F497113

General Info

Members Datasets Scaffolds Average Seq Length
2866 844 2741 195

Family's Representative Sequence

Representative Sequence 3300003784|Ga0055534_1014646|Ga0055534_10146462
Length 226
Sequence MTDNAQQETTAAESPSSKKRWYVVHAYSGMEKSVQRALQERIERAEMQDKFGRILVPSEEVVEIKGGHKSVTERRFFPGYVLVEMEMTDETWHLVKNTSKVTGFVGGARNRPSPISQREVDKIMTQMQEGVEKPRPKTLFEVGEMVRVKDGPFTDFNGNVEEVNYEKSRLRFKDFDRGDPQGPSRKDRAGRKSCPKRSVRPYPGMAIARYDSTGSSSRMGMGSGLE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
6 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
7 2547132374 Acidovorax radicis N35 Isolate Unclassified
8 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
9 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
10 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
11 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
12 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
13 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
14 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
15 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
16 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
17 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
18 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
19 2643221556 Massilia sp. Root1485 Isolate Unclassified
20 2643221570 Acidovorax sp. Root568 Isolate Unclassified
21 2643221585 Pelomonas sp. Root662 Isolate Unclassified
22 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
23 2643221596 Acidovorax sp. Root70 Isolate Unclassified
24 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
25 2643221609 Acidovorax sp. Root217 Isolate Unclassified
26 2643221611 Acidovorax sp. Root219 Isolate Unclassified
27 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
28 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
29 2643221638 Duganella sp. Root336D2 Isolate Unclassified
30 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
31 2643221645 Massilia sp. Root351 Isolate Unclassified
32 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
33 2643221652 Acidovorax sp. Root402 Isolate Unclassified
34 2643221656 Pelomonas sp. Root405 Isolate Unclassified
35 2643221658 Variovorax sp. Root411 Isolate Unclassified
36 2643221660 Methylibium sp. Root1272 Isolate Unclassified
37 2643221664 Massilia sp. Root418 Isolate Unclassified
38 2643221672 Variovorax sp. Root434 Isolate Unclassified
39 2643221683 Variovorax sp. Root473 Isolate Unclassified
40 2643221684 Massilia sp. Root133 Isolate Unclassified
41 2643221717 Acidovorax sp. Root267 Isolate Unclassified
42 2721755523 Delftia sp. HK171 Isolate Unclassified
43 2738541277 Variovorax sp. GV051 Isolate Unclassified
44 2738541280 Massilia sp. GV090 Isolate Unclassified
45 2738541297 Duganella sp. GV083 Isolate Unclassified
46 2738541300 Massilia sp. GV016 Isolate Unclassified
47 2738541307 Variovorax sp. GV008 Isolate Unclassified
48 2738541357 Duganella sp. GV053 Isolate Unclassified
49 2738543003 Duganella sp. GV066 Isolate Unclassified
50 2738543012 Acidovorax sp. CF301 Isolate Unclassified
51 2738543013 Variovorax sp. BT01 Isolate Unclassified
52 2738543018 Massilia sp. GV045 Isolate Unclassified
53 2738543019 Variovorax sp. GV040 Isolate Unclassified
54 2738543026 Duganella sp. GV089 Isolate Unclassified
55 2738543029 Duganella sp. GV039 Isolate Unclassified
56 2738543030 Massilia sp. GV097 Isolate Unclassified
57 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
58 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
59 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
60 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
61 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
62 2816332133 Acidovorax radicis 2721A Isolate Unclassified
63 2818991446 Variovorax sp. 1180 Isolate Unclassified
64 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
65 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
66 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
67 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
68 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
69 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
70 2842677519 Variovorax sp. R-72495 Isolate Unclassified
71 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
72 2842733646 Variovorax sp. R-72446 Isolate Unclassified
73 2842747753 Variovorax sp. R-72060 Isolate Unclassified
74 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
75 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
76 2857553236 Duganella sp. R-74557 Isolate Unclassified
77 2857564685 Duganella sp. R-74599 Isolate Unclassified
78 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
79 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
80 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
81 2885198086 Variovorax sp. 679 Isolate Unclassified
82 2885211737 Variovorax sp. 553 Isolate Unclassified
83 2885266251 Ralstonia sp. SET104 Isolate Nodule
84 2899924645 Variovorax sp. 369 Isolate Unclassified
85 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
86 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
87 2904424332 Duganella sp. 1411 Isolate Rhizosphere
88 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
89 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
90 2904456579 Variovorax sp. 2002 Isolate Unclassified
91 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
92 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
93 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
94 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
95 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
96 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
97 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
98 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
99 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
100 2919476304 Duganella sp. 3397 Isolate Unclassified
101 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
102 2928037797 Variovorax sp. 1126 Isolate Unclassified
103 2928044640 Variovorax sp. 1128 Isolate Unclassified
104 2928051484 Variovorax sp. 1133 Isolate Unclassified
105 2928058823 Ralstonia sp. 1138 Isolate Unclassified
106 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
107 2928070936 Variovorax gossypii 1167 Isolate Unclassified
108 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
109 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
110 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
111 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
112 2929520902 Variovorax beijingensis 502 Isolate Unclassified
113 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
114 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
115 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
116 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
117 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
118 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
119 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
120 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
121 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
122 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
123 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
124 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
125 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
126 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
127 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
128 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
129 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
130 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
131 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
132 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
133 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
134 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
135 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
136 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
137 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
138 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
139 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
140 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
141 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
142 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
143 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
144 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
145 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
148 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
149 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
150 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
151 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
152 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
153 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
154 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
155 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
156 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
157 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
158 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
159 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
160 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
161 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
162 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
163 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
164 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
165 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
166 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
167 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
168 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
169 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
171 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
172 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
173 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
174 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
175 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
176 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
177 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
178 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
179 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
180 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
181 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
182 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
183 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
184 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
185 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
186 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
187 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
188 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
189 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
190 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
191 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
192 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
193 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
194 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
195 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
196 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
197 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
198 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
199 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
200 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
201 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
202 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
203 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
204 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
205 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
206 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
207 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
208 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
209 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
210 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
211 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
212 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
213 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
214 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
215 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
216 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
217 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
218 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
219 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
220 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
221 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
222 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
223 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
224 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
225 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
226 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
227 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
228 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
229 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
230 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
