:mga0sz30_24769_c1 3300050516 Bacteria 2451
1879 Ga0495601_0056376 3300053077 Bacteria 2488
1880 Ga0495601_0158728 3300053077 Bacteria 1478
1881 Ga0495601_0174072 3300053077 Bacteria 1407
1882 Ga0495601_0234530 3300053077 Bacteria 1198
1883 Ga0495612_0052075 3300053078 Bacteria 1683
1884 Ga0495612_0137090 3300053078 Bacteria 1060
1885 Ga0495612_0338722 3300053078 Bacteria 678
1886 Ga0500610_0086740 3300053079 Bacteria 1628
1887 Ga0500610_0102190 3300053079 Bacteria 1482
1888 Ga0500635_0095247 3300053080 Bacteria 1088
1889 Ga0495655_0013054 3300053083 Bacteria 1708
1890 Ga0495655_0033255 3300053083 Bacteria 1267
1891 Ga0495655_0084300 3300053083 Bacteria 914
1892 Ga0495595_0006801 3300053084 Bacteria 4667
1893 Ga0495619_0001443 3300053085 Bacteria 15640
1894 Ga0500578_0014351 3300053086 Bacteria 5096
1895 Ga0500578_0015697 3300053086 Bacteria 4863
1896 Ga0500578_0084328 3300053086 Bacteria 2019
1897 Ga0500578_0156352 3300053086 Bacteria 1417
1898 Ga0500578_0178822 3300053086 Bacteria 1308
1899 Ga0500643_000227 3300053087 Bacteria 52101
1900 Ga0500643_021452 3300053087 Bacteria 2093
1901 Ga0500643_035296 3300053087 Bacteria 1501
1902 Ga0500644_0008515 3300053088 Bacteria 2710
1903 Ga0500644_0268444 3300053088 Bacteria 723
1904 Ga0500646_0013276 3300053090 Bacteria 2131
1905 Ga0500646_0187275 3300053090 Bacteria 704
1906 Ga0500647_0082642 3300053091 Bacteria 1540
1907 Ga0500583_0205078 3300053092 Bacteria 979
1908 Ga0500583_0251208 3300053092 Bacteria 873
1909 Ga0500651_0021718 3300053093 Bacteria 4003
1910 Ga0500651_0224117 3300053093 Bacteria 1101
1911 Ga0500651_0268116 3300053093 Bacteria 988
1912 Ga0500651_0286415 3300053093 Bacteria 949
1913 Ga0500566_0000320 3300053094 Bacteria 25974
1914 Ga0500566_0034994 3300053094 Bacteria 2919
1915 Ga0500566_0361817 3300053094 Bacteria 661
1916 Ga0500640_031882 3300053095 Bacteria 2311
1917 Ga0500640_065532 3300053095 Bacteria 1566
1918 Ga0500641_0003415 3300053096 Bacteria 5615
1919 Ga0500641_0153810 3300053096 Bacteria 992
1920 Ga0500650_0001944 3300053098 Bacteria 6560
1921 Ga0500650_0225259 3300053098 Bacteria 847
1922 Ga0500650_0275431 3300053098 Bacteria 749
1923 Ga0500654_119310 3300053099 Bacteria 1045
1924 Ga0500654_132521 3300053099 Bacteria 938
1925 Ga0500554_085161 3300053102 Bacteria 1045
1926 Ga0500554_103480 3300053102 Bacteria 954
1927 Ga0500555_003915 3300053103 Bacteria 4237
1928 Ga0500555_030794 3300053103 Bacteria 1522
1929 Ga0500555_096216 3300053103 Bacteria 756
1930 Ga0500556_0000125 3300053104 Bacteria 65777
1931 Ga0500556_0301825 3300053104 Bacteria 626
1932 Ga0500557_156065 3300053105 Bacteria 749
1933 Ga0500562_029407 3300053108 Bacteria 1445
1934 Ga0500562_051142 3300053108 Bacteria 1105
1935 Ga0500562_179705 3300053108 Bacteria 574
1936 Ga0500569_015781 3300053109 Bacteria 1898
1937 Ga0500569_123083 3300053109 Bacteria 864
1938 Ga0500569_249165 3300053109 Bacteria 602
1939 Ga0500572_001453 3300053111 Bacteria 6482
1940 Ga0500572_003008 3300053111 Bacteria 3934
1941 Ga0500572_004079 3300053111 Bacteria 3319
1942 Ga0500572_005431 3300053111 Bacteria 2886
1943 Ga0500592_012356 3300053116 Bacteria 1367
1944 Ga0500594_0003742 3300053118 Bacteria 3351
1945 Ga0500594_0076516 3300053118 Bacteria 993
1946 Ga0500594_0128286 3300053118 Bacteria 801
1947 Ga0500595_004583 3300053119 Bacteria 6165
1948 Ga0500595_016409 3300053119 Bacteria 2759
1949 Ga0500595_029914 3300053119 Bacteria 1842
1950 Ga0500595_070086 3300053119 Bacteria 1042
1951 Ga0500595_089460 3300053119 Bacteria 892
1952 Ga0500607_099409 3300053121 Bacteria 1447
1953 Ga0500608_014127 3300053122 Bacteria 3557
1954 Ga0500608_075094 3300053122 Bacteria 1603
1955 Ga0500614_006081 3300053123 Bacteria 2538
1956 Ga0500614_014604 3300053123 Bacteria 1742
1957 Ga0500614_148761 3300053123 Bacteria 704
1958 Ga0500618_007381 3300053125 Bacteria 3141
1959 Ga0500618_018644 3300053125 Bacteria 1715
1960 Ga0500618_021998 3300053125 Bacteria 1552
1961 Ga0500618_048846 3300053125 Bacteria 960
1962 Ga0500623_204432 3300053127 Bacteria 724
1963 Ga0500626_191428 3300053128 Bacteria 815
1964 Ga0500642_0000105 3300053130 Bacteria 40593
1965 Ga0500642_0428789 3300053130 Bacteria 571
1966 Ga0500652_000301 3300053131 Bacteria 17879
1967 Ga0500655_069503 3300053133 Bacteria 716
1968 Ga0500658_0041978 3300053134 Bacteria 1836
1969 Ga0500658_0132638 3300053134 Bacteria 1112
1970 Ga0500658_0163884 3300053134 Bacteria 1008
1971 Ga0500559_0002803 3300053136 Bacteria 8808
1972 Ga0500559_0004117 3300053136 Bacteria 6972
1973 Ga0500559_0047761 3300053136 Bacteria 1880
1974 Ga0500559_0094839 3300053136 Bacteria 1369
1975 Ga0500564_004201 3300053138 Bacteria 5729
1976 Ga0500564_189623 3300053138 Bacteria 852
1977 Ga0500568_0001953 3300053139 Bacteria 12637
1978 Ga0500568_0003848 3300053139 Bacteria 8189
1979 Ga0500568_0050784 3300053139 Bacteria 1633
1980 Ga0500568_0054507 3300053139 Bacteria 1563
1981 Ga0500568_0060124 3300053139 Bacteria 1472
1982 Ga0500568_0121610 3300053139 Bacteria 972
1983 Ga0500573_0051024 3300053140 Bacteria 2379
1984 Ga0500577_0083822 3300053142 Bacteria 1276
1985 Ga0500586_000283 3300053145 Bacteria 10219
1986 Ga0500588_0027678 3300053146 Bacteria 1599
1987 Ga0500589_076626 3300053147 Bacteria 1501
1988 Ga0500590_019927 3300053148 Bacteria 3477
1989 Ga0500590_082463 3300053148 Bacteria 1576
1990 Ga0500603_009617 3300053150 Bacteria 2166
1991 Ga0500603_013709 3300053150 Bacteria 1883
1992 Ga0500604_0036252 3300053151 Bacteria 1470
1993 Ga0500604_0049762 3300053151 Bacteria 1289
1994 Ga0500616_0000085 3300053153 Bacteria 193192
1995 Ga0500616_0000876 3300053153 Bacteria 33191
1996 Ga0500616_0004053 3300053153 Bacteria 10652
1997 Ga0500616_0015762 3300053153 Bacteria 4314
1998 Ga0500616_0023156 3300053153 Bacteria 3462
1999 Ga0500616_0037795 3300053153 Bacteria 2611
2000 Ga0500616_0091357 3300053153 Bacteria 1507
2001 Ga0500616_0140697 3300053153 Bacteria 1128
2002 Ga0500619_000847 3300053154 Bacteria 5225
2003 Ga0500620_001784 3300053155 Bacteria 4106
2004 Ga0500620_011956 3300053155 Bacteria 2346
2005 Ga0500620_106040 3300053155 Bacteria 983
2006 Ga0500622_0001277 3300053156 Bacteria 20505
2007 Ga0500622_0004034 3300053156 Bacteria 9449
2008 Ga0500622_0071766 3300053156 Bacteria 1749
2009 Ga0500624_003843 3300053157 Bacteria 1969
2010 Ga0500624_005626 3300053157 Bacteria 1672
2011 Ga0500624_014638 3300053157 Bacteria 1189
2012 Ga0500627_0004443 3300053158 Bacteria 4507
2013 Ga0500627_0057865 3300053158 Bacteria 1701
2014 Ga0500627_0064661 3300053158 Bacteria 1613
2015 Ga0500627_0075227 3300053158 Bacteria 1500
2016 Ga0500627_0228549 3300053158 Bacteria 828
2017 Ga0500630_030399 3300053159 Bacteria 2656
2018 Ga0500633_0133711 3300053160 Bacteria 926
2019 Ga0500633_0148145 3300053160 Bacteria 879
2020 Ga0500634_0094521 3300053161 Bacteria 1509
2021 Ga0500638_002268 3300053162 Bacteria 6590
2022 Ga0500638_135474 3300053162 Bacteria 1111
2023 Ga0500638_202755 3300053162 Bacteria 838
2024 Ga0500639_002134 3300053163 Bacteria 9896
2025 Ga0500639_099603 3300053163 Bacteria 1433
2026 Ga0500636_0004057 3300053177 Bacteria 8266
2027 Ga0500636_0105133 3300053177 Bacteria 1600
2028 Ga0500636_0122353 3300053177 Bacteria 1458
2029 Ga0500636_0210649 3300053177 Bacteria 1020
2030 Ga0500636_0241209 3300053177 Bacteria 928
2031 Ga0500637_0022986 3300053178 Bacteria 3402
2032 Ga0500637_0073848 3300053178 Bacteria 1964
2033 Ga0500637_0105143 3300053178 Bacteria 1637
2034 Ga0500637_0129175 3300053178 Bacteria 1465
2035 Ga0500567_099548 3300053723 Bacteria 1211
2036 Ga0500567_144680 3300053723 Bacteria 903
2037 Ga0500611_000533 3300053727 Bacteria 3857
2038 Ga0500611_017745 3300053727 Bacteria 1301
2039 Ga0500645_012887 3300053730 Bacteria 2694
2040 Ga0500645_095920 3300053730 Bacteria 839
2041 Ga0500645_100114 3300053730 Bacteria 818
2042 Ga0500609_001189 3300053731 Bacteria 3871
2043 Ga0500609_012600 3300053731 Bacteria 1144
2044 Ga0500552_001810 3300053733 Bacteria 2050
2045 Ga0500596_002522 3300053735 Bacteria 3610
2046 Ga0500596_002612 3300053735 Bacteria 3536
2047 Ga0500596_005669 3300053735 Bacteria 2172
2048 Ga0500601_000668 3300053737 Bacteria 4680
2049 Ga0501084_0208952 3300054114 Bacteria 1647
2050 Ga0587084_002030 3300059477 Bacteria 2034
2051 Ga0587084_020477 3300059477 Bacteria 984
2052 Ga0587084_027157 3300059477 Bacteria 898
2053 Ga0587084_065251 3300059477 Bacteria 676
2054 Ga0587093_006135 3300059478 Bacteria 1297
2055 Ga0587093_025816 3300059478 Bacteria 817
2056 Ga0587066_016961 3300059490 Bacteria 1154
2057 Ga0587066_025694 3300059490 Bacteria 1012
2058 Ga0587066_049213 3300059490 Bacteria 823
2059 Ga0587066_092013 3300059490 Bacteria 675
2060 Ga0587070_003021 3300059491 Bacteria 1973
2061 Ga0587070_021067 3300059491 Bacteria 1097
2062 Ga0587070_028503 3300059491 Bacteria 996
2063 Ga0587070_050158 3300059491 Bacteria 831
2064 Ga0587073_0002863 3300059492 Bacteria 2283
2065 Ga0587073_0003501 3300059492 Bacteria 2159
2066 Ga0587073_0020094 3300059492 Bacteria 1269
2067 Ga0587073_0077065 3300059492 Bacteria 819
2068 Ga0587077_000009 3300059493 Bacteria 7681
2069 Ga0587077_000966 3300059493 Bacteria 2861
2070 Ga0587077_001192 3300059493 Bacteria 2699
2071 Ga0587077_007037 3300059493 Bacteria 1621
2072 Ga0587077_084584 3300059493 Bacteria 735
2073 Ga0587077_086847 3300059493 Bacteria 728
2074 Ga0587077_100241 3300059493 Bacteria 695
2075 Ga0587080_001548 3300059503 Bacteria 2523
2076 Ga0587080_021206 3300059503 Bacteria 1067
2077 Ga0587080_025000 3300059503 Bacteria 1005
2078 Ga0587080_030585 3300059503 Bacteria 935
2079 Ga0587080_046042 3300059503 Bacteria 810
2080 Ga0587080_055123 3300059503 Bacteria 761
2081 Ga0587080_073464 3300059503 Bacteria 689
2082 Ga0587080_080642 3300059503 Bacteria 667
2083 Ga0587082_002172 3300059504 Bacteria 2171
2084 Ga0587082_010331 3300059504 Bacteria 1345
2085 Ga0587082_011836 3300059504 Bacteria 1284
2086 Ga0587082_018124 3300059504 Bacteria 1117
2087 Ga0587082_060319 3300059504 Bacteria 746
2088 Ga0587083_0000779 3300059505 Bacteria 3164
2089 Ga0587083_0005010 3300059505 Bacteria 1886
2090 Ga0587083_0009643 3300059505 Bacteria 1543
2091 Ga0587083_0048563 3300059505 Bacteria 917
2092 Ga0587083_0063068 3300059505 Bacteria 841
2093 Ga0587083_0070597 3300059505 Bacteria 810
2094 Ga0587083_0143102 3300059505 Bacteria 639
2095 Ga0587086_012441 3300059507 Bacteria 1057
2096 Ga0587086_019666 3300059507 Bacteria 911
2097 Ga0587086_025772 3300059507 Bacteria 834
2098 Ga0587088_003238 3300059508 Bacteria 1952
2099 Ga0587088_005796 3300059508 Bacteria 1641
2100 Ga0587088_092060 3300059508 Bacteria 665
2101 Ga0587089_014607 3300059509 Bacteria 1028
2102 Ga0587090_014809 3300059510 Bacteria 1145
2103 Ga0587090_033265 3300059510 Bacteria 873
2104 Ga0587090_044553 3300059510 Bacteria 793
2105 Ga0587091_002706 3300059511 Bacteria 2139
2106 Ga0587091_030088 3300059511 Bacteria 1013
2107 Ga0587091_069227 3300059511 Bacteria 768
2108 Ga0587091_123639 3300059511 Bacteria 631
2109 Ga0587092_030647 3300059512 Bacteria 888
2110 Ga0587094_003207 3300059513 Bacteria 1762
2111 Ga0587094_010537 3300059513 Bacteria 1201
2112 Ga0587094_025919 3300059513 Bacteria 881
2113 Ga0587095_001259 3300059514 Bacteria 1524
2114 Ga0587106_000532 3300059605 Bacteria 2754
2115 Ga0587106_001821 3300059605 Bacteria 1981
2116 Ga0587106_032656 3300059605 Bacteria 844
2117 Ga0587106_048323 3300059605 Bacteria 746
2118 Ga0587106_065610 3300059605 Bacteria 677
2119 Ga0587125_000201 3300059607 Bacteria 2966
2120 Ga0587099_000819 3300059622 Bacteria 1980
2121 Ga0587101_000083 3300059623 Bacteria 4378
2122 Ga0587101_001406 3300059623 Bacteria 2070
2123 Ga0587101_001709 3300059623 Bacteria 1953
2124 Ga0587101_026514 3300059623 Bacteria 875
2125 Ga0587101_033032 3300059623 Bacteria 817
2126 Ga0587113_018961 3300059625 Bacteria 709
2127 Ga0587117_001509 3300059627 Bacteria 1988
2128 Ga0587128_001043 3300059630 Bacteria 2460
2129 Ga0587128_002525 3300059630 Bacteria 1917
2130 Ga0587128_014831 3300059630 Bacteria 1121
2131 Ga0587062_000087 3300059639 Bacteria 4502
2132 Ga0587062_001045 3300059639 Bacteria 2235
2133 Ga0587067_000579 3300059640 Bacteria 3324
2134 Ga0587067_002914 3300059640 Bacteria 2086
2135 Ga0587067_020253 3300059640 Bacteria 1135
2136 Ga0587067_040989 3300059640 Bacteria 900
2137 Ga0587068_004710 3300059641 Bacteria 1818
2138 Ga0587068_005189 3300059641 Bacteria 1764
2139 Ga0587068_017886 3300059641 Bacteria 1137
2140 Ga0587068_027314 3300059641 Bacteria 970
2141 Ga0587069_000933 3300059642 Bacteria 2487
2142 Ga0587069_007649 3300059642 Bacteria 1341
2143 Ga0587069_066102 3300059642 Bacteria 677
2144 Ga0587072_001084 3300059643 Bacteria 3200
2145 Ga0587072_023890 3300059643 Bacteria 1102
2146 Ga0587072_057239 3300059643 Bacteria 795
2147 Ga0587075_007386 3300059644 Bacteria 1377
2148 Ga0587075_045319 3300059644 Bacteria 751
2149 Ga0587076_001067 3300059645 Bacteria 2654
2150 Ga0587076_002866 3300059645 Bacteria 1988
2151 Ga0587076_006339 3300059645 Bacteria 1573
2152 Ga0587076_012964 3300059645 Bacteria 1255
2153 Ga0587076_013372 3300059645 Bacteria 1244
2154 Ga0587076_040978 3300059645 Bacteria 865
2155 Ga0587076_047296 3300059645 Bacteria 826
2156 Ga0587078_001949 3300059646 Bacteria 1943
2157 Ga0587078_003530 3300059646 Bacteria 1592
2158 Ga0587078_011343 3300059646 Bacteria 1034
2159 Ga0587078_025263 3300059646 Bacteria 774
2160 Ga0587079_001640 3300059647 Bacteria 2567
2161 Ga0587079_001675 3300059647 Bacteria 2547
2162 Ga0587079_035708 3300059647 Bacteria 979
2163 Ga0587079_081662 3300059647 Bacteria 741
2164 Ga0587100_000435 3300059648 Bacteria 1974
2165 Ga0587100_009027 3300059648 Bacteria 816
2166 Ga0587102_001812 3300059649 Bacteria 1566
2167 Ga0587102_013443 3300059649 Bacteria 847
2168 Ga0587104_000880 3300059650 Bacteria 1447
2169 Ga0587105_000231 3300059651 Bacteria 2030
2170 Ga0587107_000246 3300059652 Bacteria 3204
2171 Ga0587107_011972 3300059652 Bacteria 1073
2172 Ga0587107_026748 3300059652 Bacteria 849
2173 Ga0587107_030915 3300059652 Bacteria 814
2174 Ga0587107_032044 3300059652 Bacteria 806
2175 Ga0587107_050262 3300059652 Bacteria 705
2176 Ga0587107_063701 3300059652 Bacteria 657
2177 Ga0587110_003745 3300059654 Bacteria 1289
2178 Ga0587114_015371 3300059655 Bacteria 1011
2179 Ga0587118_01321 3300059657 Bacteria 1483
2180 Ga0587124_001062 3300059660 Bacteria 1707
2181 Ga0587071_004370 3300060344 Bacteria 2102
2182 Ga0587071_038692 3300060344 Bacteria 948
2183 Ga0587071_039260 3300060344 Bacteria 943
2184 Ga0587071_084729 3300060344 Bacteria 711
2185 Ga0587111_0008874 3300060346 Bacteria 1679
2186 Ga0587111_0021561 3300060346 Bacteria 1244
2187 Ga0587111_0026461 3300060346 Bacteria 1156
2188 Ga0587111_0174304 3300060346 Bacteria 594
2189 Ga0501082_0077674 3300060353 Bacteria 2863
2190 Ga0501082_0949836 3300060353 Bacteria 752

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10803025 Ga0114129_108030252 156
2 3300042157 Ga0439458_0024387 Ga0439458_0024387_95_604 156
3 3300050494 nmdc:mga06z11_640924_c1 nmdc:mga06z11_640924_c1_108_617 156
4 3300012483 Ga0157337_1004344 Ga0157337_10043442 162
5 3300053087 Ga0500643_035296 Ga0500643_035296_884_1393 162
6 3300053092 Ga0500583_0205078 Ga0500583_0205078_243_752 162
7 3300005578 Ga0068854_100289438 Ga0068854_1002894383 163
8 3300005937 Ga0081455_10011724 Ga0081455_1001172414 163
9 3300025981 Ga0207640_10082080 Ga0207640_100820802 163
10 3300037471 Ga0395905_0122200 Ga0395905_0122200_1418_1951 163
11 3300049743 Ga0501081_0373523 Ga0501081_0373523_468_1001 163
12 3300001989 JGI24739J22299_10023100 JGI24739J22299_100231003 164
13 3300001990 JGI24737J22298_10014566 JGI24737J22298_100145662 164
14 3300005366 Ga0070659_100093075 Ga0070659_1000930753 164
15 3300005563 Ga0068855_100748333 Ga0068855_1007483331 164
16 3300006195 Ga0075366_10807706 Ga0075366_108077061 164
17 3300025297 Ga0209758_1005457 Ga0209758_100545712 164
18 3300025932 Ga0207690_10180895 Ga0207690_101808953 164
19 3300025949 Ga0207667_10374831 Ga0207667_103748314 164
20 3300033180 Ga0307510_10019223 Ga0307510_100192237 164
21 3300049576 Ga0501040_0185433 Ga0501040_0185433_429_938 164
22 3300049578 Ga0501042_0490992 Ga0501042_0490992_360_869 164
23 3300050494 nmdc:mga06z11_149729_c1 nmdc:mga06z11_149729_c1_59_592 164
24 3300050507 nmdc:mga05p37_107787_c1 nmdc:mga05p37_107787_c1_154_687 164
25 3300050516 nmdc:mga0sz30_135357_c1 nmdc:mga0sz30_135357_c1_397_930 164
26 3300013249 Ga0171463_1011 Ga0171463_101141 166
27 3300015690 Ga0183363_1121 Ga0183363_11217 166
28 3300031995 Ga0307409_101062512 Ga0307409_1010625122 166
29 3300053095 Ga0500640_065532 Ga0500640_065532_303_836 166
30 3300059503 Ga0587080_021206 Ga0587080_021206_44_544 166
31 3300003752 Ga0055539_1004785 Ga0055539_10047854 167
32 3300006042 Ga0075368_10127719 Ga0075368_101277192 167
33 3300006186 Ga0075369_10307634 Ga0075369_103076341 167
34 3300006358 Ga0068871_100185062 Ga0068871_1001850622 167
35 3300025253 Ga0209677_100816 Ga0209677_10081616 167
36 3300025302 Ga0207426_1000605 Ga0207426_10006051 167
37 3300035692 Ga0373935_1310739 Ga0373935_1310739_12_515 167
38 3300042004 Ga0439445_0195117 Ga0439445_0195117_71_574 167
39 3300046506 Ga0495583_0092005 Ga0495583_0092005_782_1285 167
40 3300048903 Ga0496100_1423029 Ga0496100_1423029_32_535 167
41 3300048921 Ga0496118_0038146 Ga0496118_0038146_23_556 167
42 3300048924 Ga0496121_0071016 Ga0496121_0071016_957_1490 167
43 3300049742 Ga0501080_0214502 Ga0501080_0214502_1242_1745 167
44 3300049742 Ga0501080_1012279 Ga0501080_1012279_22_525 167
45 3300005335 Ga0070666_10353481 Ga0070666_103534812 168
46 3300005353 Ga0070669_100178786 Ga0070669_1001787861 168
47 3300005842 Ga0068858_100281378 Ga0068858_1002813783 168
48 3300009101 Ga0105247_10183825 Ga0105247_101838253 168
49 3300025261 Ga0209233_1000925 Ga0209233_10009255 168
50 3300025903 Ga0207680_10151154 Ga0207680_101511543 168
51 3300053153 Ga0500616_0000085 Ga0500616_0000085_137586_138119 168
52 3300060346 Ga0587111_0174304 Ga0587111_0174304_19_552 168
53 iso_pu_bacteria 2965110997 2965119198 168
54 3300005327 Ga0070658_10129002 Ga0070658_101290025 169
55 3300009101 Ga0105247_10651234 Ga0105247_106512341 169
56 3300009174 Ga0105241_10497460 Ga0105241_104974602 169
57 3300009553 Ga0105249_10359397 Ga0105249_103593972 169
58 3300011119 Ga0105246_10860944 Ga0105246_108609442 169
59 3300012477 Ga0157336_1011556 Ga0157336_10115561 169
60 3300012492 Ga0157335_1017071 Ga0157335_10170712 169
61 3300013297 Ga0157378_11749985 Ga0157378_117499852 169
62 3300013306 Ga0163162_10420389 Ga0163162_104203894 169
63 3300014325 Ga0163163_11277198 Ga0163163_112771982 169
64 3300014497 Ga0182008_10702647 Ga0182008_107026471 169
65 3300014745 Ga0157377_10577928 Ga0157377_105779282 169
66 3300015261 Ga0182006_1076059 Ga0182006_10760593 169
67 3300025909 Ga0207705_10897083 Ga0207705_108970832 169
68 3300035083 Ga0373926_0068693 Ga0373926_0068693_418_927 169
69 3300035088 Ga0373940_0085362 Ga0373940_0085362_213_722 169
70 3300035089 Ga0373944_0024464 Ga0373944_0024464_130_639 169
71 3300035092 Ga0373952_0007333 Ga0373952_0007333_1013_1522 169
72 3300035113 Ga0373936_0022605 Ga0373936_0022605_1038_1547 169
73 3300035170 Ga0373943_0003463 Ga0373943_0003463_902_1411 169
74 3300035172 Ga0373955_0368936 Ga0373955_0368936_264_773 169
75 3300035241 Ga0373961_0124000 Ga0373961_0124000_216_725 169
76 3300035691 Ga0373931_0051137 Ga0373931_0051137_65_574 169
77 3300035692 Ga0373935_0006317 Ga0373935_0006317_4337_4846 169
78 3300035695 Ga0373927_0025754 Ga0373927_0025754_2095_2604 169
79 3300035724 Ga0373933_0153266 Ga0373933_0153266_774_1283 169
80 3300037068 Ga0373925_0005636 Ga0373925_0005636_6901_7410 169
81 3300037418 Ga0395900_0050005 Ga0395900_0050005_3642_4151 169
82 3300037466 Ga0395898_0104107 Ga0395898_0104107_1857_2366 169
83 3300037471 Ga0395905_0546988 Ga0395905_0546988_24_533 169
84 3300037853 Ga0436364_0877349 Ga0436364_0877349_256_765 169
85 3300041463 Ga0451804_0446889 Ga0451804_0446889_436_945 169
86 3300042011 Ga0439454_004038 Ga0439454_004038_659_1168 169
87 3300042438 Ga0439459_0149042 Ga0439459_0149042_13_522 169
88 3300046454 Ga0495592_0076879 Ga0495592_0076879_59_568 169
89 3300046455 Ga0495603_0007442 Ga0495603_0007442_2085_2594 169
90 3300046459 Ga0495629_0016778 Ga0495629_0016778_4418_4927 169
91 3300046460 Ga0495638_0360000 Ga0495638_0360000_228_737 169
92 3300046461 Ga0495641_0012494 Ga0495641_0012494_2092_2601 169
93 3300046463 Ga0495653_0104959 Ga0495653_0104959_705_1214 169
94 3300046471 Ga0495650_0143952 Ga0495650_0143952_124_633 169
95 3300046472 Ga0495580_0022295 Ga0495580_0022295_853_1362 169
96 3300046472 Ga0495580_0243520 Ga0495580_0243520_99_608 169
97 3300046473 Ga0495582_0000163 Ga0495582_0000163_2251_2760 169
98 3300046474 Ga0495605_0201719 Ga0495605_0201719_280_789 169
99 3300046475 Ga0495639_0000873 Ga0495639_0000873_7583_8092 169
100 3300046475 Ga0495639_0036968 Ga0495639_0036968_897_1406 169
101 3300046476 Ga0495662_0000285 Ga0495662_0000285_2497_3006 169
102 3300046477 Ga0495664_0005138 Ga0495664_0005138_3144_3653 169
103 3300046499 Ga0495594_0002164 Ga0495594_0002164_2233_2742 169
104 3300046512 Ga0495610_0049985 Ga0495610_0049985_712_1221 169
105 3300046514 Ga0495618_0034866 Ga0495618_0034866_736_1245 169
106 3300046515 Ga0495620_0041601 Ga0495620_0041601_647_1156 169
107 3300046516 Ga0495628_0106321 Ga0495628_0106321_418_927 169
108 3300046517 Ga0495630_0027680 Ga0495630_0027680_2190_2699 169
109 3300046518 Ga0495631_0163607 Ga0495631_0163607_65_574 169
110 3300046519 Ga0495632_0148294 Ga0495632_0148294_344_853 169
111 3300046519 Ga0495632_0406026 Ga0495632_0406026_57_566 169
112 3300046522 Ga0495643_0120853 Ga0495643_0120853_456_965 169
113 3300046526 Ga0495666_0057685 Ga0495666_0057685_97_606 169
114 3300046526 Ga0495666_0057810 Ga0495666_0057810_337_846 169
115 3300046529 Ga0495652_0091173 Ga0495652_0091173_265_774 169
116 3300046530 Ga0495654_0202547 Ga0495654_0202547_179_688 169
117 3300046531 Ga0495665_0004495 Ga0495665_0004495_4365_4874 169
118 3300046533 Ga0495640_0017722 Ga0495640_0017722_2808_3317 169
119 3300046537 Ga0495598_0263375 Ga0495598_0263375_97_606 169
120 3300046538 Ga0495609_0169871 Ga0495609_0169871_303_812 169
121 3300046543 Ga0495645_0592660 Ga0495645_0592660_19_528 169
122 3300046559 Ga0495667_0032383 Ga0495667_0032383_2446_2955 169
123 3300046616 Ga0495668_0201897 Ga0495668_0201897_276_785 169
124 3300046648 Ga0495611_0234501 Ga0495611_0234501_82_591 169
125 3300046663 Ga0495635_0036862 Ga0495635_0036862_2020_2529 169
126 3300046674 Ga0495588_0079565 Ga0495588_0079565_26_535 169
127 3300046680 Ga0495646_0009353 Ga0495646_0009353_4924_5433 169
128 3300046681 Ga0495647_0006072 Ga0495647_0006072_2081_2590 169
129 3300046681 Ga0495647_0085938 Ga0495647_0085938_209_718 169
130 3300046683 Ga0495658_0001480 Ga0495658_0001480_5079_5588 169
131 3300046684 Ga0495669_0071622 Ga0495669_0071622_743_1252 169
132 3300046689 Ga0495613_0068299 Ga0495613_0068299_1836_2345 169
133 3300046690 Ga0495624_0004478 Ga0495624_0004478_2709_3218 169
134 3300046692 Ga0495671_0066997 Ga0495671_0066997_779_1288 169
135 3300047315 Ga0495581_0004107 Ga0495581_0004107_840_1349 169
136 3300047317 Ga0495604_0298678 Ga0495604_0298678_525_1034 169
137 3300047319 Ga0495674_0081704 Ga0495674_0081704_380_889 169
138 3300047320 Ga0495672_0215848 Ga0495672_0215848_301_810 169
139 3300047320 Ga0495672_0224259 Ga0495672_0224259_393_902 169
140 3300047321 Ga0495676_0522864 Ga0495676_0522864_250_759 169
141 3300047469 Ga0495673_0206468 Ga0495673_0206468_74_583 169
142 3300047673 Ga0495593_0003980 Ga0495593_0003980_2552_3061 169
143 3300048089 Ga0495614_0096077 Ga0495614_0096077_624_1133 169
144 3300048903 Ga0496100_1082482 Ga0496100_1082482_93_602 169
145 3300048905 Ga0496102_0597617 Ga0496102_0597617_323_832 169
146 3300048907 Ga0496104_0134355 Ga0496104_0134355_340_849 169
147 3300048907 Ga0496104_0424340 Ga0496104_0424340_17_526 169
148 3300048908 Ga0496105_0068020 Ga0496105_0068020_818_1327 169
149 3300048909 Ga0496106_0012368 Ga0496106_0012368_3684_4193 169
150 3300048910 Ga0496107_0195912 Ga0496107_0195912_413_922 169
151 3300048912 Ga0496109_0052420 Ga0496109_0052420_2617_3126 169
152 3300048913 Ga0496110_0893074 Ga0496110_0893074_207_716 169
153 3300048915 Ga0496112_0065915 Ga0496112_0065915_563_1072 169
154 3300048916 Ga0496113_1280684 Ga0496113_1280684_49_558 169
155 3300048917 Ga0496114_0202573 Ga0496114_0202573_699_1208 169
156 3300048918 Ga0496115_0224324 Ga0496115_0224324_311_820 169
157 3300048919 Ga0496116_0087897 Ga0496116_0087897_516_1025 169
158 3300048926 Ga0496123_0130297 Ga0496123_0130297_443_952 169
159 3300048926 Ga0496123_0180592 Ga0496123_0180592_475_984 169
160 3300048929 Ga0496126_0055514 Ga0496126_0055514_2355_2864 169
161 3300049459 Ga0495678_114186 Ga0495678_114186_134_643 169
162 3300049460 Ga0495682_0114243 Ga0495682_0114243_197_706 169
163 3300049652 Ga0501202_125437 Ga0501202_125437_123_632 169
164 3300050492 nmdc:mga0yw44_158476_c1 nmdc:mga0yw44_158476_c1_140_649 169
165 3300050493 nmdc:mga0k408_579178_c1 nmdc:mga0k408_579178_c1_23_532 169
166 3300053077 Ga0495601_0174072 Ga0495601_0174072_693_1202 169
167 3300053078 Ga0495612_0338722 Ga0495612_0338722_21_530 169
168 3300053083 Ga0495655_0084300 Ga0495655_0084300_186_695 169
169 3300053086 Ga0500578_0156352 Ga0500578_0156352_18_527 169
170 3300053087 Ga0500643_000227 Ga0500643_000227_35925_36434 169
171 3300053094 Ga0500566_0034994 Ga0500566_0034994_1859_2368 169