231 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
232 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
233 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
234 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
235 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
236 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
237 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
238 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
239 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
240 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
241 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
242 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
243 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
244 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
245 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
246 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
247 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
248 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
249 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
250 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
251 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
252 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
253 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
254 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
255 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
256 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
257 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
258 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
259 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
260 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
261 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
262 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
263 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
264 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
265 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
266 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
267 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
268 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
269 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
270 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
273 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
274 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
275 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
276 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
277 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
278 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
279 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
280 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
281 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
282 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
283 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
284 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
285 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
286 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
287 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
288 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
289 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
290 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
291 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
292 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
293 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
294 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
295 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
296 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
297 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
298 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
299 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
300 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
301 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
302 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
303 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
304 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
305 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
306 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
307 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
308 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
309 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
310 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
312 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
313 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
314 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
315 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
316 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
317 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
318 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
319 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
320 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
322 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
323 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
324 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
325 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
332 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
334 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
335 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
336 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
339 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
340 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
341 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
342 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
344 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
345 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
348 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
349 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
350 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
352 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
353 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
414 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
415 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
416 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
418 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
420 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
423 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
425 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
427 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
431 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
432 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
433 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
434 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
435 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
436 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
437 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
438 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
439 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
440 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
441 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
442 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
443 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
444 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
445 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
446 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
447 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
452 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
453 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
454 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
455 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
456 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
457 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
458 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
459 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
460 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
461 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
463 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
464 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
465 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
466 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
467 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
468 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
469 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
470 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
471 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
472 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
473 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
474 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
475 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
476 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
477 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
478 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
479 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
480 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
481 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
482 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
483 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
484 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
485 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
486 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
487 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
488 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
489 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
490 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
491 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
492 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
493 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
494 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
495 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
496 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
497 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
498 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
499 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
500 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
501 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
502 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
503 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
504 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
505 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
506 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
507 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
508 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
509 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
510 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
511 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
512 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
513 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
514 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
515 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
516 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
517 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
518 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
519 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
520 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
521 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
522 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
523 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
524 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
525 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
526 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
527 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
528 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
529 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
530 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
531 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
532 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
533 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
534 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
535 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
536 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
537 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
538 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
539 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
540 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
541 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
542 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
543 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
544 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
545 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
546 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
547 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
548 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
549 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