172 3300053096 Ga0500641_0153810 Ga0500641_0153810_19_528 169
173 3300053098 Ga0500650_0225259 Ga0500650_0225259_284_793 169
174 3300053099 Ga0500654_119310 Ga0500654_119310_518_1027 169
175 3300053103 Ga0500555_003915 Ga0500555_003915_2777_3286 169
176 3300053108 Ga0500562_179705 Ga0500562_179705_52_561 169
177 3300053109 Ga0500569_249165 Ga0500569_249165_52_561 169
178 3300053111 Ga0500572_005431 Ga0500572_005431_779_1288 169
179 3300053118 Ga0500594_0076516 Ga0500594_0076516_35_544 169
180 3300053119 Ga0500595_004583 Ga0500595_004583_5637_6146 169
181 3300053119 Ga0500595_089460 Ga0500595_089460_47_556 169
182 3300053122 Ga0500608_014127 Ga0500608_014127_155_664 169
183 3300053123 Ga0500614_006081 Ga0500614_006081_1367_1876 169
184 3300053125 Ga0500618_018644 Ga0500618_018644_698_1207 169
185 3300053127 Ga0500623_204432 Ga0500623_204432_74_583 169
186 3300053130 Ga0500642_0428789 Ga0500642_0428789_13_522 169
187 3300053136 Ga0500559_0047761 Ga0500559_0047761_709_1218 169
188 3300053138 Ga0500564_004201 Ga0500564_004201_2748_3257 169
189 3300053139 Ga0500568_0121610 Ga0500568_0121610_13_522 169
190 3300053147 Ga0500589_076626 Ga0500589_076626_227_736 169
191 3300053150 Ga0500603_013709 Ga0500603_013709_633_1142 169
192 3300053154 Ga0500619_000847 Ga0500619_000847_4622_5131 169
193 3300053155 Ga0500620_011956 Ga0500620_011956_662_1171 169
194 3300053157 Ga0500624_005626 Ga0500624_005626_66_575 169
195 3300053162 Ga0500638_002268 Ga0500638_002268_4492_5001 169
196 3300053178 Ga0500637_0105143 Ga0500637_0105143_47_556 169
197 3300053178 Ga0500637_0129175 Ga0500637_0129175_623_1132 169
198 3300053723 Ga0500567_144680 Ga0500567_144680_376_885 169
199 3300060353 Ga0501082_0949836 Ga0501082_0949836_228_737 169
200 3300001977 JGI24746J21847_1014539 JGI24746J21847_10145392 170
201 3300002077 JGI24744J21845_10011648 JGI24744J21845_100116483 170
202 3300002244 JGI24742J22300_10008938 JGI24742J22300_100089383 170
203 3300005328 Ga0070676_10175790 Ga0070676_101757901 170
204 3300005340 Ga0070689_100395279 Ga0070689_1003952791 170
205 3300005365 Ga0070688_100350601 Ga0070688_1003506012 170
206 3300005367 Ga0070667_100244954 Ga0070667_1002449541 170
207 3300005457 Ga0070662_100524098 Ga0070662_1005240982 170
208 3300005539 Ga0068853_101187741 Ga0068853_1011877411 170
209 3300005718 Ga0068866_10315407 Ga0068866_103154072 170
210 3300006237 Ga0097621_100639187 Ga0097621_1006391872 170
211 3300013306 Ga0163162_10599872 Ga0163162_105998722 170
212 3300025302 Ga0207426_1102888 Ga0207426_11028882 170
213 3300025899 Ga0207642_10154579 Ga0207642_101545792 170
214 3300025914 Ga0207671_10307566 Ga0207671_103075662 170
215 3300025934 Ga0207686_10113572 Ga0207686_101135723 170
216 3300025935 Ga0207709_10213516 Ga0207709_102135161 170
217 3300028381 Ga0268264_10447926 Ga0268264_104479262 170
218 iso_pu_bacteria 2876406927 2876407196 170
219 3300026116 Ga0207674_10151658 Ga0207674_101516581 172
220 3300031456 Ga0307513_10585943 Ga0307513_105859431 172
221 3300059639 Ga0587062_000087 Ga0587062_000087_2196_2729 172
222 iso_pu_bacteria 2503198000 2503202652 173
223 iso_pu_bacteria 2507262055 2507509767 173
224 iso_pu_bacteria 2508501009 2508543783 173
225 iso_pu_bacteria 2508501042 2508698429 173
226 iso_pu_bacteria 2508501050 2508735876 173
227 iso_pu_bacteria 2508501122 2509112687 173
228 iso_pu_bacteria 2508501123 2509117733 173
229 iso_pu_bacteria 2508501127 2509143582 173
230 iso_pu_bacteria 2509276018 2509373003 173
231 iso_pu_bacteria 2509276019 2509380423 173
232 iso_pu_bacteria 2509276021 2509387438 173
233 iso_pu_bacteria 2509276022 2509397157 173
234 iso_pu_bacteria 2509276033 2509442828 173
235 iso_pu_bacteria 2510065019 2510132549 173
236 iso_pu_bacteria 2510065057 2510308401 173
237 iso_pu_bacteria 2510065059 2510319905 173
238 iso_pu_bacteria 2510461069 2510843195 173
239 iso_pu_bacteria 2510461076 2510893894 173
240 iso_pu_bacteria 2510461076 2510898919 173
241 iso_pu_bacteria 2510917022 2511132387 173
242 iso_pu_bacteria 2510917026 2511174065 173
243 iso_pu_bacteria 2510917028 2511181291 173
244 iso_pu_bacteria 2510917030 2511193811 173
245 iso_pu_bacteria 2511231027 2511390488 173
246 iso_pu_bacteria 2511231028 2511396967 173
247 iso_pu_bacteria 2511231052 2511501272 173
248 iso_pu_bacteria 2512047086 2512532697 173
249 iso_pu_bacteria 2512875016 2512930574 173
250 iso_pu_bacteria 2512875024 2512958306 173
251 iso_pu_bacteria 2512875026 2512971974 173
252 iso_pu_bacteria 2513237084 2513574103 173
253 iso_pu_bacteria 2513237085 2513579041 173
254 iso_pu_bacteria 2513237086 2513587134 173
255 iso_pu_bacteria 2513237088 2513599768 173
256 iso_pu_bacteria 2513237089 2513607081 173
257 iso_pu_bacteria 2513237090 2513612119 173
258 iso_pu_bacteria 2513237091 2513620837 173
259 iso_pu_bacteria 2513237092 2513625283 173
260 iso_pu_bacteria 2513237093 2513632522 173
261 iso_pu_bacteria 2513237094 2513644600 173
262 iso_pu_bacteria 2513237095 2513646167 173
263 iso_pu_bacteria 2513237096 2513658403 173
264 iso_pu_bacteria 2513237101 2513695926 173
265 iso_pu_bacteria 2513237103 2513708971 173
266 iso_pu_bacteria 2513237137 2513857521 173
267 iso_pu_bacteria 2513237138 2513866864 173
268 iso_pu_bacteria 2513237139 2513875845 173
269 iso_pu_bacteria 2513237140 2513886844 173
270 iso_pu_bacteria 2513237143 2513906985 173
271 iso_pu_bacteria 2513237144 2513909597 173
272 iso_pu_bacteria 2513237145 2513920105 173
273 iso_pu_bacteria 2513237146 2513929471 173
274 iso_pu_bacteria 2513237156 2513987842 173
275 iso_pu_bacteria 2513237159 2514002399 173
276 iso_pu_bacteria 2513237160 2514008879 173
277 iso_pu_bacteria 2513237161 2514011488 173
278 iso_pu_bacteria 2513237162 2514019598 173
279 iso_pu_bacteria 2513237164 2514032561 173
280 iso_pu_bacteria 2513237305 2514422072 173
281 iso_pu_bacteria 2513237351 2514589877 173
282 iso_pu_bacteria 2515075009 2515111539 173
283 iso_pu_bacteria 2515154107 2515613332 173
284 iso_pu_bacteria 2515154112 2515630021 173
285 iso_pu_bacteria 2515154113 2515639322 173
286 iso_pu_bacteria 2515154114 2515646522 173
287 iso_pu_bacteria 2515154116 2515661954 173
288 iso_pu_bacteria 2515154134 2515744445 173
289 iso_pu_bacteria 2516143018 2516209150 173
290 iso_pu_bacteria 2516653046 2516892554 173
291 iso_pu_bacteria 2516653077 2517040185 173
292 iso_pu_bacteria 2516653085 2517075727 173
293 iso_pu_bacteria 2517093000 2517094316 173
294 iso_pu_bacteria 2517093001 2517103533 173
295 iso_pu_bacteria 2517287029 2517406118 173
296 iso_pu_bacteria 2517487022 2517569366 173
297 iso_pu_bacteria 2517572143 2517893474 173
298 iso_pu_bacteria 2519899620 2520375132 173
299 iso_pu_bacteria 2524023205 2524441042 173
300 iso_pu_bacteria 2524023207 2524454329 173
301 iso_pu_bacteria 2524023209 2524461383 173
302 iso_pu_bacteria 2524023210 2524469984 173
303 iso_pu_bacteria 2524023228 2524537979 173
304 iso_pu_bacteria 2528768022 2528856450 173
305 iso_pu_bacteria 2529292951 2530643640 173
306 iso_pu_bacteria 2534681786 2535484933 173
307 iso_pu_bacteria 2534681796 2535515869 173
308 iso_pu_bacteria 2537561587 2537874335 173
309 iso_pu_bacteria 2551306084 2551678254 173
310 iso_pu_bacteria 2551306085 2551687645 173
311 iso_pu_bacteria 2551306086 2551695269 173
312 iso_pu_bacteria 2551306087 2551699385 173
313 iso_pu_bacteria 2551306089 2551711309 173
314 iso_pu_bacteria 2551306090 2551723056 173
315 iso_pu_bacteria 2551306091 2551728468 173
316 iso_pu_bacteria 2551306091 2551730899 173
317 iso_pu_bacteria 2551306092 2551733991 173
318 iso_pu_bacteria 2551306093 2551742267 173
319 iso_pu_bacteria 2554235003 2554248080 173
320 iso_pu_bacteria 2558860100 2558863227 173
321 iso_pu_bacteria 2558860242 2559295197 173
322 iso_pu_bacteria 2558860983 2561468206 173
323 iso_pu_bacteria 2582581283 2585168178 173
324 iso_pu_bacteria 2582581294 2585199615 173
325 iso_pu_bacteria 2582581298 2585226126 173
326 iso_pu_bacteria 2582581299 2585231211 173
327 iso_pu_bacteria 2582581304 2585254082 173
328 iso_pu_bacteria 2582581306 2585268793 173
329 iso_pu_bacteria 2582581307 2585273001 173
330 iso_pu_bacteria 2582581308 2585282859 173
331 iso_pu_bacteria 2582581315 2585325225 173
332 iso_pu_bacteria 2582581316 2585333358 173
333 iso_pu_bacteria 2582581865 2585390971 173
334 iso_pu_bacteria 2582581866 2585398179 173
335 iso_pu_bacteria 2582581867 2585400393 173
336 iso_pu_bacteria 2585427526 2585529500 173
337 iso_pu_bacteria 2585427527 2585534941 173
338 iso_pu_bacteria 2585427528 2585543717 173
339 iso_pu_bacteria 2585427529 2585547160 173
340 iso_pu_bacteria 2585427530 2585551612 173
341 iso_pu_bacteria 2585427531 2585558040 173
342 iso_pu_bacteria 2585427590 2585824501 173
343 iso_pu_bacteria 2585427593 2585842045 173
344 iso_pu_bacteria 2585427594 2585845542 173
345 iso_pu_bacteria 2585427608 2585897491 173
346 iso_pu_bacteria 2585427609 2585904922 173
347 iso_pu_bacteria 2585427633 2585995387 173
348 iso_pu_bacteria 2585427634 2585999942 173
349 iso_pu_bacteria 2585428125 2587979962 173
350 iso_pu_bacteria 2588253730 2588516216 173
351 iso_pu_bacteria 2597489875 2597813663 173
352 iso_pu_bacteria 2599185156 2599333507 173
353 iso_pu_bacteria 2599185170 2599418316 173
354 iso_pu_bacteria 2599185210 2599601517 173
355 iso_pu_bacteria 2599185236 2599721229 173
356 iso_pu_bacteria 2599185301 2599939551 173
357 iso_pu_bacteria 2599185352 2600192216 173
358 iso_pu_bacteria 2600254933 2600375484 173
359 iso_pu_bacteria 2600255279 2601612146 173
360 iso_pu_bacteria 2600255308 2601749070 173
361 iso_pu_bacteria 2602042107 2603859856 173
362 iso_pu_bacteria 2615840624 2616298080 173
363 iso_pu_bacteria 2615840626 2616308128 173
364 iso_pu_bacteria 2615840698 2616556852 173
365 iso_pu_bacteria 2617270735 2617349291 173
366 iso_pu_bacteria 2617270742 2617381488 173
367 iso_pu_bacteria 2643221550 2643773778 173
368 iso_pu_bacteria 2643221551 2643775182 173
369 iso_pu_bacteria 2643221555 2643793628 173
370 iso_pu_bacteria 2643221557 2643808296 173
371 iso_pu_bacteria 2643221558 2643812206 173
372 iso_pu_bacteria 2643221564 2643837516 173
373 iso_pu_bacteria 2643221568 2643857822 173
374 iso_pu_bacteria 2643221582 2643919619 173
375 iso_pu_bacteria 2643221595 2643987311 173
376 iso_pu_bacteria 2643221599 2644006161 173
377 iso_pu_bacteria 2643221607 2644049681 173
378 iso_pu_bacteria 2643221610 2644068116 173
379 iso_pu_bacteria 2643221618 2644108033 173
380 iso_pu_bacteria 2643221623 2644131939 173
381 iso_pu_bacteria 2643221626 2644150543 173
382 iso_pu_bacteria 2643221627 2644155635 173
383 iso_pu_bacteria 2643221634 2644191300 173
384 iso_pu_bacteria 2643221636 2644203911 173
385 iso_pu_bacteria 2643221637 2644207705 173
386 iso_pu_bacteria 2643221643 2644240101 173
387 iso_pu_bacteria 2643221653 2644300123 173
388 iso_pu_bacteria 2643221655 2644310101 173
389 iso_pu_bacteria 2643221659 2644335305 173
390 iso_pu_bacteria 2643221668 2644379286 173
391 iso_pu_bacteria 2643221675 2644419060 173
392 iso_pu_bacteria 2643221680 2644450421 173
393 iso_pu_bacteria 2643221686 2644482714 173
394 iso_pu_bacteria 2643221688 2644494812 173
395 iso_pu_bacteria 2643221689 2644499205 173
396 iso_pu_bacteria 2643221693 2644520158 173
397 iso_pu_bacteria 2643221698 2644544820 173
398 iso_pu_bacteria 2643221712 2644617147 173
399 iso_pu_bacteria 2643221718 2644654488 173
400 iso_pu_bacteria 2643221719 2644658349 173
401 iso_pu_bacteria 2643221723 2644677793 173
402 iso_pu_bacteria 2643221726 2644687284 173
403 iso_pu_bacteria 2657244999 2657686413 173
404 iso_pu_bacteria 2667528174 2671114758 173
405 iso_pu_bacteria 2667528175 2671118112 173
406 iso_pu_bacteria 2687453392 2688599072 173
407 iso_pu_bacteria 2690316117 2692316533 173
408 iso_pu_bacteria 2693429783 2694631921 173
409 iso_pu_bacteria 2693429784 2694634658 173
410 iso_pu_bacteria 2718217882 2719180524 173
411 iso_pu_bacteria 2718217927 2719385118 173
412 iso_pu_bacteria 2718217997 2719664877 173
413 iso_pu_bacteria 2718218009 2719731273 173
414 iso_pu_bacteria 2718218199 2720491297 173
415 iso_pu_bacteria 2718218232 2720612657 173
416 iso_pu_bacteria 2718218233 2720619495 173
417 iso_pu_bacteria 2718218235 2720630951 173
418 iso_pu_bacteria 2718218269 2720774589 173
419 iso_pu_bacteria 2718218363 2721146618 173
420 iso_pu_bacteria 2718218365 2721158143 173
421 iso_pu_bacteria 2718218366 2721163497 173
422 iso_pu_bacteria 2718218423 2721398838 173
423 iso_pu_bacteria 2721755514 2722839667 173
424 iso_pu_bacteria 2721755556 2723026314 173
425 iso_pu_bacteria 2721755684 2723559857 173
426 iso_pu_bacteria 2721755685 2723566477 173
427 iso_pu_bacteria 2721755686 2723576076 173
428 iso_pu_bacteria 2721755755 2723846158 173
429 iso_pu_bacteria 2721755809 2724037651 173
430 iso_pu_bacteria 2721755810 2724044029 173
431 iso_pu_bacteria 2721755819 2724089196 173
432 iso_pu_bacteria 2721755822 2724103742 173
433 iso_pu_bacteria 2721755823 2724109580 173
434 iso_pu_bacteria 2724679232 2725948695 173
435 iso_pu_bacteria 2728368998 2728747763 173
436 iso_pu_bacteria 2728369352 2730107250 173
437 iso_pu_bacteria 2728369365 2730163761 173
438 iso_pu_bacteria 2728369397 2730297775 173
439 iso_pu_bacteria 2738541293 2738799606 173
440 iso_pu_bacteria 2738541317 2738945241 173
441 iso_pu_bacteria 2738541333 2739038921 173
442 iso_pu_bacteria 2738543024 2739309057 173
443 iso_pu_bacteria 2744054633 2745082435 173
444 iso_pu_bacteria 2751185800 2753359562 173
445 iso_pu_bacteria 2751185821 2753460134 173
446 iso_pu_bacteria 2756170246 2756677766 173
447 iso_pu_bacteria 2757320392 2757572025 173
448 iso_pu_bacteria 2758568016 2758641823 173
449 iso_pu_bacteria 2765235802 2765465548 173
450 iso_pu_bacteria 2765235942 2766063709 173
451 iso_pu_bacteria 2767802442 2770195573 173
452 iso_pu_bacteria 2773857925 2774868366 173
453 iso_pu_bacteria 2775506901 2776259150 173
454 iso_pu_bacteria 2775506902 2776271565 173
455 iso_pu_bacteria 2775506904 2776279923 173
456 iso_pu_bacteria 2775507049 2776913091 173
457 iso_pu_bacteria 2775507266 2778176277 173
458 iso_pu_bacteria 2791355082 2792581297 173
459 iso_pu_bacteria 2791355091 2792624837 173
460 iso_pu_bacteria 2791355092 2792630871 173
461 iso_pu_bacteria 2791355094 2792642401 173
462 iso_pu_bacteria 2791355123 2792750759 173
463 iso_pu_bacteria 2791355196 2793060259 173
464 iso_pu_bacteria 2791355197 2793071769 173
465 iso_pu_bacteria 2791355199 2793076672 173
466 iso_pu_bacteria 2791355253 2793282381 173
467 iso_pu_bacteria 2791355256 2793299599 173
468 iso_pu_bacteria 2791355259 2793318468 173
469 iso_pu_bacteria 2791355260 2793325209 173
470 iso_pu_bacteria 2791355261 2793331451 173
471 iso_pu_bacteria 2791355262 2793337875 173
472 iso_pu_bacteria 2791355263 2793344740 173
473 iso_pu_bacteria 2791355264 2793351000 173
474 iso_pu_bacteria 2791355265 2793357347 173
475 iso_pu_bacteria 2791355266 2793364024 173
476 iso_pu_bacteria 2791355267 2793371080 173
477 iso_pu_bacteria 2802428858 2802719379 173
478 iso_pu_bacteria 2802428859 2802723060 173
479 iso_pu_bacteria 2802428860 2802734755 173
480 iso_pu_bacteria 2802428861 2802741297 173
481 iso_pu_bacteria 2802428862 2802745046 173
482 iso_pu_bacteria 2802428863 2802751481 173
483 iso_pu_bacteria 2802429268 2804751747 173
484 iso_pu_bacteria 2802429603 2805917625 173
485 iso_pu_bacteria 2802429605 2805931637 173
486 iso_pu_bacteria 2802429606 2805937752 173
487 iso_pu_bacteria 2802429633 2806049360 173
488 iso_pu_bacteria 2802429634 2806056368 173
489 iso_pu_bacteria 2802429635 2806063408 173
490 iso_pu_bacteria 2802429636 2806070954 173
491 iso_pu_bacteria 2802429637 2806077768 173
492 iso_pu_bacteria 2808606387 2808985085 173
493 iso_pu_bacteria 2816332527 2818241494 173
494 iso_pu_bacteria 2818991272 2819242262 173
495 iso_pu_bacteria 2818991439 2819559513 173
496 iso_pu_bacteria 2818991448 2819610709 173
497 iso_pu_bacteria 2818991453 2819638359 173
498 iso_pu_bacteria 2818991461 2819683814 173
499 iso_pu_bacteria 2821123053 2821124587 173
500 iso_pu_bacteria 2824653114 2824654972 173
501 iso_pu_bacteria 2824661429 2824662370 173
502 iso_pu_bacteria 2824671348 2824672619 173
503 iso_pu_bacteria 2824687955 2824689048 173
504 iso_pu_bacteria 2824696289 2824697415 173
505 iso_pu_bacteria 2824704595 2824706687 173
506 iso_pu_bacteria 2824753945 2824759429 173
507 iso_pu_bacteria 2824763712 2824769665 173
508 iso_pu_bacteria 2824773399 2824774024 173
509 iso_pu_bacteria 2835312727 2835318460 173
510 iso_pu_bacteria 2837651117 2837653704 173
511 iso_pu_bacteria 2837678835 2837679320 173
512 iso_pu_bacteria 2837678835 2837682798 173
513 iso_pu_bacteria 2838016132 2838017545 173
514 iso_pu_bacteria 2838022645 2838022887 173
515 iso_pu_bacteria 2838029111 2838032382 173
516 iso_pu_bacteria 2838035591 2838041255 173
517 iso_pu_bacteria 2838042994 2838046192 173
518 iso_pu_bacteria 2838048938 2838048973 173
519 iso_pu_bacteria 2838061910 2838063596 173
520 iso_pu_bacteria 2838068647 2838072751 173
521 iso_pu_bacteria 2838074704 2838079221 173
522 iso_pu_bacteria 2838122688 2838130073 173
523 iso_pu_bacteria 2838661181 2838662992 173
524 iso_pu_bacteria 2838668709 2838674911 173
525 iso_pu_bacteria 2838675328 2838675948 173
526 iso_pu_bacteria 2838680041 2838681623 173
527 iso_pu_bacteria 2838686498 2838692720 173
528 iso_pu_bacteria 2838694306 2838694340 173
529 iso_pu_bacteria 2838701080 2838707214 173
530 iso_pu_bacteria 2838707686 2838707720 173
531 iso_pu_bacteria 2838714209 2838714830 173
532 iso_pu_bacteria 2838719591 2838721369 173
533 iso_pu_bacteria 2838724970 2838725590 173
534 iso_pu_bacteria 2838729681 2838735094 173
535 iso_pu_bacteria 2838736955 2838742444 173
536 iso_pu_bacteria 2838742623 2838747547 173
537 iso_pu_bacteria 2839993093 2839995584 173
538 iso_pu_bacteria 2840764183 2840768029 173
539 iso_pu_bacteria 2841734538 2841740443 173
540 iso_pu_bacteria 2841840854 2841846399 173
541 iso_pu_bacteria 2841846520 2841848336 173
542 iso_pu_bacteria 2841851746 2841857330 173
543 iso_pu_bacteria 2841859092 2841859109 173
544 iso_pu_bacteria 2841864319 2841865219 173
545 iso_pu_bacteria 2841941048 2841941230 173
546 iso_pu_bacteria 2841949485 2841952743 173
547 iso_pu_bacteria 2841966195 2841967385 173
548 iso_pu_bacteria 2841974524 2841979217 173
549 iso_pu_bacteria 2841983080 2841990793 173
550 iso_pu_bacteria 2842038055 2842038633 173
551 iso_pu_bacteria 2842045827 2842048422 173
552 iso_pu_bacteria 2842077413 2842081050 173
553 iso_pu_bacteria 2842110456 2842117508 173
554 iso_pu_bacteria 2842118031 2842121669 173
555 iso_pu_bacteria 2842124991 2842125634 173
556 iso_pu_bacteria 2842130223 2842130843 173
557 iso_pu_bacteria 2842140634 2842146123 173
558 iso_pu_bacteria 2842146304 2842151858 173
559 iso_pu_bacteria 2842152218 2842153987 173
560 iso_pu_bacteria 2842156927 2842163212 173
561 iso_pu_bacteria 2842163707 2842170321 173
562 iso_pu_bacteria 2842170452 2842171074 173
563 iso_pu_bacteria 2842175837 2842177607 173
564 iso_pu_bacteria 2842180545 2842186888 173
565 iso_pu_bacteria 2842187318 2842187939 173
566 iso_pu_bacteria 2842192696 2842197641 173
567 iso_pu_bacteria 2842198810 2842199316 173
568 iso_pu_bacteria 2842205361 2842210162 173
569 iso_pu_bacteria 2842211629 2842212250 173
570 iso_pu_bacteria 2842217011 2842224194 173
571 iso_pu_bacteria 2842224351 2842226131 173
572 iso_pu_bacteria 2842229732 2842234894 173
573 iso_pu_bacteria 2842237096 2842237130 173
574 iso_pu_bacteria 2842243621 2842248959 173
575 iso_pu_bacteria 2842250916 2842257052 173
576 iso_pu_bacteria 2842257432 2842262751 173
577 iso_pu_bacteria 2842264693 2842268738 173
578 iso_pu_bacteria 2842271015 2842277189 173
579 iso_pu_bacteria 2842278818 2842283616 173
580 iso_pu_bacteria 2842285085 2842286876 173
581 iso_pu_bacteria 2842291075 2842294707 173
582 iso_pu_bacteria 2842298080 2842302972 173
583 iso_pu_bacteria 2842304105 2842311002 173
584 iso_pu_bacteria 2842311132 2842317327 173
585 iso_pu_bacteria 2842317721 2842324083 173
586 iso_pu_bacteria 2842341865 2842343341 173
587 iso_pu_bacteria 2842357229 2842361841 173
588 iso_pu_bacteria 2842363717 2842365519 173
589 iso_pu_bacteria 2842370503 2842372087 173
590 iso_pu_bacteria 2842377471 2842381105 173
591 iso_pu_bacteria 2842384541 2842388176 173
592 iso_pu_bacteria 2842395702 2842402236 173
593 iso_pu_bacteria 2842402390 2842404144 173
594 iso_pu_bacteria 2842409023 2842411171 173
595 iso_pu_bacteria 2842415677 2842417373 173
596 iso_pu_bacteria 2842422224 2842426564 173
597 iso_pu_bacteria 2842428310 2842432871 173
598 iso_pu_bacteria 2842434925 2842439176 173
599 iso_pu_bacteria 2842441272 2842445805 173
600 iso_pu_bacteria 2842447887 2842451345 173
601 iso_pu_bacteria 2842462802 2842466843 173
602 iso_pu_bacteria 2842469257 2842473790 173
603 iso_pu_bacteria 2842475841 2842478989 173
604 iso_pu_bacteria 2842482326 2842483119 173
605 iso_pu_bacteria 2842489311 2842495136 173
606 iso_pu_bacteria 2842495871 2842502314 173
607 iso_pu_bacteria 2842502639 2842506291 173
608 iso_pu_bacteria 2842515876 2842515893 173
609 iso_pu_bacteria 2842521101 2842527563 173
610 iso_pu_bacteria 2842871566 2842872895 173
611 iso_pu_bacteria 2842922631 2842925085 173
612 iso_pu_bacteria 2844002411 2844006788 173
613 iso_pu_bacteria 2844009547 2844014471 173
614 iso_pu_bacteria 2844163670 2844169508 173
615 iso_pu_bacteria 2844454524 2844454871 173
616 iso_pu_bacteria 2847417321 2847418401 173
617 iso_pu_bacteria 2847670302 2847670804 173
618 iso_pu_bacteria 2847686936 2847687059 173
619 iso_pu_bacteria 2847939898 2847945407 173
620 iso_pu_bacteria 2848992105 2848993380 173
621 iso_pu_bacteria 2849076700 2849080405 173
622 iso_pu_bacteria 2850079185 2850081038 173
623 iso_pu_bacteria 2852387548 2852389365 173
624 iso_pu_bacteria 2854896431 2854901796 173
625 iso_pu_bacteria 2854911287 2854912154 173
626 iso_pu_bacteria 2854916844 2854919415 173
627 iso_pu_bacteria 2855825444 2855831624 173
628 iso_pu_bacteria 2855839649 2855840742 173
629 iso_pu_bacteria 2855872281 2855873434 173
630 iso_pu_bacteria 2856314179 2856316261 173
631 iso_pu_bacteria 2856320880 2856325085 173
632 iso_pu_bacteria 2856328259 2856330557 173
633 iso_pu_bacteria 2856334872 2856340857 173
634 iso_pu_bacteria 2856342000 2856345825 173
635 iso_pu_bacteria 2856349417 2856349749 173
636 iso_pu_bacteria 2856356410 2856359243 173
637 iso_pu_bacteria 2856364286 2856369141 173
638 iso_pu_bacteria 2857349434 2857355595 173
639 iso_pu_bacteria 2857367948 2857372485 173
640 iso_pu_bacteria 2857509624 2857510242 173
641 iso_pu_bacteria 2857516855 2857521662 173
642 iso_pu_bacteria 2857524615 2857528504 173
643 iso_pu_bacteria 2857531043 2857532168 173
644 iso_pu_bacteria 2858800743 2858801269 173
645 iso_pu_bacteria 2869162929 2869168968 173
646 iso_pu_bacteria 2869169390 2869169854 173
647 iso_pu_bacteria 2869234852 2869237153 173
648 iso_pu_bacteria 2869242130 2869243179 173
649 iso_pu_bacteria 2869249662 2869252750 173
650 iso_pu_bacteria 2869256925 2869262755 173
651 iso_pu_bacteria 2869264136 2869270272 173
652 iso_pu_bacteria 2869271264 2869273288 173
653 iso_pu_bacteria 2869278585 2869280893 173
654 iso_pu_bacteria 2869285874 2869288401 173
655 iso_pu_bacteria 2871429161 2871432110 173
656 iso_pu_bacteria 2871435913 2871439280 173
657 iso_pu_bacteria 2871444079 2871451492 173
658 iso_pu_bacteria 2871451962 2871455271 173
659 iso_pu_bacteria 2871459585 2871459666 173
660 iso_pu_bacteria 2871466892 2871471641 173
661 iso_pu_bacteria 2871474448 2871480981 173
662 iso_pu_bacteria 2871481445 2871488344 173
663 iso_pu_bacteria 2871488783 2871495243 173
664 iso_pu_bacteria 2871495908 2871500467 173
665 iso_pu_bacteria 2874102143 2874104416 173
666 iso_pu_bacteria 2874109183 2874112669 173
667 iso_pu_bacteria 2874116593 2874121370 173
668 iso_pu_bacteria 2874123672 2874125718 173
669 iso_pu_bacteria 2874131515 2874138149 173
670 iso_pu_bacteria 2874139085 2874141439 173
671 iso_pu_bacteria 2874146452 2874150989 173
672 iso_pu_bacteria 2874155637 2874157328 173
673 iso_pu_bacteria 2874162495 2874163775 173
674 iso_pu_bacteria 2874168670 2874172582 173
675 iso_pu_bacteria 2874590934 2874595124 173
676 iso_pu_bacteria 2874604998 2874610932 173
677 iso_pu_bacteria 2874620515 2874621666 173
678 iso_pu_bacteria 2874628541 2874632700 173
679 iso_pu_bacteria 2874645413 2874650985 173
680 iso_pu_bacteria 2876363079 2876368080 173
681 iso_pu_bacteria 2876369609 2876374951 173
682 iso_pu_bacteria 2876377896 2876378185 173
683 iso_pu_bacteria 2876386047 2876392711 173
684 iso_pu_bacteria 2876392853 2876395256 173
685 iso_pu_bacteria 2876399893 2876405245 173
686 iso_pu_bacteria 2876413966 2876417018 173
687 iso_pu_bacteria 2876420981 2876427153 173
688 iso_pu_bacteria 2876771140 2876775060 173
689 iso_pu_bacteria 2876818435 2876823875 173
690 iso_pu_bacteria 2878035449 2878041584 173
691 iso_pu_bacteria 2878730984 2878734398 173
692 iso_pu_bacteria 2878738818 2878743168 173
693 iso_pu_bacteria 2878745973 2878748829 173
694 iso_pu_bacteria 2878753008 2878758091 173
695 iso_pu_bacteria 2878760144 2878764556 173
696 iso_pu_bacteria 2878767105 2878771657 173
697 iso_pu_bacteria 2878774303 2878776396 173
698 iso_pu_bacteria 2878781027 2878782373 173
699 iso_pu_bacteria 2879074833 2879080503 173
700 iso_pu_bacteria 2879099564 2879109351 173
701 iso_pu_bacteria 2879127579 2879134891 173
702 iso_pu_bacteria 2879142872 2879149202 173
703 iso_pu_bacteria 2881147464 2881152561 173
704 iso_pu_bacteria 2881155292 2881155988 173
705 iso_pu_bacteria 2881161766 2881161783 173
706 iso_pu_bacteria 2881665667 2881671577 173
707 iso_pu_bacteria 2881845957 2881846275 173
708 iso_pu_bacteria 2881861095 2881862938 173
709 iso_pu_bacteria 2882456835 2882459691 173
710 iso_pu_bacteria 2882632389 2882633072 173
711 iso_pu_bacteria 2882912400 2882915325 173
712 iso_pu_bacteria 2884298095 2884300439 173
713 iso_pu_bacteria 2885305155 2885310668 173
714 iso_pu_bacteria 2885312484 2885317432 173
715 iso_pu_bacteria 2885318864 2885320323 173
716 iso_pu_bacteria 2885326080 2885326385 173
717 iso_pu_bacteria 2885342637 2885348528 173
718 iso_pu_bacteria 2885350715 2885355688 173
719 iso_pu_bacteria 2885366525 2885372829 173
720 iso_pu_bacteria 2885374607 2885380935 173
721 iso_pu_bacteria 2888337043 2888340684 173
722 iso_pu_bacteria 2888343758 2888347863 173
723 iso_pu_bacteria 2888350351 2888356880 173
724 iso_pu_bacteria 2888378607 2888382828 173
725 iso_pu_bacteria 2888388044 2888394972 173
726 iso_pu_bacteria 2889010040 2889011927 173
727 iso_pu_bacteria 2889016732 2889023141 173
728 iso_pu_bacteria 2889033259 2889041107 173
729 iso_pu_bacteria 2891373044 2891377327 173
730 iso_pu_bacteria 2893066018 2893070180 173
731 iso_pu_bacteria 2894232714 2894240755 173
732 iso_pu_bacteria 2894652903 2894654248 173
733 iso_pu_bacteria 2894817345 2894818640 173
734 iso_pu_bacteria 2896384573 2896386892 173
735 iso_pu_bacteria 2899792073 2899794872 173
736 iso_pu_bacteria 2899845264 2899848093 173
737 iso_pu_bacteria 2903448605 2903452100 173
738 iso_pu_bacteria 2903492973 2903495118 173
739 iso_pu_bacteria 2903492973 2903496177 173
740 iso_pu_bacteria 2903513507 2903518364 173
741 iso_pu_bacteria 2903521522 2903527076 173
742 iso_pu_bacteria 2903528002 2903533303 173
743 iso_pu_bacteria 2903540706 2903545280 173
744 iso_pu_bacteria 2903748898 2903758252 173
745 iso_pu_bacteria 2904578770 2904583221 173
746 iso_pu_bacteria 2904659560 2904661886 173
747 iso_pu_bacteria 2904666416 2904668617 173
748 iso_pu_bacteria 2904690495 2904696906 173
749 iso_pu_bacteria 2904699407 2904701669 173
750 iso_pu_bacteria 2904711408 2904716661 173
751 iso_pu_bacteria 2906308376 2906311181 173
752 iso_pu_bacteria 2906321335 2906323948 173
753 iso_pu_bacteria 2906328253 2906328369 173
754 iso_pu_bacteria 2906363423 2906370610 173
755 iso_pu_bacteria 2906386501 2906391168 173
756 iso_pu_bacteria 2906393657 2906394189 173
757 iso_pu_bacteria 2906401398 2906407930 173
758 iso_pu_bacteria 2906408224 2906410564 173
759 iso_pu_bacteria 2906414383 2906416398 173
760 iso_pu_bacteria 2906427513 2906428176 173
761 iso_pu_bacteria 2906610324 2906610359 173
762 iso_pu_bacteria 2906626472 2906628258 173
763 iso_pu_bacteria 2906635258 2906642774 173
764 iso_pu_bacteria 2906643746 2906644209 173
765 iso_pu_bacteria 2906660503 2906665909 173
766 iso_pu_bacteria 2908739725 2908743880 173
767 iso_pu_bacteria 2908756301 2908761482 173
768 iso_pu_bacteria 2913295892 2913301777 173
769 iso_pu_bacteria 2913308742 2913309943 173
770 iso_pu_bacteria 2915650412 2915654118 173
771 iso_pu_bacteria 2915980308 2915985668 173
772 iso_pu_bacteria 2915986958 2915991801 173
773 iso_pu_bacteria 2915993759 2916000604 173
774 iso_pu_bacteria 2916000859 2916007564 173
775 iso_pu_bacteria 2916007675 2916008882 173
776 iso_pu_bacteria 2916014648 2916018775 173
777 iso_pu_bacteria 2916021584 2916026383 173
778 iso_pu_bacteria 2916028427 2916034650 173
779 iso_pu_bacteria 2916035215 2916040631 173
780 iso_pu_bacteria 2916041962 2916048201 173
781 iso_pu_bacteria 2916048683 2916054390 173
782 iso_pu_bacteria 2916055098 2916060799 173
783 iso_pu_bacteria 2916061851 2916068167 173
784 iso_pu_bacteria 2916068649 2916075017 173
785 iso_pu_bacteria 2919073203 2919076131 173
786 iso_pu_bacteria 2919100787 2919104091 173
787 iso_pu_bacteria 2919114240 2919114919 173
788 iso_pu_bacteria 2919119836 2919123869 173
789 iso_pu_bacteria 2919166419 2919167993 173
790 iso_pu_bacteria 2919171160 2919175589 173
791 iso_pu_bacteria 2919408235 2919409575 173
792 iso_pu_bacteria 2920760137 2920765479 173
793 iso_pu_bacteria 2920822456 2920824107 173
794 iso_pu_bacteria 2921201388 2921208182 173
795 iso_pu_bacteria 2921208531 2921209425 173
796 iso_pu_bacteria 2921237296 2921242267 173
797 iso_pu_bacteria 2921244191 2921248072 173
798 iso_pu_bacteria 2921250672 2921256122 173
799 iso_pu_bacteria 2921257292 2921263458 173
800 iso_pu_bacteria 2921263974 2921270091 173
801 iso_pu_bacteria 2921282425 2921285909 173
802 iso_pu_bacteria 2921289301 2921296758 173
803 iso_pu_bacteria 2921296804 2921299127 173
804 iso_pu_bacteria 2922130491 2922132704 173
805 iso_pu_bacteria 2922151315 2922154890 173
806 iso_pu_bacteria 2922158528 2922161782 173
807 iso_pu_bacteria 2922172374 2922175792 173
808 iso_pu_bacteria 2922185730 2922191536 173
809 iso_pu_bacteria 2922361189 2922361954 173
810 iso_pu_bacteria 2922368715 2922375212 173
811 iso_pu_bacteria 2922386360 2922392040 173
812 iso_pu_bacteria 2922425934 2922429002 173
813 iso_pu_bacteria 2923556063 2923562202 173
814 iso_pu_bacteria 2924144063 2924147667 173
815 iso_pu_bacteria 2924150972 2924157724 173
816 iso_pu_bacteria 2924158325 2924165049 173
817 iso_pu_bacteria 2924165586 2924172869 173
818 iso_pu_bacteria 2924172951 2924179190 173
819 iso_pu_bacteria 2924179722 2924184585 173
820 iso_pu_bacteria 2924186466 2924192969 173
821 iso_pu_bacteria 2924193448 2924199579 173
822 iso_pu_bacteria 2924200457 2924204255 173
823 iso_pu_bacteria 2924207177 2924213329 173
824 iso_pu_bacteria 2924214083 2924214805 173
825 iso_pu_bacteria 2924221636 2924221990 173
826 iso_pu_bacteria 2924228884 2924233678 173
827 iso_pu_bacteria 2924710171 2924712525 173
828 iso_pu_bacteria 2924726620 2924727270 173
829 iso_pu_bacteria 2924733363 2924736146 173
830 iso_pu_bacteria 2924748358 2924750373 173
831 iso_pu_bacteria 2924754689 2924761550 173
832 iso_pu_bacteria 2924762789 2924763835 173
833 iso_pu_bacteria 2924776078 2924777282 173
834 iso_pu_bacteria 2924784321 2924785832 173
835 iso_pu_bacteria 2926754445 2926755885 173
836 iso_pu_bacteria 2926760298 2926762983 173
837 iso_pu_bacteria 2928521798 2928524352 173
838 iso_pu_bacteria 2929138655 2929140705 173
839 iso_pu_bacteria 2929615660 2929615900 173
840 iso_pu_bacteria 2929624759 2929630513 173
841 iso_pu_bacteria 2932784394 2932792462 173
842 iso_pu_bacteria 2932794094 2932800392 173
843 iso_pu_bacteria 2932801729 2932804565 173
844 iso_pu_bacteria 2932809354 2932813961 173
845 iso_pu_bacteria 2932818245 2932819527 173
846 iso_pu_bacteria 2932828146 2932833767 173
847 iso_pu_bacteria 2933006813 2933008632 173
848 iso_pu_bacteria 2933011516 2933011731 173
849 iso_pu_bacteria 2933570622 2933577511 173
850 iso_pu_bacteria 2933577622 2933578814 173
851 iso_pu_bacteria 2933586486 2933593605 173
852 iso_pu_bacteria 2933594066 2933596765 173
853 iso_pu_bacteria 2933599457 2933603680 173
854 iso_pu_bacteria 2935608549 2935611374 173
855 iso_pu_bacteria 2935616580 2935618729 173
856 iso_pu_bacteria 2935630451 2935637735 173
857 iso_pu_bacteria 2935638405 2935644431 173
858 iso_pu_bacteria 2935648319 2935648758 173
859 iso_pu_bacteria 2935656913 2935657159 173
860 iso_pu_bacteria 2935665750 2935674169 173
861 iso_pu_bacteria 2935675223 2935678549 173
862 iso_pu_bacteria 2935684952 2935687954 173
863 iso_pu_bacteria 2935694250 2935701434 173
864 iso_pu_bacteria 2935703347 2935708288 173
865 iso_pu_bacteria 2935713505 2935714974 173
866 iso_pu_bacteria 2935722832 2935726461 173
867 iso_pu_bacteria 2935732158 2935733792 173
868 iso_pu_bacteria 2935741537 2935743171 173
869 iso_pu_bacteria 2935750917 2935754790 173
870 iso_pu_bacteria 2935760218 2935765498 173
871 iso_pu_bacteria 2935769743 2935775251 173
872 iso_pu_bacteria 2935777560 2935779549 173
873 iso_pu_bacteria 2935785616 2935791551 173
874 iso_pu_bacteria 2935793552 2935799863 173
875 iso_pu_bacteria 2935801545 2935805451 173
876 iso_pu_bacteria 2935810662 2935816745 173
877 iso_pu_bacteria 2935819856 2935820851 173
878 iso_pu_bacteria 2935827899 2935833820 173
879 iso_pu_bacteria 2935837841 2935839495 173
880 iso_pu_bacteria 2935847175 2935850889 173
881 iso_pu_bacteria 2935855204 2935857094 173
882 iso_pu_bacteria 2935864058 2935864638 173
883 iso_pu_bacteria 2935873716 2935876416 173
884 iso_pu_bacteria 2935883170 2935889759 173
885 iso_pu_bacteria 2935894831 2935894865 173
886 iso_pu_bacteria 2935901341 2935908189 173
887 iso_pu_bacteria 2935908558 2935913744 173
888 iso_pu_bacteria 2935916978 2935920266 173
889 iso_pu_bacteria 2935926038 2935930605 173
890 iso_pu_bacteria 2935934488 2935939422 173
891 iso_pu_bacteria 2935942939 2935946371 173
892 iso_pu_bacteria 2935951376 2935955790 173
893 iso_pu_bacteria 2935959822 2935966946 173
894 iso_pu_bacteria 2935967501 2935972500 173
895 iso_pu_bacteria 2935975950 2935981669 173
896 iso_pu_bacteria 2935984226 2935991044 173
897 iso_pu_bacteria 2935992306 2935997615 173
898 iso_pu_bacteria 2936002035 2936007133 173
899 iso_pu_bacteria 2936011229 2936011668 173
900 iso_pu_bacteria 2936019824 2936020263 173
901 iso_pu_bacteria 2936028420 2936028958 173
902 iso_pu_bacteria 2936037263 2936042993 173
903 iso_pu_bacteria 2936046547 2936046986 173
904 iso_pu_bacteria 2936055302 2936058134 173
905 iso_pu_bacteria 2936367885 2936371435 173
906 iso_pu_bacteria 2936375103 2936379457 173
907 iso_pu_bacteria 2936381700 2936387944 173
908 iso_pu_bacteria 2936996657 2937001413 173
909 iso_pu_bacteria 2937002841 2937008151 173
910 iso_pu_bacteria 2937009748 2937015641 173
911 iso_pu_bacteria 2937016420 2937019599 173
912 iso_pu_bacteria 2937023124 2937028370 173
913 iso_pu_bacteria 2937029754 2937034848 173
914 iso_pu_bacteria 2937036028 2937040790 173
915 iso_pu_bacteria 2937042894 2937049359 173
916 iso_pu_bacteria 2937049772 2937056389 173
917 iso_pu_bacteria 2937056579 2937060868 173
918 iso_pu_bacteria 2937063883 2937069362 173
919 iso_pu_bacteria 2937071275 2937076552 173
920 iso_pu_bacteria 2937078374 2937079345 173
921 iso_pu_bacteria 2937084907 2937088450 173
922 iso_pu_bacteria 2937091812 2937096832 173
923 iso_pu_bacteria 2937098957 2937105919 173
924 iso_pu_bacteria 2937106411 2937113065 173
925 iso_pu_bacteria 2937113482 2937118555 173
926 iso_pu_bacteria 2937119839 2937125239 173
927 iso_pu_bacteria 2937126314 2937129968 173
928 iso_pu_bacteria 2937813078 2937813402 173
929 iso_pu_bacteria 2937822353 2937826665 173
930 iso_pu_bacteria 2937836603 2937840003 173
931 iso_pu_bacteria 2937843397 2937845885 173
932 iso_pu_bacteria 2937848649 2937853638 173
933 iso_pu_bacteria 2937861824 2937864423 173
934 iso_pu_bacteria 2937868953 2937869764 173
935 iso_pu_bacteria 2937877337 2937879313 173
936 iso_pu_bacteria 2937891427 2937898199 173
937 iso_pu_bacteria 2937972304 2937974953 173
938 iso_pu_bacteria 2937980651 2937988319 173
939 iso_pu_bacteria 2937994558 2937999130 173
940 iso_pu_bacteria 2938014810 2938019877 173
941 iso_pu_bacteria 2940556831 2940559833 173
942 iso_pu_bacteria 2941499720 2941499946 173
943 iso_pu_bacteria 2941507105 2941514408 173
944 iso_pu_bacteria 2941515067 2941522304 173
945 iso_pu_bacteria 2941523033 2941530177 173
946 iso_pu_bacteria 2941531003 2941536077 173
947 iso_pu_bacteria 2941538514 2941540184 173
948 iso_pu_bacteria 2954011201 2954015372 173
949 iso_pu_bacteria 2957375807 2957377132 173
950 iso_pu_bacteria 2957382221 2957385712 173
951 iso_pu_bacteria 2957388812 2957388835 173
952 iso_pu_bacteria 2957395598 2957401725 173
953 iso_pu_bacteria 2957402308 2957406441 173
954 iso_pu_bacteria 2957408893 2957414198 173
955 iso_pu_bacteria 2957415311 2957418168 173
956 iso_pu_bacteria 2957422303 2957429133 173
957 iso_pu_bacteria 2957430029 2957435562 173
958 iso_pu_bacteria 2957437181 2957443034 173
959 iso_pu_bacteria 2957443900 2957449775 173
960 iso_pu_bacteria 2957450854 2957453198 173
961 iso_pu_bacteria 2957457609 2957464198 173
962 iso_pu_bacteria 2957464669 2957468116 173
963 iso_pu_bacteria 2957471148 2957477675 173
964 iso_pu_bacteria 2957478035 2957483694 173
965 iso_pu_bacteria 2957484790 2957491289 173
966 iso_pu_bacteria 2957491536 2957496674 173
967 iso_pu_bacteria 2957498199 2957504892 173
968 iso_pu_bacteria 2957505466 2957512930 173
969 iso_pu_bacteria 2958034702 2958036856 173
970 iso_pu_bacteria 2958041894 2958050478 173
971 iso_pu_bacteria 2958064165 2958070260 173
972 iso_pu_bacteria 2958071322 2958072558 173
973 iso_pu_bacteria 2958084443 2958086488 173
974 iso_pu_bacteria 2958100919 2958101574 173
975 iso_pu_bacteria 2958108152 2958110465 173
976 iso_pu_bacteria 2958115193 2958122505 173
977 iso_pu_bacteria 2958122699 2958130094 173
978 iso_pu_bacteria 2958130278 2958132802 173
979 iso_pu_bacteria 2958137437 2958142874 173
980 iso_pu_bacteria 2958144490 2958145617 173
981 iso_pu_bacteria 2958158011 2958162958 173
982 iso_pu_bacteria 2958165035 2958169604 173
983 iso_pu_bacteria 2958172287 2958177436 173
984 iso_pu_bacteria 2958179912 2958182934 173
985 iso_pu_bacteria 2960584000 2960586008 173
986 iso_pu_bacteria 2960591022 2960593523 173
987 iso_pu_bacteria 2960597568 2960602386 173
988 iso_pu_bacteria 2960603979 2960608999 173
989 iso_pu_bacteria 2960610863 2960616764 173
990 iso_pu_bacteria 2960617483 2960623101 173
991 iso_pu_bacteria 2960624210 2960630976 173
992 iso_pu_bacteria 2960631154 2960636896 173
993 iso_pu_bacteria 2960637947 2960639646 173
994 iso_pu_bacteria 2960645483 2960652511 173
995 iso_pu_bacteria 2960652885 2960655267 173
996 iso_pu_bacteria 2960660292 2960666652 173
997 iso_pu_bacteria 2960667422 2960673107 173
998 iso_pu_bacteria 2960674078 2960677295 173
999 iso_pu_bacteria 2960680706 2960686305 173
1000 iso_pu_bacteria 2960687367 2960693516 173
1001 iso_pu_bacteria 2960693952 2960700507 173
1002 iso_pu_bacteria 2961077736 2961080814 173
1003 iso_pu_bacteria 2961114664 2961117039 173
1004 iso_pu_bacteria 2961127735 2961129438 173
1005 iso_pu_bacteria 2961136820 2961139058 173
1006 iso_pu_bacteria 2961163497 2961168064 173
1007 iso_pu_bacteria 2961170736 2961174721 173
1008 iso_pu_bacteria 2961183825 2961186451 173
1009 iso_pu_bacteria 2963644680 2963648653 173
1010 iso_pu_bacteria 2964607997 2964611279 173
1011 iso_pu_bacteria 2964615318 2964621254 173
1012 iso_pu_bacteria 2964621998 2964626448 173
1013 iso_pu_bacteria 2964628898 2964635554 173
1014 iso_pu_bacteria 2964636051 2964641217 173
1015 iso_pu_bacteria 2964643177 2964647064 173
1016 iso_pu_bacteria 2964649959 2964655517 173
1017 iso_pu_bacteria 2964656573 2964661948 173
1018 iso_pu_bacteria 2964663802 2964670117 173
1019 iso_pu_bacteria 2964670856 2964677220 173
1020 iso_pu_bacteria 2964678106 2964684936 173
1021 iso_pu_bacteria 2964685014 2964691770 173
1022 iso_pu_bacteria 2964691889 2964698503 173
1023 iso_pu_bacteria 2964698721 2964703425 173
1024 iso_pu_bacteria 2964705432 2964710556 173
1025 iso_pu_bacteria 2964712639 2964713691 173
1026 iso_pu_bacteria 2964719344 2964721087 173
1027 iso_pu_bacteria 2965018300 2965022883 173
1028 iso_pu_bacteria 2965025482 2965027332 173
1029 iso_pu_bacteria 2965032056 2965037911 173
1030 iso_pu_bacteria 2965040258 2965040804 173
1031 iso_pu_bacteria 2965047637 2965050108 173
1032 iso_pu_bacteria 2965062239 2965066157 173
1033 iso_pu_bacteria 2965089291 2965091037 173
1034 iso_pu_bacteria 2967664464 2967671049 173
1035 iso_pu_bacteria 2967671571 2967672373 173
1036 iso_pu_bacteria 2967678726 2967683409 173
1037 iso_pu_bacteria 2967686174 2967692233 173
1038 iso_pu_bacteria 2967693043 2967694497 173
1039 iso_pu_bacteria 2967699805 2967702495 173
1040 iso_pu_bacteria 2967706974 2967714195 173
1041 iso_pu_bacteria 2967714385 2967718842 173
1042 iso_pu_bacteria 2967721400 2967726172 173
1043 iso_pu_bacteria 2967728569 2967729652 173
1044 iso_pu_bacteria 2967735183 2967739544 173
1045 iso_pu_bacteria 2967742019 2967745160 173
1046 iso_pu_bacteria 2967748971 2967754769 173
1047 iso_pu_bacteria 2967755722 2967762226 173
1048 iso_pu_bacteria 2967762386 2967766740 173
1049 iso_pu_bacteria 2967769361 2967775200 173
1050 iso_pu_bacteria 2967775926 2967782609 173
1051 iso_pu_bacteria 2967996073 2968000656 173
1052 iso_pu_bacteria 2968003550 2968009971 173
1053 iso_pu_bacteria 2968016561 2968017469 173
1054 iso_pu_bacteria 2968083720 2968083880 173
1055 iso_pu_bacteria 2968091066 2968092495 173
1056 iso_pu_bacteria 2968097103 2968102417 173
1057 iso_pu_bacteria 2968110612 2968112947 173
1058 iso_pu_bacteria 2968117919 2968122820 173
1059 iso_pu_bacteria 2968128360 2968128774 173
1060 iso_pu_bacteria 2968171901 2968176464 173
1061 iso_pu_bacteria 2970019648 2970026361 173
1062 iso_pu_bacteria 2970026789 2970033120 173
1063 iso_pu_bacteria 2970033650 2970034149 173
1064 iso_pu_bacteria 2970040964 2970046971 173
1065 iso_pu_bacteria 2970047711 2970051794 173
1066 iso_pu_bacteria 2970054988 2970060505 173
1067 iso_pu_bacteria 2970061556 2970062282 173
1068 iso_pu_bacteria 2970068827 2970069232 173
1069 iso_pu_bacteria 2970076120 2970079546 173
1070 iso_pu_bacteria 2970082768 2970086676 173
1071 iso_pu_bacteria 2970088815 2970091739 173
1072 iso_pu_bacteria 2970095765 2970102540 173
1073 iso_pu_bacteria 2970102677 2970107856 173
1074 iso_pu_bacteria 2970109326 2970115555 173
1075 iso_pu_bacteria 2970116247 2970120781 173
1076 iso_pu_bacteria 2970122695 2970128520 173
1077 iso_pu_bacteria 2970129317 2970129813 173
1078 iso_pu_bacteria 2970136068 2970143452 173
1079 iso_pu_bacteria 2970143518 2970149810 173
1080 iso_pu_bacteria 2970149975 2970156337 173
1081 iso_pu_bacteria 2970156795 2970158342 173
1082 iso_pu_bacteria 2970164137 2970167606 173
1083 iso_pu_bacteria 2970170962 2970173589 173
1084 iso_pu_bacteria 2970177841 2970178668 173
1085 iso_pu_bacteria 2970184632 2970190746 173
1086 iso_pu_bacteria 2970191845 2970198217 173
1087 iso_pu_bacteria 2970469710 2970472355 173
1088 iso_pu_bacteria 2970489779 2970490902 173
1089 iso_pu_bacteria 2970503327 2970507307 173
1090 iso_pu_bacteria 2970510686 2970513844 173
1091 iso_pu_bacteria 2970524798 2970530020 173
1092 iso_pu_bacteria 2970532167 2970539355 173
1093 iso_pu_bacteria 2970540015 2970540152 173
1094 iso_pu_bacteria 2970547951 2970548655 173
1095 iso_pu_bacteria 2970554993 2970559403 173
1096 iso_pu_bacteria 2970593180 2970595497 173
1097 iso_pu_bacteria 2970619444 2970620313 173
1098 iso_pu_bacteria 2970627176 2970632003 173
1099 iso_pu_bacteria 2977516862 2977520503 173
1100 iso_pu_bacteria 2977523885 2977530226 173
1101 iso_pu_bacteria 2977530762 2977532344 173
1102 iso_pu_bacteria 2977537788 2977541446 173
1103 iso_pu_bacteria 2977544691 2977551373 173
1104 iso_pu_bacteria 2977551784 2977557500 173
1105 iso_pu_bacteria 2977558990 2977559959 173
1106 iso_pu_bacteria 2977565890 2977569828 173
1107 iso_pu_bacteria 2977572785 2977578820 173
1108 iso_pu_bacteria 2977579622 2977583942 173
1109 iso_pu_bacteria 2977821940 2977828835 173
1110 iso_pu_bacteria 2977828996 2977829842 173
1111 iso_pu_bacteria 2977843712 2977845402 173
1112 iso_pu_bacteria 2977851361 2977851799 173
1113 iso_pu_bacteria 2977858184 2977860258 173
1114 iso_pu_bacteria 2977864932 2977871966 173
1115 iso_pu_bacteria 2977872689 2977873260 173
1116 iso_pu_bacteria 2977907340 2977913686 173
1117 iso_pu_bacteria 2977922695 2977928119 173
1118 iso_pu_bacteria 2977935797 2977939448 173
1119 iso_pu_bacteria 2977942078 2977946935 173
1120 iso_pu_bacteria 2977950692 2977951354 173
1121 iso_pu_bacteria 2977957713 2977958681 173
1122 iso_pu_bacteria 2977971508 2977980095 173
1123 iso_pu_bacteria 2977986579 2977989479 173
1124 iso_pu_bacteria 2978969890 2978974444 173
1125 iso_pu_bacteria 2979089926 2979094524 173
1126 iso_pu_bacteria 2979095461 2979098093 173
1127 iso_pu_bacteria 2979100975 2979103766 173
1128 iso_pu_bacteria 2979710463 2979715731 173
1129 iso_pu_bacteria 2979779861 2979783234 173
1130 iso_pu_bacteria 2979808191 2979812503 173
1131 iso_pu_bacteria 2984509177 2984511668 173
1132 iso_pu_bacteria 2984518228 2984521971 173
1133 iso_pu_bacteria 2984537506 2984541269 173
1134 iso_pu_bacteria 2984587000 2984589782 173
1135 iso_pu_bacteria 2984601300 2984603547 173
1136 iso_pu_bacteria 2987636660 2987640729 173
1137 iso_pu_bacteria 2987645492 2987647826 173
1138 iso_pu_bacteria 2987652177 2987652481 173
1139 iso_pu_bacteria 2987659509 2987664078 173
1140 iso_pu_bacteria 2987666974 2987670303 173
1141 iso_pu_bacteria 2987673487 2987674281 173
1142 iso_pu_bacteria 2989349275 2989353402 173
1143 iso_pu_bacteria 2989771324 2989775905 173
1144 iso_pu_bacteria 2989776772 2989778460 173
1145 iso_pu_bacteria 2995392953 2995397034 173
1146 iso_pu_bacteria 2996310559 2996310964 173
1147 iso_pu_bacteria 2996336353 2996340563 173
1148 iso_pu_bacteria 2996341866 2996347156 173
1149 iso_pu_bacteria 2996348954 2996351226 173
1150 iso_pu_bacteria 2996386984 2996390919 173
1151 iso_pu_bacteria 2996887358 2996888846 173
1152 iso_pu_bacteria 2996893221 2996898882 173
1153 iso_pu_bacteria 3000135777 3000136178 173
1154 iso_pu_bacteria 3002141150 3002143937 173
1155 iso_pu_bacteria 3003930520 3003933077 173
1156 iso_pu_bacteria 3004167301 3004170180 173
1157 iso_pu_bacteria 3004188549 3004193133 173
1158 iso_pu_bacteria 3004195979 3004196117 173
1159 iso_pu_bacteria 3004203850 3004208926 173
1160 iso_pu_bacteria 3004211236 3004213112 173
1161 iso_pu_bacteria 3004218560 3004222125 173
1162 iso_pu_bacteria 3004232784 3004239280 173
1163 iso_pu_bacteria 3004268573 3004273814 173
1164 iso_pu_bacteria 3004275668 3004277924 173
1165 iso_pu_bacteria 3004289098 3004290241 173
1166 iso_pu_bacteria 3004334049 3004340250 173
1167 iso_pu_bacteria 3005409236 3005412757 173
1168 iso_pu_bacteria 3005416602 3005417902 173
1169 iso_pu_bacteria 3005445848 3005446994 173
1170 iso_pu_bacteria 3005452660 3005453627 173
1171 iso_pu_bacteria 3005474847 3005479147 173
1172 iso_pu_bacteria 3005506211 3005512696 173
1173 iso_pu_bacteria 3005594810 3005598081 173
1174 iso_pu_bacteria 3005718088 3005721271 173
1175 iso_pu_bacteria 637000159 637073569 173
1176 iso_pu_bacteria 639633055 639647674 173
1177 iso_pu_bacteria 643692032 643825411 173
1178 iso_pu_bacteria 648276728 648741353 173
1179 iso_pu_bacteria 649633066 649873505 173
1180 iso_pu_bacteria 650716007 650740403 173
1181 iso_pu_bacteria 8002285264 8002285930 173
1182 iso_pu_bacteria 8003570095 8003571465 173
1183 iso_pu_bacteria 8003992118 8003993240 173
1184 iso_pu_bacteria 8003999396 8004000497 173
1185 iso_pu_bacteria 8004300914 8004307028 173
1186 iso_pu_bacteria 8004312739 8004316477 173
1187 iso_pu_bacteria 8004361976 8004366431 173
1188 iso_pu_bacteria 8004374579 8004379603 173
1189 iso_pu_bacteria 8004387939 8004390932 173
1190 iso_pu_bacteria 8004445564 8004451624 173
1191 iso_pu_bacteria 8004633249 8004638913 173
1192 iso_pu_bacteria 8004640170 8004643115 173
1193 iso_pu_bacteria 8004695233 8004703055 173
1194 iso_pu_bacteria 8004703790 8004714465 173
1195 iso_pu_bacteria 8004714634 8004717484 173
1196 iso_pu_bacteria 8004727605 8004731780 173
1197 iso_pu_bacteria 8005246636 8005251034 173
1198 iso_pu_bacteria 8005258706 8005260117 173
1199 iso_pu_bacteria 8005275841 8005279889 173
1200 iso_pu_bacteria 8005282627 8005286951 173
1201 iso_pu_bacteria 8005289223 8005293034 173
1202 iso_pu_bacteria 8005301065 8005304846 173
1203 iso_pu_bacteria 8005307578 8005308636 173
1204 iso_pu_bacteria 8005314921 8005316448 173
1205 iso_pu_bacteria 8005321885 8005323373 173
1206 iso_pu_bacteria 8005376324 8005376361 173
1207 iso_pu_bacteria 8005382845 8005385747 173
1208 iso_pu_bacteria 8005395548 8005400605 173
1209 iso_pu_bacteria 8005430974 8005435331 173
1210 iso_pu_bacteria 8005460587 8005462187 173
1211 iso_pu_bacteria 8005484373 8005487110 173
1212 iso_pu_bacteria 8005497431 8005499606 173
1213 iso_pu_bacteria 8005542996 8005544505 173
1214 iso_pu_bacteria 8005556819 8005559794 173
1215 iso_pu_bacteria 8005563573 8005564966 173
1216 iso_pu_bacteria 8005570704 8005570874 173
1217 iso_pu_bacteria 8005619151 8005620786 173
1218 iso_pu_bacteria 8005626139 8005628920 173
1219 iso_pu_bacteria 8005645114 8005646536 173
1220 iso_pu_bacteria 8005658619 8005659721 173
1221 iso_pu_bacteria 8005668836 8005671023 173
1222 iso_pu_bacteria 8005682033 8005686565 173
1223 iso_pu_bacteria 8005688590 8005691271 173
1224 iso_pu_bacteria 8005695170 8005698522 173
1225 iso_pu_bacteria 8006926726 8006930384 173
1226 iso_pu_bacteria 8006933436 8006942201 173
1227 iso_pu_bacteria 8006964411 8006964512 173
1228 iso_pu_bacteria 8006973647 8006981935 173
1229 iso_pu_bacteria 8006984368 8006986869 173
1230 iso_pu_bacteria 8006994254 8006996088 173
1231 iso_pu_bacteria 8016511872 8016514670 173
1232 iso_pu_bacteria 8016522445 8016530769 173
1233 iso_pu_bacteria 8016530956 8016536060 173
1234 iso_pu_bacteria 8016539877 8016540339 173
1235 iso_pu_bacteria 8016548790 8016552891 173
1236 iso_pu_bacteria 8016557553 8016561270 173
1237 iso_pu_bacteria 8016566248 8016574406 173
1238 iso_pu_bacteria 8016575299 8016578504 173
1239 iso_pu_bacteria 8016583857 8016591256 173
1240 iso_pu_bacteria 8016595262 8016599127 173
1241 iso_pu_bacteria 8016603502 8016611921 173
1242 iso_pu_bacteria 8016613128 8016621883 173
1243 iso_pu_bacteria 8016622563 8016627971 173
1244 iso_pu_bacteria 8016630954 8016632294 173
1245 iso_pu_bacteria 8017057580 8017061764 173
1246 iso_pu_bacteria 8018127388 8018131578 173
1247 iso_pu_bacteria 8018150411 8018150793 173
1248 iso_pu_bacteria 8018163183 8018169241 173
1249 iso_pu_bacteria 8018176218 8018180140 173