550 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
551 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
552 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
553 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
554 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
555 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
556 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
557 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
558 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
559 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
560 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
561 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
562 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
563 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
564 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
565 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
566 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
567 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
568 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
569 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
570 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
571 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
572 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
573 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
574 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
575 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
576 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
577 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
578 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
579 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
580 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
581 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
582 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
583 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
584 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
585 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
586 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
587 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
588 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
589 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
590 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
591 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
592 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
593 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
594 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
595 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
596 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
597 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
598 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
599 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
600 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
601 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
602 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
603 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
604 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
605 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
606 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
607 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
608 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
609 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
610 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
611 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
612 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
613 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
614 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
615 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
616 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
617 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
618 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
619 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
620 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
621 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
622 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
623 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
624 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
625 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
626 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
627 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
628 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
629 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
630 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
631 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
632 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
633 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
634 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
635 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
636 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
637 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
638 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
639 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
640 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
641 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
642 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
643 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
644 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
645 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
646 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
647 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
648 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
649 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
650 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
651 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
652 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
653 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
654 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
655 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
656 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
657 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
658 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
659 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
660 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
661 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
662 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
663 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
664 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
665 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
666 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
667 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
668 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
669 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
670 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
671 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
672 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
673 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
674 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
675 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
676 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
677 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
678 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
679 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
680 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
681 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
682 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
683 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
684 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
685 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
686 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
696 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
697 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
698 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
699 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
700 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
721 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
722 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
724 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
725 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
726 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
727 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
728 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
729 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
730 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
731 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
732 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
733 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
734 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
735 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
736 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
737 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
738 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
739 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
740 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
741 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
742 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
743 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
744 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
745 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
746 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
747 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
748 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
749 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
750 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
751 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
752 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
753 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
754 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
755 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
756 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
757 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
758 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
759 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
760 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
761 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
762 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
763 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
764 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
765 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
766 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
767 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
768 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
769 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
770 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
771 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
772 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
773 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
774 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
775 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
776 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
777 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
778 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
779 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
780 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
781 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
782 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
783 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
784 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
785 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
786 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
787 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
788 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
789 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
790 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
791 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
792 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
793 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
794 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
795 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
801 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
802 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
808 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
809 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
810 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
811 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
812 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
813 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
814 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
815 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
816 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
817 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
818 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