1250 iso_pu_bacteria 8019530166 8019535786 173
1251 iso_pu_bacteria 8019538911 8019543693 173
1252 iso_pu_bacteria 8019547302 8019555079 173
1253 iso_pu_bacteria 8019555841 8019557922 173
1254 iso_pu_bacteria 8019565922 8019567363 173
1255 iso_pu_bacteria 8019576017 8019581264 173
1256 iso_pu_bacteria 8019586578 8019588891 173
1257 iso_pu_bacteria 8019597564 8019602343 173
1258 iso_pu_bacteria 8019608314 8019616218 173
1259 iso_pu_bacteria 8019619141 8019626838 173
1260 iso_pu_bacteria 8019629233 8019635674 173
1261 iso_pu_bacteria 8019638758 8019644011 173
1262 iso_pu_bacteria 8019648815 8019657008 173
1263 iso_pu_bacteria 8019659431 8019663470 173
1264 iso_pu_bacteria 8019668869 8019673084 173
1265 iso_pu_bacteria 8019678201 8019683056 173
1266 iso_pu_bacteria 8019687851 8019688753 173
1267 iso_pu_bacteria 8023680758 8023681983 173
1268 iso_pu_bacteria 8024479707 8024482504 173
1269 iso_pu_bacteria 8024486573 8024489489 173
1270 iso_pu_bacteria 8024501048 8024503005 173
1271 iso_pu_bacteria 8045864390 8045865492 173
1272 iso_pu_bacteria 8046767195 8046768492 173
1273 iso_pu_bacteria 8049293176 8049294292 173
1274 iso_pu_bacteria 8054460903 8054462016 173
1275 iso_pu_bacteria 8054558443 8054562914 173
1276 iso_pu_bacteria 8055617313 8055621996 173
1277 iso_pu_bacteria 8055742211 8055747547 173
1278 iso_pu_bacteria 8056375014 8056380979 173
1279 iso_pu_bacteria 8056382006 8056384495 173
1280 iso_pu_bacteria 8056681323 8056684533 173
1281 iso_pu_bacteria 8056689827 8056691243 173
1282 iso_pu_bacteria 8056875544 8056879580 173
1283 iso_pu_bacteria 8056967851 8056972377 173
1284 iso_pu_bacteria 8057575449 8057577979 173
1285 iso_pu_bacteria 8057874678 8057876559 173
1286 iso_pu_bacteria 3004248173 3004249011 175
1287 3300003320 rootH2_10008940 rootH2_1000894017 176
1288 3300000546 LJNas_1019970 LJNas_10199701 177
1289 3300001979 JGI24740J21852_10005876 JGI24740J21852_100058767 177
1290 3300001979 JGI24740J21852_10038834 JGI24740J21852_100388342 177
1291 3300002067 JGI24735J21928_10008865 JGI24735J21928_100088656 177
1292 3300002070 JGI24750J21931_1002476 JGI24750J21931_10024763 177
1293 3300002074 JGI24748J21848_1006619 JGI24748J21848_10066192 177
1294 3300002704 JGI25155J39150_1000061 JGI25155J39150_100006119 177
1295 3300002705 JGI25156J39149_1001959 JGI25156J39149_100195910 177
1296 3300002737 JGI25162J39368_1009004 JGI25162J39368_10090043 177
1297 3300002737 JGI25162J39368_1009005 JGI25162J39368_10090053 177
1298 3300002738 JGI25154J39366_1002042 JGI25154J39366_10020426 177
1299 3300002739 JGI25158J39367_1002239 JGI25158J39367_10022391 177
1300 3300002741 JGI25157J39369_1000106 JGI25157J39369_100010619 177
1301 3300002741 JGI25157J39369_1002241 JGI25157J39369_100224110 177
1302 3300002773 JGI25152J39213_1035375 JGI25152J39213_10353751 177
1303 3300002773 JGI25152J39213_1043016 JGI25152J39213_10430161 177
1304 3300002773 JGI25152J39213_1043464 JGI25152J39213_10434641 177
1305 3300002773 JGI25152J39213_1047518 JGI25152J39213_10475181 177
1306 3300002774 JGI25150J39212_1009762 JGI25150J39212_10097624 177
1307 3300002774 JGI25150J39212_1014332 JGI25150J39212_10143322 177
1308 3300002774 JGI25150J39212_1018199 JGI25150J39212_10181992 177
1309 3300002774 JGI25150J39212_1041666 JGI25150J39212_10416661 177
1310 3300002987 JGI25159J45721_1001742 JGI25159J45721_100174210 177
1311 3300002987 JGI25159J45721_1001758 JGI25159J45721_100175810 177
1312 3300002987 JGI25159J45721_1001854 JGI25159J45721_100185410 177
1313 3300003162 Ga0006778J45830_1043587 Ga0006778J45830_10435879 177
1314 3300003162 Ga0006778J45830_1078890 Ga0006778J45830_10788902 177
1315 3300003187 JGI25151J46595_10033134 JGI25151J46595_100331343 177
1316 3300003187 JGI25151J46595_10051541 JGI25151J46595_100515412 177
1317 3300003187 JGI25151J46595_10094552 JGI25151J46595_100945521 177
1318 3300003187 JGI25151J46595_10095923 JGI25151J46595_100959231 177
1319 3300003187 JGI25151J46595_10097329 JGI25151J46595_100973291 177
1320 3300003203 JGI25406J46586_10001918 JGI25406J46586_100019185 177
1321 3300003214 JGI25165J46597_1001303 JGI25165J46597_100130310 177
1322 3300003214 JGI25165J46597_1008576 JGI25165J46597_10085763 177
1323 3300003214 JGI25165J46597_1009987 JGI25165J46597_10099873 177
1324 3300003215 JGI25153J46596_10001601 JGI25153J46596_1000160110 177
1325 3300003215 JGI25153J46596_10013209 JGI25153J46596_100132095 177
1326 3300003215 JGI25153J46596_10022281 JGI25153J46596_100222811 177
1327 3300003215 JGI25153J46596_10080670 JGI25153J46596_100806701 177
1328 3300003215 JGI25153J46596_10086554 JGI25153J46596_100865541 177
1329 3300003215 JGI25153J46596_10114136 JGI25153J46596_101141361 177
1330 3300003215 JGI25153J46596_10127048 JGI25153J46596_101270481 177
1331 3300003300 Ga0006758J48902_1009309 Ga0006758J48902_100930911 177
1332 3300003322 rootL2_10037314 rootL2_100373142 177
1333 3300003354 JGI25160J50197_1000711 JGI25160J50197_10007112 177
1334 3300003354 JGI25160J50197_1002401 JGI25160J50197_100240110 177
1335 3300003354 JGI25160J50197_1010180 JGI25160J50197_10101802 177
1336 3300003354 JGI25160J50197_1020369 JGI25160J50197_10203692 177
1337 3300003354 JGI25160J50197_1023262 JGI25160J50197_10232623 177
1338 3300003354 JGI25160J50197_1062080 JGI25160J50197_10620801 177
1339 3300003354 JGI25160J50197_1065297 JGI25160J50197_10652971 177
1340 3300003374 JGI25161J50226_1001504 JGI25161J50226_100150410 177
1341 3300003374 JGI25161J50226_1005101 JGI25161J50226_10051016 177
1342 3300003374 JGI25161J50226_1005181 JGI25161J50226_10051811 177
1343 3300003544 Ga0007417J51691_1064787 Ga0007417J51691_10647872 177
1344 3300003559 Ga0007427J51700_119959 Ga0007427J51700_1199591 177
1345 3300003575 Ga0007409J51694_1066553 Ga0007409J51694_10665532 177
1346 3300003578 Ga0006562J51391_1040260 Ga0006562J51391_10402604 177
1347 3300003579 Ga0007429J51699_1060640 Ga0007429J51699_10606404 177
1348 3300003579 Ga0007429J51699_1080175 Ga0007429J51699_10801753 177
1349 3300003693 Ga0032354_1024703 Ga0032354_102470318 177
1350 3300003762 Ga0055542_1001882 Ga0055542_100188210 177
1351 3300003762 Ga0055542_1002921 Ga0055542_10029219 177
1352 3300003763 Ga0055529_1004418 Ga0055529_10044183 177
1353 3300003771 Ga0055526_1003723 Ga0055526_10037233 177
1354 3300003771 Ga0055526_1035691 Ga0055526_10356911 177
1355 3300003771 Ga0055526_1064369 Ga0055526_10643691 177
1356 3300003775 Ga0055524_1036623 Ga0055524_10366233 177
1357 3300003775 Ga0055524_1044107 Ga0055524_10441072 177
1358 3300003775 Ga0055524_1050093 Ga0055524_10500932 177
1359 3300003775 Ga0055524_1066669 Ga0055524_10666692 177
1360 3300003781 Ga0055536_1001886 Ga0055536_100188614 177
1361 3300003781 Ga0055536_1002273 Ga0055536_100227313 177
1362 3300003781 Ga0055536_1006942 Ga0055536_10069426 177
1363 3300003790 Ga0055528_1021587 Ga0055528_10215874 177
1364 3300003790 Ga0055528_1056056 Ga0055528_10560561 177
1365 3300003790 Ga0055528_1076269 Ga0055528_10762691 177
1366 3300003790 Ga0055528_1076384 Ga0055528_10763841 177
1367 3300003791 Ga0055530_10009225 Ga0055530_100092256 177
1368 3300003791 Ga0055530_10024067 Ga0055530_100240672 177
1369 3300003792 Ga0055540_1004614 Ga0055540_10046148 177
1370 3300003792 Ga0055540_1064046 Ga0055540_10640461 177
1371 3300003792 Ga0055540_1065134 Ga0055540_10651341 177
1372 3300003792 Ga0055540_1077922 Ga0055540_10779221 177
1373 3300003792 Ga0055540_1085533 Ga0055540_10855331 177
1374 3300003794 Ga0055531_10006947 Ga0055531_100069478 177
1375 3300003794 Ga0055531_10017723 Ga0055531_100177232 177
1376 3300003794 Ga0055531_10080310 Ga0055531_100803102 177
1377 3300004625 Ga0055543_1000156 Ga0055543_10001566 177
1378 3300004625 Ga0055543_1000856 Ga0055543_100085610 177
1379 3300004625 Ga0055543_1000880 Ga0055543_100088018 177
1380 3300004625 Ga0055543_1001602 Ga0055543_100160210 177
1381 3300004798 Ga0058859_11714120 Ga0058859_117141202 177
1382 3300004801 Ga0058860_10018536 Ga0058860_100185363 177
1383 3300004801 Ga0058860_11771056 Ga0058860_117710561 177
1384 3300005262 Ga0065165_1002620 Ga0065165_100262010 177
1385 3300005262 Ga0065165_1002688 Ga0065165_100268810 177
1386 3300005262 Ga0065165_1008206 Ga0065165_10082066 177
1387 3300005262 Ga0065165_1014496 Ga0065165_10144965 177
1388 3300005262 Ga0065165_1019265 Ga0065165_10192655 177
1389 3300005262 Ga0065165_1020288 Ga0065165_10202885 177
1390 3300005289 Ga0065704_10166257 Ga0065704_101662571 177
1391 3300005295 Ga0065707_10012753 Ga0065707_100127533 177
1392 3300005327 Ga0070658_10092435 Ga0070658_100924355 177
1393 3300005328 Ga0070676_10812915 Ga0070676_108129151 177
1394 3300005331 Ga0070670_100003237 Ga0070670_10000323711 177
1395 3300005331 Ga0070670_100139598 Ga0070670_1001395982 177
1396 3300005335 Ga0070666_10461003 Ga0070666_104610032 177
1397 3300005335 Ga0070666_10739099 Ga0070666_107390991 177
1398 3300005335 Ga0070666_10788376 Ga0070666_107883761 177
1399 3300005337 Ga0070682_100060292 Ga0070682_1000602925 177
1400 3300005337 Ga0070682_100106402 Ga0070682_1001064024 177
1401 3300005337 Ga0070682_100644370 Ga0070682_1006443702 177
1402 3300005337 Ga0070682_101449987 Ga0070682_1014499871 177
1403 3300005339 Ga0070660_100228895 Ga0070660_1002288951 177
1404 3300005339 Ga0070660_100286912 Ga0070660_1002869121 177
1405 3300005340 Ga0070689_101175664 Ga0070689_1011756641 177
1406 3300005343 Ga0070687_100950748 Ga0070687_1009507481 177
1407 3300005344 Ga0070661_100490127 Ga0070661_1004901272 177
1408 3300005345 Ga0070692_10549122 Ga0070692_105491222 177
1409 3300005347 Ga0070668_100162574 Ga0070668_1001625741 177
1410 3300005347 Ga0070668_100167991 Ga0070668_1001679914 177
1411 3300005347 Ga0070668_100231234 Ga0070668_1002312341 177
1412 3300005347 Ga0070668_100334546 Ga0070668_1003345462 177
1413 3300005347 Ga0070668_100927361 Ga0070668_1009273611 177
1414 3300005353 Ga0070669_100237958 Ga0070669_1002379583 177
1415 3300005353 Ga0070669_100279858 Ga0070669_1002798582 177
1416 3300005353 Ga0070669_100311739 Ga0070669_1003117393 177
1417 3300005353 Ga0070669_100440199 Ga0070669_1004401992 177
1418 3300005354 Ga0070675_100903392 Ga0070675_1009033922 177
1419 3300005355 Ga0070671_100016669 Ga0070671_1000166695 177
1420 3300005355 Ga0070671_100177196 Ga0070671_1001771962 177
1421 3300005355 Ga0070671_100329945 Ga0070671_1003299452 177
1422 3300005355 Ga0070671_101149589 Ga0070671_1011495891 177
1423 3300005355 Ga0070671_101211801 Ga0070671_1012118011 177
1424 3300005356 Ga0070674_100224686 Ga0070674_1002246861 177
1425 3300005356 Ga0070674_100422934 Ga0070674_1004229342 177
1426 3300005364 Ga0070673_100870080 Ga0070673_1008700801 177
1427 3300005365 Ga0070688_100220798 Ga0070688_1002207982 177
1428 3300005366 Ga0070659_100100837 Ga0070659_1001008372 177
1429 3300005367 Ga0070667_100967783 Ga0070667_1009677832 177
1430 3300005367 Ga0070667_101192686 Ga0070667_1011926862 177
1431 3300005367 Ga0070667_101453121 Ga0070667_1014531211 177
1432 3300005406 Ga0070703_10123651 Ga0070703_101236512 177
1433 3300005434 Ga0070709_10004324 Ga0070709_1000432411 177
1434 3300005434 Ga0070709_10499759 Ga0070709_104997591 177
1435 3300005435 Ga0070714_100059218 Ga0070714_1000592186 177
1436 3300005435 Ga0070714_100112402 Ga0070714_1001124022 177
1437 3300005436 Ga0070713_100027784 Ga0070713_1000277843 177
1438 3300005436 Ga0070713_100030565 Ga0070713_1000305656 177
1439 3300005436 Ga0070713_100187641 Ga0070713_1001876412 177
1440 3300005436 Ga0070713_101186952 Ga0070713_1011869521 177
1441 3300005436 Ga0070713_101663701 Ga0070713_1016637011 177
1442 3300005437 Ga0070710_10003270 Ga0070710_100032706 177
1443 3300005437 Ga0070710_10033673 Ga0070710_100336735 177
1444 3300005437 Ga0070710_10211874 Ga0070710_102118741 177
1445 3300005439 Ga0070711_100007497 Ga0070711_10000749713 177
1446 3300005439 Ga0070711_100123070 Ga0070711_1001230703 177
1447 3300005439 Ga0070711_100126700 Ga0070711_1001267004 177
1448 3300005439 Ga0070711_100201995 Ga0070711_1002019952 177
1449 3300005439 Ga0070711_100357588 Ga0070711_1003575883 177
1450 3300005444 Ga0070694_100180173 Ga0070694_1001801732 177
1451 3300005445 Ga0070708_100035098 Ga0070708_1000350989 177
1452 3300005455 Ga0070663_100146891 Ga0070663_1001468912 177
1453 3300005455 Ga0070663_100254636 Ga0070663_1002546363 177
1454 3300005455 Ga0070663_100816616 Ga0070663_1008166161 177
1455 3300005456 Ga0070678_100023343 Ga0070678_1000233436 177
1456 3300005458 Ga0070681_10018722 Ga0070681_100187228 177
1457 3300005458 Ga0070681_10068789 Ga0070681_100687897 177
1458 3300005466 Ga0070685_10472265 Ga0070685_104722651 177
1459 3300005466 Ga0070685_10917889 Ga0070685_109178891 177
1460 3300005467 Ga0070706_100045185 Ga0070706_1000451857 177
1461 3300005467 Ga0070706_100246691 Ga0070706_1002466913 177
1462 3300005467 Ga0070706_101013047 Ga0070706_1010130471 177
1463 3300005468 Ga0070707_100065254 Ga0070707_1000652546 177
1464 3300005471 Ga0070698_100298640 Ga0070698_1002986401 177
1465 3300005471 Ga0070698_100327715 Ga0070698_1003277153 177
1466 3300005471 Ga0070698_101101846 Ga0070698_1011018462 177
1467 3300005530 Ga0070679_100237155 Ga0070679_1002371553 177
1468 3300005530 Ga0070679_100305294 Ga0070679_1003052942 177
1469 3300005530 Ga0070679_100329362 Ga0070679_1003293622 177
1470 3300005535 Ga0070684_100792115 Ga0070684_1007921151 177
1471 3300005535 Ga0070684_100911036 Ga0070684_1009110362 177
1472 3300005535 Ga0070684_101120991 Ga0070684_1011209912 177
1473 3300005536 Ga0070697_100102676 Ga0070697_1001026764 177
1474 3300005536 Ga0070697_100279312 Ga0070697_1002793122 177
1475 3300005539 Ga0068853_100027914 Ga0068853_1000279146 177
1476 3300005539 Ga0068853_100087278 Ga0068853_1000872784 177
1477 3300005539 Ga0068853_100159771 Ga0068853_1001597714 177
1478 3300005539 Ga0068853_100495158 Ga0068853_1004951582 177
1479 3300005539 Ga0068853_101444864 Ga0068853_1014448641 177
1480 3300005543 Ga0070672_100153802 Ga0070672_1001538023 177
1481 3300005543 Ga0070672_100921346 Ga0070672_1009213461 177
1482 3300005544 Ga0070686_100291835 Ga0070686_1002918351 177
1483 3300005546 Ga0070696_100105177 Ga0070696_1001051773 177
1484 3300005547 Ga0070693_100556937 Ga0070693_1005569371 177
1485 3300005548 Ga0070665_100006166 Ga0070665_10000616618 177
1486 3300005548 Ga0070665_100149739 Ga0070665_1001497393 177
1487 3300005548 Ga0070665_100189603 Ga0070665_1001896033 177
1488 3300005548 Ga0070665_100578965 Ga0070665_1005789653 177
1489 3300005548 Ga0070665_100588727 Ga0070665_1005887272 177
1490 3300005548 Ga0070665_100658220 Ga0070665_1006582202 177
1491 3300005549 Ga0070704_100474375 Ga0070704_1004743751 177
1492 3300005563 Ga0068855_100017220 Ga0068855_10001722013 177
1493 3300005563 Ga0068855_100324040 Ga0068855_1003240404 177
1494 3300005563 Ga0068855_100408666 Ga0068855_1004086663 177
1495 3300005563 Ga0068855_100516500 Ga0068855_1005165001 177
1496 3300005563 Ga0068855_100528959 Ga0068855_1005289593 177
1497 3300005563 Ga0068855_100860885 Ga0068855_1008608852 177
1498 3300005563 Ga0068855_101690612 Ga0068855_1016906121 177
1499 3300005564 Ga0070664_100444593 Ga0070664_1004445932 177
1500 3300005564 Ga0070664_101316078 Ga0070664_1013160782 177
1501 3300005577 Ga0068857_100250838 Ga0068857_1002508382 177
1502 3300005577 Ga0068857_100788810 Ga0068857_1007888102 177
1503 3300005578 Ga0068854_100367640 Ga0068854_1003676402 177
1504 3300005578 Ga0068854_100767970 Ga0068854_1007679701 177
1505 3300005614 Ga0068856_100055880 Ga0068856_1000558804 177
1506 3300005614 Ga0068856_100137388 Ga0068856_1001373886 177
1507 3300005614 Ga0068856_100156445 Ga0068856_1001564453 177
1508 3300005614 Ga0068856_100489690 Ga0068856_1004896902 177
1509 3300005614 Ga0068856_100700160 Ga0068856_1007001601 177
1510 3300005614 Ga0068856_100817239 Ga0068856_1008172391 177
1511 3300005615 Ga0070702_100640463 Ga0070702_1006404631 177
1512 3300005616 Ga0068852_100626597 Ga0068852_1006265973 177
1513 3300005616 Ga0068852_101350716 Ga0068852_1013507161 177
1514 3300005616 Ga0068852_101864462 Ga0068852_1018644621 177
1515 3300005617 Ga0068859_100087579 Ga0068859_1000875796 177
1516 3300005617 Ga0068859_101045611 Ga0068859_1010456112 177
1517 3300005618 Ga0068864_100514273 Ga0068864_1005142732 177
1518 3300005618 Ga0068864_101231776 Ga0068864_1012317762 177
1519 3300005719 Ga0068861_100287874 Ga0068861_1002878742 177
1520 3300005834 Ga0068851_10105812 Ga0068851_101058122 177
1521 3300005834 Ga0068851_10382695 Ga0068851_103826952 177
1522 3300005842 Ga0068858_100044764 Ga0068858_1000447645 177
1523 3300005842 Ga0068858_100401297 Ga0068858_1004012972 177
1524 3300005842 Ga0068858_100622112 Ga0068858_1006221122 177
1525 3300005842 Ga0068858_100653539 Ga0068858_1006535392 177
1526 3300005843 Ga0068860_100078148 Ga0068860_1000781486 177
1527 3300005843 Ga0068860_100138904 Ga0068860_1001389046 177
1528 3300005843 Ga0068860_100671828 Ga0068860_1006718281 177
1529 3300005844 Ga0068862_100434499 Ga0068862_1004344992 177
1530 3300005983 Ga0081540_1002663 Ga0081540_100266319 177
1531 3300005983 Ga0081540_1014636 Ga0081540_10146367 177
1532 3300005983 Ga0081540_1072665 Ga0081540_10726652 177
1533 3300005983 Ga0081540_1186647 Ga0081540_11866472 177
1534 3300005985 Ga0081539_10000273 Ga0081539_1000027318 177
1535 3300005985 Ga0081539_10004419 Ga0081539_1000441918 177
1536 3300005985 Ga0081539_10038639 Ga0081539_100386395 177
1537 3300006028 Ga0070717_10023212 Ga0070717_100232128 177
1538 3300006028 Ga0070717_10257030 Ga0070717_102570302 177
1539 3300006028 Ga0070717_11382128 Ga0070717_113821281 177
1540 3300006038 Ga0075365_10004647 Ga0075365_100046479 177
1541 3300006038 Ga0075365_10027241 Ga0075365_100272416 177
1542 3300006038 Ga0075365_10057229 Ga0075365_100572291 177
1543 3300006038 Ga0075365_10062221 Ga0075365_100622215 177
1544 3300006038 Ga0075365_10089365 Ga0075365_100893653 177
1545 3300006038 Ga0075365_10121312 Ga0075365_101213122 177
1546 3300006038 Ga0075365_10168486 Ga0075365_101684863 177
1547 3300006038 Ga0075365_10206089 Ga0075365_102060893 177
1548 3300006038 Ga0075365_10235649 Ga0075365_102356492 177
1549 3300006038 Ga0075365_10255350 Ga0075365_102553503 177
1550 3300006038 Ga0075365_10264031 Ga0075365_102640311 177
1551 3300006038 Ga0075365_10626635 Ga0075365_106266352 177
1552 3300006038 Ga0075365_10747840 Ga0075365_107478402 177
1553 3300006042 Ga0075368_10085252 Ga0075368_100852522 177
1554 3300006042 Ga0075368_10106170 Ga0075368_101061702 177
1555 3300006042 Ga0075368_10117777 Ga0075368_101177771 177
1556 3300006042 Ga0075368_10203279 Ga0075368_102032791 177
1557 3300006042 Ga0075368_10240025 Ga0075368_102400251 177
1558 3300006042 Ga0075368_10410777 Ga0075368_104107771 177
1559 3300006048 Ga0075363_100073492 Ga0075363_1000734923 177
1560 3300006048 Ga0075363_100099958 Ga0075363_1000999582 177
1561 3300006048 Ga0075363_100141538 Ga0075363_1001415383 177
1562 3300006048 Ga0075363_100351063 Ga0075363_1003510631 177
1563 3300006048 Ga0075363_100776260 Ga0075363_1007762601 177
1564 3300006051 Ga0075364_10010552 Ga0075364_100105525 177
1565 3300006051 Ga0075364_10036710 Ga0075364_100367103 177
1566 3300006051 Ga0075364_10042063 Ga0075364_100420633 177
1567 3300006051 Ga0075364_10119377 Ga0075364_101193772 177
1568 3300006051 Ga0075364_10254910 Ga0075364_102549103 177
1569 3300006051 Ga0075364_10316047 Ga0075364_103160472 177
1570 3300006051 Ga0075364_10426515 Ga0075364_104265152 177
1571 3300006051 Ga0075364_10447344 Ga0075364_104473442 177
1572 3300006051 Ga0075364_10641372 Ga0075364_106413721 177
1573 3300006163 Ga0070715_10001968 Ga0070715_100019684 177
1574 3300006163 Ga0070715_10011442 Ga0070715_100114428 177
1575 3300006163 Ga0070715_10330699 Ga0070715_103306991 177
1576 3300006173 Ga0070716_100272909 Ga0070716_1002729092 177
1577 3300006173 Ga0070716_100470612 Ga0070716_1004706121 177
1578 3300006173 Ga0070716_100473025 Ga0070716_1004730252 177
1579 3300006175 Ga0070712_100025062 Ga0070712_1000250627 177
1580 3300006175 Ga0070712_100056366 Ga0070712_1000563663 177
1581 3300006175 Ga0070712_100060765 Ga0070712_1000607653 177
1582 3300006177 Ga0075362_10079775 Ga0075362_100797752 177
1583 3300006177 Ga0075362_10110162 Ga0075362_101101622 177
1584 3300006177 Ga0075362_10153066 Ga0075362_101530661 177
1585 3300006178 Ga0075367_10033189 Ga0075367_100331896 177
1586 3300006178 Ga0075367_10037524 Ga0075367_100375242 177
1587 3300006178 Ga0075367_10054062 Ga0075367_100540625 177
1588 3300006178 Ga0075367_10065439 Ga0075367_100654394 177
1589 3300006178 Ga0075367_10308575 Ga0075367_103085752 177
1590 3300006178 Ga0075367_10586198 Ga0075367_105861981 177
1591 3300006178 Ga0075367_10691774 Ga0075367_106917741 177
1592 3300006186 Ga0075369_10014487 Ga0075369_100144874 177
1593 3300006186 Ga0075369_10020381 Ga0075369_100203812 177
1594 3300006186 Ga0075369_10037612 Ga0075369_100376124 177
1595 3300006186 Ga0075369_10375803 Ga0075369_103758032 177
1596 3300006195 Ga0075366_10131212 Ga0075366_101312123 177
1597 3300006195 Ga0075366_10138136 Ga0075366_101381363 177
1598 3300006195 Ga0075366_10174089 Ga0075366_101740893 177
1599 3300006195 Ga0075366_10355545 Ga0075366_103555452 177
1600 3300006237 Ga0097621_100292431 Ga0097621_1002924313 177
1601 3300006237 Ga0097621_101368845 Ga0097621_1013688451 177
1602 3300006353 Ga0075370_10039567 Ga0075370_100395676 177
1603 3300006353 Ga0075370_10062119 Ga0075370_100621193 177
1604 3300006353 Ga0075370_10122384 Ga0075370_101223842 177
1605 3300006353 Ga0075370_10161654 Ga0075370_101616543 177
1606 3300006353 Ga0075370_10179770 Ga0075370_101797702 177
1607 3300006353 Ga0075370_10187626 Ga0075370_101876261 177
1608 3300006353 Ga0075370_10347804 Ga0075370_103478042 177
1609 3300006353 Ga0075370_10367753 Ga0075370_103677531 177
1610 3300006353 Ga0075370_10371994 Ga0075370_103719942 177
1611 3300006353 Ga0075370_10705560 Ga0075370_107055601 177
1612 3300006358 Ga0068871_100308486 Ga0068871_1003084862 177
1613 3300006358 Ga0068871_100474415 Ga0068871_1004744153 177
1614 3300006844 Ga0075428_101573100 Ga0075428_1015731001 177
1615 3300006846 Ga0075430_100224662 Ga0075430_1002246623 177
1616 3300006881 Ga0068865_101156479 Ga0068865_1011564791 177
1617 3300006931 Ga0097620_100087577 Ga0097620_1000875776 177
1618 3300006931 Ga0097620_101045554 Ga0097620_1010455542 177
1619 3300006942 Ga0099824_1018607 Ga0099824_10186074 177
1620 3300006942 Ga0099824_1032925 Ga0099824_10329253 177
1621 3300006943 Ga0099822_1005414 Ga0099822_100541423 177
1622 3300006946 Ga0079104_1000547 Ga0079104_100054739 177
1623 3300006946 Ga0079104_1065570 Ga0079104_10655702 177
1624 3300006946 Ga0079104_1065575 Ga0079104_10655751 177
1625 3300007076 Ga0075435_100092843 Ga0075435_1000928432 177
1626 3300007076 Ga0075435_100655224 Ga0075435_1006552241 177
1627 3300007265 Ga0099794_10106923 Ga0099794_101069232 177
1628 3300007265 Ga0099794_10477110 Ga0099794_104771101 177
1629 3300007265 Ga0099794_10550597 Ga0099794_105505971 177
1630 3300007265 Ga0099794_10556276 Ga0099794_105562761 177
1631 3300007788 Ga0099795_10055043 Ga0099795_100550433 177
1632 3300007788 Ga0099795_10060930 Ga0099795_100609302 177
1633 3300009036 Ga0105244_10078483 Ga0105244_100784833 177
1634 3300009092 Ga0105250_10074943 Ga0105250_100749431 177
1635 3300009092 Ga0105250_10164015 Ga0105250_101640152 177
1636 3300009093 Ga0105240_10000005 Ga0105240_1000000518 177
1637 3300009093 Ga0105240_10015249 Ga0105240_1001524910 177
1638 3300009093 Ga0105240_10349884 Ga0105240_103498842 177
1639 3300009093 Ga0105240_10398679 Ga0105240_103986793 177
1640 3300009093 Ga0105240_10501863 Ga0105240_105018632 177
1641 3300009093 Ga0105240_10788852 Ga0105240_107888521 177
1642 3300009093 Ga0105240_11016121 Ga0105240_110161212 177
1643 3300009093 Ga0105240_12181467 Ga0105240_121814671 177
1644 3300009094 Ga0111539_11432011 Ga0111539_114320112 177
1645 3300009098 Ga0105245_10811286 Ga0105245_108112862 177
1646 3300009101 Ga0105247_10042031 Ga0105247_100420312 177
1647 3300009101 Ga0105247_10158943 Ga0105247_101589431 177
1648 3300009101 Ga0105247_10641537 Ga0105247_106415371 177
1649 3300009148 Ga0105243_10336891 Ga0105243_103368912 177
1650 3300009148 Ga0105243_10571340 Ga0105243_105713402 177
1651 3300009174 Ga0105241_10145737 Ga0105241_101457373 177
1652 3300009174 Ga0105241_10251998 Ga0105241_102519982 177
1653 3300009174 Ga0105241_10421547 Ga0105241_104215471 177
1654 3300009174 Ga0105241_10721348 Ga0105241_107213482 177
1655 3300009176 Ga0105242_10350072 Ga0105242_103500723 177
1656 3300009176 Ga0105242_10376779 Ga0105242_103767793 177
1657 3300009177 Ga0105248_10284816 Ga0105248_102848163 177
1658 3300009545 Ga0105237_10001070 Ga0105237_1000107034 177
1659 3300009545 Ga0105237_10054286 Ga0105237_100542862 177
1660 3300009545 Ga0105237_10219809 Ga0105237_102198093 177
1661 3300009545 Ga0105237_10745415 Ga0105237_107454152 177
1662 3300009545 Ga0105237_10896931 Ga0105237_108969311 177
1663 3300009545 Ga0105237_11112702 Ga0105237_111127022 177
1664 3300009545 Ga0105237_11633537 Ga0105237_116335371 177
1665 3300009551 Ga0105238_10012597 Ga0105238_1001259714 177
1666 3300009551 Ga0105238_10026677 Ga0105238_100266776 177
1667 3300009551 Ga0105238_10144804 Ga0105238_101448044 177
1668 3300009551 Ga0105238_11115291 Ga0105238_111152912 177
1669 3300009551 Ga0105238_11215300 Ga0105238_112153001 177
1670 3300009553 Ga0105249_10147904 Ga0105249_101479042 177
1671 3300009553 Ga0105249_10154860 Ga0105249_101548603 177
1672 3300009553 Ga0105249_10357884 Ga0105249_103578843 177
1673 3300009553 Ga0105249_10406344 Ga0105249_104063443 177
1674 3300009553 Ga0105249_11188666 Ga0105249_111886661 177
1675 3300009763 Ga0123340_1058714 Ga0123340_10587142 177
1676 3300009765 Ga0123341_1005490 Ga0123341_100549010 177
1677 3300009765 Ga0123341_1017290 Ga0123341_10172903 177
1678 3300009766 Ga0123342_1018253 Ga0123342_10182539 177
1679 3300009766 Ga0123342_1019698 Ga0123342_10196988 177
1680 3300010375 Ga0105239_10008784 Ga0105239_100087846 177
1681 3300010375 Ga0105239_10501837 Ga0105239_105018371 177
1682 3300010375 Ga0105239_10530800 Ga0105239_105308002 177
1683 3300010375 Ga0105239_10687690 Ga0105239_106876903 177
1684 3300010375 Ga0105239_10707819 Ga0105239_107078192 177
1685 3300010375 Ga0105239_11224442 Ga0105239_112244422 177
1686 3300010375 Ga0105239_11811102 Ga0105239_118111022 177
1687 3300011119 Ga0105246_10278490 Ga0105246_102784903 177
1688 3300012490 Ga0157322_1011849 Ga0157322_10118492 177
1689 3300012494 Ga0157341_1003500 Ga0157341_10035002 177
1690 3300012513 Ga0157326_1004470 Ga0157326_10044703 177
1691 3300013100 Ga0157373_10011316 Ga0157373_1001131610 177
1692 3300013100 Ga0157373_10235722 Ga0157373_102357222 177
1693 3300013102 Ga0157371_10221421 Ga0157371_102214212 177
1694 3300013102 Ga0157371_10269063 Ga0157371_102690633 177
1695 3300013104 Ga0157370_10235560 Ga0157370_102355602 177
1696 3300013104 Ga0157370_10280834 Ga0157370_102808342 177
1697 3300013105 Ga0157369_10030062 Ga0157369_100300623 177
1698 3300013105 Ga0157369_10066010 Ga0157369_100660106 177
1699 3300013105 Ga0157369_10592128 Ga0157369_105921282 177
1700 3300013306 Ga0163162_10601306 Ga0163162_106013061 177
1701 3300013306 Ga0163162_11570527 Ga0163162_115705272 177
1702 3300013307 Ga0157372_10252779 Ga0157372_102527793 177
1703 3300013307 Ga0157372_11662276 Ga0157372_116622762 177
1704 3300013308 Ga0157375_10809287 Ga0157375_108092871 177
1705 3300014325 Ga0163163_10283279 Ga0163163_102832792 177
1706 3300014325 Ga0163163_12127994 Ga0163163_121279941 177
1707 3300014325 Ga0163163_12210041 Ga0163163_122100411 177
1708 3300014326 Ga0157380_10906414 Ga0157380_109064141 177
1709 3300014968 Ga0157379_10555742 Ga0157379_105557422 177
1710 3300014968 Ga0157379_10845111 Ga0157379_108451112 177
1711 3300014968 Ga0157379_11039853 Ga0157379_110398531 177
1712 3300014968 Ga0157379_11435066 Ga0157379_114350662 177
1713 3300014969 Ga0157376_10329717 Ga0157376_103297173 177
1714 3300014969 Ga0157376_10360807 Ga0157376_103608072 177
1715 3300015262 Ga0182007_10070537 Ga0182007_100705372 177
1716 3300015265 Ga0182005_1065239 Ga0182005_10652392 177
1717 3300017792 Ga0163161_11005207 Ga0163161_110052072 177
1718 3300017792 Ga0163161_11196992 Ga0163161_111969921 177
1719 3300021320 Ga0214544_1002211 Ga0214544_100221137 177
1720 3300021321 Ga0214542_1002553 Ga0214542_100255337 177
1721 3300021321 Ga0214542_1023288 Ga0214542_10232883 177
1722 3300021327 Ga0214543_1000032 Ga0214543_1000032172 177
1723 3300021327 Ga0214543_1005345 Ga0214543_100534514 177
1724 3300021377 Ga0213874_10007273 Ga0213874_100072735 177
1725 3300021384 Ga0213876_10076608 Ga0213876_100766082 177
1726 3300021388 Ga0213875_10069901 Ga0213875_100699012 177
1727 3300021388 Ga0213875_10173625 Ga0213875_101736252 177
1728 3300021441 Ga0213871_10039050 Ga0213871_100390503 177
1729 3300022739 Ga0228711_1000015 Ga0228711_100001524 177
1730 3300022740 Ga0228710_1000015 Ga0228710_1000015124 177
1731 3300025206 Ga0209435_100024 Ga0209435_100024200 177
1732 3300025208 Ga0209436_100747 Ga0209436_10074714 177
1733 3300025208 Ga0209436_102829 Ga0209436_1028295 177
1734 3300025208 Ga0209436_113709 Ga0209436_1137093 177
1735 3300025230 Ga0209563_105579 Ga0209563_1055793 177
1736 3300025231 Ga0207427_104571 Ga0207427_1045714 177
1737 3300025233 Ga0209437_100969 Ga0209437_10096912 177
1738 3300025233 Ga0209437_100970 Ga0209437_10097012 177
1739 3300025245 Ga0207425_1000010 Ga0207425_10000102 177
1740 3300025245 Ga0207425_1010336 Ga0207425_10103362 177
1741 3300025245 Ga0207425_1027304 Ga0207425_10273042 177
1742 3300025245 Ga0207425_1028939 Ga0207425_10289391 177
1743 3300025245 Ga0207425_1059856 Ga0207425_10598561 177
1744 3300025245 Ga0207425_1063179 Ga0207425_10631791 177
1745 3300025246 Ga0209646_1000064 Ga0209646_1000064200 177
1746 3300025246 Ga0209646_1008880 Ga0209646_10088801 177
1747 3300025250 Ga0209026_1000002 Ga0209026_1000002480 177
1748 3300025250 Ga0209026_1000053 Ga0209026_1000053200 177
1749 3300025253 Ga0209677_102830 Ga0209677_1028307 177
1750 3300025254 Ga0209148_1000038 Ga0209148_100003869 177
1751 3300025254 Ga0209148_1018493 Ga0209148_10184932 177
1752 3300025256 Ga0209759_1000042 Ga0209759_1000042200 177
1753 3300025256 Ga0209759_1000119 Ga0209759_100011918 177
1754 3300025258 Ga0209129_1003311 Ga0209129_10033118 177
1755 3300025258 Ga0209129_1003860 Ga0209129_100386010 177
1756 3300025258 Ga0209129_1004622 Ga0209129_10046228 177
1757 3300025258 Ga0209129_1009973 Ga0209129_10099735 177
1758 3300025258 Ga0209129_1013981 Ga0209129_10139813 177
1759 3300025258 Ga0209129_1021010 Ga0209129_10210102 177
1760 3300025258 Ga0209129_1035221 Ga0209129_10352212 177
1761 3300025261 Ga0209233_1000188 Ga0209233_100018842 177
1762 3300025261 Ga0209233_1003053 Ga0209233_10030536 177
1763 3300025261 Ga0209233_1006179 Ga0209233_10061797 177
1764 3300025261 Ga0209233_1007083 Ga0209233_10070834 177
1765 3300025261 Ga0209233_1011270 Ga0209233_10112706 177
1766 3300025261 Ga0209233_1013455 Ga0209233_10134553 177
1767 3300025261 Ga0209233_1050210 Ga0209233_10502101 177
1768 3300025263 Ga0209565_1019241 Ga0209565_10192413 177
1769 3300025263 Ga0209565_1021440 Ga0209565_10214403 177
1770 3300025271 Ga0207666_1004017 Ga0207666_10040172 177
1771 3300025272 Ga0209455_1000204 Ga0209455_100020418 177
1772 3300025273 Ga0209673_1000825 Ga0209673_100082518 177
1773 3300025273 Ga0209673_1000864 Ga0209673_100086435 177
1774 3300025273 Ga0209673_1001977 Ga0209673_100197717 177
1775 3300025273 Ga0209673_1012038 Ga0209673_10120385 177
1776 3300025273 Ga0209673_1014347 Ga0209673_10143475 177
1777 3300025273 Ga0209673_1029006 Ga0209673_10290062 177
1778 3300025284 Ga0209130_1000006 Ga0209130_1000006283 177
1779 3300025284 Ga0209130_1000007 Ga0209130_1000007337 177
1780 3300025284 Ga0209130_1001130 Ga0209130_100113017 177
1781 3300025284 Ga0209130_1021190 Ga0209130_10211903 177
1782 3300025284 Ga0209130_1022665 Ga0209130_10226653 177
1783 3300025290 Ga0207673_1001859 Ga0207673_10018593 177
1784 3300025292 Ga0209676_1001545 Ga0209676_100154515 177
1785 3300025292 Ga0209676_1002955 Ga0209676_10029556 177
1786 3300025292 Ga0209676_1029437 Ga0209676_10294374 177
1787 3300025294 Ga0209025_1000022 Ga0209025_1000022580 177
1788 3300025294 Ga0209025_1000303 Ga0209025_100030310 177
1789 3300025294 Ga0209025_1018223 Ga0209025_10182236 177
1790 3300025294 Ga0209025_1035969 Ga0209025_10359694 177
1791 3300025294 Ga0209025_1076174 Ga0209025_10761742 177
1792 3300025294 Ga0209025_1108888 Ga0209025_11088882 177
1793 3300025294 Ga0209025_1114335 Ga0209025_11143352 177
1794 3300025294 Ga0209025_1158082 Ga0209025_11580821 177
1795 3300025295 Ga0209564_1000140 Ga0209564_1000140161 177
1796 3300025295 Ga0209564_1002708 Ga0209564_10027089 177
1797 3300025295 Ga0209564_1006724 Ga0209564_10067246 177
1798 3300025295 Ga0209564_1028708 Ga0209564_10287082 177
1799 3300025295 Ga0209564_1028709 Ga0209564_10287092 177
1800 3300025295 Ga0209564_1038119 Ga0209564_10381193 177
1801 3300025295 Ga0209564_1044462 Ga0209564_10444622 177
1802 3300025295 Ga0209564_1059134 Ga0209564_10591342 177
1803 3300025295 Ga0209564_1060915 Ga0209564_10609152 177
1804 3300025297 Ga0209758_1000584 Ga0209758_10005842 177
1805 3300025297 Ga0209758_1005081 Ga0209758_10050814 177
1806 3300025297 Ga0209758_1006057 Ga0209758_10060579 177
1807 3300025297 Ga0209758_1007716 Ga0209758_10077163 177
1808 3300025297 Ga0209758_1007810 Ga0209758_10078103 177
1809 3300025297 Ga0209758_1067228 Ga0209758_10672283 177
1810 3300025297 Ga0209758_1094800 Ga0209758_10948002 177
1811 3300025297 Ga0209758_1101405 Ga0209758_11014051 177
1812 3300025297 Ga0209758_1103555 Ga0209758_11035552 177
1813 3300025297 Ga0209758_1111129 Ga0209758_11111291 177
1814 3300025298 Ga0209050_1002103 Ga0209050_100210318 177
1815 3300025298 Ga0209050_1003219 Ga0209050_100321918 177
1816 3300025299 Ga0209256_1002683 Ga0209256_100268310 177
1817 3300025299 Ga0209256_1004555 Ga0209256_100455518 177
1818 3300025299 Ga0209256_1005314 Ga0209256_10053143 177
1819 3300025299 Ga0209256_1015662 Ga0209256_10156622 177
1820 3300025299 Ga0209256_1026985 Ga0209256_10269853 177
1821 3300025299 Ga0209256_1044054 Ga0209256_10440542 177
1822 3300025299 Ga0209256_1074909 Ga0209256_10749091 177
1823 3300025302 Ga0207426_1000003 Ga0207426_10000031144 177
1824 3300025302 Ga0207426_1000044 Ga0207426_1000044406 177
1825 3300025302 Ga0207426_1000064 Ga0207426_1000064337 177
1826 3300025302 Ga0207426_1003449 Ga0207426_100344910 177
1827 3300025302 Ga0207426_1004394 Ga0207426_100439410 177
1828 3300025302 Ga0207426_1033419 Ga0207426_10334192 177
1829 3300025303 Ga0209051_1000914 Ga0209051_100091429 177
1830 3300025303 Ga0209051_1002149 Ga0209051_100214918 177
1831 3300025303 Ga0209051_1049570 Ga0209051_10495703 177
1832 3300025303 Ga0209051_1058167 Ga0209051_10581673 177
1833 3300025303 Ga0209051_1092745 Ga0209051_10927452 177
1834 3300025303 Ga0209051_1100821 Ga0209051_11008212 177
1835 3300025303 Ga0209051_1101244 Ga0209051_11012442 177
1836 3300025304 Ga0209257_1000817 Ga0209257_100081715 177
1837 3300025304 Ga0209257_1002507 Ga0209257_100250715 177
1838 3300025304 Ga0209257_1014551 Ga0209257_10145512 177
1839 3300025304 Ga0209257_1081649 Ga0209257_10816492 177
1840 3300025304 Ga0209257_1087031 Ga0209257_10870312 177
1841 3300025315 Ga0207697_10183153 Ga0207697_101831531 177
1842 3300025321 Ga0207656_10169352 Ga0207656_101693522 177
1843 3300025711 Ga0207696_1059111 Ga0207696_10591112 177
1844 3300025711 Ga0207696_1066851 Ga0207696_10668512 177
1845 3300025885 Ga0207653_10002069 Ga0207653_1000206913 177
1846 3300025893 Ga0207682_10188622 Ga0207682_101886221 177
1847 3300025898 Ga0207692_10143795 Ga0207692_101437952 177
1848 3300025898 Ga0207692_10182104 Ga0207692_101821042 177
1849 3300025898 Ga0207692_10251460 Ga0207692_102514602 177
1850 3300025899 Ga0207642_10153786 Ga0207642_101537863 177
1851 3300025900 Ga0207710_10066137 Ga0207710_100661374 177
1852 3300025900 Ga0207710_10118810 Ga0207710_101188103 177
1853 3300025901 Ga0207688_10036755 Ga0207688_100367554 177
1854 3300025901 Ga0207688_10170052 Ga0207688_101700523 177
1855 3300025903 Ga0207680_10268268 Ga0207680_102682683 177
1856 3300025903 Ga0207680_10269652 Ga0207680_102696522 177
1857 3300025903 Ga0207680_10678482 Ga0207680_106784822 177
1858 3300025904 Ga0207647_10020923 Ga0207647_100209234 177
1859 3300025904 Ga0207647_10123459 Ga0207647_101234593 177
1860 3300025904 Ga0207647_10167943 Ga0207647_101679431 177
1861 3300025905 Ga0207685_10075648 Ga0207685_100756482 177
1862 3300025906 Ga0207699_10048434 Ga0207699_100484342 177
1863 3300025906 Ga0207699_10747762 Ga0207699_107477622 177
1864 3300025907 Ga0207645_10216210 Ga0207645_102162102 177
1865 3300025907 Ga0207645_10345962 Ga0207645_103459622 177
1866 3300025908 Ga0207643_10012061 Ga0207643_100120613 177
1867 3300025909 Ga0207705_10424032 Ga0207705_104240321 177
1868 3300025911 Ga0207654_10111792 Ga0207654_101117922 177
1869 3300025911 Ga0207654_10162516 Ga0207654_101625163 177
1870 3300025911 Ga0207654_10243499 Ga0207654_102434992 177
1871 3300025912 Ga0207707_10091218 Ga0207707_100912185 177
1872 3300025912 Ga0207707_10110359 Ga0207707_101103595 177
1873 3300025913 Ga0207695_10000011 Ga0207695_10000011896 177
1874 3300025913 Ga0207695_10000599 Ga0207695_1000059977 177
1875 3300025913 Ga0207695_10185740 Ga0207695_101857403 177
1876 3300025913 Ga0207695_10347578 Ga0207695_103475782 177
1877 3300025913 Ga0207695_10602979 Ga0207695_106029792 177
1878 3300025913 Ga0207695_10916655 Ga0207695_109166551 177
1879 3300025914 Ga0207671_10001852 Ga0207671_1000185221 177
1880 3300025914 Ga0207671_10041691 Ga0207671_100416913 177
1881 3300025914 Ga0207671_10074646 Ga0207671_100746464 177
1882 3300025914 Ga0207671_10137222 Ga0207671_101372223 177
1883 3300025914 Ga0207671_10169506 Ga0207671_101695063 177
1884 3300025914 Ga0207671_10262894 Ga0207671_102628942 177
1885 3300025915 Ga0207693_10001926 Ga0207693_1000192611 177
1886 3300025915 Ga0207693_10022819 Ga0207693_1002281910 177
1887 3300025915 Ga0207693_10896374 Ga0207693_108963742 177
1888 3300025916 Ga0207663_10000218 Ga0207663_1000021822 177
1889 3300025916 Ga0207663_10278254 Ga0207663_102782542 177
1890 3300025916 Ga0207663_10633030 Ga0207663_106330302 177
1891 3300025917 Ga0207660_10125797 Ga0207660_101257974 177
1892 3300025917 Ga0207660_10196644 Ga0207660_101966442 177
1893 3300025917 Ga0207660_10719386 Ga0207660_107193861 177
1894 3300025917 Ga0207660_10980937 Ga0207660_109809371 177
1895 3300025918 Ga0207662_10029232 Ga0207662_100292326 177
1896 3300025919 Ga0207657_10011937 Ga0207657_100119372 177
1897 3300025919 Ga0207657_10042894 Ga0207657_100428942 177
1898 3300025919 Ga0207657_10184754 Ga0207657_101847542 177
1899 3300025920 Ga0207649_10278021 Ga0207649_102780212 177
1900 3300025920 Ga0207649_10295983 Ga0207649_102959832 177
1901 3300025920 Ga0207649_10745714 Ga0207649_107457142 177
1902 3300025921 Ga0207652_10014975 Ga0207652_100149759 177
1903 3300025921 Ga0207652_10051466 Ga0207652_100514662 177
1904 3300025921 Ga0207652_10178552 Ga0207652_101785522 177
1905 3300025921 Ga0207652_10247386 Ga0207652_102473862 177
1906 3300025922 Ga0207646_10024544 Ga0207646_100245443 177
1907 3300025923 Ga0207681_10583279 Ga0207681_105832792 177
1908 3300025923 Ga0207681_10624399 Ga0207681_106243992 177
1909 3300025924 Ga0207694_10017395 Ga0207694_100173958 177
1910 3300025924 Ga0207694_10058951 Ga0207694_100589516 177
1911 3300025924 Ga0207694_10577698 Ga0207694_105776981 177
1912 3300025924 Ga0207694_10581697 Ga0207694_105816972 177
1913 3300025924 Ga0207694_10582934 Ga0207694_105829342 177
1914 3300025925 Ga0207650_10002132 Ga0207650_1000213213 177
1915 3300025927 Ga0207687_10174946 Ga0207687_101749462 177
1916 3300025927 Ga0207687_10312348 Ga0207687_103123482 177
1917 3300025928 Ga0207700_10028497 Ga0207700_100284976 177
1918 3300025928 Ga0207700_10162421 Ga0207700_101624213 177
1919 3300025929 Ga0207664_10008551 Ga0207664_100085511 177
1920 3300025929 Ga0207664_10019269 Ga0207664_100192697 177
1921 3300025929 Ga0207664_10842846 Ga0207664_108428461 177
1922 3300025931 Ga0207644_10052527 Ga0207644_100525273 177
1923 3300025931 Ga0207644_10362620 Ga0207644_103626201 177
1924 3300025931 Ga0207644_10588068 Ga0207644_105880681 177
1925 3300025933 Ga0207706_10017336 Ga0207706_100173361 177
1926 3300025933 Ga0207706_10024819 Ga0207706_100248195 177
1927 3300025933 Ga0207706_10177321 Ga0207706_101773212 177
1928 3300025933 Ga0207706_10691664 Ga0207706_106916641 177
1929 3300025935 Ga0207709_10125723 Ga0207709_101257233 177
1930 3300025935 Ga0207709_10479660 Ga0207709_104796602 177
1931 3300025936 Ga0207670_10765472 Ga0207670_107654721 177
1932 3300025936 Ga0207670_10838880 Ga0207670_108388801 177
1933 3300025937 Ga0207669_10129274 Ga0207669_101292742 177
1934 3300025937 Ga0207669_10148688 Ga0207669_101486881 177
1935 3300025937 Ga0207669_10977420 Ga0207669_109774201 177
1936 3300025939 Ga0207665_10005572 Ga0207665_100055726 177
1937 3300025939 Ga0207665_10096951 Ga0207665_100969512 177
1938 3300025939 Ga0207665_10626583 Ga0207665_106265832 177
1939 3300025939 Ga0207665_10896494 Ga0207665_108964941 177
1940 3300025939 Ga0207665_10998136 Ga0207665_109981362 177
1941 3300025940 Ga0207691_10213024 Ga0207691_102130241 177
1942 3300025940 Ga0207691_10676163 Ga0207691_106761632 177
1943 3300025940 Ga0207691_10815269 Ga0207691_108152691 177
1944 3300025941 Ga0207711_10724750 Ga0207711_107247502 177
1945 3300025944 Ga0207661_10202043 Ga0207661_102020433 177
1946 3300025949 Ga0207667_10012912 Ga0207667_100129125 177
1947 3300025949 Ga0207667_10708426 Ga0207667_107084262 177
1948 3300025949 Ga0207667_11025820 Ga0207667_110258201 177
1949 3300025949 Ga0207667_11056972 Ga0207667_110569722 177
1950 3300025961 Ga0207712_10265973 Ga0207712_102659733 177
1951 3300025961 Ga0207712_10377846 Ga0207712_103778462 177
1952 3300025961 Ga0207712_10439966 Ga0207712_104399661 177
1953 3300025961 Ga0207712_10563146 Ga0207712_105631461 177
1954 3300025961 Ga0207712_10836207 Ga0207712_108362072 177
1955 3300025961 Ga0207712_11447523 Ga0207712_114475231 177
1956 3300025972 Ga0207668_10034259 Ga0207668_100342592 177
1957 3300025972 Ga0207668_10115150 Ga0207668_101151503 177
1958 3300025972 Ga0207668_10335973 Ga0207668_103359732 177
1959 3300025981 Ga0207640_10095376 Ga0207640_100953762 177
1960 3300025981 Ga0207640_10290151 Ga0207640_102901513 177
1961 3300025981 Ga0207640_10576471 Ga0207640_105764712 177
1962 3300025986 Ga0207658_10537705 Ga0207658_105377052 177
1963 3300026023 Ga0207677_11066392 Ga0207677_110663922 177
1964 3300026023 Ga0207677_11403137 Ga0207677_114031371 177
1965 3300026035 Ga0207703_10082720 Ga0207703_100827205 177
1966 3300026035 Ga0207703_10215009 Ga0207703_102150092 177
1967 3300026035 Ga0207703_10437335 Ga0207703_104373352 177
1968 3300026035 Ga0207703_10568359 Ga0207703_105683592 177
1969 3300026035 Ga0207703_10735320 Ga0207703_107353202 177
1970 3300026041 Ga0207639_10032054 Ga0207639_100320546 177
1971 3300026041 Ga0207639_10060119 Ga0207639_100601193 177
1972 3300026041 Ga0207639_10226993 Ga0207639_102269931 177
1973 3300026067 Ga0207678_10014673 Ga0207678_100146736 177
1974 3300026067 Ga0207678_10105086 Ga0207678_101050866 177
1975 3300026067 Ga0207678_10116776 Ga0207678_101167763 177
1976 3300026067 Ga0207678_10931100 Ga0207678_109311002 177
1977 3300026075 Ga0207708_10809324 Ga0207708_108093241 177
1978 3300026078 Ga0207702_10417925 Ga0207702_104179252 177
1979 3300026078 Ga0207702_10498187 Ga0207702_104981872 177
1980 3300026078 Ga0207702_11162490 Ga0207702_111624901 177
1981 3300026088 Ga0207641_10040588 Ga0207641_100405885 177
1982 3300026088 Ga0207641_10591440 Ga0207641_105914403 177
1983 3300026088 Ga0207641_10889212 Ga0207641_108892122 177
1984 3300026089 Ga0207648_10011030 Ga0207648_100110301 177
1985 3300026095 Ga0207676_10568268 Ga0207676_105682681 177
1986 3300026095 Ga0207676_11301193 Ga0207676_113011931 177
1987 3300026116 Ga0207674_10068821 Ga0207674_100688214 177
1988 3300026116 Ga0207674_10188280 Ga0207674_101882802 177
1989 3300026118 Ga0207675_100040050 Ga0207675_10004005010 177
1990 3300026118 Ga0207675_100604527 Ga0207675_1006045273 177
1991 3300026121 Ga0207683_10053025 Ga0207683_100530256 177
1992 3300026142 Ga0207698_10583192 Ga0207698_105831922 177
1993 3300026142 Ga0207698_11598754 Ga0207698_115987542 177
1994 3300027111 Ga0209281_1000573 Ga0209281_100057319 177
1995 3300027111 Ga0209281_1001498 Ga0209281_100149810 177
1996 3300027296 Ga0209389_1002002 Ga0209389_100200210 177
1997 3300027312 Ga0209371_1002385 Ga0209371_100238519 177
1998 3300027312 Ga0209371_1058949 Ga0209371_10589491 177
1999 3300027357 Ga0209589_1000009 Ga0209589_100000922 177
2000 3300027357 Ga0209589_1000300 Ga0209589_100030034 177
2001 3300027361 Ga0209489_100010 Ga0209489_100010249 177
2002 3300027363 Ga0209700_100017 Ga0209700_100017249 177
2003 3300027512 Ga0209179_1017049 Ga0209179_10170491 177
2004 3300027512 Ga0209179_1059062 Ga0209179_10590622 177
2005 3300027666 Ga0209282_1000054 Ga0209282_1000054109 177
2006 3300027866 Ga0209813_10036049 Ga0209813_100360493 177
2007 3300027866 Ga0209813_10049896 Ga0209813_100498962 177
2008 3300027866 Ga0209813_10153312 Ga0209813_101533122 177
2009 3300027866 Ga0209813_10227598 Ga0209813_102275981 177
2010 3300027876 Ga0209974_10092975 Ga0209974_100929752 177
2011 3300027876 Ga0209974_10123372 Ga0209974_101233722 177
2012 3300028379 Ga0268266_10012436 Ga0268266_100124367 177
2013 3300028379 Ga0268266_10014157 Ga0268266_100141579 177
2014 3300028379 Ga0268266_10020829 Ga0268266_100208292 177
2015 3300028379 Ga0268266_10073688 Ga0268266_100736883 177
2016 3300028379 Ga0268266_10163131 Ga0268266_101631313 177
2017 3300028379 Ga0268266_10247200 Ga0268266_102472001 177
2018 3300028379 Ga0268266_10532816 Ga0268266_105328162 177
2019 3300028379 Ga0268266_10790242 Ga0268266_107902422 177
2020 3300028379 Ga0268266_11139255 Ga0268266_111392551 177
2021 3300028379 Ga0268266_11248062 Ga0268266_112480622 177
2022 3300028380 Ga0268265_10198713 Ga0268265_101987133 177
2023 3300028380 Ga0268265_10366074 Ga0268265_103660742 177
2024 3300028381 Ga0268264_10000655 Ga0268264_1000065510 177
2025 3300028558 Ga0265326_10001795 Ga0265326_1000179512 177
2026 3300028563 Ga0265319_1001825 Ga0265319_100182518 177
2027 3300028573 Ga0265334_10000469 Ga0265334_100004697 177
2028 3300028577 Ga0265318_10007417 Ga0265318_100074177 177
2029 3300028653 Ga0265323_10001237 Ga0265323_1000123719 177
2030 3300028666 Ga0265336_10000535 Ga0265336_1000053512 177
2031 3300028786 Ga0307517_10000125 Ga0307517_1000012512 177
2032 3300028794 Ga0307515_10001393 Ga0307515_1000139357 177
2033 3300028794 Ga0307515_10040194 Ga0307515_1004019411 177
2034 3300028794 Ga0307515_10065844 Ga0307515_100658442 177
2035 3300028794 Ga0307515_10100071 Ga0307515_101000714 177
2036 3300028794 Ga0307515_10182119 Ga0307515_101821193 177
2037 3300028794 Ga0307515_10398804 Ga0307515_103988042 177
2038 3300028800 Ga0265338_10000131 Ga0265338_1000013198 177
2039 3300028800 Ga0265338_10168673 Ga0265338_101686732 177
2040 3300029277 Ga0311001_1103890 Ga0311001_11038903 177
2041 3300029285 Ga0310981_1004097 Ga0310981_10040973 177
2042 3300029957 Ga0265324_10001269 Ga0265324_1000126922 177
2043 3300030500 Ga0268256_1002127 Ga0268256_100212719 177
2044 3300030500 Ga0268256_1072371 Ga0268256_10723711 177
2045 3300030521 Ga0307511_10071057 Ga0307511_100710573 177
2046 3300031235 Ga0265330_10313325 Ga0265330_103133251 177
2047 3300031238 Ga0265332_10026568 Ga0265332_100265682 177
2048 3300031241 Ga0265325_10057917 Ga0265325_100579172 177
2049 3300031249 Ga0265339_10030677 Ga0265339_100306775 177
2050 3300031344 Ga0265316_10148533 Ga0265316_101485333 177
2051 3300031344 Ga0265316_10187162 Ga0265316_101871622 177
2052 3300031456 Ga0307513_10005182 Ga0307513_1000518217 177
2053 3300031456 Ga0307513_10143103 Ga0307513_101431032 177
2054 3300031456 Ga0307513_10304695 Ga0307513_103046952 177
2055 3300031456 Ga0307513_10327399 Ga0307513_103273991 177
2056 3300031456 Ga0307513_10580817 Ga0307513_105808172 177
2057 3300031507 Ga0307509_10041031 Ga0307509_100410316 177
2058 3300031507 Ga0307509_10353192 Ga0307509_103531922 177
2059 3300031548 Ga0307408_100012729 Ga0307408_10001272912 177
2060 3300031548 Ga0307408_100016332 Ga0307408_1000163323 177
2061 3300031548 Ga0307408_100027626 Ga0307408_1000276264 177
2062 3300031548 Ga0307408_100038322 Ga0307408_1000383226 177
2063 3300031548 Ga0307408_100776864 Ga0307408_1007768642 177
2064 3300031595 Ga0265313_10003614 Ga0265313_1000361418 177
2065 3300031616 Ga0307508_10000378 Ga0307508_1000037834 177
2066 3300031616 Ga0307508_10044639 Ga0307508_100446396 177
2067 3300031616 Ga0307508_10096553 Ga0307508_100965535 177
2068 3300031616 Ga0307508_10117010 Ga0307508_101170103 177
2069 3300031616 Ga0307508_10189157 Ga0307508_101891574 177
2070 3300031616 Ga0307508_10326929 Ga0307508_103269292 177
2071 3300031665 Ga0316575_10144645 Ga0316575_101446451 177
2072 3300031711 Ga0265314_10017878 Ga0265314_100178787 177
2073 3300031712 Ga0265342_10020769 Ga0265342_100207696 177
2074 3300031730 Ga0307516_10114735 Ga0307516_101147353 177
2075 3300031730 Ga0307516_10174401 Ga0307516_101744012 177
2076 3300031730 Ga0307516_10207509 Ga0307516_102075093 177
2077 3300031731 Ga0307405_10050000 Ga0307405_100500002 177
2078 3300031731 Ga0307405_10083046 Ga0307405_100830464 177
2079 3300031731 Ga0307405_10113053 Ga0307405_101130533 177
2080 3300031731 Ga0307405_10192671 Ga0307405_101926712 177
2081 3300031731 Ga0307405_10199654 Ga0307405_101996543 177
2082 3300031731 Ga0307405_10381714 Ga0307405_103817142 177
2083 3300031824 Ga0307413_10126131 Ga0307413_101261312 177
2084 3300031824 Ga0307413_10253244 Ga0307413_102532442 177
2085 3300031852 Ga0307410_10007156 Ga0307410_100071569 177
2086 3300031852 Ga0307410_10201000 Ga0307410_102010001 177
2087 3300031852 Ga0307410_10316483 Ga0307410_103164831 177
2088 3300031852 Ga0307410_10508370 Ga0307410_105083702 177
2089 3300031901 Ga0307406_10036624 Ga0307406_100366244 177
2090 3300031901 Ga0307406_10251323 Ga0307406_102513232 177
2091 3300031901 Ga0307406_10419198 Ga0307406_104191982 177
2092 3300031901 Ga0307406_10447080 Ga0307406_104470802 177
2093 3300031903 Ga0307407_10011518 Ga0307407_100115183 177
2094 3300031903 Ga0307407_10662297 Ga0307407_106622971 177
2095 3300031911 Ga0307412_10041042 Ga0307412_100410423 177
2096 3300031911 Ga0307412_10076697 Ga0307412_100766972 177
2097 3300031911 Ga0307412_10118477 Ga0307412_101184772 177
2098 3300031911 Ga0307412_10137880 Ga0307412_101378803 177
2099 3300031911 Ga0307412_10163888 Ga0307412_101638882 177
2100 3300031911 Ga0307412_10241880 Ga0307412_102418802 177
2101 3300031967 Ga0315914_1000013 Ga0315914_100001324 177
2102 3300031995 Ga0307409_100004876 Ga0307409_10000487615 177
2103 3300031995 Ga0307409_100045054 Ga0307409_1000450543 177
2104 3300031995 Ga0307409_101947674 Ga0307409_1019476741 177
2105 3300032002 Ga0307416_100010349 Ga0307416_1000103496 177