819 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
820 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
821 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
822 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
823 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
824 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
825 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
826 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
827 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
828 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
829 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
830 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
831 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
832 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
833 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
834 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
835 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
836 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
837 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
838 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
839 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
840 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
841 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
842 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
843 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
844 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.76
Metatranscriptomes 12.88
Isolates 4.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.35
Nodule 0.73
Rhizoplane 3.14
Rhizosphere 68.21
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2635680 2162886007 Bacteria 1900
2 SwRhRL2b_contig_787748 2162886007 Bacteria 947
3 SwRhRL2b_contig_93034 2162886007 Bacteria 5076
4 SwRhRL2b_contig_976277 2162886007 Bacteria 1753
5 JGI24736J21556_1003444 3300001904 Bacteria 2746
6 JGI24736J21556_1012627 3300001904 Bacteria 1368
7 JGI24741J21665_1002533 3300001915 Bacteria 4717
8 JGI24741J21665_1015120 3300001915 Bacteria 1278
9 JGI24740J21852_10002263 3300001979 Bacteria 8774
10 JGI24740J21852_10038645 3300001979 Bacteria 1462
11 JGI24740J21852_10042360 3300001979 Bacteria 1365
12 JGI24739J22299_10038309 3300001989 Bacteria 1612
13 JGI24739J22299_10043184 3300001989 Bacteria 1491
14 JGI24739J22299_10043914 3300001989 Bacteria 1475
15 JGI24739J22299_10093767 3300001989 Bacteria 911
16 JGI24739J22299_10164206 3300001989 Bacteria 655
17 JGI24737J22298_10011277 3300001990 Bacteria 2932
18 JGI24737J22298_10026240 3300001990 Bacteria 1840
19 JGI24737J22298_10045012 3300001990 Bacteria 1348
20 JGI24735J21928_10004283 3300002067 Bacteria 4809
21 JGI24735J21928_10016824 3300002067 Bacteria 2264
22 JGI24735J21928_10019195 3300002067 Bacteria 2103
23 JGI24735J21928_10034358 3300002067 Bacteria 1495
24 JGI24735J21928_10045175 3300002067 Bacteria 1279
25 JGI24735J21928_10093462 3300002067 Bacteria 863
26 JGI24738J21930_10000269 3300002075 Bacteria 14192
27 JGI24744J21845_10023566 3300002077 Bacteria 1205
28 JGI25155J39150_1000033 3300002704 Bacteria 105391
29 JGI25156J39149_1000043 3300002705 Bacteria 105452
30 JGI25156J39149_1006073 3300002705 Bacteria 3356
31 JGI25156J39149_1014169 3300002705 Bacteria 1657
32 JGI25156J39149_1021755 3300002705 Bacteria 1103
33 JGI25156J39149_1023191 3300002705 Bacteria 1039
34 JGI25156J39149_1027974 3300002705 Bacteria 875
35 JGI25156J39149_1032885 3300002705 Bacteria 762
36 JGI25154J39366_1000062 3300002738 Bacteria 105525
37 JGI25154J39366_1001113 3300002738 Bacteria 10452
38 JGI25154J39366_1002655 3300002738 Bacteria 4401
39 JGI25154J39366_1003448 3300002738 Bacteria 3316
40 JGI25158J39367_1002309 3300002739 Bacteria 3132
41 JGI25157J39369_1000060 3300002741 Bacteria 105525
42 JGI25157J39369_1000533 3300002741 Bacteria 23087
43 JGI25164J39214_1001514 3300002772 Bacteria 5207
44 JGI25152J39213_1008855 3300002773 Bacteria 2454
45 JGI25152J39213_1011126 3300002773 Bacteria 2009
46 JGI25152J39213_1016985 3300002773 Bacteria 1386
47 JGI25152J39213_1039625 3300002773 Bacteria 670
48 JGI25150J39212_1001674 3300002774 Bacteria 6004
49 JGI25150J39212_1005229 3300002774 Bacteria 2795
50 JGI25150J39212_1008078 3300002774 Bacteria 2081
51 JGI25150J39212_1014310 3300002774 Bacteria 1351
52 JGI25150J39212_1018303 3300002774 Bacteria 1116
53 JGI25150J39212_1033063 3300002774 Bacteria 704
54 JGI25159J45721_1003731 3300002987 Bacteria 5277
55 JGI25159J45721_1008095 3300002987 Bacteria 2927
56 JGI25159J45721_1008470 3300002987 Bacteria 2821
57 JGI25159J45721_1013430 3300002987 Bacteria 1894
58 JGI25159J45721_1018433 3300002987 Bacteria 1408
59 Ga0006765J45826_105488 3300003161 Bacteria 3656
60 Ga0006778J45830_1009154 3300003162 Bacteria 4301
61 Ga0006778J45830_1013353 3300003162 Bacteria 3860
62 Ga0006778J45830_1042439 3300003162 Bacteria 1815
63 Ga0006759J45824_1008312 3300003163 Bacteria 3423
64 Ga0006759J45824_1008313 3300003163 Bacteria 2545
65 Ga0006759J45824_1011840 3300003163 Bacteria 8858
66 Ga0006759J45824_1037313 3300003163 Bacteria 3877
67 Ga0006759J45824_1054940 3300003163 Bacteria 2522
68 JGI25151J46595_10019549 3300003187 Bacteria 2875
69 JGI25151J46595_10043576 3300003187 Bacteria 1604
70 JGI25151J46595_10047464 3300003187 Bacteria 1494
71 JGI25151J46595_10052920 3300003187 Bacteria 1361
72 JGI25151J46595_10060773 3300003187 Bacteria 1207
73 JGI25165J46597_1000973 3300003214 Bacteria 19249
74 JGI25153J46596_10007546 3300003215 Bacteria 5327
75 JGI25153J46596_10025429 3300003215 Bacteria 2115
76 JGI25153J46596_10026468 3300003215 Bacteria 2051
77 JGI25153J46596_10042510 3300003215 Bacteria 1386
78 Ga0007428J48920_101816 3300003288 Bacteria 1673
79 Ga0007421J48921_105529 3300003291 Bacteria 3469
80 Ga0006758J48902_1003362 3300003300 Bacteria 5424
81 Ga0006758J48902_1008629 3300003300 Bacteria 4431
82 Ga0006770J48903_1008186 3300003305 Bacteria 5363
83 Ga0006770J48903_1043850 3300003305 Bacteria 1409
84 Ga0006777J48905_1021980 3300003308 Bacteria 8416
85 Ga0006777J48905_1035131 3300003308 Bacteria 2894
86 Ga0006777J48905_1091911 3300003308 Bacteria 922
87 rootH2_10100020 3300003320 Bacteria 1658
88 rootH1_10071175 3300003323 Bacteria 1240
89 rootH1_10213140 3300003323 Bacteria 1339
90 JGI25160J50197_1002205 3300003354 Bacteria 9150
91 JGI25160J50197_1010648 3300003354 Bacteria 3310
92 JGI25160J50197_1013215 3300003354 Bacteria 2825
93 JGI25160J50197_1016863 3300003354 Bacteria 2336
94 JGI25161J50226_1001064 3300003374 Bacteria 9354
95 JGI25161J50226_1008369 3300003374 Bacteria 1601
96 JGI25161J50226_1009336 3300003374 Bacteria 1408
97 JGI25161J50226_1015430 3300003374 Bacteria 833
98 Ga0006556J51387_1013499 3300003479 Bacteria 5298
99 Ga0006556J51387_1016726 3300003479 Bacteria 5570
100 Ga0007417J51691_1002081 3300003544 Bacteria 10064
101 Ga0007417J51691_1010301 3300003544 Bacteria 12984
102 Ga0007417J51691_1012480 3300003544 Bacteria 3735
103 Ga0007417J51691_1025655 3300003544 Bacteria 5250
104 Ga0007417J51691_1044568 3300003544 Bacteria 1123
105 Ga0006558J51389_1020499 3300003558 Bacteria 3482
106 Ga0007427J51700_104977 3300003559 Bacteria 3786
107 Ga0006560J51390_1014141 3300003565 Bacteria 14363
108 Ga0006560J51390_1019398 3300003565 Bacteria 4229
109 Ga0006554J51385_1014759 3300003567 Bacteria 5312
110 Ga0007410J51695_1002863 3300003574 Bacteria 2678
111 Ga0007410J51695_1007231 3300003574 Bacteria 17470
112 Ga0007410J51695_1013246 3300003574 Bacteria 4057
113 Ga0007410J51695_1045991 3300003574 Bacteria 3465
114 Ga0007409J51694_1004205 3300003575 Bacteria 13192
115 Ga0007409J51694_1015401 3300003575 Bacteria 4272
116 Ga0007409J51694_1024015 3300003575 Bacteria 7372
117 Ga0007416J51690_1005419 3300003577 Bacteria 1456
118 Ga0007416J51690_1008732 3300003577 Bacteria 13163
119 Ga0007416J51690_1031581 3300003577 Bacteria 4320
120 Ga0007416J51690_1034163 3300003577 Bacteria 2857
121 Ga0006562J51391_1010419 3300003578 Bacteria 3619
122 Ga0006562J51391_1022410 3300003578 Bacteria 3640
123 Ga0007429J51699_1009554 3300003579 Bacteria 5322
124 Ga0007429J51699_1013683 3300003579 Bacteria 2328
125 Ga0007429J51699_1048446 3300003579 Bacteria 4130
126 Ga0007429J51699_1053830 3300003579 Bacteria 623
127 Ga0007411J51799_105052 3300003611 Bacteria 7712
128 Ga0007411J51799_105765 3300003611 Bacteria 1376
129 Ga0007415J51800_105799 3300003613 Bacteria 1906
130 Ga0007415J51800_108879 3300003613 Bacteria 4302
131 Ga0032354_1003507 3300003693 Bacteria 1535
132 Ga0032354_1003508 3300003693 Bacteria 1339
133 Ga0032354_1011615 3300003693 Bacteria 13713
134 Ga0032354_1024828 3300003693 Bacteria 3589
135 Ga0032354_1035910 3300003693 Bacteria 4518
136 Ga0032354_1080619 3300003693 Bacteria 1056
137 Ga0032354_1085038 3300003693 Bacteria 2433
138 Ga0006780_1004575 3300003735 Bacteria 5394
139 Ga0055538_1005237 3300003751 Bacteria 1363
140 Ga0055538_1005242 3300003751 Bacteria 1362
141 Ga0055539_1001825 3300003752 Bacteria 3616
142 Ga0055539_1002407 3300003752 Bacteria 2880
143 Ga0055539_1005916 3300003752 Bacteria 1576
144 Ga0055539_1005933 3300003752 Bacteria 1574
145 Ga0055533_1000312 3300003756 Bacteria 23470
146 Ga0055533_1000367 3300003756 Bacteria 18717
147 Ga0055533_1003837 3300003756 Bacteria 2880
148 Ga0055533_1005172 3300003756 Bacteria 2156
149 Ga0055533_1007666 3300003756 Bacteria 1442
150 Ga0055533_1009803 3300003756 Bacteria 1121
151 Ga0055532_1000810 3300003758 Bacteria 10720
152 Ga0055532_1000904 3300003758 Bacteria 9723
153 Ga0055525_1000147 3300003759 Bacteria 96457
154 Ga0055525_1001045 3300003759 Bacteria 7187
155 Ga0055525_1001619 3300003759 Bacteria 3542
156 Ga0055525_1001833 3300003759 Bacteria 2880
157 Ga0055527_1000706 3300003760 Bacteria 9723
158 Ga0055527_1000854 3300003760 Bacteria 7973
159 Ga0055535_1001280 3300003761 Bacteria 13685
160 Ga0055535_1001602 3300003761 Bacteria 10720
161 Ga0055535_1001743 3300003761 Bacteria 9723
162 Ga0055535_1009842 3300003761 Bacteria 1613
163 Ga0055542_1000965 3300003762 Bacteria 18727
164 Ga0055542_1000994 3300003762 Bacteria 18210
165 Ga0055542_1004878 3300003762 Bacteria 3136
166 Ga0055542_1009264 3300003762 Bacteria 1867
167 Ga0055542_1016625 3300003762 Bacteria 1154
168 Ga0055529_1000375 3300003763 Bacteria 48263
169 Ga0055529_1001065 3300003763 Bacteria 12728
170 Ga0055529_1001175 3300003763 Bacteria 10720
171 Ga0055529_1001229 3300003763 Bacteria 9723
172 Ga0055526_1001586 3300003771 Bacteria 15971
173 Ga0055526_1013133 3300003771 Bacteria 3534
174 Ga0055526_1016495 3300003771 Bacteria 2884
175 Ga0055526_1021258 3300003771 Bacteria 2266
176 Ga0055526_1021298 3300003771 Bacteria 2261
177 Ga0055526_1032408 3300003771 Bacteria 1475
178 Ga0055526_1033851 3300003771 Bacteria 1408
179 Ga0055526_1034131 3300003771 Bacteria 1396
180 Ga0055526_1050126 3300003771 Bacteria 959
181 Ga0055537_1004461 3300003773 Bacteria 3998
182 Ga0055537_1004555 3300003773 Bacteria 3944
183 Ga0055537_1006936 3300003773 Bacteria 2800
184 Ga0055537_1007354 3300003773 Bacteria 2661
185 Ga0055537_1012735 3300003773 Bacteria 1621
186 Ga0055537_1014924 3300003773 Bacteria 1386
187 Ga0055537_1017808 3300003773 Bacteria 1155
188 Ga0055537_1024076 3300003773 Bacteria 861
189 Ga0055524_1004310 3300003775 Bacteria 6598
190 Ga0055524_1005244 3300003775 Bacteria 5825
191 Ga0055524_1014273 3300003775 Bacteria 2952
192 Ga0055524_1023907 3300003775 Bacteria 1954
193 Ga0055524_1032548 3300003775 Bacteria 1475
194 Ga0055524_1034239 3300003775 Bacteria 1408
195 Ga0055524_1035570 3300003775 Bacteria 1356
196 Ga0055524_1039973 3300003775 Bacteria 1203
197 Ga0055536_1000672 3300003781 Bacteria 23032
198 Ga0055536_1014497 3300003781 Bacteria 2762
199 Ga0055536_1015419 3300003781 Bacteria 2616
200 Ga0055536_1018706 3300003781 Bacteria 2209
201 Ga0055536_1033135 3300003781 Bacteria 1324
202 Ga0055536_1037401 3300003781 Bacteria 1189
203 Ga0055534_1003672 3300003784 Bacteria 4752
204 Ga0055534_1004800 3300003784 Bacteria 3800
205 Ga0055534_1006810 3300003784 Bacteria 2819
206 Ga0055534_1007419 3300003784 Bacteria 2615
207 Ga0055534_1007786 3300003784 Bacteria 2502
208 Ga0055534_1014646 3300003784 Bacteria 1461
209 Ga0055534_1015575 3300003784 Bacteria 1390
210 Ga0055534_1015624 3300003784 Bacteria 1386
211 Ga0055528_1003799 3300003790 Bacteria 7438
212 Ga0055528_1003884 3300003790 Bacteria 7344
213 Ga0055528_1007975 3300003790 Bacteria 4609
214 Ga0055528_1012187 3300003790 Bacteria 3355
215 Ga0055528_1028580 3300003790 Bacteria 1534
216 Ga0055530_10014192 3300003791 Bacteria 2668
217 Ga0055530_10014213 3300003791 Bacteria 2664
218 Ga0055530_10017613 3300003791 Bacteria 2233
219 Ga0055530_10020908 3300003791 Bacteria 1941
220 Ga0055540_1002657 3300003792 Bacteria 9244
221 Ga0055540_1004941 3300003792 Bacteria 5809
222 Ga0055540_1024669 3300003792 Bacteria 1488
223 Ga0055540_1059854 3300003792 Bacteria 763
224 Ga0055531_10008751 3300003794 Bacteria 5281
225 Ga0055531_10013115 3300003794 Bacteria 3846
226 Ga0055531_10026230 3300003794 Bacteria 2086
227 Ga0055531_10034017 3300003794 Bacteria 1627
228 Ga0055531_10039892 3300003794 Bacteria 1386
229 Ga0055531_10040055 3300003794 Bacteria 1380
230 Ga0055541_1003620 3300003841 Bacteria 2880
231 Ga0055541_1010550 3300003841 Bacteria 1386
232 Ga0055541_1016711 3300003841 Bacteria 946