2106 3300032002 Ga0307416_100047875 Ga0307416_1000478755 177
2107 3300032002 Ga0307416_100221340 Ga0307416_1002213403 177
2108 3300032002 Ga0307416_100334228 Ga0307416_1003342283 177
2109 3300032002 Ga0307416_100433393 Ga0307416_1004333931 177
2110 3300032002 Ga0307416_100456649 Ga0307416_1004566492 177
2111 3300032002 Ga0307416_100729760 Ga0307416_1007297602 177
2112 3300032002 Ga0307416_100909837 Ga0307416_1009098372 177
2113 3300032002 Ga0307416_101763188 Ga0307416_1017631881 177
2114 3300032004 Ga0307414_10022676 Ga0307414_100226765 177
2115 3300032004 Ga0307414_10023691 Ga0307414_100236912 177
2116 3300032004 Ga0307414_10367138 Ga0307414_103671383 177
2117 3300032004 Ga0307414_11500318 Ga0307414_115003181 177
2118 3300032126 Ga0307415_100010922 Ga0307415_1000109227 177
2119 3300032126 Ga0307415_100102687 Ga0307415_1001026874 177
2120 3300032126 Ga0307415_100194833 Ga0307415_1001948331 177
2121 3300032126 Ga0307415_100212815 Ga0307415_1002128152 177
2122 3300032126 Ga0307415_100442306 Ga0307415_1004423062 177
2123 3300032126 Ga0307415_100475817 Ga0307415_1004758172 177
2124 3300032168 Ga0316593_10011301 Ga0316593_100113011 177
2125 3300032168 Ga0316593_10155232 Ga0316593_101552321 177
2126 3300033179 Ga0307507_10023232 Ga0307507_100232326 177
2127 3300033179 Ga0307507_10309089 Ga0307507_103090891 177
2128 3300033180 Ga0307510_10075120 Ga0307510_100751203 177
2129 3300033180 Ga0307510_10227413 Ga0307510_102274133 177
2130 3300033430 Ga0315913_1000097 Ga0315913_100009724 177
2131 3300033442 Ga0315911_1000009 Ga0315911_100000987 177
2132 3300033464 Ga0315915_1000001 Ga0315915_100000124 177
2133 3300033527 Ga0316586_1022492 Ga0316586_10224922 177
2134 3300033544 Ga0316215_1006608 Ga0316215_10066083 177
2135 3300033544 Ga0316215_1007336 Ga0316215_10073362 177
2136 3300033545 Ga0316214_1003835 Ga0316214_10038352 177
2137 3300034816 Ga0373930_0060467 Ga0373930_0060467_201_734 177
2138 3300035083 Ga0373926_0183521 Ga0373926_0183521_108_641 177
2139 3300035086 Ga0373934_0038719 Ga0373934_0038719_882_1415 177
2140 3300035090 Ga0373949_0023572 Ga0373949_0023572_186_719 177
2141 3300035111 Ga0373923_0070704 Ga0373923_0070704_273_806 177
2142 3300035113 Ga0373936_0113018 Ga0373936_0113018_601_1134 177
2143 3300035113 Ga0373936_0130018 Ga0373936_0130018_153_686 177
2144 3300035116 Ga0373945_0009397 Ga0373945_0009397_728_1261 177
2145 3300035117 Ga0373953_0089085 Ga0373953_0089085_416_949 177
2146 3300035118 Ga0373954_0000100 Ga0373954_0000100_26750_27283 177
2147 3300035118 Ga0373954_0012064 Ga0373954_0012064_597_1130 177
2148 3300035118 Ga0373954_0180527 Ga0373954_0180527_175_708 177
2149 3300035119 Ga0373956_0015818 Ga0373956_0015818_391_924 177
2150 3300035119 Ga0373956_0061795 Ga0373956_0061795_610_1143 177
2151 3300035170 Ga0373943_0013859 Ga0373943_0013859_2084_2617 177
2152 3300035170 Ga0373943_0125965 Ga0373943_0125965_535_1068 177
2153 3300035171 Ga0373946_0005668 Ga0373946_0005668_2302_2835 177
2154 3300035171 Ga0373946_0029093 Ga0373946_0029093_1158_1691 177
2155 3300035172 Ga0373955_0003141 Ga0373955_0003141_6441_6974 177
2156 3300035172 Ga0373955_0154665 Ga0373955_0154665_390_923 177
2157 3300035242 Ga0373962_0119763 Ga0373962_0119763_205_738 177
2158 3300035398 Ga0316574_0310493 Ga0316574_0310493_378_911 177
2159 3300035410 Ga0373924_0002732 Ga0373924_0002732_3674_4207 177
2160 3300035410 Ga0373924_0070831 Ga0373924_0070831_673_1206 177
2161 3300035692 Ga0373935_0010090 Ga0373935_0010090_2833_3366 177
2162 3300035692 Ga0373935_0047345 Ga0373935_0047345_1614_2147 177
2163 3300035692 Ga0373935_0069246 Ga0373935_0069246_248_781 177
2164 3300035692 Ga0373935_0080178 Ga0373935_0080178_1456_1989 177
2165 3300035692 Ga0373935_0101688 Ga0373935_0101688_1050_1583 177
2166 3300035695 Ga0373927_0019967 Ga0373927_0019967_1874_2407 177
2167 3300035695 Ga0373927_0025263 Ga0373927_0025263_1533_2066 177
2168 3300035695 Ga0373927_0050046 Ga0373927_0050046_334_867 177
2169 3300035695 Ga0373927_0210714 Ga0373927_0210714_596_1129 177
2170 3300035724 Ga0373933_0032326 Ga0373933_0032326_2189_2722 177
2171 3300035724 Ga0373933_0158464 Ga0373933_0158464_87_620 177
2172 3300035725 Ga0373947_0005298 Ga0373947_0005298_4944_5477 177
2173 3300035725 Ga0373947_0015233 Ga0373947_0015233_249_782 177
2174 3300036242 Ga0310104_00079 Ga0310104_00079_601_1134 177
2175 3300036401 Ga0373937_0372659 Ga0373937_0372659_87_620 177
2176 3300036401 Ga0373937_0870788 Ga0373937_0870788_219_752 177
2177 3300036458 Ga0310112_018869 Ga0310112_018869_84_617 177
2178 3300037068 Ga0373925_0008352 Ga0373925_0008352_2491_3024 177
2179 3300037068 Ga0373925_0045136 Ga0373925_0045136_2519_3052 177
2180 3300037068 Ga0373925_0298656 Ga0373925_0298656_702_1235 177
2181 3300037068 Ga0373925_0385728 Ga0373925_0385728_279_812 177
2182 3300037068 Ga0373925_0464376 Ga0373925_0464376_252_785 177
2183 3300037068 Ga0373925_0600591 Ga0373925_0600591_26_559 177
2184 3300037312 Ga0395899_0181581 Ga0395899_0181581_874_1407 177
2185 3300037312 Ga0395899_0215112 Ga0395899_0215112_80_613 177
2186 3300037418 Ga0395900_0012290 Ga0395900_0012290_400_933 177
2187 3300037418 Ga0395900_0031276 Ga0395900_0031276_604_1137 177
2188 3300037418 Ga0395900_0128904 Ga0395900_0128904_1057_1590 177
2189 3300037418 Ga0395900_0298104 Ga0395900_0298104_123_656 177
2190 3300037418 Ga0395900_0880864 Ga0395900_0880864_124_657 177
2191 3300037466 Ga0395898_0029950 Ga0395898_0029950_4863_5396 177
2192 3300037466 Ga0395898_0639357 Ga0395898_0639357_40_573 177
2193 3300037471 Ga0395905_0012867 Ga0395905_0012867_6996_7529 177
2194 3300037471 Ga0395905_0032064 Ga0395905_0032064_3831_4364 177
2195 3300037471 Ga0395905_0033796 Ga0395905_0033796_361_894 177
2196 3300037471 Ga0395905_0145663 Ga0395905_0145663_1132_1665 177
2197 3300037471 Ga0395905_0167375 Ga0395905_0167375_486_1019 177
2198 3300037471 Ga0395905_0212637 Ga0395905_0212637_1168_1701 177
2199 3300037471 Ga0395905_0329762 Ga0395905_0329762_638_1171 177
2200 3300037853 Ga0436364_1550501 Ga0436364_1550501_626_1159 177
2201 3300038443 Ga0395901_0052439 Ga0395901_0052439_3688_4221 177
2202 3300038443 Ga0395901_0091387 Ga0395901_0091387_1659_2192 177
2203 3300038443 Ga0395901_0179544 Ga0395901_0179544_971_1504 177
2204 3300038443 Ga0395901_0262534 Ga0395901_0262534_977_1510 177
2205 3300038443 Ga0395901_0391260 Ga0395901_0391260_124_657 177
2206 3300038443 Ga0395901_0403424 Ga0395901_0403424_706_1239 177
2207 3300039437 Ga0436365_0334854 Ga0436365_0334854_518_1051 177
2208 3300039438 Ga0436360_0077529 Ga0436360_0077529_129_662 177
2209 3300039450 Ga0436363_1140251 Ga0436363_1140251_677_1210 177
2210 3300039450 Ga0436363_1416214 Ga0436363_1416214_783_1316 177
2211 3300041404 Ga0439436_0020046 Ga0439436_0020046_470_1006 177
2212 3300041404 Ga0439436_0143939 Ga0439436_0143939_29_562 177
2213 3300041406 Ga0439439_0012516 Ga0439439_0012516_869_1405 177
2214 3300041407 Ga0439447_049450 Ga0439447_049450_188_724 177
2215 3300041413 Ga0439465_0015249 Ga0439465_0015249_1620_2153 177
2216 3300041413 Ga0439465_0199717 Ga0439465_0199717_58_591 177
2217 3300041413 Ga0439465_0228722 Ga0439465_0228722_61_594 177
2218 3300041413 Ga0439465_0255743 Ga0439465_0255743_105_638 177
2219 3300041444 Ga0451790_40977 Ga0451790_40977_64_597 177
2220 3300041444 Ga0451790_43748 Ga0451790_43748_60_593 177
2221 3300041446 Ga0451794_06620 Ga0451794_06620_85_618 177
2222 3300041446 Ga0451794_19747 Ga0451794_19747_327_860 177
2223 3300041446 Ga0451794_30427 Ga0451794_30427_33_566 177
2224 3300041451 Ga0451791_0540605 Ga0451791_0540605_307_840 177
2225 3300041452 Ga0451793_0500431 Ga0451793_0500431_165_698 177
2226 3300041452 Ga0451793_1332179 Ga0451793_1332179_161_694 177
2227 3300041453 Ga0451797_0261817 Ga0451797_0261817_381_914 177
2228 3300041459 Ga0451800_1614829 Ga0451800_1614829_567_1100 177
2229 3300041460 Ga0451802_0387222 Ga0451802_0387222_314_847 177
2230 3300041461 Ga0451805_093557 Ga0451805_093557_130_663 177
2231 3300041461 Ga0451805_105019 Ga0451805_105019_442_975 177
2232 3300041486 Ga0451807_1614199 Ga0451807_1614199_104_637 177
2233 3300041491 Ga0451833_0705110 Ga0451833_0705110_2464_2997 177
2234 3300041494 Ga0451837_1342466 Ga0451837_1342466_147_680 177
2235 3300041496 Ga0451839_0023059 Ga0451839_0023059_2222_2755 177
2236 3300041497 Ga0451840_02584 Ga0451840_02584_1181_1714 177
2237 3300041498 Ga0451841_0087010 Ga0451841_0087010_258_791 177
2238 3300041498 Ga0451841_0468289 Ga0451841_0468289_23_556 177
2239 3300041500 Ga0451844_06822 Ga0451844_06822_334_867 177
2240 3300041501 Ga0451845_0062342 Ga0451845_0062342_656_1189 177
2241 3300041501 Ga0451845_0910627 Ga0451845_0910627_10_543 177
2242 3300041502 Ga0451846_01205 Ga0451846_01205_1870_2403 177
2243 3300041503 Ga0451847_0040601 Ga0451847_0040601_3983_4516 177
2244 3300041503 Ga0451847_0230433 Ga0451847_0230433_87_620 177
2245 3300041504 Ga0451848_20644 Ga0451848_20644_1075_1608 177
2246 3300041505 Ga0451849_0364808 Ga0451849_0364808_1047_1580 177
2247 3300041507 Ga0451851_0450253 Ga0451851_0450253_33_566 177
2248 3300041509 Ga0451843_0956766 Ga0451843_0956766_1119_1652 177
2249 3300041510 Ga0451854_09647 Ga0451854_09647_4212_4745 177
2250 3300041512 Ga0451853_2317430 Ga0451853_2317430_656_1189 177
2251 3300041907 Ga0452268_20544 Ga0452268_20544_632_1165 177
2252 3300041907 Ga0452268_47665 Ga0452268_47665_228_761 177
2253 3300041909 Ga0452270_1255 Ga0452270_1255_12_545 177
2254 3300041999 Ga0439433_0013404 Ga0439433_0013404_145_681 177
2255 3300042002 Ga0439442_038874 Ga0439442_038874_255_791 177
2256 3300042007 Ga0439449_0006732 Ga0439449_0006732_2502_3035 177
2257 3300042007 Ga0439449_0054575 Ga0439449_0054575_535_1071 177
2258 3300042007 Ga0439449_0101230 Ga0439449_0101230_488_1021 177
2259 3300042010 Ga0439452_028778 Ga0439452_028778_822_1355 177
2260 3300042014 Ga0439457_036043 Ga0439457_036043_547_1080 177
2261 3300042015 Ga0439462_0114593 Ga0439462_0114593_195_731 177
2262 3300042122 Ga0450920_009054 Ga0450920_009054_889_1425 177
2263 3300042125 Ga0450923_033863 Ga0450923_033863_32_568 177
2264 3300042145 Ga0450906_006379 Ga0450906_006379_273_809 177
2265 3300042145 Ga0450906_034473 Ga0450906_034473_97_630 177
2266 3300042147 Ga0450910_024747 Ga0450910_024747_342_878 177
2267 3300042156 Ga0439446_0139922 Ga0439446_0139922_120_656 177
2268 3300042157 Ga0439458_0114002 Ga0439458_0114002_83_616 177
2269 3300042185 Ga0450909_014549 Ga0450909_014549_417_953 177
2270 3300042438 Ga0439459_0065768 Ga0439459_0065768_55_588 177
2271 3300042531 Ga0450918_002411 Ga0450918_002411_244_780 177
2272 3300044658 Ga0466972_0009543 Ga0466972_0009543_659_1192 177
2273 3300044658 Ga0466972_0010313 Ga0466972_0010313_684_1217 177
2274 3300044683 Ga0466965_0043824 Ga0466965_0043824_1044_1577 177
2275 3300044684 Ga0466966_0328826 Ga0466966_0328826_235_768 177
2276 3300044694 Ga0466963_0571417 Ga0466963_0571417_226_759 177
2277 3300044719 Ga0466971_0267720 Ga0466971_0267720_134_667 177
2278 3300044735 Ga0466968_0039813 Ga0466968_0039813_1293_1826 177
2279 3300044735 Ga0466968_0500013 Ga0466968_0500013_27_560 177
2280 3300044765 Ga0466970_0120853 Ga0466970_0120853_212_745 177
2281 3300044765 Ga0466970_0280446 Ga0466970_0280446_232_765 177
2282 3300044765 Ga0466970_0398052 Ga0466970_0398052_15_548 177
2283 3300044842 Ga0466957_0183247 Ga0466957_0183247_750_1283 177
2284 3300044901 Ga0466960_0306295 Ga0466960_0306295_220_753 177
2285 3300044901 Ga0466960_0333658 Ga0466960_0333658_24_557 177
2286 3300045051 Ga0451576_0268673 Ga0451576_0268673_391_924 177
2287 3300045976 Ga0466967_0116210 Ga0466967_0116210_544_1077 177
2288 3300045976 Ga0466967_0504747 Ga0466967_0504747_564_1097 177
2289 3300046452 Ga0495617_051710 Ga0495617_051710_759_1292 177
2290 3300046452 Ga0495617_120064 Ga0495617_120064_111_644 177
2291 3300046452 Ga0495617_191278 Ga0495617_191278_56_589 177
2292 3300046453 Ga0495627_027112 Ga0495627_027112_383_916 177
2293 3300046453 Ga0495627_091553 Ga0495627_091553_150_683 177
2294 3300046453 Ga0495627_127225 Ga0495627_127225_132_665 177
2295 3300046454 Ga0495592_0052463 Ga0495592_0052463_2136_2669 177
2296 3300046454 Ga0495592_0066229 Ga0495592_0066229_359_892 177
2297 3300046454 Ga0495592_0653508 Ga0495592_0653508_11_544 177
2298 3300046455 Ga0495603_0055263 Ga0495603_0055263_376_909 177
2299 3300046455 Ga0495603_0125496 Ga0495603_0125496_360_893 177
2300 3300046455 Ga0495603_0294904 Ga0495603_0294904_178_711 177
2301 3300046457 Ga0495590_0019220 Ga0495590_0019220_847_1380 177
2302 3300046457 Ga0495590_0095975 Ga0495590_0095975_162_695 177
2303 3300046457 Ga0495590_0110661 Ga0495590_0110661_152_685 177
2304 3300046457 Ga0495590_0167563 Ga0495590_0167563_98_631 177
2305 3300046458 Ga0495591_015562 Ga0495591_015562_1380_1913 177
2306 3300046459 Ga0495629_0007179 Ga0495629_0007179_5189_5722 177
2307 3300046459 Ga0495629_0020113 Ga0495629_0020113_4184_4717 177
2308 3300046459 Ga0495629_0083222 Ga0495629_0083222_1530_2063 177
2309 3300046459 Ga0495629_0099061 Ga0495629_0099061_707_1240 177
2310 3300046460 Ga0495638_0021308 Ga0495638_0021308_3365_3898 177
2311 3300046460 Ga0495638_0077879 Ga0495638_0077879_239_772 177
2312 3300046460 Ga0495638_0118477 Ga0495638_0118477_386_919 177
2313 3300046460 Ga0495638_0139171 Ga0495638_0139171_170_703 177
2314 3300046461 Ga0495641_0111870 Ga0495641_0111870_394_927 177
2315 3300046462 Ga0495651_0000990 Ga0495651_0000990_359_892 177
2316 3300046462 Ga0495651_0013306 Ga0495651_0013306_5556_6089 177
2317 3300046462 Ga0495651_0418928 Ga0495651_0418928_324_857 177
2318 3300046463 Ga0495653_0000149 Ga0495653_0000149_22606_23139 177
2319 3300046463 Ga0495653_0349662 Ga0495653_0349662_118_651 177
2320 3300046471 Ga0495650_0143717 Ga0495650_0143717_140_673 177
2321 3300046473 Ga0495582_0015152 Ga0495582_0015152_59_592 177
2322 3300046473 Ga0495582_0116912 Ga0495582_0116912_552_1085 177
2323 3300046474 Ga0495605_0027351 Ga0495605_0027351_206_739 177
2324 3300046474 Ga0495605_0064266 Ga0495605_0064266_135_668 177
2325 3300046474 Ga0495605_0233506 Ga0495605_0233506_19_552 177
2326 3300046474 Ga0495605_0234254 Ga0495605_0234254_107_640 177
2327 3300046475 Ga0495639_0134033 Ga0495639_0134033_176_709 177
2328 3300046476 Ga0495662_0156979 Ga0495662_0156979_521_1054 177
2329 3300046477 Ga0495664_0034135 Ga0495664_0034135_1588_2121 177
2330 3300046492 Ga0495585_0101819 Ga0495585_0101819_756_1289 177
2331 3300046492 Ga0495585_0105082 Ga0495585_0105082_64_597 177
2332 3300046492 Ga0495585_0162916 Ga0495585_0162916_415_948 177
2333 3300046492 Ga0495585_0356567 Ga0495585_0356567_46_579 177
2334 3300046499 Ga0495594_0177180 Ga0495594_0177180_554_1087 177
2335 3300046500 Ga0495596_0142130 Ga0495596_0142130_312_845 177
2336 3300046501 Ga0495607_0014002 Ga0495607_0014002_722_1255 177
2337 3300046501 Ga0495607_0110814 Ga0495607_0110814_356_889 177
2338 3300046501 Ga0495607_0155712 Ga0495607_0155712_197_730 177
2339 3300046501 Ga0495607_0273367 Ga0495607_0273367_100_633 177
2340 3300046506 Ga0495583_0090017 Ga0495583_0090017_48_581 177
2341 3300046506 Ga0495583_0138755 Ga0495583_0138755_157_690 177
2342 3300046506 Ga0495583_0167313 Ga0495583_0167313_276_809 177
2343 3300046506 Ga0495583_0185398 Ga0495583_0185398_229_762 177
2344 3300046507 Ga0495606_0004034 Ga0495606_0004034_7048_7581 177
2345 3300046507 Ga0495606_0027177 Ga0495606_0027177_2730_3263 177
2346 3300046507 Ga0495606_0036411 Ga0495606_0036411_2048_2581 177
2347 3300046507 Ga0495606_0037805 Ga0495606_0037805_261_794 177
2348 3300046507 Ga0495606_0111077 Ga0495606_0111077_114_647 177
2349 3300046507 Ga0495606_0217061 Ga0495606_0217061_272_805 177
2350 3300046507 Ga0495606_0244632 Ga0495606_0244632_445_978 177
2351 3300046507 Ga0495606_0279877 Ga0495606_0279877_264_797 177
2352 3300046511 Ga0495608_0006327 Ga0495608_0006327_954_1487 177
2353 3300046511 Ga0495608_0239568 Ga0495608_0239568_61_594 177
2354 3300046511 Ga0495608_0300374 Ga0495608_0300374_445_978 177
2355 3300046511 Ga0495608_0375591 Ga0495608_0375591_10_543 177
2356 3300046512 Ga0495610_0021518 Ga0495610_0021518_2613_3146 177
2357 3300046512 Ga0495610_0073233 Ga0495610_0073233_789_1322 177
2358 3300046512 Ga0495610_0092046 Ga0495610_0092046_494_1027 177
2359 3300046512 Ga0495610_0138990 Ga0495610_0138990_413_946 177
2360 3300046512 Ga0495610_0140822 Ga0495610_0140822_405_938 177
2361 3300046512 Ga0495610_0143034 Ga0495610_0143034_252_785 177
2362 3300046513 Ga0495616_0003845 Ga0495616_0003845_3009_3542 177
2363 3300046514 Ga0495618_0099764 Ga0495618_0099764_363_896 177
2364 3300046514 Ga0495618_0324938 Ga0495618_0324938_271_804 177
2365 3300046515 Ga0495620_0008766 Ga0495620_0008766_4343_4876 177
2366 3300046515 Ga0495620_0011590 Ga0495620_0011590_2515_3048 177
2367 3300046515 Ga0495620_0140987 Ga0495620_0140987_349_882 177
2368 3300046515 Ga0495620_0199183 Ga0495620_0199183_221_754 177
2369 3300046516 Ga0495628_0053224 Ga0495628_0053224_102_635 177
2370 3300046516 Ga0495628_0215453 Ga0495628_0215453_210_743 177
2371 3300046517 Ga0495630_0029804 Ga0495630_0029804_1049_1582 177
2372 3300046518 Ga0495631_0007141 Ga0495631_0007141_3625_4158 177
2373 3300046518 Ga0495631_0050633 Ga0495631_0050633_339_872 177
2374 3300046518 Ga0495631_0061512 Ga0495631_0061512_704_1237 177
2375 3300046519 Ga0495632_0053677 Ga0495632_0053677_726_1259 177
2376 3300046519 Ga0495632_0069504 Ga0495632_0069504_353_886 177
2377 3300046519 Ga0495632_0097889 Ga0495632_0097889_588_1121 177
2378 3300046519 Ga0495632_0113199 Ga0495632_0113199_334_867 177
2379 3300046520 Ga0495637_0063527 Ga0495637_0063527_504_1037 177
2380 3300046522 Ga0495643_0010467 Ga0495643_0010467_3294_3827 177
2381 3300046522 Ga0495643_0011617 Ga0495643_0011617_1529_2062 177
2382 3300046522 Ga0495643_0071765 Ga0495643_0071765_391_924 177
2383 3300046522 Ga0495643_0128976 Ga0495643_0128976_219_752 177
2384 3300046523 Ga0495644_0074077 Ga0495644_0074077_432_965 177
2385 3300046523 Ga0495644_0277617 Ga0495644_0277617_40_573 177
2386 3300046524 Ga0495648_0001935 Ga0495648_0001935_14386_14919 177
2387 3300046524 Ga0495648_0008251 Ga0495648_0008251_55_588 177
2388 3300046524 Ga0495648_0015480 Ga0495648_0015480_4410_4943 177
2389 3300046524 Ga0495648_0086535 Ga0495648_0086535_903_1436 177
2390 3300046524 Ga0495648_0361201 Ga0495648_0361201_20_553 177
2391 3300046525 Ga0495663_0047321 Ga0495663_0047321_184_717 177
2392 3300046529 Ga0495652_0004067 Ga0495652_0004067_2457_2990 177
2393 3300046529 Ga0495652_0169584 Ga0495652_0169584_413_946 177
2394 3300046530 Ga0495654_0000169 Ga0495654_0000169_57498_58031 177
2395 3300046530 Ga0495654_0008744 Ga0495654_0008744_3494_4027 177
2396 3300046530 Ga0495654_0063133 Ga0495654_0063133_255_788 177
2397 3300046530 Ga0495654_0088680 Ga0495654_0088680_188_721 177
2398 3300046533 Ga0495640_0007699 Ga0495640_0007699_7377_7910 177
2399 3300046533 Ga0495640_0016564 Ga0495640_0016564_4708_5241 177
2400 3300046533 Ga0495640_0044682 Ga0495640_0044682_1854_2387 177
2401 3300046533 Ga0495640_0102873 Ga0495640_0102873_794_1327 177
2402 3300046533 Ga0495640_0146627 Ga0495640_0146627_26_559 177
2403 3300046535 Ga0495586_0030573 Ga0495586_0030573_344_877 177
2404 3300046536 Ga0495587_0149435 Ga0495587_0149435_765_1298 177
2405 3300046536 Ga0495587_0434788 Ga0495587_0434788_108_641 177
2406 3300046537 Ga0495598_0228688 Ga0495598_0228688_131_664 177
2407 3300046538 Ga0495609_0039691 Ga0495609_0039691_802_1335 177
2408 3300046538 Ga0495609_0160948 Ga0495609_0160948_53_586 177
2409 3300046538 Ga0495609_0310991 Ga0495609_0310991_61_594 177
2410 3300046539 Ga0495621_0013886 Ga0495621_0013886_738_1271 177
2411 3300046542 Ga0495597_0009306 Ga0495597_0009306_660_1193 177
2412 3300046542 Ga0495597_0024609 Ga0495597_0024609_1995_2528 177
2413 3300046542 Ga0495597_0075007 Ga0495597_0075007_874_1407 177
2414 3300046542 Ga0495597_0128654 Ga0495597_0128654_164_697 177
2415 3300046542 Ga0495597_0190657 Ga0495597_0190657_48_581 177
2416 3300046543 Ga0495645_0187257 Ga0495645_0187257_846_1379 177
2417 3300046543 Ga0495645_0313988 Ga0495645_0313988_427_960 177
2418 3300046543 Ga0495645_0746600 Ga0495645_0746600_38_571 177
2419 3300046557 Ga0495622_0020195 Ga0495622_0020195_1425_1958 177
2420 3300046557 Ga0495622_0032660 Ga0495622_0032660_1258_1791 177
2421 3300046557 Ga0495622_0084171 Ga0495622_0084171_861_1394 177
2422 3300046557 Ga0495622_0094497 Ga0495622_0094497_62_595 177
2423 3300046557 Ga0495622_0318953 Ga0495622_0318953_26_559 177
2424 3300046558 Ga0495633_0055449 Ga0495633_0055449_786_1322 177
2425 3300046558 Ga0495633_0070701 Ga0495633_0070701_893_1426 177
2426 3300046558 Ga0495633_0115593 Ga0495633_0115593_130_663 177
2427 3300046558 Ga0495633_0132887 Ga0495633_0132887_498_1031 177
2428 3300046559 Ga0495667_0016440 Ga0495667_0016440_2009_2542 177
2429 3300046559 Ga0495667_0271969 Ga0495667_0271969_81_614 177
2430 3300046615 Ga0495656_0070658 Ga0495656_0070658_943_1476 177
2431 3300046615 Ga0495656_0163017 Ga0495656_0163017_451_984 177
2432 3300046615 Ga0495656_0204799 Ga0495656_0204799_212_745 177
2433 3300046615 Ga0495656_0207938 Ga0495656_0207938_217_753 177
2434 3300046616 Ga0495668_0009874 Ga0495668_0009874_710_1243 177
2435 3300046616 Ga0495668_0063697 Ga0495668_0063697_1104_1637 177
2436 3300046616 Ga0495668_0095153 Ga0495668_0095153_939_1472 177
2437 3300046616 Ga0495668_0271703 Ga0495668_0271703_345_878 177
2438 3300046616 Ga0495668_0283076 Ga0495668_0283076_163_696 177
2439 3300046616 Ga0495668_0488217 Ga0495668_0488217_72_605 177
2440 3300046642 Ga0495634_0044824 Ga0495634_0044824_375_908 177
2441 3300046642 Ga0495634_0050558 Ga0495634_0050558_1665_2198 177
2442 3300046642 Ga0495634_0366988 Ga0495634_0366988_238_771 177
2443 3300046642 Ga0495634_0417166 Ga0495634_0417166_49_582 177
2444 3300046648 Ga0495611_0053779 Ga0495611_0053779_308_841 177
2445 3300046648 Ga0495611_0057726 Ga0495611_0057726_677_1210 177
2446 3300046660 Ga0495625_0027395 Ga0495625_0027395_929_1462 177
2447 3300046660 Ga0495625_0036051 Ga0495625_0036051_1686_2219 177
2448 3300046660 Ga0495625_0064552 Ga0495625_0064552_358_891 177
2449 3300046660 Ga0495625_0125448 Ga0495625_0125448_517_1050 177
2450 3300046660 Ga0495625_0233111 Ga0495625_0233111_440_973 177
2451 3300046660 Ga0495625_0667476 Ga0495625_0667476_32_565 177
2452 3300046663 Ga0495635_0009893 Ga0495635_0009893_282_815 177
2453 3300046663 Ga0495635_0102905 Ga0495635_0102905_685_1218 177
2454 3300046663 Ga0495635_0479966 Ga0495635_0479966_247_780 177
2455 3300046663 Ga0495635_0578370 Ga0495635_0578370_132_665 177
2456 3300046664 Ga0495659_0100765 Ga0495659_0100765_191_724 177
2457 3300046665 Ga0495661_0152638 Ga0495661_0152638_347_880 177
2458 3300046674 Ga0495588_0025858 Ga0495588_0025858_623_1156 177
2459 3300046674 Ga0495588_0052266 Ga0495588_0052266_357_890 177
2460 3300046674 Ga0495588_0059100 Ga0495588_0059100_1142_1678 177
2461 3300046674 Ga0495588_0064395 Ga0495588_0064395_91_624 177
2462 3300046674 Ga0495588_0081997 Ga0495588_0081997_714_1247 177
2463 3300046674 Ga0495588_0104250 Ga0495588_0104250_236_769 177
2464 3300046674 Ga0495588_0349138 Ga0495588_0349138_22_555 177
2465 3300046675 Ga0495657_0020577 Ga0495657_0020577_2457_2990 177
2466 3300046675 Ga0495657_0088229 Ga0495657_0088229_751_1284 177
2467 3300046678 Ga0495599_0006010 Ga0495599_0006010_6362_6895 177
2468 3300046679 Ga0495623_0078486 Ga0495623_0078486_507_1040 177
2469 3300046679 Ga0495623_0134558 Ga0495623_0134558_301_834 177
2470 3300046679 Ga0495623_0200184 Ga0495623_0200184_350_883 177
2471 3300046679 Ga0495623_0264429 Ga0495623_0264429_10_543 177
2472 3300046680 Ga0495646_0002026 Ga0495646_0002026_11102_11635 177
2473 3300046681 Ga0495647_0184717 Ga0495647_0184717_324_857 177
2474 3300046681 Ga0495647_0222830 Ga0495647_0222830_275_808 177
2475 3300046683 Ga0495658_0024761 Ga0495658_0024761_887_1420 177
2476 3300046683 Ga0495658_0117919 Ga0495658_0117919_63_596 177
2477 3300046684 Ga0495669_0187682 Ga0495669_0187682_189_722 177
2478 3300046689 Ga0495613_0033309 Ga0495613_0033309_1417_1950 177
2479 3300046689 Ga0495613_0222981 Ga0495613_0222981_57_590 177
2480 3300046689 Ga0495613_0292012 Ga0495613_0292012_500_1033 177
2481 3300046690 Ga0495624_0019695 Ga0495624_0019695_2333_2866 177
2482 3300046690 Ga0495624_0257636 Ga0495624_0257636_219_752 177
2483 3300046691 Ga0495670_0019785 Ga0495670_0019785_2729_3262 177
2484 3300046691 Ga0495670_0067647 Ga0495670_0067647_756_1289 177
2485 3300046691 Ga0495670_0227925 Ga0495670_0227925_168_701 177
2486 3300046691 Ga0495670_0284616 Ga0495670_0284616_90_623 177
2487 3300046692 Ga0495671_0020389 Ga0495671_0020389_470_1003 177
2488 3300046692 Ga0495671_0098045 Ga0495671_0098045_842_1375 177
2489 3300046692 Ga0495671_0106435 Ga0495671_0106435_391_924 177
2490 3300046692 Ga0495671_0119333 Ga0495671_0119333_573_1106 177
2491 3300046694 Ga0495649_0056016 Ga0495649_0056016_1509_2042 177
2492 3300046694 Ga0495649_0128244 Ga0495649_0128244_714_1247 177
2493 3300046694 Ga0495649_0402130 Ga0495649_0402130_117_650 177
2494 3300046694 Ga0495649_0450401 Ga0495649_0450401_46_579 177
2495 3300046794 Ga0495589_0086867 Ga0495589_0086867_693_1226 177
2496 3300046794 Ga0495589_0108956 Ga0495589_0108956_77_610 177
2497 3300046794 Ga0495589_0440352 Ga0495589_0440352_17_550 177
2498 3300046809 Ga0495600_0001328 Ga0495600_0001328_2457_2990 177
2499 3300046809 Ga0495600_0200756 Ga0495600_0200756_174_707 177
2500 3300046809 Ga0495600_0249391 Ga0495600_0249391_93_626 177
2501 3300046810 Ga0495660_0003610 Ga0495660_0003610_3088_3621 177