233 Ga0055541_1017810 3300003841 Bacteria 891
234 Ga0058692_1008521 3300003856 Bacteria 2644
235 Ga0058692_1009145 3300003856 Bacteria 2514
236 Ga0055543_1006838 3300004625 Bacteria 2709
237 Ga0055543_1013180 3300004625 Bacteria 1641
238 Ga0058859_10118627 3300004798 Bacteria 2763
239 Ga0058859_11827169 3300004798 Bacteria 3381
240 Ga0058860_10027197 3300004801 Bacteria 3593
241 Ga0058860_10069139 3300004801 Bacteria 1208
242 Ga0058860_12214629 3300004801 Bacteria 1490
243 Ga0065165_1002163 3300005262 Bacteria 17774
244 Ga0065165_1003318 3300005262 Bacteria 11513
245 Ga0065165_1012211 3300005262 Bacteria 3513
246 Ga0065165_1013838 3300005262 Bacteria 3174
247 Ga0065165_1017368 3300005262 Bacteria 2655
248 Ga0065165_1037975 3300005262 Bacteria 1455
249 Ga0065714_10013518 3300005288 Bacteria 4610
250 Ga0065704_10082542 3300005289 Bacteria 3587
251 Ga0065704_10083470 3300005289 Bacteria 3462
252 Ga0065704_10154776 3300005289 Bacteria 1400
253 Ga0065704_10158451 3300005289 Bacteria 1373
254 Ga0065704_10305018 3300005289 Bacteria 875
255 Ga0065704_10343003 3300005289 Bacteria 821
256 Ga0065715_10242832 3300005293 Bacteria 1193
257 Ga0065707_10007320 3300005295 Bacteria 3971
258 Ga0065707_10142183 3300005295 Bacteria 1758
259 Ga0070658_10022814 3300005327 Bacteria 5022
260 Ga0070658_10130175 3300005327 Bacteria 2097
261 Ga0070658_10144359 3300005327 Bacteria 1989
262 Ga0070658_10212708 3300005327 Bacteria 1633
263 Ga0070658_10274106 3300005327 Bacteria 1435
264 Ga0070683_100062099 3300005329 Bacteria 3474
265 Ga0070670_100172020 3300005331 Bacteria 1879
266 Ga0070670_100316063 3300005331 Bacteria 1368
267 Ga0070670_100642709 3300005331 Bacteria 951
268 Ga0070677_10075653 3300005333 Bacteria 1428
269 Ga0068869_100075056 3300005334 Bacteria 2511
270 Ga0068869_100128507 3300005334 Bacteria 1945
271 Ga0068869_100160311 3300005334 Bacteria 1751
272 Ga0070666_10041480 3300005335 Bacteria 3075
273 Ga0070666_10749580 3300005335 Bacteria 718
274 Ga0070682_100049501 3300005337 Bacteria 2620
275 Ga0070682_100162046 3300005337 Bacteria 1546
276 Ga0068868_100090414 3300005338 Bacteria 2465
277 Ga0068868_100410448 3300005338 Bacteria 1170
278 Ga0070660_100004872 3300005339 Bacteria 9275
279 Ga0070660_100054384 3300005339 Bacteria 3091
280 Ga0070660_100164599 3300005339 Bacteria 1789
281 Ga0070660_100245380 3300005339 Bacteria 1459
282 Ga0070660_100310601 3300005339 Bacteria 1294
283 Ga0070660_100363154 3300005339 Bacteria 1193
284 Ga0070691_10203478 3300005341 Bacteria 1041
285 Ga0070661_100005763 3300005344 Bacteria 8525
286 Ga0070661_100012369 3300005344 Bacteria 5970
287 Ga0070661_100103030 3300005344 Bacteria 2125
288 Ga0070661_100154369 3300005344 Bacteria 1736
289 Ga0070661_100174709 3300005344 Bacteria 1632
290 Ga0070661_100296955 3300005344 Bacteria 1257
291 Ga0070661_100781199 3300005344 Bacteria 783
292 Ga0070668_100039490 3300005347 Bacteria 3609
293 Ga0070668_100145349 3300005347 Bacteria 1914
294 Ga0070668_100152914 3300005347 Bacteria 1867
295 Ga0070669_100036662 3300005353 Bacteria 3555
296 Ga0070669_100095132 3300005353 Bacteria 2240
297 Ga0070675_100491793 3300005354 Bacteria 1104
298 Ga0070675_100588843 3300005354 Bacteria 1008
299 Ga0070675_100724187 3300005354 Bacteria 907
300 Ga0070671_100161442 3300005355 Bacteria 1894
301 Ga0070674_100149580 3300005356 Bacteria 1760
302 Ga0070674_100317106 3300005356 Bacteria 1248
303 Ga0070674_100454834 3300005356 Bacteria 1057
304 Ga0070673_100101877 3300005364 Bacteria 2366
305 Ga0070673_101053663 3300005364 Bacteria 758
306 Ga0070688_100472065 3300005365 Bacteria 942
307 Ga0070688_100617168 3300005365 Bacteria 832
308 Ga0070659_100004507 3300005366 Bacteria 9949
309 Ga0070659_100022490 3300005366 Bacteria 4814
310 Ga0070659_100039486 3300005366 Bacteria 3685
311 Ga0070659_100047642 3300005366 Bacteria 3363
312 Ga0070659_100210997 3300005366 Bacteria 1600
313 Ga0070659_100254295 3300005366 Bacteria 1456
314 Ga0070659_100315784 3300005366 Bacteria 1305
315 Ga0070659_100563182 3300005366 Bacteria 976
316 Ga0070667_100137525 3300005367 Bacteria 2136
317 Ga0070714_100707887 3300005435 Bacteria 972
318 Ga0070713_100757445 3300005436 Bacteria 929
319 Ga0070700_100103999 3300005441 Bacteria 1876
320 Ga0070708_100722927 3300005445 Bacteria 937
321 Ga0070663_100001491 3300005455 Bacteria 12866
322 Ga0070663_100002790 3300005455 Bacteria 9908
323 Ga0070663_100066928 3300005455 Bacteria 2604
324 Ga0070663_100307186 3300005455 Bacteria 1271
325 Ga0070663_100324767 3300005455 Bacteria 1238
326 Ga0070663_100787529 3300005455 Bacteria 814
327 Ga0070678_100167594 3300005456 Bacteria 1785
328 Ga0070678_100628016 3300005456 Bacteria 962
329 Ga0070678_100773994 3300005456 Bacteria 870
330 Ga0070678_100891314 3300005456 Bacteria 813
331 Ga0070662_100013879 3300005457 Bacteria 5366
332 Ga0070662_100085953 3300005457 Bacteria 2351
333 Ga0070662_100169496 3300005457 Bacteria 1714
334 Ga0070662_100200968 3300005457 Bacteria 1581
335 Ga0070662_100213204 3300005457 Bacteria 1538
336 Ga0070662_100368402 3300005457 Bacteria 1180
337 Ga0070681_10349156 3300005458 Bacteria 1390
338 Ga0068867_100072766 3300005459 Bacteria 2573
339 Ga0068867_100123267 3300005459 Bacteria 2005
340 Ga0068867_100901526 3300005459 Bacteria 796
341 Ga0070685_10340272 3300005466 Bacteria 1023
342 Ga0070706_100007906 3300005467 Bacteria 9931
343 Ga0070706_100979923 3300005467 Bacteria 780
344 Ga0070707_100037509 3300005468 Bacteria 4626
345 Ga0070699_100118437 3300005518 Bacteria 2328
346 Ga0070679_100218727 3300005530 Bacteria 1866
347 Ga0070679_100565941 3300005530 Bacteria 1080
348 Ga0070679_100864591 3300005530 Bacteria 848
349 Ga0070684_100335993 3300005535 Bacteria 1388
350 Ga0068853_100146388 3300005539 Bacteria 2123
351 Ga0068853_100148083 3300005539 Bacteria 2111
352 Ga0068853_100254548 3300005539 Bacteria 1612
353 Ga0068853_101028218 3300005539 Bacteria 794
354 Ga0068853_101363889 3300005539 Bacteria 686
355 Ga0070672_100289802 3300005543 Bacteria 1386
356 Ga0070665_100133750 3300005548 Bacteria 2482
357 Ga0070665_101433398 3300005548 Bacteria 699
358 Ga0068855_100070674 3300005563 Bacteria 4061
359 Ga0068855_100097026 3300005563 Bacteria 3395
360 Ga0068855_100196836 3300005563 Bacteria 2270
361 Ga0068855_100327924 3300005563 Bacteria 1690
362 Ga0068855_100364578 3300005563 Bacteria 1589
363 Ga0070664_100000356 3300005564 Bacteria 33677
364 Ga0070664_100031876 3300005564 Bacteria 4407
365 Ga0070664_100048424 3300005564 Bacteria 3592
366 Ga0070664_100139315 3300005564 Bacteria 2135
367 Ga0068857_100006407 3300005577 Bacteria 10091
368 Ga0068857_100025716 3300005577 Bacteria 5183
369 Ga0068857_100132782 3300005577 Bacteria 2246
370 Ga0068857_100274956 3300005577 Bacteria 1548
371 Ga0068857_100405816 3300005577 Bacteria 1268
372 Ga0068857_100544615 3300005577 Bacteria 1093
373 Ga0068854_100008705 3300005578 Bacteria 6530
374 Ga0068854_100029412 3300005578 Bacteria 3803
375 Ga0068854_100060898 3300005578 Bacteria 2732
376 Ga0068854_100253397 3300005578 Bacteria 1406
377 Ga0068854_100256449 3300005578 Bacteria 1399
378 Ga0068854_100377989 3300005578 Bacteria 1166
379 Ga0068854_100380776 3300005578 Bacteria 1163
380 Ga0068856_100017010 3300005614 Bacteria 7048
381 Ga0068856_100087143 3300005614 Bacteria 3103
382 Ga0068856_100139940 3300005614 Bacteria 2427
383 Ga0068856_100397719 3300005614 Bacteria 1397
384 Ga0068856_100424493 3300005614 Bacteria 1350
385 Ga0068856_100496881 3300005614 Bacteria 1241
386 Ga0068856_100679718 3300005614 Bacteria 1050
387 Ga0068852_100108612 3300005616 Bacteria 2518
388 Ga0068852_100196220 3300005616 Bacteria 1908
389 Ga0068852_100209083 3300005616 Bacteria 1850
390 Ga0068852_100626586 3300005616 Bacteria 1081
391 Ga0068852_101450198 3300005616 Bacteria 709
392 Ga0068859_100108192 3300005617 Bacteria 2841
393 Ga0068859_100190283 3300005617 Bacteria 2136
394 Ga0068859_100270429 3300005617 Bacteria 1792
395 Ga0068864_100201546 3300005618 Bacteria 1828
396 Ga0068864_100261657 3300005618 Bacteria 1609
397 Ga0068866_10231068 3300005718 Bacteria 1122
398 Ga0068866_10248192 3300005718 Bacteria 1088
399 Ga0068851_10017555 3300005834 Bacteria 3438
400 Ga0068851_10071502 3300005834 Bacteria 1795
401 Ga0068851_10112534 3300005834 Bacteria 1454
402 Ga0068863_100042406 3300005841 Bacteria 4323
403 Ga0068863_100042419 3300005841 Bacteria 4323
404 Ga0068858_100342202 3300005842 Bacteria 1432
405 Ga0068858_100387388 3300005842 Bacteria 1342
406 Ga0068860_100042655 3300005843 Bacteria 4331
407 Ga0068860_100058871 3300005843 Bacteria 3653
408 Ga0068860_100186597 3300005843 Bacteria 2006
409 Ga0068860_100356883 3300005843 Bacteria 1439
410 Ga0068860_100375170 3300005843 Bacteria 1403
411 Ga0068860_100961425 3300005843 Bacteria 871
412 Ga0068862_100071686 3300005844 Bacteria 2991
413 Ga0068862_100195814 3300005844 Bacteria 1820
414 Ga0068862_100227610 3300005844 Bacteria 1690
415 Ga0068862_100517618 3300005844 Bacteria 1135
416 Ga0081455_10221316 3300005937 Bacteria 1402
417 Ga0075365_10139156 3300006038 Bacteria 1684
418 Ga0075365_10148664 3300006038 Bacteria 1629
419 Ga0075365_10410059 3300006038 Bacteria 956
420 Ga0075363_100009222 3300006048 Bacteria 4635
421 Ga0075363_100016273 3300006048 Bacteria 3672
422 Ga0075363_100038090 3300006048 Bacteria 2527
423 Ga0075363_100086452 3300006048 Bacteria 1721
424 Ga0075363_100160082 3300006048 Bacteria 1274
425 Ga0075363_100242403 3300006048 Bacteria 1036
426 Ga0075363_100343882 3300006048 Bacteria 870
427 Ga0075363_100362887 3300006048 Bacteria 847
428 Ga0075364_10022236 3300006051 Bacteria 4002
429 Ga0075364_10039645 3300006051 Bacteria 3054
430 Ga0075364_10240995 3300006051 Bacteria 1228
431 Ga0075432_10037401 3300006058 Bacteria 1689
432 Ga0075432_10046990 3300006058 Bacteria 1516
433 Ga0075362_10002336 3300006177 Bacteria 6348
434 Ga0075362_10054648 3300006177 Bacteria 1795
435 Ga0075362_10058911 3300006177 Bacteria 1733
436 Ga0075362_10066228 3300006177 Bacteria 1641
437 Ga0075362_10079547 3300006177 Bacteria 1509
438 Ga0075362_10096575 3300006177 Bacteria 1377
439 Ga0075362_10101894 3300006177 Bacteria 1343
440 Ga0075362_10124262 3300006177 Bacteria 1223
441 Ga0075362_10173186 3300006177 Bacteria 1043
442 Ga0075362_10179662 3300006177 Bacteria 1025
443 Ga0075367_10069422 3300006178 Bacteria 2115
444 Ga0075367_10137116 3300006178 Bacteria 1514
445 Ga0075367_10199983 3300006178 Bacteria 1248
446 Ga0075367_10234089 3300006178 Bacteria 1150
447 Ga0075367_10453671 3300006178 Bacteria 812
448 Ga0075367_10674102 3300006178 Bacteria 657
449 Ga0075369_10019408 3300006186 Bacteria 2775
450 Ga0075369_10208542 3300006186 Bacteria 903
451 Ga0075369_10212084 3300006186 Bacteria 895
452 Ga0075366_10004740 3300006195 Bacteria 7327
453 Ga0075366_10019914 3300006195 Bacteria 3888
454 Ga0075366_10020376 3300006195 Bacteria 3848
455 Ga0075366_10037482 3300006195 Bacteria 2863
456 Ga0075366_10039994 3300006195 Bacteria 2772
457 Ga0075366_10048077 3300006195 Bacteria 2529
458 Ga0075366_10057020 3300006195 Bacteria 2321
459 Ga0075366_10084492 3300006195 Bacteria 1898
460 Ga0075366_10121189 3300006195 Bacteria 1576
461 Ga0075366_10126196 3300006195 Bacteria 1543
462 Ga0075366_10138697 3300006195 Bacteria 1469
463 Ga0075366_10140740 3300006195 Bacteria 1458
464 Ga0075366_10150220 3300006195 Bacteria 1410
465 Ga0075366_10158241 3300006195 Bacteria 1372
466 Ga0075366_10202859 3300006195 Bacteria 1206
467 Ga0075366_10392069 3300006195 Bacteria 854
468 Ga0097621_100018618 3300006237 Bacteria 5310
469 Ga0097621_100176041 3300006237 Bacteria 1846
470 Ga0097621_100321030 3300006237 Bacteria 1372
471 Ga0097621_100879263 3300006237 Bacteria 834
472 Ga0097621_101363971 3300006237 Bacteria 671
473 Ga0075370_10010622 3300006353 Bacteria 4823
474 Ga0075370_10017419 3300006353 Bacteria 3882
475 Ga0075370_10018877 3300006353 Bacteria 3745
476 Ga0075370_10020081 3300006353 Bacteria 3646
477 Ga0075370_10099076 3300006353 Bacteria 1686
478 Ga0075370_10105513 3300006353 Bacteria 1633
479 Ga0075370_10130476 3300006353 Bacteria 1466
480 Ga0075370_10196767 3300006353 Bacteria 1188
481 Ga0075370_10203742 3300006353 Bacteria 1167
482 Ga0075370_10259042 3300006353 Bacteria 1031
483 Ga0075370_10315062 3300006353 Bacteria 931
484 Ga0075370_10386668 3300006353 Bacteria 838
485 Ga0068871_100137146 3300006358 Bacteria 2078
486 Ga0068871_100146732 3300006358 Bacteria 2009
487 Ga0075429_100079292 3300006880 Bacteria 2862
488 Ga0068865_100044877 3300006881 Bacteria 3027
489 Ga0068865_100089515 3300006881 Bacteria 2229
490 Ga0068865_100357587 3300006881 Bacteria 1185
491 Ga0097620_100108193 3300006931 Bacteria 2841
492 Ga0097620_100190298 3300006931 Bacteria 2136
493 Ga0097620_100270432 3300006931 Bacteria 1792
494 Ga0079104_1000460 3300006946 Bacteria 45964
495 Ga0079104_1001225 3300006946 Bacteria 18084
496 Ga0079104_1025741 3300006946 Bacteria 1531
497 Ga0079104_1030065 3300006946 Bacteria 1362
498 Ga0099826_10000093 3300006948 Bacteria 43176
499 Ga0099826_10029122 3300006948 Bacteria 4029
500 Ga0099826_10034336 3300006948 Bacteria 3624
501 Ga0105251_10025374 3300009011 Bacteria 3033
502 Ga0105251_10026606 3300009011 Bacteria 2944
503 Ga0105251_10199732 3300009011 Bacteria 901
504 Ga0105244_10015476 3300009036 Bacteria 4374
505 Ga0105244_10019926 3300009036 Bacteria 3729
506 Ga0105244_10028299 3300009036 Bacteria 3008
507 Ga0105244_10039890 3300009036 Bacteria 2441
508 Ga0105244_10072576 3300009036 Bacteria 1715
509 Ga0105244_10134277 3300009036 Bacteria 1193
510 Ga0105244_10278352 3300009036 Bacteria 776
511 Ga0105244_10287104 3300009036 Bacteria 763
512 Ga0105244_10345120 3300009036 Bacteria 686
513 Ga0105250_10000429 3300009092 Bacteria 30738
514 Ga0105250_10095376 3300009092 Bacteria 1212
515 Ga0105250_10097901 3300009092 Bacteria 1196
516 Ga0105240_10021815 3300009093 Bacteria 8510
517 Ga0105240_10028244 3300009093 Bacteria 7329
518 Ga0105240_10084275 3300009093 Bacteria 3898
519 Ga0105240_10127654 3300009093 Bacteria 3054
520 Ga0105240_10209527 3300009093 Bacteria 2279
521 Ga0105240_10268174 3300009093 Bacteria 1967
522 Ga0105240_10347499 3300009093 Bacteria 1683
523 Ga0105240_10949647 3300009093 Bacteria 922
524 Ga0105240_11021466 3300009093 Bacteria 883
525 Ga0105240_11677126 3300009093 Bacteria 664
526 Ga0105245_10043502 3300009098 Bacteria 4006
527 Ga0105245_10190805 3300009098 Bacteria 1963
528 Ga0105245_11311935 3300009098 Bacteria 773
529 Ga0114129_10090756 3300009147 Bacteria 4234
530 Ga0105243_10007089 3300009148 Bacteria 8622
531 Ga0105243_10016441 3300009148 Bacteria 5595
532 Ga0105243_10053700 3300009148 Bacteria 3197
533 Ga0105243_10058416 3300009148 Bacteria 3074
534 Ga0105243_10082803 3300009148 Bacteria 2623
535 Ga0105243_10115013 3300009148 Bacteria 2258
536 Ga0105243_10407367 3300009148 Bacteria 1265
537 Ga0105241_10062554 3300009174 Bacteria 2870
538 Ga0105241_10173179 3300009174 Bacteria 1784
539 Ga0105241_10257043 3300009174 Bacteria 1483
540 Ga0105241_10349146 3300009174 Bacteria 1284
541 Ga0105242_10011101 3300009176 Bacteria 6922
542 Ga0105242_11490658 3300009176 Bacteria 707
543 Ga0105248_10182225 3300009177 Bacteria 2366
544 Ga0105248_10407962 3300009177 Bacteria 1530
545 Ga0105237_10023654 3300009545 Bacteria 6293
546 Ga0105237_10088934 3300009545 Bacteria 3078
547 Ga0105237_10140721 3300009545 Bacteria 2407
548 Ga0105237_10229198 3300009545 Bacteria 1858
549 Ga0105237_10253389 3300009545 Bacteria 1762
550 Ga0105237_11000138 3300009545 Bacteria 843
551 Ga0105237_11181785 3300009545 Bacteria 771
552 Ga0105238_10002020 3300009551 Bacteria 20484
553 Ga0105238_10070225 3300009551 Bacteria 3502
554 Ga0105238_10118991 3300009551 Bacteria 2622
555 Ga0105238_10135101 3300009551 Bacteria 2444
556 Ga0105238_10399640 3300009551 Bacteria 1367
557 Ga0105238_10472703 3300009551 Bacteria 1252
558 Ga0105238_10476928 3300009551 Bacteria 1246
559 Ga0105238_11320723 3300009551 Bacteria 747
560 Ga0105249_10089955 3300009553 Bacteria 2869
561 Ga0105249_10677686 3300009553 Bacteria 1090
562 Ga0130086_1005042 3300009829 Bacteria 2342
563 Ga0130086_1075241 3300009829 Bacteria 2349
564 Ga0130086_1091490 3300009829 Bacteria 2006
565 Ga0130085_1017480 3300009850 Bacteria 2342
566 Ga0130085_1078041 3300009850 Bacteria 2349
567 Ga0130085_1107450 3300009850 Bacteria 2006
568 Ga0105239_10014369 3300010375 Bacteria 8786
569 Ga0105239_10030541 3300010375 Bacteria 5924
570 Ga0105239_10143278 3300010375 Bacteria 2664
571 Ga0105239_10149771 3300010375 Bacteria 2604
572 Ga0105239_10258543 3300010375 Bacteria 1956
573 Ga0105239_10385566 3300010375 Bacteria 1585
574 Ga0105239_10566710 3300010375 Bacteria 1294
575 Ga0105246_10115841 3300011119 Bacteria 1977
576 Ga0105246_10228328 3300011119 Bacteria 1464
577 Ga0105246_10453176 3300011119 Bacteria 1079
578 Ga0157347_1001133 3300012502 Bacteria 2013
579 Ga0157339_1001144 3300012505 Bacteria 1554
580 Ga0157327_1003396 3300012512 Bacteria 1171
581 Ga0157326_1032962 3300012513 Bacteria 694
582 Ga0157373_10004374 3300013100 Bacteria 10647
583 Ga0157373_10026424 3300013100 Bacteria 4193
584 Ga0157373_10148144 3300013100 Bacteria 1651
585 Ga0157373_10210267 3300013100 Bacteria 1372
586 Ga0157371_10000710 3300013102 Bacteria 39002
587 Ga0157371_10005586 3300013102 Bacteria 10564
588 Ga0157371_10056239 3300013102 Bacteria 2791
589 Ga0157370_10009078 3300013104 Bacteria 10662
590 Ga0157370_10020339 3300013104 Bacteria 6629
591 Ga0157370_10272082 3300013104 Bacteria 1565
592 Ga0157370_10295926 3300013104 Bacteria 1495
593 Ga0157370_10406076 3300013104 Bacteria 1253
594 Ga0157370_10463365 3300013104 Bacteria 1165
595 Ga0157369_10014756 3300013105 Bacteria 8815
596 Ga0157369_10052190 3300013105 Bacteria 4425
597 Ga0157369_10056080 3300013105 Bacteria 4252
598 Ga0157369_10079398 3300013105 Bacteria 3514
599 Ga0157369_10330101 3300013105 Bacteria 1585
600 Ga0157369_10359801 3300013105 Bacteria 1511
601 Ga0157369_10365342 3300013105 Bacteria 1498
602 Ga0157369_10871364 3300013105 Bacteria 924
603 Ga0157374_10230020 3300013296 Bacteria 1821
604 Ga0157374_10382671 3300013296 Bacteria 1402
605 Ga0157378_10004819 3300013297 Bacteria 11823
606 Ga0157378_10322527 3300013297 Bacteria 1501
607 Ga0157378_11077392 3300013297 Bacteria 840
608 Ga0163162_10120962 3300013306 Bacteria 2723
609 Ga0163162_10132202 3300013306 Bacteria 2604
610 Ga0163162_10278756 3300013306 Bacteria 1804
611 Ga0163162_10336003 3300013306 Bacteria 1643
612 Ga0157372_10007032 3300013307 Bacteria 11985
613 Ga0157372_10036644 3300013307 Bacteria 5407
614 Ga0157372_10250785 3300013307 Bacteria 2055
615 Ga0157372_10318860 3300013307 Bacteria 1809
616 Ga0157375_10154272 3300013308 Bacteria 2434
617 Ga0157375_10281193 3300013308 Bacteria 1827
618 Ga0157375_10521342 3300013308 Bacteria 1352
619 Ga0157375_10837518 3300013308 Bacteria 1067
620 Ga0157375_10902937 3300013308 Bacteria 1027
621 Ga0163163_10583739 3300014325 Bacteria 1181
622 Ga0163163_11655822 3300014325 Bacteria 701
623 Ga0157380_10045061 3300014326 Bacteria 3459
624 Ga0157380_10347176 3300014326 Bacteria 1387
625 Ga0182008_10004539 3300014497 Bacteria 8101
626 Ga0182008_10005790 3300014497 Bacteria 6992
627 Ga0182008_10026855 3300014497 Bacteria 2919
628 Ga0182008_10054466 3300014497 Bacteria 1979
629 Ga0182008_10070591 3300014497 Bacteria 1718
630 Ga0182008_10081586 3300014497 Bacteria 1592
631 Ga0182008_10192012 3300014497 Bacteria 1037
632 Ga0182008_10337231 3300014497 Bacteria 797
633 Ga0157377_10000420 3300014745 Bacteria 18352
634 Ga0157379_10114119 3300014968 Bacteria 2428
635 Ga0157379_10172914 3300014968 Bacteria 1950
636 Ga0157379_10704450 3300014968 Bacteria 948
637 Ga0157379_10955801 3300014968 Bacteria 815
638 Ga0157376_10209205 3300014969 Bacteria 1800
639 Ga0157376_10284121 3300014969 Bacteria 1559
640 Ga0157376_10469954 3300014969 Bacteria 1230
641 Ga0157376_10517136 3300014969 Bacteria 1176
642 Ga0182006_1000186 3300015261 Bacteria 64784
643 Ga0182006_1007795 3300015261 Bacteria 4881
644 Ga0182006_1008556 3300015261 Bacteria 4637
645 Ga0182006_1013810 3300015261 Bacteria 3494
646 Ga0182006_1048397 3300015261 Bacteria 1645
647 Ga0182006_1067629 3300015261 Bacteria 1332
648 Ga0182006_1101103 3300015261 Bacteria 1023
649 Ga0182006_1104497 3300015261 Bacteria 1001
650 Ga0182007_10000202 3300015262 Bacteria 40165
651 Ga0182007_10006260 3300015262 Bacteria 5117
652 Ga0182007_10014740 3300015262 Bacteria 2936
653 Ga0182007_10024596 3300015262 Bacteria 2106
654 Ga0182007_10025073 3300015262 Bacteria 2080
655 Ga0182007_10032705 3300015262 Bacteria 1766
656 Ga0182005_1001566 3300015265 Bacteria 9037
657 Ga0182005_1001571 3300015265 Bacteria 9020
658 Ga0182005_1027054 3300015265 Bacteria 1564
659 Ga0182005_1027929 3300015265 Bacteria 1539
660 Ga0182005_1029495 3300015265 Bacteria 1497
661 Ga0182005_1059936 3300015265 Bacteria 1040
662 Ga0182005_1093621 3300015265 Bacteria 837
663 Ga0183362_10014 3300015683 Bacteria 40122
664 Ga0183361_10015 3300016635 Bacteria 166772
665 Ga0163161_10059881 3300017792 Bacteria 2770
666 Ga0163161_10068372 3300017792 Bacteria 2595
667 Ga0163161_10089105 3300017792 Bacteria 2281
668 Ga0163161_10188599 3300017792 Bacteria 1584
669 Ga0163161_10216950 3300017792 Bacteria 1480
670 Ga0163161_10238636 3300017792 Bacteria 1413
671 Ga0163161_10469741 3300017792 Bacteria 1020
672 Ga0163161_11063663 3300017792 Bacteria 694
673 Ga0184594_127158 3300019181 Bacteria 1229
674 Ga0197907_10126445 3300020069 Bacteria 6432
675 Ga0197907_10276287 3300020069 Bacteria 8484
676 Ga0197907_10464023 3300020069 Bacteria 3861
677 Ga0206356_10084425 3300020070 Bacteria 4866
678 Ga0206356_11000981 3300020070 Bacteria 10025
679 Ga0206356_11570777 3300020070 Bacteria 2668
680 Ga0206356_11852297 3300020070 Bacteria 769
681 Ga0206356_11852813 3300020070 Bacteria 787
682 Ga0206349_1060179 3300020075 Bacteria 1117
683 Ga0206349_1520604 3300020075 Bacteria 901
684 Ga0206349_1521794 3300020075 Bacteria 905
685 Ga0206355_1003085 3300020076 Bacteria 7491
686 Ga0206355_1487813 3300020076 Bacteria 4294
687 Ga0206355_1517176 3300020076 Bacteria 718
688 Ga0206355_1531200 3300020076 Bacteria 4443
689 Ga0206351_10512755 3300020077 Bacteria 1607
690 Ga0206351_10898479 3300020077 Bacteria 10613
691 Ga0206352_10576776 3300020078 Bacteria 1479
692 Ga0206352_11049024 3300020078 Bacteria 1433
693 Ga0206352_11304994 3300020078 Bacteria 2511
694 Ga0206350_10154136 3300020080 Bacteria 6815
695 Ga0206350_10252000 3300020080 Bacteria 1897
696 Ga0206350_10694065 3300020080 Bacteria 744
697 Ga0206350_10703408 3300020080 Bacteria 2976
698 Ga0206350_11654024 3300020080 Bacteria 1642
699 Ga0206354_10999262 3300020081 Bacteria 3114
700 Ga0206354_11062004 3300020081 Bacteria 4352
701 Ga0206353_10874677 3300020082 Bacteria 1078
702 Ga0206353_10877119 3300020082 Bacteria 975
703 Ga0206353_11555147 3300020082 Bacteria 2180
704 Ga0154015_1218269 3300020610 Bacteria 11158
705 Ga0213872_10013483 3300021361 Bacteria 3829
706 Ga0213872_10036563 3300021361 Bacteria 2244
707 Ga0213872_10052983 3300021361 Bacteria 1840
708 Ga0213872_10067471 3300021361 Bacteria 1614
709 Ga0213872_10105856 3300021361 Bacteria 1252
710 Ga0224712_10000449 3300022467 Bacteria 8219
711 Ga0224712_10016134 3300022467 Bacteria 2446
712 Ga0224712_10033458 3300022467 Bacteria 1882
713 Ga0224712_10093976 3300022467 Bacteria 1261
714 Ga0209435_100041 3300025206 Bacteria 105577
715 Ga0209436_101414 3300025208 Bacteria 8429
716 Ga0209436_101521 3300025208 Bacteria 7947
717 Ga0209436_110176 3300025208 Bacteria 1737
718 Ga0209436_122652 3300025208 Bacteria 805
719 Ga0209784_100035 3300025224 Bacteria 299760
720 Ga0209784_101495 3300025224 Bacteria 3029
721 Ga0209784_101598 3300025224 Bacteria 2828
722 Ga0209784_102871 3300025224 Bacteria 1603
723 Ga0209566_100040 3300025225 Bacteria 299760
724 Ga0209566_100422 3300025225 Bacteria 32606
725 Ga0209566_100606 3300025225 Bacteria 22462
726 Ga0209566_102009 3300025225 Bacteria 4299
727 Ga0209674_100057 3300025226 Bacteria 299760
728 Ga0209674_100067 3300025226 Bacteria 253824
729 Ga0209674_100310 3300025226 Bacteria 32606
730 Ga0209674_102782 3300025226 Bacteria 3532
731 Ga0209674_103534 3300025226 Bacteria 2833
732 Ga0209674_104927 3300025226 Bacteria 2072
733 Ga0209672_100073 3300025228 Bacteria 166621
734 Ga0209672_100291 3300025228 Bacteria 34939
735 Ga0209672_100717 3300025228 Bacteria 16431
736 Ga0209672_100718 3300025228 Bacteria 16386
737 Ga0209672_101679 3300025228 Bacteria 7175
738 Ga0209672_104561 3300025228 Bacteria 2548
739 Ga0209672_108028 3300025228 Bacteria 1588
740 Ga0209147_100090 3300025229 Bacteria 176176
741 Ga0209147_100093 3300025229 Bacteria 167196
742 Ga0209147_100853 3300025229 Bacteria 14271
743 Ga0209147_102542 3300025229 Bacteria 4404
744 Ga0209147_103483 3300025229 Bacteria 3042
745 Ga0209563_100011 3300025230 Bacteria 1187808
746 Ga0209563_100059 3300025230 Bacteria 299760
747 Ga0209563_100068 3300025230 Bacteria 254802
748 Ga0209563_100200 3300025230 Bacteria 32606
749 Ga0209563_103356 3300025230 Bacteria 3335
750 Ga0207427_100260 3300025231 Bacteria 41435
751 Ga0207427_103146 3300025231 Bacteria 3700
752 Ga0209258_100130 3300025242 Bacteria 176078
753 Ga0209258_100140 3300025242 Bacteria 167245
754 Ga0209258_100793 3300025242 Bacteria 18779
755 Ga0209258_102011 3300025242 Bacteria 5860
756 Ga0209258_102012 3300025242 Bacteria 5860
757 Ga0209258_103442 3300025242 Bacteria 3412
758 Ga0209258_103546 3300025242 Bacteria 3317
759 Ga0207425_1000767 3300025245 Bacteria 16556
760 Ga0207425_1001042 3300025245 Bacteria 12856
761 Ga0207425_1001095 3300025245 Bacteria 12292
762 Ga0207425_1004830 3300025245 Bacteria 3956
763 Ga0207425_1007941 3300025245 Bacteria 2756
764 Ga0207425_1011687 3300025245 Bacteria 2084
765 Ga0207425_1035268 3300025245 Bacteria 977
766 Ga0209646_1000144 3300025246 Bacteria 105691
767 Ga0209646_1000246 3300025246 Bacteria 55219
768 Ga0209646_1000348 3300025246 Bacteria 33896
769 Ga0209646_1000434 3300025246 Bacteria 23139
770 Ga0209646_1033258 3300025246 Bacteria 682
771 Ga0209026_1000004 3300025250 Bacteria 949012
772 Ga0209026_1000159 3300025250 Bacteria 105691
773 Ga0209026_1006910 3300025250 Bacteria 2668
774 Ga0209026_1025543 3300025250 Bacteria 890
775 Ga0209677_100036 3300025253 Bacteria 299760
776 Ga0209677_100043 3300025253 Bacteria 222331
777 Ga0209677_101729 3300025253 Bacteria 9091
778 Ga0209677_104488 3300025253 Bacteria 4000
779 Ga0209677_105221 3300025253 Bacteria 3457
780 Ga0209677_109701 3300025253 Bacteria 1692
781 Ga0209677_111325 3300025253 Bacteria 1401
782 Ga0209148_1000140 3300025254 Bacteria 166819
783 Ga0209148_1000323 3300025254 Bacteria 66396
784 Ga0209148_1000666 3300025254 Bacteria 29479