2502 3300046810 Ga0495660_0216181 Ga0495660_0216181_213_746 177
2503 3300047315 Ga0495581_0046393 Ga0495581_0046393_523_1056 177
2504 3300047315 Ga0495581_0443387 Ga0495581_0443387_68_601 177
2505 3300047317 Ga0495604_0024237 Ga0495604_0024237_2029_2562 177
2506 3300047317 Ga0495604_0038744 Ga0495604_0038744_3131_3664 177
2507 3300047317 Ga0495604_0056047 Ga0495604_0056047_1330_1863 177
2508 3300047317 Ga0495604_0154622 Ga0495604_0154622_273_806 177
2509 3300047318 Ga0495636_0254486 Ga0495636_0254486_211_744 177
2510 3300047318 Ga0495636_0372624 Ga0495636_0372624_74_607 177
2511 3300047319 Ga0495674_0033963 Ga0495674_0033963_3292_3825 177
2512 3300047319 Ga0495674_0084213 Ga0495674_0084213_1695_2228 177
2513 3300047319 Ga0495674_0133161 Ga0495674_0133161_190_723 177
2514 3300047319 Ga0495674_0881304 Ga0495674_0881304_85_618 177
2515 3300047320 Ga0495672_0072639 Ga0495672_0072639_142_675 177
2516 3300047320 Ga0495672_0118367 Ga0495672_0118367_196_729 177
2517 3300047320 Ga0495672_0151289 Ga0495672_0151289_202_735 177
2518 3300047321 Ga0495676_0267319 Ga0495676_0267319_394_927 177
2519 3300047321 Ga0495676_0425480 Ga0495676_0425480_145_678 177
2520 3300047322 Ga0495680_0026837 Ga0495680_0026837_1752_2285 177
2521 3300047322 Ga0495680_0636489 Ga0495680_0636489_114_647 177
2522 3300047323 Ga0495683_0094699 Ga0495683_0094699_508_1041 177
2523 3300047323 Ga0495683_0106493 Ga0495683_0106493_114_647 177
2524 3300047443 Ga0495687_047418 Ga0495687_047418_1189_1722 177
2525 3300047444 Ga0495675_0009679 Ga0495675_0009679_4135_4668 177
2526 3300047444 Ga0495675_0467629 Ga0495675_0467629_108_641 177
2527 3300047447 Ga0495685_058639 Ga0495685_058639_84_617 177
2528 3300047469 Ga0495673_0054337 Ga0495673_0054337_324_857 177
2529 3300047469 Ga0495673_0060972 Ga0495673_0060972_855_1388 177
2530 3300047469 Ga0495673_0084303 Ga0495673_0084303_520_1053 177
2531 3300047470 Ga0495681_0111401 Ga0495681_0111401_173_706 177
2532 3300047470 Ga0495681_0164393 Ga0495681_0164393_237_770 177
2533 3300047471 Ga0495684_0003854 Ga0495684_0003854_4252_4785 177
2534 3300047471 Ga0495684_0063489 Ga0495684_0063489_253_786 177
2535 3300047471 Ga0495684_0068141 Ga0495684_0068141_602_1135 177
2536 3300047472 Ga0495686_0012709 Ga0495686_0012709_347_880 177
2537 3300047472 Ga0495686_0020367 Ga0495686_0020367_1586_2119 177
2538 3300047472 Ga0495686_0053911 Ga0495686_0053911_808_1341 177
2539 3300047472 Ga0495686_0070208 Ga0495686_0070208_1300_1833 177
2540 3300047472 Ga0495686_0113885 Ga0495686_0113885_964_1497 177
2541 3300047472 Ga0495686_0115126 Ga0495686_0115126_845_1378 177
2542 3300047472 Ga0495686_0117960 Ga0495686_0117960_873_1406 177
2543 3300047472 Ga0495686_0136673 Ga0495686_0136673_780_1313 177
2544 3300047673 Ga0495593_0012224 Ga0495593_0012224_544_1077 177
2545 3300047673 Ga0495593_0056011 Ga0495593_0056011_577_1110 177
2546 3300048088 Ga0495602_0368581 Ga0495602_0368581_407_940 177
2547 3300048088 Ga0495602_0547652 Ga0495602_0547652_167_700 177
2548 3300048088 Ga0495602_0549525 Ga0495602_0549525_50_583 177
2549 3300048089 Ga0495614_0160820 Ga0495614_0160820_415_948 177
2550 3300048090 Ga0495615_0018125 Ga0495615_0018125_558_1091 177
2551 3300048090 Ga0495615_0077871 Ga0495615_0077871_299_832 177
2552 3300048091 Ga0495626_0008866 Ga0495626_0008866_3954_4487 177
2553 3300048091 Ga0495626_0009507 Ga0495626_0009507_2599_3132 177
2554 3300048091 Ga0495626_0078153 Ga0495626_0078153_647_1180 177
2555 3300048091 Ga0495626_0232172 Ga0495626_0232172_166_699 177
2556 3300048903 Ga0496100_0304033 Ga0496100_0304033_641_1174 177
2557 3300048903 Ga0496100_0700908 Ga0496100_0700908_152_685 177
2558 3300048904 Ga0496101_0218582 Ga0496101_0218582_227_760 177
2559 3300048904 Ga0496101_0664100 Ga0496101_0664100_233_766 177
2560 3300048904 Ga0496101_0758557 Ga0496101_0758557_171_704 177
2561 3300048905 Ga0496102_0275494 Ga0496102_0275494_157_690 177
2562 3300048905 Ga0496102_0401030 Ga0496102_0401030_358_891 177
2563 3300048905 Ga0496102_0488810 Ga0496102_0488810_72_605 177
2564 3300048905 Ga0496102_1348092 Ga0496102_1348092_22_555 177
2565 3300048905 Ga0496102_1607049 Ga0496102_1607049_18_551 177
2566 3300048906 Ga0496103_0169291 Ga0496103_0169291_246_779 177
2567 3300048906 Ga0496103_0420846 Ga0496103_0420846_140_673 177
2568 3300048907 Ga0496104_0038871 Ga0496104_0038871_2659_3192 177
2569 3300048907 Ga0496104_0117685 Ga0496104_0117685_593_1126 177
2570 3300048907 Ga0496104_0245933 Ga0496104_0245933_730_1263 177
2571 3300048908 Ga0496105_0005725 Ga0496105_0005725_5737_6270 177
2572 3300048908 Ga0496105_0100695 Ga0496105_0100695_23_556 177
2573 3300048908 Ga0496105_0203046 Ga0496105_0203046_728_1261 177
2574 3300048908 Ga0496105_0579954 Ga0496105_0579954_166_699 177
2575 3300048909 Ga0496106_0287189 Ga0496106_0287189_749_1282 177
2576 3300048909 Ga0496106_0592345 Ga0496106_0592345_190_723 177
2577 3300048909 Ga0496106_0675079 Ga0496106_0675079_190_723 177
2578 3300048910 Ga0496107_0146618 Ga0496107_0146618_235_768 177
2579 3300048910 Ga0496107_0931367 Ga0496107_0931367_51_584 177
2580 3300048911 Ga0496108_0065562 Ga0496108_0065562_301_834 177
2581 3300048911 Ga0496108_0093770 Ga0496108_0093770_1828_2361 177
2582 3300048911 Ga0496108_0407426 Ga0496108_0407426_77_610 177
2583 3300048911 Ga0496108_0605644 Ga0496108_0605644_159_692 177
2584 3300048912 Ga0496109_0694864 Ga0496109_0694864_134_667 177
2585 3300048913 Ga0496110_0072438 Ga0496110_0072438_2368_2901 177
2586 3300048913 Ga0496110_0225558 Ga0496110_0225558_669_1202 177
2587 3300048913 Ga0496110_0457335 Ga0496110_0457335_68_601 177
2588 3300048913 Ga0496110_0618696 Ga0496110_0618696_311_844 177
2589 3300048914 Ga0496111_0010053 Ga0496111_0010053_4242_4775 177
2590 3300048914 Ga0496111_0065502 Ga0496111_0065502_2063_2596 177
2591 3300048914 Ga0496111_0470529 Ga0496111_0470529_148_681 177
2592 3300048915 Ga0496112_0000021 Ga0496112_0000021_7517_8050 177
2593 3300048915 Ga0496112_0049260 Ga0496112_0049260_37_570 177
2594 3300048915 Ga0496112_0110610 Ga0496112_0110610_1431_1964 177
2595 3300048915 Ga0496112_0116362 Ga0496112_0116362_561_1094 177
2596 3300048915 Ga0496112_0126745 Ga0496112_0126745_180_713 177
2597 3300048915 Ga0496112_1395192 Ga0496112_1395192_39_572 177
2598 3300048916 Ga0496113_0212481 Ga0496113_0212481_720_1253 177
2599 3300048916 Ga0496113_0243254 Ga0496113_0243254_111_644 177
2600 3300048916 Ga0496113_0435358 Ga0496113_0435358_171_704 177
2601 3300048916 Ga0496113_0704217 Ga0496113_0704217_34_567 177
2602 3300048916 Ga0496113_0917896 Ga0496113_0917896_50_583 177
2603 3300048917 Ga0496114_0089784 Ga0496114_0089784_1761_2294 177
2604 3300048917 Ga0496114_0189609 Ga0496114_0189609_487_1020 177
2605 3300048917 Ga0496114_0230803 Ga0496114_0230803_896_1429 177
2606 3300048917 Ga0496114_0346523 Ga0496114_0346523_178_711 177
2607 3300048917 Ga0496114_0613657 Ga0496114_0613657_273_806 177
2608 3300048918 Ga0496115_0004922 Ga0496115_0004922_3098_3631 177
2609 3300048918 Ga0496115_0063129 Ga0496115_0063129_596_1129 177
2610 3300048918 Ga0496115_0161711 Ga0496115_0161711_755_1288 177
2611 3300048918 Ga0496115_0397682 Ga0496115_0397682_528_1061 177
2612 3300048918 Ga0496115_0707357 Ga0496115_0707357_241_774 177
2613 3300048918 Ga0496115_0906199 Ga0496115_0906199_22_555 177
2614 3300048919 Ga0496116_0016936 Ga0496116_0016936_2573_3106 177
2615 3300048919 Ga0496116_0020299 Ga0496116_0020299_1640_2173 177
2616 3300048919 Ga0496116_0090144 Ga0496116_0090144_592_1125 177
2617 3300048919 Ga0496116_0150213 Ga0496116_0150213_580_1113 177
2618 3300048919 Ga0496116_0246987 Ga0496116_0246987_73_606 177
2619 3300048919 Ga0496116_0266409 Ga0496116_0266409_153_686 177
2620 3300048920 Ga0496117_0036203 Ga0496117_0036203_2617_3150 177
2621 3300048920 Ga0496117_0039434 Ga0496117_0039434_1299_1832 177
2622 3300048920 Ga0496117_0079630 Ga0496117_0079630_253_786 177
2623 3300048920 Ga0496117_0113384 Ga0496117_0113384_255_788 177
2624 3300048920 Ga0496117_0131919 Ga0496117_0131919_635_1168 177
2625 3300048921 Ga0496118_0010277 Ga0496118_0010277_6339_6872 177
2626 3300048921 Ga0496118_0047138 Ga0496118_0047138_2353_2886 177
2627 3300048921 Ga0496118_0048277 Ga0496118_0048277_701_1234 177
2628 3300048921 Ga0496118_0083225 Ga0496118_0083225_1510_2043 177
2629 3300048921 Ga0496118_0115246 Ga0496118_0115246_848_1381 177
2630 3300048921 Ga0496118_0154123 Ga0496118_0154123_585_1118 177
2631 3300048921 Ga0496118_0193744 Ga0496118_0193744_314_847 177
2632 3300048921 Ga0496118_0345288 Ga0496118_0345288_101_634 177
2633 3300048921 Ga0496118_0419965 Ga0496118_0419965_98_631 177
2634 3300048922 Ga0496119_0022470 Ga0496119_0022470_1435_1968 177
2635 3300048922 Ga0496119_0026500 Ga0496119_0026500_268_801 177
2636 3300048922 Ga0496119_0049927 Ga0496119_0049927_787_1320 177
2637 3300048922 Ga0496119_0132438 Ga0496119_0132438_117_650 177
2638 3300048922 Ga0496119_0192824 Ga0496119_0192824_157_690 177
2639 3300048922 Ga0496119_0195203 Ga0496119_0195203_51_584 177
2640 3300048922 Ga0496119_0314293 Ga0496119_0314293_104_637 177
2641 3300048923 Ga0496120_0003668 Ga0496120_0003668_10163_10696 177
2642 3300048923 Ga0496120_0014732 Ga0496120_0014732_2715_3248 177
2643 3300048923 Ga0496120_0067605 Ga0496120_0067605_421_954 177
2644 3300048923 Ga0496120_0120324 Ga0496120_0120324_238_771 177
2645 3300048923 Ga0496120_0136578 Ga0496120_0136578_406_939 177
2646 3300048923 Ga0496120_0236970 Ga0496120_0236970_161_694 177
2647 3300048924 Ga0496121_0000003 Ga0496121_0000003_231827_232360 177
2648 3300048924 Ga0496121_0002196 Ga0496121_0002196_14467_15000 177
2649 3300048924 Ga0496121_0012437 Ga0496121_0012437_6245_6778 177
2650 3300048924 Ga0496121_0015937 Ga0496121_0015937_6724_7257 177
2651 3300048924 Ga0496121_0018961 Ga0496121_0018961_6195_6728 177
2652 3300048924 Ga0496121_0059739 Ga0496121_0059739_1246_1779 177
2653 3300048924 Ga0496121_0074250 Ga0496121_0074250_1783_2316 177
2654 3300048924 Ga0496121_0091959 Ga0496121_0091959_330_863 177
2655 3300048924 Ga0496121_0133823 Ga0496121_0133823_1239_1772 177
2656 3300048924 Ga0496121_0136963 Ga0496121_0136963_356_889 177
2657 3300048924 Ga0496121_0145522 Ga0496121_0145522_385_918 177
2658 3300048924 Ga0496121_0181295 Ga0496121_0181295_231_764 177
2659 3300048924 Ga0496121_0198020 Ga0496121_0198020_643_1176 177
2660 3300048924 Ga0496121_0213609 Ga0496121_0213609_249_782 177
2661 3300048924 Ga0496121_0385665 Ga0496121_0385665_102_635 177
2662 3300048924 Ga0496121_0410174 Ga0496121_0410174_143_676 177
2663 3300048924 Ga0496121_0510997 Ga0496121_0510997_118_651 177
2664 3300048925 Ga0496122_0000179 Ga0496122_0000179_7804_8337 177
2665 3300048925 Ga0496122_0037393 Ga0496122_0037393_2758_3291 177
2666 3300048925 Ga0496122_0049928 Ga0496122_0049928_2296_2829 177
2667 3300048925 Ga0496122_0085161 Ga0496122_0085161_1529_2062 177
2668 3300048925 Ga0496122_0090444 Ga0496122_0090444_392_925 177
2669 3300048925 Ga0496122_0172441 Ga0496122_0172441_579_1112 177
2670 3300048925 Ga0496122_0209271 Ga0496122_0209271_363_896 177
2671 3300048925 Ga0496122_0262012 Ga0496122_0262012_322_855 177
2672 3300048925 Ga0496122_0326762 Ga0496122_0326762_178_711 177
2673 3300048926 Ga0496123_0000305 Ga0496123_0000305_5749_6282 177
2674 3300048926 Ga0496123_0017503 Ga0496123_0017503_2096_2629 177
2675 3300048926 Ga0496123_0029976 Ga0496123_0029976_2886_3419 177
2676 3300048926 Ga0496123_0041395 Ga0496123_0041395_206_739 177
2677 3300048926 Ga0496123_0100858 Ga0496123_0100858_370_903 177
2678 3300048926 Ga0496123_0135023 Ga0496123_0135023_579_1112 177
2679 3300048926 Ga0496123_0166396 Ga0496123_0166396_586_1119 177
2680 3300048927 Ga0496124_0004199 Ga0496124_0004199_2011_2544 177
2681 3300048927 Ga0496124_0004355 Ga0496124_0004355_8068_8601 177
2682 3300048927 Ga0496124_0004631 Ga0496124_0004631_7411_7944 177
2683 3300048927 Ga0496124_0051261 Ga0496124_0051261_1232_1765 177
2684 3300048927 Ga0496124_0116377 Ga0496124_0116377_245_778 177
2685 3300048927 Ga0496124_0177566 Ga0496124_0177566_224_757 177
2686 3300048927 Ga0496124_0180285 Ga0496124_0180285_55_588 177
2687 3300048927 Ga0496124_0182153 Ga0496124_0182153_751_1284 177
2688 3300048927 Ga0496124_0203903 Ga0496124_0203903_269_802 177
2689 3300048927 Ga0496124_0205157 Ga0496124_0205157_809_1342 177
2690 3300048927 Ga0496124_0235980 Ga0496124_0235980_589_1122 177
2691 3300048927 Ga0496124_0293249 Ga0496124_0293249_543_1076 177
2692 3300048927 Ga0496124_0293752 Ga0496124_0293752_402_935 177
2693 3300048927 Ga0496124_0507002 Ga0496124_0507002_173_706 177
2694 3300048927 Ga0496124_0731920 Ga0496124_0731920_41_574 177
2695 3300048928 Ga0496125_0000141 Ga0496125_0000141_152663_153196 177
2696 3300048928 Ga0496125_0063176 Ga0496125_0063176_264_797 177
2697 3300048928 Ga0496125_0103317 Ga0496125_0103317_249_782 177
2698 3300048928 Ga0496125_0114457 Ga0496125_0114457_1021_1554 177
2699 3300048928 Ga0496125_0126066 Ga0496125_0126066_889_1422 177
2700 3300048928 Ga0496125_0164647 Ga0496125_0164647_768_1301 177
2701 3300048928 Ga0496125_0165868 Ga0496125_0165868_222_755 177
2702 3300048928 Ga0496125_0234291 Ga0496125_0234291_58_591 177
2703 3300048928 Ga0496125_0289968 Ga0496125_0289968_439_972 177
2704 3300048928 Ga0496125_0327707 Ga0496125_0327707_307_840 177
2705 3300048928 Ga0496125_0435865 Ga0496125_0435865_89_622 177
2706 3300048928 Ga0496125_0499966 Ga0496125_0499966_48_581 177
2707 3300048928 Ga0496125_0526708 Ga0496125_0526708_42_575 177
2708 3300048929 Ga0496126_0027348 Ga0496126_0027348_3089_3622 177
2709 3300048929 Ga0496126_0106083 Ga0496126_0106083_1585_2118 177
2710 3300048929 Ga0496126_0157376 Ga0496126_0157376_668_1201 177
2711 3300048929 Ga0496126_0179786 Ga0496126_0179786_342_875 177
2712 3300048929 Ga0496126_0195531 Ga0496126_0195531_600_1133 177
2713 3300048929 Ga0496126_0209361 Ga0496126_0209361_762_1295 177
2714 3300048929 Ga0496126_0218163 Ga0496126_0218163_469_1002 177
2715 3300048929 Ga0496126_0311670 Ga0496126_0311670_339_872 177
2716 3300048929 Ga0496126_0315366 Ga0496126_0315366_177_710 177
2717 3300048929 Ga0496126_0370688 Ga0496126_0370688_91_624 177
2718 3300048929 Ga0496126_0426882 Ga0496126_0426882_271_804 177
2719 3300048929 Ga0496126_0568184 Ga0496126_0568184_285_818 177
2720 3300048929 Ga0496126_0627878 Ga0496126_0627878_33_566 177
2721 3300048929 Ga0496126_0683432 Ga0496126_0683432_83_616 177
2722 3300049127 Ga0501306_000444 Ga0501306_000444_422_955 177
2723 3300049127 Ga0501306_007899 Ga0501306_007899_155_688 177
2724 3300049127 Ga0501306_039073 Ga0501306_039073_62_595 177
2725 3300049128 Ga0501308_002370 Ga0501308_002370_1098_1631 177
2726 3300049129 Ga0501309_000912 Ga0501309_000912_54_587 177
2727 3300049129 Ga0501309_004872 Ga0501309_004872_699_1232 177
2728 3300049130 Ga0501310_010190 Ga0501310_010190_170_703 177
2729 3300049130 Ga0501310_011449 Ga0501310_011449_165_698 177
2730 3300049130 Ga0501310_013612 Ga0501310_013612_323_856 177
2731 3300049130 Ga0501310_032438 Ga0501310_032438_27_560 177
2732 3300049160 Ga0501304_003511 Ga0501304_003511_284_817 177
2733 3300049161 Ga0501305_003020 Ga0501305_003020_885_1418 177
2734 3300049161 Ga0501305_003176 Ga0501305_003176_499_1032 177
2735 3300049161 Ga0501305_009509 Ga0501305_009509_698_1231 177
2736 3300049162 Ga0501307_034945 Ga0501307_034945_119_652 177
2737 3300049459 Ga0495678_057051 Ga0495678_057051_187_720 177
2738 3300049459 Ga0495678_152901 Ga0495678_152901_73_606 177
2739 3300049459 Ga0495678_162925 Ga0495678_162925_63_596 177
2740 3300049527 Ga0501311_000194 Ga0501311_000194_446_979 177
2741 3300049527 Ga0501311_006601 Ga0501311_006601_174_707 177
2742 3300049529 Ga0501313_009901 Ga0501313_009901_28_561 177
2743 3300049530 Ga0501314_002564 Ga0501314_002564_533_1066 177
2744 3300049530 Ga0501314_002648 Ga0501314_002648_208_741 177
2745 3300049530 Ga0501314_008466 Ga0501314_008466_184_717 177
2746 3300049531 Ga0501315_000060 Ga0501315_000060_857_1390 177
2747 3300049531 Ga0501315_001308 Ga0501315_001308_1518_2051 177
2748 3300049531 Ga0501315_014320 Ga0501315_014320_274_807 177
2749 3300049532 Ga0501316_000132 Ga0501316_000132_2709_3242 177
2750 3300049532 Ga0501316_001097 Ga0501316_001097_891_1424 177
2751 3300049533 Ga0501317_000084 Ga0501317_000084_1920_2453 177
2752 3300049533 Ga0501317_000409 Ga0501317_000409_1118_1651 177
2753 3300049533 Ga0501317_017769 Ga0501317_017769_136_669 177
2754 3300049534 Ga0501318_000193 Ga0501318_000193_1724_2257 177
2755 3300049535 Ga0501319_005724 Ga0501319_005724_185_718 177
2756 3300049535 Ga0501319_006566 Ga0501319_006566_25_558 177
2757 3300049536 Ga0501320_005669 Ga0501320_005669_599_1132 177
2758 3300049537 Ga0501321_010209 Ga0501321_010209_324_857 177
2759 3300049537 Ga0501321_025502 Ga0501321_025502_50_583 177
2760 3300049538 Ga0501322_000140 Ga0501322_000140_630_1163 177
2761 3300049539 Ga0501323_006869 Ga0501323_006869_215_748 177
2762 3300049540 Ga0501324_013699 Ga0501324_013699_160_693 177
2763 3300049540 Ga0501324_014661 Ga0501324_014661_135_668 177
2764 3300049550 Ga0501334_06607 Ga0501334_06607_217_750 177
2765 3300049568 Ga0501031_0000651 Ga0501031_0000651_12483_13016 177
2766 3300049568 Ga0501031_0002703 Ga0501031_0002703_2646_3179 177
2767 3300049568 Ga0501031_0004402 Ga0501031_0004402_2911_3444 177
2768 3300049568 Ga0501031_0007624 Ga0501031_0007624_1017_1550 177
2769 3300049568 Ga0501031_0095082 Ga0501031_0095082_1097_1630 177
2770 3300049569 Ga0501032_0000111 Ga0501032_0000111_7532_8065 177
2771 3300049569 Ga0501032_0003488 Ga0501032_0003488_4002_4535 177
2772 3300049569 Ga0501032_0006160 Ga0501032_0006160_2781_3314 177
2773 3300049569 Ga0501032_0066026 Ga0501032_0066026_1834_2367 177
2774 3300049569 Ga0501032_0233067 Ga0501032_0233067_593_1126 177
2775 3300049569 Ga0501032_0319882 Ga0501032_0319882_49_582 177
2776 3300049569 Ga0501032_0686129 Ga0501032_0686129_59_592 177
2777 3300049570 Ga0501033_0000121 Ga0501033_0000121_45850_46383 177
2778 3300049570 Ga0501033_0006462 Ga0501033_0006462_4863_5396 177
2779 3300049570 Ga0501033_0007122 Ga0501033_0007122_1506_2039 177
2780 3300049570 Ga0501033_0010287 Ga0501033_0010287_6149_6682 177
2781 3300049570 Ga0501033_0011172 Ga0501033_0011172_3693_4226 177
2782 3300049570 Ga0501033_0015204 Ga0501033_0015204_4763_5296 177
2783 3300049570 Ga0501033_0079988 Ga0501033_0079988_1780_2334 177
2784 3300049570 Ga0501033_0080471 Ga0501033_0080471_1103_1636 177
2785 3300049570 Ga0501033_0087475 Ga0501033_0087475_1696_2229 177
2786 3300049570 Ga0501033_0511846 Ga0501033_0511846_213_746 177
2787 3300049571 Ga0501034_0000298 Ga0501034_0000298_80135_80668 177
2788 3300049571 Ga0501034_0004897 Ga0501034_0004897_1758_2291 177
2789 3300049571 Ga0501034_0006180 Ga0501034_0006180_10265_10798 177
2790 3300049571 Ga0501034_0009013 Ga0501034_0009013_9135_9668 177
2791 3300049571 Ga0501034_0012627 Ga0501034_0012627_4435_4968 177
2792 3300049571 Ga0501034_0014685 Ga0501034_0014685_2371_2904 177
2793 3300049571 Ga0501034_0030885 Ga0501034_0030885_1302_1835 177
2794 3300049571 Ga0501034_0031298 Ga0501034_0031298_2407_2940 177
2795 3300049571 Ga0501034_0073278 Ga0501034_0073278_1784_2317 177
2796 3300049571 Ga0501034_0209490 Ga0501034_0209490_57_590 177
2797 3300049571 Ga0501034_0386571 Ga0501034_0386571_178_711 177
2798 3300049571 Ga0501034_0420618 Ga0501034_0420618_156_689 177
2799 3300049572 Ga0501036_0000724 Ga0501036_0000724_16727_17260 177
2800 3300049572 Ga0501036_0002605 Ga0501036_0002605_6159_6692 177
2801 3300049572 Ga0501036_0025540 Ga0501036_0025540_2370_2903 177
2802 3300049572 Ga0501036_0194494 Ga0501036_0194494_446_979 177
2803 3300049572 Ga0501036_0236449 Ga0501036_0236449_194_727 177
2804 3300049572 Ga0501036_0256206 Ga0501036_0256206_333_866 177
2805 3300049572 Ga0501036_1008151 Ga0501036_1008151_31_564 177
2806 3300049573 Ga0501037_0000131 Ga0501037_0000131_61738_62271 177
2807 3300049573 Ga0501037_0000191 Ga0501037_0000191_48813_49346 177
2808 3300049573 Ga0501037_0000195 Ga0501037_0000195_51040_51573 177
2809 3300049573 Ga0501037_0006435 Ga0501037_0006435_1798_2331 177
2810 3300049573 Ga0501037_0270062 Ga0501037_0270062_61_594 177
2811 3300049573 Ga0501037_0838005 Ga0501037_0838005_35_568 177
2812 3300049574 Ga0501038_0000109 Ga0501038_0000109_61738_62271 177
2813 3300049574 Ga0501038_0001882 Ga0501038_0001882_11302_11835 177
2814 3300049574 Ga0501038_0005274 Ga0501038_0005274_4002_4535 177
2815 3300049574 Ga0501038_0047294 Ga0501038_0047294_2219_2752 177
2816 3300049574 Ga0501038_0158498 Ga0501038_0158498_144_677 177
2817 3300049574 Ga0501038_0468144 Ga0501038_0468144_21_554 177
2818 3300049574 Ga0501038_0702777 Ga0501038_0702777_50_583 177
2819 3300049574 Ga0501038_0757002 Ga0501038_0757002_32_565 177
2820 3300049575 Ga0501039_0000080 Ga0501039_0000080_64500_65033 177
2821 3300049575 Ga0501039_0002279 Ga0501039_0002279_7532_8065 177
2822 3300049575 Ga0501039_0032207 Ga0501039_0032207_2082_2615 177
2823 3300049575 Ga0501039_0077058 Ga0501039_0077058_974_1507 177
2824 3300049575 Ga0501039_0216355 Ga0501039_0216355_25_558 177
2825 3300049575 Ga0501039_0279144 Ga0501039_0279144_70_603 177
2826 3300049575 Ga0501039_0752592 Ga0501039_0752592_190_723 177
2827 3300049576 Ga0501040_0008666 Ga0501040_0008666_3502_4035 177
2828 3300049576 Ga0501040_0046602 Ga0501040_0046602_1297_1830 177
2829 3300049576 Ga0501040_0498267 Ga0501040_0498267_237_770 177
2830 3300049577 Ga0501041_0053535 Ga0501041_0053535_990_1523 177
2831 3300049578 Ga0501042_0060942 Ga0501042_0060942_243_776 177
2832 3300049579 Ga0501043_0000080 Ga0501043_0000080_7494_8027 177
2833 3300049579 Ga0501043_0004023 Ga0501043_0004023_7487_8020 177
2834 3300049579 Ga0501043_0015219 Ga0501043_0015219_4780_5313 177
2835 3300049579 Ga0501043_0024392 Ga0501043_0024392_1798_2331 177
2836 3300049579 Ga0501043_0052836 Ga0501043_0052836_1211_1765 177
2837 3300049579 Ga0501043_0256680 Ga0501043_0256680_338_871 177
2838 3300049579 Ga0501043_0574453 Ga0501043_0574453_230_763 177
2839 3300049579 Ga0501043_0712068 Ga0501043_0712068_46_579 177
2840 3300049580 Ga0501046_0018165 Ga0501046_0018165_2550_3083 177
2841 3300049580 Ga0501046_0048594 Ga0501046_0048594_570_1124 177
2842 3300049580 Ga0501046_0363102 Ga0501046_0363102_305_838 177
2843 3300049581 Ga0501047_0011259 Ga0501047_0011259_6136_6669 177
2844 3300049581 Ga0501047_0017299 Ga0501047_0017299_232_765 177
2845 3300049581 Ga0501047_0025104 Ga0501047_0025104_427_960 177
2846 3300049581 Ga0501047_0040375 Ga0501047_0040375_65_598 177
2847 3300049581 Ga0501047_0080199 Ga0501047_0080199_1799_2332 177
2848 3300049581 Ga0501047_0106587 Ga0501047_0106587_1322_1855 177
2849 3300049581 Ga0501047_0135845 Ga0501047_0135845_570_1124 177
2850 3300049581 Ga0501047_0224418 Ga0501047_0224418_326_859 177
2851 3300049581 Ga0501047_0235624 Ga0501047_0235624_208_741 177
2852 3300049581 Ga0501047_0549634 Ga0501047_0549634_230_763 177
2853 3300049581 Ga0501047_0911058 Ga0501047_0911058_87_620 177
2854 3300049582 Ga0501048_0030318 Ga0501048_0030318_180_713 177
2855 3300049582 Ga0501048_0235219 Ga0501048_0235219_24_557 177
2856 3300049582 Ga0501048_0639197 Ga0501048_0639197_52_606 177
2857 3300049583 Ga0501067_0054293 Ga0501067_0054293_1588_2121 177
2858 3300049583 Ga0501067_0059220 Ga0501067_0059220_806_1339 177
2859 3300049583 Ga0501067_0211083 Ga0501067_0211083_207_740 177
2860 3300049584 Ga0501068_0022655 Ga0501068_0022655_2369_2902 177
2861 3300049584 Ga0501068_0211224 Ga0501068_0211224_449_982 177
2862 3300049585 Ga0501069_0000172 Ga0501069_0000172_25998_26531 177
2863 3300049585 Ga0501069_0045997 Ga0501069_0045997_809_1342 177
2864 3300049585 Ga0501069_0059883 Ga0501069_0059883_1076_1609 177
2865 3300049585 Ga0501069_0157705 Ga0501069_0157705_186_719 177
2866 3300049586 Ga0501070_0001286 Ga0501070_0001286_9393_9926 177
2867 3300049586 Ga0501070_0006301 Ga0501070_0006301_2103_2636 177
2868 3300049586 Ga0501070_0015591 Ga0501070_0015591_1162_1695 177
2869 3300049586 Ga0501070_0018655 Ga0501070_0018655_4404_4937 177
2870 3300049586 Ga0501070_0052211 Ga0501070_0052211_882_1415 177
2871 3300049586 Ga0501070_0296563 Ga0501070_0296563_696_1229 177
2872 3300049586 Ga0501070_0634142 Ga0501070_0634142_292_825 177
2873 3300049586 Ga0501070_0798960 Ga0501070_0798960_110_643 177
2874 3300049586 Ga0501070_0897266 Ga0501070_0897266_129_662 177
2875 3300049587 Ga0501071_0050678 Ga0501071_0050678_1416_1949 177
2876 3300049588 Ga0501072_0117144 Ga0501072_0117144_764_1297 177
2877 3300049589 Ga0501073_0018884 Ga0501073_0018884_1947_2480 177
2878 3300049589 Ga0501073_0032628 Ga0501073_0032628_2934_3467 177
2879 3300049589 Ga0501073_0047706 Ga0501073_0047706_2419_2952 177
2880 3300049589 Ga0501073_0392284 Ga0501073_0392284_151_684 177
2881 3300049590 Ga0501074_0002583 Ga0501074_0002583_7473_8006 177
2882 3300049590 Ga0501074_0040640 Ga0501074_0040640_1284_1817 177
2883 3300049590 Ga0501074_0368918 Ga0501074_0368918_337_870 177
2884 3300049590 Ga0501074_0528040 Ga0501074_0528040_85_618 177
2885 3300049592 Ga0501076_0588821 Ga0501076_0588821_214_747 177
2886 3300049671 Ga0501238_015849 Ga0501238_015849_224_757 177
2887 3300049741 Ga0501079_0143858 Ga0501079_0143858_140_673 177
2888 3300049742 Ga0501080_0003453 Ga0501080_0003453_2166_2699 177
2889 3300049742 Ga0501080_0004752 Ga0501080_0004752_3448_3981 177
2890 3300049742 Ga0501080_0020715 Ga0501080_0020715_290_823 177
2891 3300049742 Ga0501080_0603270 Ga0501080_0603270_411_944 177
2892 3300049742 Ga0501080_0681820 Ga0501080_0681820_252_785 177
2893 3300049744 Ga0501083_0001214 Ga0501083_0001214_9425_9958 177