785 Ga0209148_1000990 3300025254 Bacteria 18287
786 Ga0209148_1003649 3300025254 Bacteria 4113
787 Ga0209148_1004793 3300025254 Bacteria 3237
788 Ga0209759_1000001 3300025256 Bacteria 2799452
789 Ga0209759_1000979 3300025256 Bacteria 19760
790 Ga0209759_1002023 3300025256 Bacteria 9609
791 Ga0209759_1005734 3300025256 Bacteria 4281
792 Ga0209759_1005917 3300025256 Bacteria 4182
793 Ga0209759_1006000 3300025256 Bacteria 4146
794 Ga0209759_1008706 3300025256 Bacteria 3137
795 Ga0209759_1010247 3300025256 Bacteria 2760
796 Ga0209759_1012596 3300025256 Bacteria 2333
797 Ga0209759_1014035 3300025256 Bacteria 2138
798 Ga0209759_1018278 3300025256 Bacteria 1698
799 Ga0209759_1019396 3300025256 Bacteria 1613
800 Ga0209759_1031246 3300025256 Bacteria 1039
801 Ga0209129_1000204 3300025258 Bacteria 69584
802 Ga0209129_1001020 3300025258 Bacteria 16691
803 Ga0209129_1001630 3300025258 Bacteria 12174
804 Ga0209129_1009319 3300025258 Bacteria 2604
805 Ga0209129_1013076 3300025258 Bacteria 1851
806 Ga0209129_1014488 3300025258 Bacteria 1677
807 Ga0209233_1000612 3300025261 Bacteria 18261
808 Ga0209565_1002110 3300025263 Bacteria 7576
809 Ga0209565_1002835 3300025263 Bacteria 5965
810 Ga0209565_1003275 3300025263 Bacteria 5332
811 Ga0209565_1006443 3300025263 Bacteria 3290
812 Ga0209565_1006554 3300025263 Bacteria 3253
813 Ga0209565_1008022 3300025263 Bacteria 2793
814 Ga0209565_1008373 3300025263 Bacteria 2709
815 Ga0209565_1010529 3300025263 Bacteria 2289
816 Ga0209565_1012279 3300025263 Bacteria 2051
817 Ga0209565_1024371 3300025263 Bacteria 1232
818 Ga0209565_1026547 3300025263 Bacteria 1160
819 Ga0209455_1000083 3300025272 Bacteria 255660
820 Ga0209455_1000119 3300025272 Bacteria 174994
821 Ga0209455_1000125 3300025272 Bacteria 166819
822 Ga0209455_1000303 3300025272 Bacteria 50385
823 Ga0209455_1001203 3300025272 Bacteria 12356
824 Ga0209673_1000463 3300025273 Bacteria 68460
825 Ga0209673_1000687 3300025273 Bacteria 48530
826 Ga0209673_1001644 3300025273 Bacteria 19348
827 Ga0209673_1003465 3300025273 Bacteria 9278
828 Ga0209673_1004929 3300025273 Bacteria 6945
829 Ga0209673_1005984 3300025273 Bacteria 5985
830 Ga0209673_1008361 3300025273 Bacteria 4614
831 Ga0209673_1013243 3300025273 Bacteria 3266
832 Ga0209673_1013310 3300025273 Bacteria 3253
833 Ga0209673_1020687 3300025273 Bacteria 2324
834 Ga0209673_1021223 3300025273 Bacteria 2278
835 Ga0209673_1036397 3300025273 Bacteria 1460
836 Ga0209130_1000146 3300025284 Bacteria 111777
837 Ga0209130_1002838 3300025284 Bacteria 8041
838 Ga0209130_1003943 3300025284 Bacteria 5943
839 Ga0209130_1003951 3300025284 Bacteria 5937
840 Ga0209130_1006752 3300025284 Bacteria 3667
841 Ga0209130_1012392 3300025284 Bacteria 2234
842 Ga0209130_1014066 3300025284 Bacteria 2023
843 Ga0209130_1027614 3300025284 Bacteria 1203
844 Ga0209130_1044975 3300025284 Bacteria 832
845 Ga0209675_1000121 3300025291 Bacteria 107684
846 Ga0209675_1000186 3300025291 Bacteria 68471
847 Ga0209675_1002952 3300025291 Bacteria 8387
848 Ga0209675_1004701 3300025291 Bacteria 5985
849 Ga0209675_1006318 3300025291 Bacteria 4778
850 Ga0209675_1007235 3300025291 Bacteria 4296
851 Ga0209675_1009571 3300025291 Bacteria 3407
852 Ga0209675_1009879 3300025291 Bacteria 3319
853 Ga0209675_1009998 3300025291 Bacteria 3285
854 Ga0209675_1013946 3300025291 Bacteria 2476
855 Ga0209675_1022955 3300025291 Bacteria 1627
856 Ga0209675_1044513 3300025291 Bacteria 949
857 Ga0209676_1000073 3300025292 Bacteria 305947
858 Ga0209676_1001219 3300025292 Bacteria 27305
859 Ga0209676_1001412 3300025292 Bacteria 23058
860 Ga0209676_1004462 3300025292 Bacteria 7783
861 Ga0209676_1007865 3300025292 Bacteria 4898
862 Ga0209676_1011169 3300025292 Bacteria 3651
863 Ga0209676_1035438 3300025292 Bacteria 1463
864 Ga0209025_1001281 3300025294 Bacteria 34537
865 Ga0209025_1014425 3300025294 Bacteria 4856
866 Ga0209025_1015058 3300025294 Bacteria 4696
867 Ga0209025_1017025 3300025294 Bacteria 4232
868 Ga0209025_1025048 3300025294 Bacteria 3052
869 Ga0209025_1027439 3300025294 Bacteria 2824
870 Ga0209025_1035567 3300025294 Bacteria 2248
871 Ga0209025_1050329 3300025294 Bacteria 1667
872 Ga0209025_1051369 3300025294 Bacteria 1639
873 Ga0209025_1052014 3300025294 Bacteria 1621
874 Ga0209025_1053063 3300025294 Bacteria 1594
875 Ga0209564_1000027 3300025295 Bacteria 518458
876 Ga0209564_1000230 3300025295 Bacteria 123814
877 Ga0209564_1002159 3300025295 Bacteria 16581
878 Ga0209564_1006016 3300025295 Bacteria 6698
879 Ga0209564_1006926 3300025295 Bacteria 5964
880 Ga0209564_1007105 3300025295 Bacteria 5849
881 Ga0209564_1007309 3300025295 Bacteria 5730
882 Ga0209564_1009674 3300025295 Bacteria 4550
883 Ga0209564_1010601 3300025295 Bacteria 4222
884 Ga0209564_1011746 3300025295 Bacteria 3891
885 Ga0209564_1013777 3300025295 Bacteria 3407
886 Ga0209564_1019927 3300025295 Bacteria 2482
887 Ga0209564_1031796 3300025295 Bacteria 1604
888 Ga0209564_1033355 3300025295 Bacteria 1533
889 Ga0209758_1000295 3300025297 Bacteria 97968
890 Ga0209758_1000442 3300025297 Bacteria 69581
891 Ga0209758_1006572 3300025297 Bacteria 8264
892 Ga0209758_1006647 3300025297 Bacteria 8182
893 Ga0209758_1006747 3300025297 Bacteria 8074
894 Ga0209758_1011259 3300025297 Bacteria 5207
895 Ga0209758_1017275 3300025297 Bacteria 3605
896 Ga0209050_1000008 3300025298 Bacteria 1144179
897 Ga0209050_1000052 3300025298 Bacteria 351785
898 Ga0209050_1000292 3300025298 Bacteria 106140
899 Ga0209050_1001097 3300025298 Bacteria 32856
900 Ga0209050_1002318 3300025298 Bacteria 16744
901 Ga0209050_1017496 3300025298 Bacteria 2852
902 Ga0209050_1023398 3300025298 Bacteria 2176
903 Ga0209050_1038475 3300025298 Bacteria 1363
904 Ga0209050_1041802 3300025298 Bacteria 1259
905 Ga0209050_1048101 3300025298 Bacteria 1105
906 Ga0209256_1000045 3300025299 Bacteria 325506
907 Ga0209256_1000168 3300025299 Bacteria 132040
908 Ga0209256_1004685 3300025299 Bacteria 8390
909 Ga0209256_1005253 3300025299 Bacteria 7562
910 Ga0209256_1006716 3300025299 Bacteria 5964
911 Ga0209256_1006866 3300025299 Bacteria 5849
912 Ga0209256_1011472 3300025299 Bacteria 3536
913 Ga0209256_1012344 3300025299 Bacteria 3290
914 Ga0209256_1018394 3300025299 Bacteria 2273
915 Ga0209256_1027830 3300025299 Bacteria 1605
916 Ga0209256_1046975 3300025299 Bacteria 1065
917 Ga0207426_1001110 3300025302 Bacteria 24727
918 Ga0207426_1002317 3300025302 Bacteria 12467
919 Ga0207426_1002480 3300025302 Bacteria 11738
920 Ga0207426_1005297 3300025302 Bacteria 5937
921 Ga0207426_1005398 3300025302 Bacteria 5849
922 Ga0207426_1005868 3300025302 Bacteria 5475
923 Ga0207426_1010324 3300025302 Bacteria 3631
924 Ga0209051_1000004 3300025303 Bacteria 1155596
925 Ga0209051_1000005 3300025303 Bacteria 1142353
926 Ga0209051_1003269 3300025303 Bacteria 10749
927 Ga0209051_1003409 3300025303 Bacteria 10436
928 Ga0209051_1003790 3300025303 Bacteria 9684
929 Ga0209051_1009985 3300025303 Bacteria 4835
930 Ga0209051_1021880 3300025303 Bacteria 2706
931 Ga0209051_1022225 3300025303 Bacteria 2675
932 Ga0209051_1028249 3300025303 Bacteria 2219
933 Ga0209051_1036341 3300025303 Bacteria 1820
934 Ga0209051_1043557 3300025303 Bacteria 1573
935 Ga0209257_1000015 3300025304 Bacteria 908141
936 Ga0209257_1000031 3300025304 Bacteria 688770
937 Ga0209257_1000295 3300025304 Bacteria 109542
938 Ga0209257_1002681 3300025304 Bacteria 17054
939 Ga0209257_1011934 3300025304 Bacteria 4098
940 Ga0209257_1013612 3300025304 Bacteria 3592
941 Ga0209257_1018291 3300025304 Bacteria 2706
942 Ga0209257_1019267 3300025304 Bacteria 2578
943 Ga0209257_1019494 3300025304 Bacteria 2551
944 Ga0209257_1027519 3300025304 Bacteria 1891
945 Ga0209257_1042245 3300025304 Bacteria 1346
946 Ga0207697_10202928 3300025315 Bacteria 872
947 Ga0207656_10033689 3300025321 Bacteria 2135
948 Ga0207696_1001013 3300025711 Bacteria 16826
949 Ga0207696_1062568 3300025711 Bacteria 1044
950 Ga0207655_1003094 3300025728 Bacteria 12643
951 Ga0207655_1006903 3300025728 Bacteria 7447
952 Ga0207655_1010082 3300025728 Bacteria 5777
953 Ga0207655_1051288 3300025728 Bacteria 1669
954 Ga0207655_1146634 3300025728 Bacteria 751
955 Ga0207713_1001520 3300025735 Bacteria 18293
956 Ga0207713_1039596 3300025735 Bacteria 1986
957 Ga0207682_10039674 3300025893 Bacteria 1915
958 Ga0207642_10067330 3300025899 Bacteria 1690
959 Ga0207642_10071102 3300025899 Bacteria 1656
960 Ga0207642_10095766 3300025899 Bacteria 1478
961 Ga0207642_10138655 3300025899 Bacteria 1279
962 Ga0207710_10132240 3300025900 Bacteria 1199
963 Ga0207680_10032158 3300025903 Bacteria 2979
964 Ga0207680_10440776 3300025903 Bacteria 924
965 Ga0207647_10005195 3300025904 Bacteria 9579
966 Ga0207647_10045927 3300025904 Bacteria 2723
967 Ga0207647_10091999 3300025904 Bacteria 1808
968 Ga0207647_10127112 3300025904 Bacteria 1500
969 Ga0207647_10162471 3300025904 Bacteria 1302
970 Ga0207647_10222493 3300025904 Bacteria 1087
971 Ga0207647_10344992 3300025904 Bacteria 843
972 Ga0207647_10345276 3300025904 Bacteria 843
973 Ga0207645_10038999 3300025907 Bacteria 3044
974 Ga0207645_10216452 3300025907 Bacteria 1262
975 Ga0207705_10001508 3300025909 Bacteria 18496
976 Ga0207705_10052423 3300025909 Bacteria 2937
977 Ga0207705_10087321 3300025909 Bacteria 2280
978 Ga0207705_10230320 3300025909 Bacteria 1409
979 Ga0207705_10427123 3300025909 Bacteria 1026
980 Ga0207705_10574504 3300025909 Bacteria 876
981 Ga0207684_10003400 3300025910 Bacteria 15575
982 Ga0207654_10002179 3300025911 Bacteria 10027
983 Ga0207654_10216219 3300025911 Bacteria 1269
984 Ga0207654_10297594 3300025911 Bacteria 1096
985 Ga0207707_10238214 3300025912 Bacteria 1582
986 Ga0207695_10003953 3300025913 Bacteria 20492
987 Ga0207695_10006996 3300025913 Bacteria 14471
988 Ga0207695_10010308 3300025913 Bacteria 11442
989 Ga0207695_10145282 3300025913 Bacteria 2317
990 Ga0207695_10146618 3300025913 Bacteria 2304
991 Ga0207695_10257734 3300025913 Bacteria 1642
992 Ga0207695_10266941 3300025913 Bacteria 1608
993 Ga0207695_10401694 3300025913 Bacteria 1255
994 Ga0207695_10769596 3300025913 Bacteria 843
995 Ga0207695_10803533 3300025913 Bacteria 821
996 Ga0207695_10838610 3300025913 Bacteria 799
997 Ga0207695_10891333 3300025913 Bacteria 769
998 Ga0207671_10014095 3300025914 Bacteria 6336
999 Ga0207671_10020608 3300025914 Bacteria 5015
1000 Ga0207671_10048974 3300025914 Bacteria 3127
1001 Ga0207671_10062151 3300025914 Bacteria 2773
1002 Ga0207671_10075831 3300025914 Bacteria 2516
1003 Ga0207671_10178519 3300025914 Bacteria 1652
1004 Ga0207671_10698362 3300025914 Bacteria 807
1005 Ga0207660_10067750 3300025917 Bacteria 2587
1006 Ga0207657_10006550 3300025919 Bacteria 12056
1007 Ga0207657_10149710 3300025919 Bacteria 1902
1008 Ga0207657_10168368 3300025919 Bacteria 1776
1009 Ga0207657_10196766 3300025919 Bacteria 1623
1010 Ga0207657_10232907 3300025919 Bacteria 1472
1011 Ga0207649_10000400 3300025920 Bacteria 32409
1012 Ga0207649_10023583 3300025920 Bacteria 3565
1013 Ga0207649_10056050 3300025920 Bacteria 2459
1014 Ga0207649_10149744 3300025920 Bacteria 1606
1015 Ga0207649_10360582 3300025920 Bacteria 1078
1016 Ga0207652_10037372 3300025921 Bacteria 4110
1017 Ga0207652_10215068 3300025921 Bacteria 1731
1018 Ga0207646_10100505 3300025922 Bacteria 2592
1019 Ga0207681_10017982 3300025923 Bacteria 4446
1020 Ga0207681_10053074 3300025923 Bacteria 2751
1021 Ga0207694_10001435 3300025924 Bacteria 20449
1022 Ga0207694_10013926 3300025924 Bacteria 6064
1023 Ga0207694_10031994 3300025924 Bacteria 4023
1024 Ga0207694_10035665 3300025924 Bacteria 3816
1025 Ga0207694_10295775 3300025924 Bacteria 1332
1026 Ga0207694_10351670 3300025924 Bacteria 1220
1027 Ga0207650_10084743 3300025925 Bacteria 2410
1028 Ga0207659_10736222 3300025926 Bacteria 845
1029 Ga0207687_10025583 3300025927 Bacteria 3949
1030 Ga0207687_10182177 3300025927 Bacteria 1628
1031 Ga0207664_10209408 3300025929 Bacteria 1686
1032 Ga0207644_10028855 3300025931 Bacteria 3845
1033 Ga0207690_10000040 3300025932 Bacteria 130300
1034 Ga0207690_10039670 3300025932 Bacteria 3073
1035 Ga0207690_10041702 3300025932 Bacteria 3010
1036 Ga0207690_10143986 3300025932 Bacteria 1760
1037 Ga0207690_10207371 3300025932 Bacteria 1492
1038 Ga0207690_10208665 3300025932 Bacteria 1488
1039 Ga0207690_10371213 3300025932 Bacteria 1135
1040 Ga0207690_10393682 3300025932 Bacteria 1103
1041 Ga0207706_10034769 3300025933 Bacteria 4484
1042 Ga0207706_10050422 3300025933 Bacteria 3678
1043 Ga0207706_10313632 3300025933 Bacteria 1365
1044 Ga0207686_10006427 3300025934 Bacteria 6325
1045 Ga0207686_10173261 3300025934 Bacteria 1524
1046 Ga0207686_10246300 3300025934 Bacteria 1303
1047 Ga0207709_10000152 3300025935 Bacteria 93738
1048 Ga0207709_10007814 3300025935 Bacteria 5927
1049 Ga0207709_10008524 3300025935 Bacteria 5669
1050 Ga0207709_10032052 3300025935 Bacteria 3075
1051 Ga0207709_10055004 3300025935 Bacteria 2457
1052 Ga0207709_10078134 3300025935 Bacteria 2124
1053 Ga0207709_10090432 3300025935 Bacteria 1999
1054 Ga0207709_10267835 3300025935 Bacteria 1256
1055 Ga0207709_10362242 3300025935 Bacteria 1098
1056 Ga0207669_10411976 3300025937 Bacteria 1061
1057 Ga0207669_10585916 3300025937 Bacteria 905
1058 Ga0207704_10060670 3300025938 Bacteria 2341
1059 Ga0207704_10095815 3300025938 Bacteria 1963
1060 Ga0207704_10278481 3300025938 Bacteria 1270