2894 3300049744 Ga0501083_0012045 Ga0501083_0012045_5271_5804 177
2895 3300049744 Ga0501083_0027007 Ga0501083_0027007_799_1332 177
2896 3300049744 Ga0501083_0366141 Ga0501083_0366141_155_709 177
2897 3300049758 Ga0501241_009543 Ga0501241_009543_224_757 177
2898 3300049776 Ga0501280_003866 Ga0501280_003866_1660_2193 177
2899 3300049822 Ga0501035_0000160 Ga0501035_0000160_7477_8010 177
2900 3300049822 Ga0501035_0000167 Ga0501035_0000167_2572_3105 177
2901 3300049822 Ga0501035_0000347 Ga0501035_0000347_51079_51612 177
2902 3300049822 Ga0501035_0002188 Ga0501035_0002188_11302_11835 177
2903 3300049822 Ga0501035_0005457 Ga0501035_0005457_11327_11860 177
2904 3300049822 Ga0501035_0009004 Ga0501035_0009004_5107_5640 177
2905 3300049822 Ga0501035_0009166 Ga0501035_0009166_4944_5477 177
2906 3300049822 Ga0501035_0022061 Ga0501035_0022061_798_1331 177
2907 3300049822 Ga0501035_0093710 Ga0501035_0093710_449_982 177
2908 3300049822 Ga0501035_0174152 Ga0501035_0174152_1084_1617 177
2909 3300049822 Ga0501035_0190500 Ga0501035_0190500_154_687 177
2910 3300049822 Ga0501035_0208235 Ga0501035_0208235_701_1234 177
2911 3300049822 Ga0501035_0508070 Ga0501035_0508070_318_851 177
2912 3300049822 Ga0501035_0851207 Ga0501035_0851207_59_592 177
2913 3300049823 Ga0501044_0000234 Ga0501044_0000234_61738_62271 177
2914 3300049823 Ga0501044_0000544 Ga0501044_0000544_40888_41421 177
2915 3300049823 Ga0501044_0009229 Ga0501044_0009229_7564_8097 177
2916 3300049823 Ga0501044_0022577 Ga0501044_0022577_3649_4182 177
2917 3300049823 Ga0501044_0050656 Ga0501044_0050656_655_1188 177
2918 3300049823 Ga0501044_0059863 Ga0501044_0059863_878_1411 177
2919 3300049823 Ga0501044_0062595 Ga0501044_0062595_949_1482 177
2920 3300049823 Ga0501044_0076474 Ga0501044_0076474_1852_2385 177
2921 3300049823 Ga0501044_0092919 Ga0501044_0092919_17_550 177
2922 3300049823 Ga0501044_0106357 Ga0501044_0106357_207_740 177
2923 3300049823 Ga0501044_0229111 Ga0501044_0229111_25_558 177
2924 3300049823 Ga0501044_0233590 Ga0501044_0233590_220_753 177
2925 3300049823 Ga0501044_0463333 Ga0501044_0463333_33_566 177
2926 3300049823 Ga0501044_0644986 Ga0501044_0644986_129_662 177
2927 3300049824 Ga0501045_0001715 Ga0501045_0001715_8949_9482 177
2928 3300049824 Ga0501045_0334010 Ga0501045_0334010_254_787 177
2929 3300049824 Ga0501045_0786164 Ga0501045_0786164_156_689 177
2930 3300049850 Ga0501204_025851 Ga0501204_025851_73_606 177
2931 3300050489 nmdc:mga03683_177435_c1 nmdc:mga03683_177435_c1_84_617 177
2932 3300050489 nmdc:mga03683_25558_c1 nmdc:mga03683_25558_c1_811_1344 177
2933 3300050489 nmdc:mga03683_348988_c1 nmdc:mga03683_348988_c1_13_546 177
2934 3300050490 nmdc:mga03n38_15142_c1 nmdc:mga03n38_15142_c1_1855_2388 177
2935 3300050490 nmdc:mga03n38_167867_c1 nmdc:mga03n38_167867_c1_190_723 177
2936 3300050490 nmdc:mga03n38_408113_c1 nmdc:mga03n38_408113_c1_168_701 177
2937 3300050490 nmdc:mga03n38_564306_c1 nmdc:mga03n38_564306_c1_49_582 177
2938 3300050490 nmdc:mga03n38_83412_c2 nmdc:mga03n38_83412_c2_84_617 177
2939 3300050491 nmdc:mga00v17_1284_c1 nmdc:mga00v17_1284_c1_9988_10521 177
2940 3300050491 nmdc:mga00v17_243765_c1 nmdc:mga00v17_243765_c1_576_1109 177
2941 3300050491 nmdc:mga00v17_257607_c1 nmdc:mga00v17_257607_c1_379_912 177
2942 3300050491 nmdc:mga00v17_26923_c1 nmdc:mga00v17_26923_c1_1042_1575 177
2943 3300050491 nmdc:mga00v17_818324_c1 nmdc:mga00v17_818324_c1_35_568 177
2944 3300050492 nmdc:mga0yw44_126980_c1 nmdc:mga0yw44_126980_c1_573_1106 177
2945 3300050492 nmdc:mga0yw44_167639_c1 nmdc:mga0yw44_167639_c1_144_677 177
2946 3300050492 nmdc:mga0yw44_174646_c1 nmdc:mga0yw44_174646_c1_505_1038 177
2947 3300050492 nmdc:mga0yw44_175118_c1 nmdc:mga0yw44_175118_c1_251_784 177
2948 3300050492 nmdc:mga0yw44_231648_c1 nmdc:mga0yw44_231648_c1_551_1084 177
2949 3300050492 nmdc:mga0yw44_24060_c1 nmdc:mga0yw44_24060_c1_2498_3031 177
2950 3300050492 nmdc:mga0yw44_29953_c1 nmdc:mga0yw44_29953_c1_2077_2610 177
2951 3300050492 nmdc:mga0yw44_3148_c2 nmdc:mga0yw44_3148_c2_936_1469 177
2952 3300050492 nmdc:mga0yw44_53959_c1 nmdc:mga0yw44_53959_c1_953_1486 177
2953 3300050492 nmdc:mga0yw44_57394_c1 nmdc:mga0yw44_57394_c1_104_637 177
2954 3300050492 nmdc:mga0yw44_622060_c1 nmdc:mga0yw44_622060_c1_174_707 177
2955 3300050492 nmdc:mga0yw44_68829_c1 nmdc:mga0yw44_68829_c1_529_1062 177
2956 3300050493 nmdc:mga0k408_20070_c1 nmdc:mga0k408_20070_c1_1667_2200 177
2957 3300050493 nmdc:mga0k408_240627_c1 nmdc:mga0k408_240627_c1_495_1028 177
2958 3300050493 nmdc:mga0k408_263196_c1 nmdc:mga0k408_263196_c1_469_1002 177
2959 3300050493 nmdc:mga0k408_439977_c1 nmdc:mga0k408_439977_c1_166_699 177
2960 3300050494 nmdc:mga06z11_118295_c1 nmdc:mga06z11_118295_c1_867_1400 177
2961 3300050494 nmdc:mga06z11_167200_c1 nmdc:mga06z11_167200_c1_173_706 177
2962 3300050494 nmdc:mga06z11_384457_c1 nmdc:mga06z11_384457_c1_88_621 177
2963 3300050494 nmdc:mga06z11_471270_c1 nmdc:mga06z11_471270_c1_144_677 177
2964 3300050494 nmdc:mga06z11_70427_c1 nmdc:mga06z11_70427_c1_518_1051 177
2965 3300050494 nmdc:mga06z11_76642_c2 nmdc:mga06z11_76642_c2_846_1379 177
2966 3300050495 nmdc:mga04h51_20498_c1 nmdc:mga04h51_20498_c1_928_1461 177
2967 3300050495 nmdc:mga04h51_40208_c1 nmdc:mga04h51_40208_c1_904_1437 177
2968 3300050495 nmdc:mga04h51_80770_c1 nmdc:mga04h51_80770_c1_448_981 177
2969 3300050496 nmdc:mga07m45_187182_c1 nmdc:mga07m45_187182_c1_26_559 177
2970 3300050496 nmdc:mga07m45_199906_c1 nmdc:mga07m45_199906_c1_86_619 177
2971 3300050496 nmdc:mga07m45_292431_c1 nmdc:mga07m45_292431_c1_355_888 177
2972 3300050496 nmdc:mga07m45_480802_c1 nmdc:mga07m45_480802_c1_130_663 177
2973 3300050496 nmdc:mga07m45_65659_c1 nmdc:mga07m45_65659_c1_609_1142 177
2974 3300050496 nmdc:mga07m45_68266_c1 nmdc:mga07m45_68266_c1_885_1418 177
2975 3300050496 nmdc:mga07m45_87948_c1 nmdc:mga07m45_87948_c1_175_708 177
2976 3300050508 nmdc:mga09592_1193976_c1 nmdc:mga09592_1193976_c1_33_566 177
2977 3300050509 nmdc:mga0qj67_328369_c1 nmdc:mga0qj67_328369_c1_657_1190 177
2978 3300050512 nmdc:mga0n895_442643_c1 nmdc:mga0n895_442643_c1_121_654 177
2979 3300050512 nmdc:mga0n895_5268_c1 nmdc:mga0n895_5268_c1_345_878 177
2980 3300050513 nmdc:mga0rr50_615796_c1 nmdc:mga0rr50_615796_c1_324_857 177
2981 3300050516 nmdc:mga0sz30_130156_c1 nmdc:mga0sz30_130156_c1_378_911 177
2982 3300050516 nmdc:mga0sz30_132964_c1 nmdc:mga0sz30_132964_c1_362_895 177
2983 3300050516 nmdc:mga0sz30_146402_c1 nmdc:mga0sz30_146402_c1_48_581 177
2984 3300050516 nmdc:mga0sz30_17788_c1 nmdc:mga0sz30_17788_c1_685_1218 177
2985 3300050516 nmdc:mga0sz30_236683_c1 nmdc:mga0sz30_236683_c1_136_669 177
2986 3300050516 nmdc:mga0sz30_24769_c1 nmdc:mga0sz30_24769_c1_1145_1678 177
2987 3300053077 Ga0495601_0056376 Ga0495601_0056376_898_1431 177
2988 3300053077 Ga0495601_0158728 Ga0495601_0158728_910_1443 177
2989 3300053077 Ga0495601_0234530 Ga0495601_0234530_130_663 177
2990 3300053078 Ga0495612_0052075 Ga0495612_0052075_249_782 177
2991 3300053078 Ga0495612_0137090 Ga0495612_0137090_66_599 177
2992 3300053079 Ga0500610_0086740 Ga0500610_0086740_809_1342 177
2993 3300053079 Ga0500610_0102190 Ga0500610_0102190_445_978 177
2994 3300053080 Ga0500635_0095247 Ga0500635_0095247_243_776 177
2995 3300053083 Ga0495655_0013054 Ga0495655_0013054_1002_1535 177
2996 3300053083 Ga0495655_0033255 Ga0495655_0033255_64_597 177
2997 3300053084 Ga0495595_0006801 Ga0495595_0006801_122_655 177
2998 3300053085 Ga0495619_0001443 Ga0495619_0001443_13238_13771 177
2999 3300053086 Ga0500578_0014351 Ga0500578_0014351_116_649 177
3000 3300053086 Ga0500578_0015697 Ga0500578_0015697_388_921 177
3001 3300053086 Ga0500578_0084328 Ga0500578_0084328_996_1529 177
3002 3300053086 Ga0500578_0178822 Ga0500578_0178822_187_720 177
3003 3300053087 Ga0500643_021452 Ga0500643_021452_194_727 177
3004 3300053088 Ga0500644_0008515 Ga0500644_0008515_1842_2375 177
3005 3300053088 Ga0500644_0268444 Ga0500644_0268444_29_562 177
3006 3300053090 Ga0500646_0013276 Ga0500646_0013276_94_627 177
3007 3300053090 Ga0500646_0187275 Ga0500646_0187275_60_593 177
3008 3300053091 Ga0500647_0082642 Ga0500647_0082642_593_1126 177
3009 3300053092 Ga0500583_0251208 Ga0500583_0251208_278_811 177
3010 3300053093 Ga0500651_0021718 Ga0500651_0021718_1180_1713 177
3011 3300053093 Ga0500651_0224117 Ga0500651_0224117_311_844 177
3012 3300053093 Ga0500651_0268116 Ga0500651_0268116_130_663 177
3013 3300053093 Ga0500651_0286415 Ga0500651_0286415_73_606 177
3014 3300053094 Ga0500566_0000320 Ga0500566_0000320_17540_18073 177
3015 3300053094 Ga0500566_0361817 Ga0500566_0361817_17_550 177
3016 3300053095 Ga0500640_031882 Ga0500640_031882_632_1165 177
3017 3300053096 Ga0500641_0003415 Ga0500641_0003415_3449_3982 177
3018 3300053098 Ga0500650_0001944 Ga0500650_0001944_1134_1667 177
3019 3300053098 Ga0500650_0275431 Ga0500650_0275431_120_653 177
3020 3300053099 Ga0500654_132521 Ga0500654_132521_271_807 177
3021 3300053102 Ga0500554_085161 Ga0500554_085161_496_1029 177
3022 3300053102 Ga0500554_103480 Ga0500554_103480_396_929 177
3023 3300053103 Ga0500555_030794 Ga0500555_030794_320_853 177
3024 3300053103 Ga0500555_096216 Ga0500555_096216_38_574 177
3025 3300053104 Ga0500556_0000125 Ga0500556_0000125_57706_58239 177
3026 3300053104 Ga0500556_0301825 Ga0500556_0301825_49_582 177
3027 3300053105 Ga0500557_156065 Ga0500557_156065_88_621 177
3028 3300053108 Ga0500562_029407 Ga0500562_029407_347_880 177
3029 3300053108 Ga0500562_051142 Ga0500562_051142_188_721 177
3030 3300053109 Ga0500569_015781 Ga0500569_015781_369_902 177
3031 3300053109 Ga0500569_123083 Ga0500569_123083_139_672 177
3032 3300053111 Ga0500572_001453 Ga0500572_001453_527_1060 177
3033 3300053111 Ga0500572_003008 Ga0500572_003008_819_1352 177
3034 3300053111 Ga0500572_004079 Ga0500572_004079_549_1082 177
3035 3300053116 Ga0500592_012356 Ga0500592_012356_520_1053 177
3036 3300053118 Ga0500594_0003742 Ga0500594_0003742_1232_1765 177
3037 3300053118 Ga0500594_0128286 Ga0500594_0128286_50_583 177
3038 3300053119 Ga0500595_016409 Ga0500595_016409_817_1350 177
3039 3300053119 Ga0500595_029914 Ga0500595_029914_1119_1652 177
3040 3300053119 Ga0500595_070086 Ga0500595_070086_438_971 177
3041 3300053121 Ga0500607_099409 Ga0500607_099409_477_1010 177
3042 3300053122 Ga0500608_075094 Ga0500608_075094_898_1431 177
3043 3300053123 Ga0500614_014604 Ga0500614_014604_598_1131 177
3044 3300053123 Ga0500614_148761 Ga0500614_148761_91_624 177
3045 3300053125 Ga0500618_007381 Ga0500618_007381_63_596 177
3046 3300053125 Ga0500618_021998 Ga0500618_021998_830_1363 177
3047 3300053125 Ga0500618_048846 Ga0500618_048846_128_661 177
3048 3300053128 Ga0500626_191428 Ga0500626_191428_272_805 177
3049 3300053130 Ga0500642_0000105 Ga0500642_0000105_7571_8104 177
3050 3300053131 Ga0500652_000301 Ga0500652_000301_11352_11885 177
3051 3300053133 Ga0500655_069503 Ga0500655_069503_136_669 177
3052 3300053134 Ga0500658_0041978 Ga0500658_0041978_905_1438 177
3053 3300053134 Ga0500658_0132638 Ga0500658_0132638_326_859 177
3054 3300053134 Ga0500658_0163884 Ga0500658_0163884_377_910 177
3055 3300053136 Ga0500559_0002803 Ga0500559_0002803_2435_2968 177
3056 3300053136 Ga0500559_0004117 Ga0500559_0004117_5621_6154 177
3057 3300053136 Ga0500559_0094839 Ga0500559_0094839_230_763 177
3058 3300053138 Ga0500564_189623 Ga0500564_189623_44_577 177
3059 3300053139 Ga0500568_0001953 Ga0500568_0001953_4513_5127 177
3060 3300053139 Ga0500568_0003848 Ga0500568_0003848_3720_4253 177
3061 3300053139 Ga0500568_0050784 Ga0500568_0050784_856_1389 177
3062 3300053139 Ga0500568_0054507 Ga0500568_0054507_247_780 177
3063 3300053139 Ga0500568_0060124 Ga0500568_0060124_48_581 177
3064 3300053140 Ga0500573_0051024 Ga0500573_0051024_1131_1664 177
3065 3300053142 Ga0500577_0083822 Ga0500577_0083822_711_1244 177
3066 3300053145 Ga0500586_000283 Ga0500586_000283_2641_3174 177
3067 3300053146 Ga0500588_0027678 Ga0500588_0027678_763_1296 177
3068 3300053148 Ga0500590_019927 Ga0500590_019927_1710_2243 177
3069 3300053148 Ga0500590_082463 Ga0500590_082463_80_613 177
3070 3300053150 Ga0500603_009617 Ga0500603_009617_632_1165 177
3071 3300053151 Ga0500604_0036252 Ga0500604_0036252_372_905 177
3072 3300053151 Ga0500604_0049762 Ga0500604_0049762_15_548 177
3073 3300053153 Ga0500616_0000876 Ga0500616_0000876_25064_25597 177
3074 3300053153 Ga0500616_0004053 Ga0500616_0004053_7761_8294 177
3075 3300053153 Ga0500616_0015762 Ga0500616_0015762_337_870 177
3076 3300053153 Ga0500616_0023156 Ga0500616_0023156_1062_1595 177
3077 3300053153 Ga0500616_0037795 Ga0500616_0037795_393_926 177
3078 3300053153 Ga0500616_0091357 Ga0500616_0091357_146_679 177
3079 3300053153 Ga0500616_0140697 Ga0500616_0140697_153_686 177
3080 3300053155 Ga0500620_001784 Ga0500620_001784_2386_2919 177
3081 3300053155 Ga0500620_106040 Ga0500620_106040_299_832 177
3082 3300053156 Ga0500622_0001277 Ga0500622_0001277_16468_17001 177
3083 3300053156 Ga0500622_0004034 Ga0500622_0004034_5819_6352 177
3084 3300053156 Ga0500622_0071766 Ga0500622_0071766_863_1396 177
3085 3300053157 Ga0500624_003843 Ga0500624_003843_1090_1623 177
3086 3300053157 Ga0500624_014638 Ga0500624_014638_458_994 177
3087 3300053158 Ga0500627_0004443 Ga0500627_0004443_1984_2517 177
3088 3300053158 Ga0500627_0057865 Ga0500627_0057865_546_1079 177
3089 3300053158 Ga0500627_0064661 Ga0500627_0064661_723_1256 177
3090 3300053158 Ga0500627_0075227 Ga0500627_0075227_257_790 177
3091 3300053158 Ga0500627_0228549 Ga0500627_0228549_164_697 177
3092 3300053159 Ga0500630_030399 Ga0500630_030399_444_977 177
3093 3300053160 Ga0500633_0133711 Ga0500633_0133711_51_584 177
3094 3300053160 Ga0500633_0148145 Ga0500633_0148145_113_646 177
3095 3300053161 Ga0500634_0094521 Ga0500634_0094521_654_1187 177
3096 3300053162 Ga0500638_135474 Ga0500638_135474_478_1011 177
3097 3300053162 Ga0500638_202755 Ga0500638_202755_222_755 177
3098 3300053163 Ga0500639_002134 Ga0500639_002134_3939_4472 177
3099 3300053163 Ga0500639_099603 Ga0500639_099603_645_1178 177
3100 3300053177 Ga0500636_0004057 Ga0500636_0004057_6794_7327 177
3101 3300053177 Ga0500636_0105133 Ga0500636_0105133_126_659 177
3102 3300053177 Ga0500636_0122353 Ga0500636_0122353_829_1362 177
3103 3300053177 Ga0500636_0210649 Ga0500636_0210649_408_941 177
3104 3300053177 Ga0500636_0241209 Ga0500636_0241209_45_578 177
3105 3300053178 Ga0500637_0022986 Ga0500637_0022986_1262_1795 177
3106 3300053178 Ga0500637_0073848 Ga0500637_0073848_1406_1939 177
3107 3300053723 Ga0500567_099548 Ga0500567_099548_249_782 177
3108 3300053727 Ga0500611_000533 Ga0500611_000533_2942_3475 177
3109 3300053727 Ga0500611_017745 Ga0500611_017745_191_724 177
3110 3300053730 Ga0500645_012887 Ga0500645_012887_425_958 177
3111 3300053730 Ga0500645_095920 Ga0500645_095920_103_636 177
3112 3300053730 Ga0500645_100114 Ga0500645_100114_75_686 177
3113 3300053731 Ga0500609_001189 Ga0500609_001189_1157_1690 177
3114 3300053731 Ga0500609_012600 Ga0500609_012600_273_806 177
3115 3300053733 Ga0500552_001810 Ga0500552_001810_1242_1775 177
3116 3300053735 Ga0500596_002522 Ga0500596_002522_1514_2047 177
3117 3300053735 Ga0500596_002612 Ga0500596_002612_18_551 177
3118 3300053735 Ga0500596_005669 Ga0500596_005669_497_1030 177
3119 3300053737 Ga0500601_000668 Ga0500601_000668_845_1378 177
3120 3300054114 Ga0501084_0208952 Ga0501084_0208952_21_554 177
3121 3300059477 Ga0587084_002030 Ga0587084_002030_1450_1983 177
3122 3300059477 Ga0587084_020477 Ga0587084_020477_107_640 177
3123 3300059477 Ga0587084_027157 Ga0587084_027157_52_585 177
3124 3300059477 Ga0587084_065251 Ga0587084_065251_25_558 177
3125 3300059478 Ga0587093_006135 Ga0587093_006135_352_885 177
3126 3300059478 Ga0587093_025816 Ga0587093_025816_140_673 177
3127 3300059490 Ga0587066_016961 Ga0587066_016961_99_632 177
3128 3300059490 Ga0587066_025694 Ga0587066_025694_223_756 177
3129 3300059490 Ga0587066_049213 Ga0587066_049213_36_569 177
3130 3300059490 Ga0587066_092013 Ga0587066_092013_27_560 177
3131 3300059491 Ga0587070_003021 Ga0587070_003021_958_1491 177
3132 3300059491 Ga0587070_021067 Ga0587070_021067_221_754 177
3133 3300059491 Ga0587070_028503 Ga0587070_028503_268_801 177
3134 3300059491 Ga0587070_050158 Ga0587070_050158_58_591 177
3135 3300059492 Ga0587073_0002863 Ga0587073_0002863_102_635 177
3136 3300059492 Ga0587073_0003501 Ga0587073_0003501_667_1200 177
3137 3300059492 Ga0587073_0020094 Ga0587073_0020094_547_1080 177
3138 3300059492 Ga0587073_0077065 Ga0587073_0077065_263_796 177
3139 3300059493 Ga0587077_000009 Ga0587077_000009_1848_2381 177
3140 3300059493 Ga0587077_000966 Ga0587077_000966_1788_2321 177
3141 3300059493 Ga0587077_001192 Ga0587077_001192_1975_2508 177
3142 3300059493 Ga0587077_007037 Ga0587077_007037_975_1508 177
3143 3300059493 Ga0587077_084584 Ga0587077_084584_87_620 177
3144 3300059493 Ga0587077_086847 Ga0587077_086847_96_629 177
3145 3300059493 Ga0587077_100241 Ga0587077_100241_76_609 177
3146 3300059503 Ga0587080_001548 Ga0587080_001548_1450_1983 177
3147 3300059503 Ga0587080_025000 Ga0587080_025000_384_917 177
3148 3300059503 Ga0587080_030585 Ga0587080_030585_245_778 177
3149 3300059503 Ga0587080_046042 Ga0587080_046042_97_630 177
3150 3300059503 Ga0587080_055123 Ga0587080_055123_132_665 177
3151 3300059503 Ga0587080_073464 Ga0587080_073464_114_647 177
3152 3300059503 Ga0587080_080642 Ga0587080_080642_47_580 177
3153 3300059504 Ga0587082_002172 Ga0587082_002172_1542_2075 177
3154 3300059504 Ga0587082_010331 Ga0587082_010331_97_630 177
3155 3300059504 Ga0587082_011836 Ga0587082_011836_613_1146 177
3156 3300059504 Ga0587082_018124 Ga0587082_018124_205_738 177
3157 3300059504 Ga0587082_060319 Ga0587082_060319_38_571 177
3158 3300059505 Ga0587083_0000779 Ga0587083_0000779_1422_1955 177
3159 3300059505 Ga0587083_0005010 Ga0587083_0005010_1022_1555 177
3160 3300059505 Ga0587083_0009643 Ga0587083_0009643_64_597 177
3161 3300059505 Ga0587083_0048563 Ga0587083_0048563_144_677 177
3162 3300059505 Ga0587083_0063068 Ga0587083_0063068_217_750 177
3163 3300059505 Ga0587083_0070597 Ga0587083_0070597_18_551 177
3164 3300059505 Ga0587083_0143102 Ga0587083_0143102_44_577 177
3165 3300059507 Ga0587086_012441 Ga0587086_012441_208_741 177
3166 3300059507 Ga0587086_019666 Ga0587086_019666_189_722 177
3167 3300059507 Ga0587086_025772 Ga0587086_025772_200_733 177
3168 3300059508 Ga0587088_003238 Ga0587088_003238_887_1420 177
3169 3300059508 Ga0587088_005796 Ga0587088_005796_414_947 177
3170 3300059508 Ga0587088_092060 Ga0587088_092060_84_617 177
3171 3300059509 Ga0587089_014607 Ga0587089_014607_19_552 177
3172 3300059510 Ga0587090_014809 Ga0587090_014809_188_721 177
3173 3300059510 Ga0587090_033265 Ga0587090_033265_198_731 177
3174 3300059510 Ga0587090_044553 Ga0587090_044553_28_561 177
3175 3300059511 Ga0587091_002706 Ga0587091_002706_1135_1668 177
3176 3300059511 Ga0587091_030088 Ga0587091_030088_331_864 177
3177 3300059511 Ga0587091_069227 Ga0587091_069227_188_721 177
3178 3300059511 Ga0587091_123639 Ga0587091_123639_61_594 177
3179 3300059512 Ga0587092_030647 Ga0587092_030647_216_749 177
3180 3300059513 Ga0587094_003207 Ga0587094_003207_473_1006 177
3181 3300059513 Ga0587094_010537 Ga0587094_010537_288_821 177
3182 3300059513 Ga0587094_025919 Ga0587094_025919_150_683 177
3183 3300059514 Ga0587095_001259 Ga0587095_001259_469_1002 177
3184 3300059605 Ga0587106_000532 Ga0587106_000532_97_630 177
3185 3300059605 Ga0587106_001821 Ga0587106_001821_962_1495 177
3186 3300059605 Ga0587106_032656 Ga0587106_032656_51_584 177
3187 3300059605 Ga0587106_048323 Ga0587106_048323_64_597 177
3188 3300059605 Ga0587106_065610 Ga0587106_065610_33_566 177
3189 3300059607 Ga0587125_000201 Ga0587125_000201_1187_1720 177
3190 3300059622 Ga0587099_000819 Ga0587099_000819_1409_1942 177
3191 3300059623 Ga0587101_000083 Ga0587101_000083_342_875 177
3192 3300059623 Ga0587101_001406 Ga0587101_001406_1089_1622 177
3193 3300059623 Ga0587101_001709 Ga0587101_001709_57_590 177
3194 3300059623 Ga0587101_026514 Ga0587101_026514_88_621 177
3195 3300059623 Ga0587101_033032 Ga0587101_033032_237_770 177
3196 3300059625 Ga0587113_018961 Ga0587113_018961_92_625 177
3197 3300059627 Ga0587117_001509 Ga0587117_001509_1116_1649 177
3198 3300059630 Ga0587128_001043 Ga0587128_001043_471_1004 177
3199 3300059630 Ga0587128_002525 Ga0587128_002525_1187_1720 177
3200 3300059630 Ga0587128_014831 Ga0587128_014831_252_785 177
3201 3300059639 Ga0587062_001045 Ga0587062_001045_201_734 177
3202 3300059640 Ga0587067_000579 Ga0587067_000579_1494_2027 177
3203 3300059640 Ga0587067_002914 Ga0587067_002914_1305_1838 177
3204 3300059640 Ga0587067_020253 Ga0587067_020253_188_721 177
3205 3300059640 Ga0587067_040989 Ga0587067_040989_254_787 177
3206 3300059641 Ga0587068_004710 Ga0587068_004710_1096_1629 177
3207 3300059641 Ga0587068_005189 Ga0587068_005189_543_1076 177
3208 3300059641 Ga0587068_017886 Ga0587068_017886_84_617 177
3209 3300059641 Ga0587068_027314 Ga0587068_027314_143_676 177
3210 3300059642 Ga0587069_000933 Ga0587069_000933_1414_1947 177
3211 3300059642 Ga0587069_007649 Ga0587069_007649_169_702 177
3212 3300059642 Ga0587069_066102 Ga0587069_066102_98_631 177
3213 3300059643 Ga0587072_001084 Ga0587072_001084_1168_1701 177
3214 3300059643 Ga0587072_023890 Ga0587072_023890_120_653 177
3215 3300059643 Ga0587072_057239 Ga0587072_057239_19_552 177
3216 3300059644 Ga0587075_007386 Ga0587075_007386_761_1294 177
3217 3300059644 Ga0587075_045319 Ga0587075_045319_167_700 177
3218 3300059645 Ga0587076_001067 Ga0587076_001067_1258_1791 177
3219 3300059645 Ga0587076_002866 Ga0587076_002866_1327_1860 177
3220 3300059645 Ga0587076_006339 Ga0587076_006339_114_647 177
3221 3300059645 Ga0587076_012964 Ga0587076_012964_453_986 177
3222 3300059645 Ga0587076_013372 Ga0587076_013372_455_988 177
3223 3300059645 Ga0587076_040978 Ga0587076_040978_27_560 177
3224 3300059645 Ga0587076_047296 Ga0587076_047296_100_633 177
3225 3300059646 Ga0587078_001949 Ga0587078_001949_60_593 177
3226 3300059646 Ga0587078_003530 Ga0587078_003530_787_1320 177
3227 3300059646 Ga0587078_011343 Ga0587078_011343_189_722 177
3228 3300059646 Ga0587078_025263 Ga0587078_025263_60_593 177
3229 3300059647 Ga0587079_001640 Ga0587079_001640_1512_2045 177
3230 3300059647 Ga0587079_001675 Ga0587079_001675_1695_2228 177
3231 3300059647 Ga0587079_035708 Ga0587079_035708_254_787 177
3232 3300059647 Ga0587079_081662 Ga0587079_081662_28_561 177
3233 3300059648 Ga0587100_000435 Ga0587100_000435_321_854 177
3234 3300059648 Ga0587100_009027 Ga0587100_009027_12_545 177
3235 3300059649 Ga0587102_001812 Ga0587102_001812_472_1005 177
3236 3300059649 Ga0587102_013443 Ga0587102_013443_206_739 177
3237 3300059650 Ga0587104_000880 Ga0587104_000880_320_853 177
3238 3300059651 Ga0587105_000231 Ga0587105_000231_1457_1990 177
3239 3300059652 Ga0587107_000246 Ga0587107_000246_1175_1708 177
3240 3300059652 Ga0587107_011972 Ga0587107_011972_199_732 177
3241 3300059652 Ga0587107_026748 Ga0587107_026748_25_558 177
3242 3300059652 Ga0587107_030915 Ga0587107_030915_199_732 177
3243 3300059652 Ga0587107_032044 Ga0587107_032044_109_642 177
3244 3300059652 Ga0587107_050262 Ga0587107_050262_109_642 177
3245 3300059652 Ga0587107_063701 Ga0587107_063701_27_560 177
3246 3300059654 Ga0587110_003745 Ga0587110_003745_564_1097 177
3247 3300059655 Ga0587114_015371 Ga0587114_015371_19_552 177
3248 3300059657 Ga0587118_01321 Ga0587118_01321_833_1366 177
3249 3300059660 Ga0587124_001062 Ga0587124_001062_984_1517 177
3250 3300060344 Ga0587071_004370 Ga0587071_004370_100_633 177
3251 3300060344 Ga0587071_038692 Ga0587071_038692_223_756 177
3252 3300060344 Ga0587071_039260 Ga0587071_039260_264_797 177
3253 3300060344 Ga0587071_084729 Ga0587071_084729_65_598 177
3254 3300060346 Ga0587111_0008874 Ga0587111_0008874_976_1509 177
3255 3300060346 Ga0587111_0021561 Ga0587111_0021561_63_596 177
3256 3300060346 Ga0587111_0026461 Ga0587111_0026461_271_804 177
3257 3300060353 Ga0501082_0077674 Ga0501082_0077674_1281_1814 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

117

192

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

38

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.9368 8 165
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9334 7 171
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9272 10 167
5imq-assembly1.cif.gz_e structure of ribosome bound to cofactor at 3.8 angstrom resolution 0.9212 8 163
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9197 7 171
ID Description Score Start End Superfamily
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9239 83 160 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9159 83 168 3.90.930.12
af_P54042_8_87_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9112 7 83 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9064 3 82 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9031 83 173 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A356S592-F1-model_v4 50S ribosomal protein L6 0.9593 8 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A436W0A1-F1-model_v4 50S ribosomal protein L6 0.9382 1 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G0LBH2-F1-model_v4 50S ribosomal protein L6 0.9349 8 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A356S592-F1-model_v4 50S ribosomal protein L6 0.9344 8 79 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7X0FNZ1-F1-model_v4 50S ribosomal protein L6 0.9341 16 171 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
72.25 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map