1061 Ga0207691_10148158 3300025940 Bacteria 2065
1062 Ga0207691_10248075 3300025940 Bacteria 1537
1063 Ga0207691_10291287 3300025940 Bacteria 1404
1064 Ga0207691_10316183 3300025940 Bacteria 1339
1065 Ga0207711_10004250 3300025941 Bacteria 12246
1066 Ga0207711_10039773 3300025941 Bacteria 4000
1067 Ga0207711_10269379 3300025941 Bacteria 1567
1068 Ga0207711_10595213 3300025941 Bacteria 1032
1069 Ga0207689_10012387 3300025942 Bacteria 7294
1070 Ga0207689_10025938 3300025942 Bacteria 4907
1071 Ga0207689_10183273 3300025942 Bacteria 1727
1072 Ga0207689_10550196 3300025942 Bacteria 969
1073 Ga0207679_10000032 3300025945 Bacteria 158845
1074 Ga0207679_10001142 3300025945 Bacteria 16924
1075 Ga0207679_10018738 3300025945 Bacteria 4643
1076 Ga0207679_10078880 3300025945 Bacteria 2509
1077 Ga0207679_10079943 3300025945 Bacteria 2495
1078 Ga0207679_10999273 3300025945 Bacteria 767
1079 Ga0207667_10004067 3300025949 Bacteria 17969
1080 Ga0207667_10024497 3300025949 Bacteria 6625
1081 Ga0207667_10042185 3300025949 Bacteria 4851
1082 Ga0207667_10134865 3300025949 Bacteria 2542
1083 Ga0207667_10143578 3300025949 Bacteria 2457
1084 Ga0207667_10187117 3300025949 Bacteria 2125
1085 Ga0207667_10189105 3300025949 Bacteria 2113
1086 Ga0207667_10809941 3300025949 Bacteria 933
1087 Ga0207651_10323312 3300025960 Bacteria 1290
1088 Ga0207651_10522087 3300025960 Bacteria 1029
1089 Ga0207712_10263692 3300025961 Bacteria 1398
1090 Ga0207712_10269592 3300025961 Bacteria 1384
1091 Ga0207668_10048418 3300025972 Bacteria 2917
1092 Ga0207668_10200922 3300025972 Bacteria 1587
1093 Ga0207640_10006255 3300025981 Bacteria 6528
1094 Ga0207640_10027602 3300025981 Bacteria 3461
1095 Ga0207640_10060779 3300025981 Bacteria 2499
1096 Ga0207640_10169293 3300025981 Bacteria 1626
1097 Ga0207640_10211871 3300025981 Bacteria 1477
1098 Ga0207640_10217641 3300025981 Bacteria 1460
1099 Ga0207640_10231581 3300025981 Bacteria 1422
1100 Ga0207658_10063510 3300025986 Bacteria 2767
1101 Ga0207658_10179572 3300025986 Bacteria 1751
1102 Ga0207677_10017168 3300026023 Bacteria 4308
1103 Ga0207677_10046409 3300026023 Bacteria 2909
1104 Ga0207677_10069847 3300026023 Bacteria 2472
1105 Ga0207703_10648776 3300026035 Bacteria 1001
1106 Ga0207639_10129777 3300026041 Bacteria 2085
1107 Ga0207639_10224461 3300026041 Bacteria 1625
1108 Ga0207639_10238048 3300026041 Bacteria 1581
1109 Ga0207678_10004336 3300026067 Bacteria 12735
1110 Ga0207678_10019676 3300026067 Bacteria 5936
1111 Ga0207678_10021697 3300026067 Bacteria 5631
1112 Ga0207678_10040548 3300026067 Bacteria 4038
1113 Ga0207678_10065451 3300026067 Bacteria 3121
1114 Ga0207678_10080010 3300026067 Bacteria 2798
1115 Ga0207678_10127772 3300026067 Bacteria 2168
1116 Ga0207678_10282516 3300026067 Bacteria 1425
1117 Ga0207678_10733358 3300026067 Bacteria 871
1118 Ga0207708_10131899 3300026075 Bacteria 1954
1119 Ga0207702_10005063 3300026078 Bacteria 11575
1120 Ga0207702_10032656 3300026078 Bacteria 4343
1121 Ga0207702_10087015 3300026078 Bacteria 2726
1122 Ga0207702_10365744 3300026078 Bacteria 1383
1123 Ga0207641_10261812 3300026088 Bacteria 1620
1124 Ga0207648_10020968 3300026089 Bacteria 5883
1125 Ga0207648_10269905 3300026089 Bacteria 1520
1126 Ga0207648_10327016 3300026089 Bacteria 1379
1127 Ga0207676_10084960 3300026095 Bacteria 2581
1128 Ga0207676_10101836 3300026095 Bacteria 2382
1129 Ga0207676_10776783 3300026095 Bacteria 933
1130 Ga0207676_11091490 3300026095 Bacteria 789
1131 Ga0207674_10012636 3300026116 Bacteria 9438
1132 Ga0207674_10021420 3300026116 Bacteria 6959
1133 Ga0207674_10079818 3300026116 Bacteria 3275
1134 Ga0207674_10170117 3300026116 Bacteria 2133
1135 Ga0207674_10170614 3300026116 Bacteria 2129
1136 Ga0207674_10233402 3300026116 Bacteria 1787
1137 Ga0207674_10677146 3300026116 Bacteria 996
1138 Ga0207675_100032434 3300026118 Bacteria 4866
1139 Ga0207675_100481424 3300026118 Bacteria 1233
1140 Ga0207683_10128046 3300026121 Bacteria 2283
1141 Ga0207683_10205720 3300026121 Bacteria 1790
1142 Ga0207683_10279799 3300026121 Bacteria 1525
1143 Ga0207683_10855470 3300026121 Bacteria 844
1144 Ga0207683_11292542 3300026121 Bacteria 675
1145 Ga0207698_10087736 3300026142 Bacteria 2535
1146 Ga0207698_10125231 3300026142 Bacteria 2184
1147 Ga0207698_10151787 3300026142 Bacteria 2012
1148 Ga0207698_10191213 3300026142 Bacteria 1823
1149 Ga0207698_10345981 3300026142 Bacteria 1402
1150 Ga0207698_10366592 3300026142 Bacteria 1366
1151 Ga0207698_10516516 3300026142 Bacteria 1165
1152 Ga0207698_11288690 3300026142 Bacteria 745
1153 Ga0209281_1000072 3300027111 Bacteria 273114
1154 Ga0209281_1001178 3300027111 Bacteria 18091
1155 Ga0209281_1008175 3300027111 Bacteria 2563
1156 Ga0209281_1020381 3300027111 Bacteria 1296
1157 Ga0209371_1000983 3300027312 Bacteria 21944
1158 Ga0209371_1003035 3300027312 Bacteria 8651
1159 Ga0209969_1011740 3300027360 Bacteria 1260
1160 Ga0209981_1001130 3300027378 Bacteria 3379
1161 Ga0209996_1000589 3300027395 Bacteria 4395
1162 Ga0209995_1001072 3300027471 Bacteria 4212
1163 Ga0209968_1000400 3300027526 Bacteria 7076
1164 Ga0209999_1000995 3300027543 Bacteria 4791
1165 Ga0209970_1000399 3300027614 Bacteria 7347
1166 Ga0209282_1000137 3300027666 Bacteria 43092
1167 Ga0209282_1017523 3300027666 Bacteria 4556
1168 Ga0209282_1174937 3300027666 Bacteria 1012
1169 Ga0209966_1000297 3300027695 Bacteria 16504
1170 Ga0209813_10005815 3300027866 Bacteria 3017
1171 Ga0209974_10006186 3300027876 Bacteria 4192
1172 Ga0209974_10016726 3300027876 Bacteria 2434
1173 Ga0209974_10022170 3300027876 Bacteria 2103
1174 Ga0209974_10040219 3300027876 Bacteria 1556
1175 Ga0209974_10043408 3300027876 Bacteria 1498
1176 Ga0207428_10207028 3300027907 Bacteria 1475
1177 Ga0207428_10254643 3300027907 Bacteria 1308
1178 Ga0268266_10331612 3300028379 Bacteria 1426
1179 Ga0268265_10026744 3300028380 Bacteria 4107
1180 Ga0268265_10087074 3300028380 Bacteria 2484
1181 Ga0268265_10307045 3300028380 Bacteria 1431
1182 Ga0268264_10045122 3300028381 Bacteria 3659
1183 Ga0268264_10183974 3300028381 Bacteria 1900
1184 Ga0268264_10306835 3300028381 Bacteria 1496
1185 Ga0268264_10632083 3300028381 Bacteria 1058
1186 Ga0268264_10969594 3300028381 Bacteria 856
1187 Ga0265336_10000371 3300028666 Bacteria 28840
1188 Ga0307517_10225417 3300028786 Bacteria 1133
1189 Ga0307515_10000672 3300028794 Bacteria 78835
1190 Ga0307515_10001585 3300028794 Bacteria 50742
1191 Ga0307515_10007261 3300028794 Bacteria 21944
1192 Ga0307515_10011833 3300028794 Bacteria 16504
1193 Ga0307515_10038449 3300028794 Bacteria 7654
1194 Ga0307515_10043121 3300028794 Bacteria 7026
1195 Ga0307515_10070127 3300028794 Bacteria 4776
1196 Ga0307515_10116889 3300028794 Bacteria 3057
1197 Ga0307515_10137104 3300028794 Bacteria 2652
1198 Ga0307515_10143289 3300028794 Bacteria 2548
1199 Ga0307515_10160207 3300028794 Bacteria 2300
1200 Ga0307515_10352315 3300028794 Bacteria 1118
1201 Ga0307515_10504308 3300028794 Bacteria 820
1202 Ga0265338_10004458 3300028800 Bacteria 18890
1203 Ga0265338_10006209 3300028800 Bacteria 15309
1204 Ga0265324_10000673 3300029957 Bacteria 23038
1205 Ga0237817_12115 3300030083 Bacteria 892
1206 Ga0268256_1000914 3300030500 Bacteria 20368
1207 Ga0268256_1002721 3300030500 Bacteria 8651
1208 Ga0307511_10075303 3300030521 Bacteria 2424
1209 Ga0307512_10118308 3300030522 Bacteria 1714
1210 Ga0307512_10193679 3300030522 Bacteria 1115
1211 Ga0316177_1138179 3300030731 Bacteria 1552
1212 Ga0316177_1221459 3300030731 Bacteria 1478
1213 Ga0316176_1055008 3300030732 Bacteria 4987
1214 Ga0314311_1059830 3300030733 Bacteria 6738
1215 Ga0316179_1105638 3300030734 Bacteria 1611
1216 Ga0316178_1002350 3300030735 Bacteria 2463
1217 Ga0316178_1018733 3300030735 Bacteria 1607
1218 Ga0316180_1046416 3300030736 Bacteria 3795
1219 Ga0316180_1160791 3300030736 Bacteria 1307
1220 Ga0316183_1020377 3300030742 Bacteria 1175
1221 Ga0316183_1084751 3300030742 Bacteria 2883
1222 Ga0316181_1106969 3300030744 Bacteria 4023
1223 Ga0316181_1150418 3300030744 Bacteria 2208
1224 Ga0265767_100423 3300030836 Bacteria 1772
1225 Ga0265766_1000765 3300030863 Bacteria 1459
1226 Ga0265766_1006226 3300030863 Bacteria 777
1227 Ga0247549_100840 3300030942 Bacteria 937
1228 Ga0265768_100968 3300030963 Bacteria 1258
1229 Ga0265332_10000018 3300031238 Bacteria 224913
1230 Ga0265332_10002454 3300031238 Bacteria 9443
1231 Ga0265327_10005256 3300031251 Bacteria 10903
1232 Ga0265327_10085436 3300031251 Bacteria 1549
1233 Ga0307513_10009971 3300031456 Bacteria 11983
1234 Ga0307513_10018777 3300031456 Bacteria 8252
1235 Ga0307513_10044156 3300031456 Bacteria 4885
1236 Ga0307513_10045162 3300031456 Bacteria 4817
1237 Ga0307513_10159168 3300031456 Bacteria 2153
1238 Ga0307513_10338142 3300031456 Bacteria 1257
1239 Ga0307513_10493074 3300031456 Bacteria 943
1240 Ga0307509_10067896 3300031507 Bacteria 3732
1241 Ga0307509_10131886 3300031507 Bacteria 2452
1242 Ga0307509_10150221 3300031507 Bacteria 2246
1243 Ga0307509_10194269 3300031507 Bacteria 1876
1244 Ga0307509_10284399 3300031507 Bacteria 1413
1245 Ga0307509_10303949 3300031507 Bacteria 1341
1246 Ga0307408_100023998 3300031548 Bacteria 4159
1247 Ga0307408_100048129 3300031548 Bacteria 3056
1248 Ga0307408_100081636 3300031548 Bacteria 2417
1249 Ga0307408_100124993 3300031548 Bacteria 1998
1250 Ga0307408_100144522 3300031548 Bacteria 1870
1251 Ga0307408_100224051 3300031548 Bacteria 1536
1252 Ga0307408_100348986 3300031548 Bacteria 1255
1253 Ga0307508_10098724 3300031616 Bacteria 2513
1254 Ga0307508_10378134 3300031616 Bacteria 1007
1255 Ga0307508_10593071 3300031616 Bacteria 709
1256 Ga0307514_10002935 3300031649 Bacteria 16968
1257 Ga0307514_10120122 3300031649 Bacteria 1835
1258 Ga0265314_10000126 3300031711 Bacteria 116852
1259 Ga0265314_10092358 3300031711 Bacteria 1968
1260 Ga0265314_10139277 3300031711 Bacteria 1502
1261 Ga0265342_10109472 3300031712 Bacteria 1565
1262 Ga0265342_10260371 3300031712 Bacteria 923
1263 Ga0307516_10000048 3300031730 Bacteria 130378
1264 Ga0307516_10026131 3300031730 Bacteria 5935
1265 Ga0307516_10098740 3300031730 Bacteria 2738
1266 Ga0307516_10107067 3300031730 Bacteria 2605
1267 Ga0307516_10134248 3300031730 Bacteria 2251
1268 Ga0307516_10309306 3300031730 Bacteria 1254
1269 Ga0247548_102090 3300031814 Bacteria 847
1270 Ga0307518_10007543 3300031838 Bacteria 7779
1271 Ga0307406_10042504 3300031901 Bacteria 2837
1272 Ga0307406_10091681 3300031901 Bacteria 2047
1273 Ga0307406_10141214 3300031901 Bacteria 1705
1274 Ga0307406_10152032 3300031901 Bacteria 1652
1275 Ga0307406_10743456 3300031901 Bacteria 823
1276 Ga0307412_10017396 3300031911 Bacteria 4302
1277 Ga0307412_10041167 3300031911 Bacteria 2993
1278 Ga0307412_10113582 3300031911 Bacteria 1938
1279 Ga0307412_10209891 3300031911 Bacteria 1485
1280 Ga0307412_10212367 3300031911 Bacteria 1477
1281 Ga0307412_10234358 3300031911 Bacteria 1416
1282 Ga0307412_10321911 3300031911 Bacteria 1230
1283 Ga0307409_100814027 3300031995 Bacteria 942
1284 Ga0307416_100004760 3300032002 Bacteria 8239
1285 Ga0307416_100102646 3300032002 Bacteria 2494
1286 Ga0307416_100334660 3300032002 Bacteria 1523
1287 Ga0307416_100537972 3300032002 Bacteria 1239
1288 Ga0307416_100759428 3300032002 Bacteria 1063
1289 Ga0307416_101425911 3300032002 Bacteria 798
1290 Ga0307414_10006142 3300032004 Bacteria 6673
1291 Ga0307414_10045630 3300032004 Bacteria 3002
1292 Ga0307414_10822634 3300032004 Bacteria 848
1293 Ga0307411_10491575 3300032005 Bacteria 1035
1294 Ga0307411_10870321 3300032005 Bacteria 799
1295 Ga0307510_10085086 3300033180 Bacteria 3041
1296 Ga0307510_10124844 3300033180 Bacteria 2266
1297 Ga0307510_10133051 3300033180 Bacteria 2153
1298 Ga0307510_10177363 3300033180 Bacteria 1699
1299 Ga0307510_10427069 3300033180 Bacteria 767
1300 Ga0373930_0047422 3300034816 Bacteria 930
1301 Ga0373934_0076377 3300035086 Bacteria 1343
1302 Ga0373944_0006036 3300035089 Bacteria 3208
1303 Ga0373923_0250142 3300035111 Bacteria 830
1304 Ga0373946_0300657 3300035171 Bacteria 793
1305 Ga0373955_0530117 3300035172 Bacteria 720
1306 Ga0373962_0071990 3300035242 Bacteria 1035
1307 Ga0373931_0035690 3300035691 Bacteria 2587
1308 Ga0373931_0038363 3300035691 Bacteria 2505
1309 Ga0373931_0404444 3300035691 Bacteria 865
1310 Ga0373935_0201381 3300035692 Bacteria 1376
1311 Ga0373935_0344967 3300035692 Bacteria 1061
1312 Ga0373927_0032480 3300035695 Bacteria 3399
1313 Ga0373937_0030010 3300036401 Bacteria 4925
1314 Ga0310112_001706 3300036458 Bacteria 2587
1315 Ga0373925_0171488 3300037068 Bacteria 1713
1316 Ga0395899_0000080 3300037312 Bacteria 171568
1317 Ga0395899_0005833 3300037312 Bacteria 9559
1318 Ga0395899_0028671 3300037312 Bacteria 4190
1319 Ga0395899_0036811 3300037312 Bacteria 3669
1320 Ga0395899_0043190 3300037312 Bacteria 3363
1321 Ga0395899_0073220 3300037312 Bacteria 2506
1322 Ga0395899_0079269 3300037312 Bacteria 2391
1323 Ga0395899_0102269 3300037312 Bacteria 2067
1324 Ga0395899_0130815 3300037312 Bacteria 1792
1325 Ga0395899_0534785 3300037312 Bacteria 755
1326 Ga0395900_0000087 3300037418 Bacteria 171568
1327 Ga0395900_0048471 3300037418 Bacteria 4376
1328 Ga0395900_0077379 3300037418 Bacteria 3417
1329 Ga0395900_0082284 3300037418 Bacteria 3307
1330 Ga0395900_0108339 3300037418 Bacteria 2854
1331 Ga0395900_0154436 3300037418 Bacteria 2344
1332 Ga0395900_0195712 3300037418 Bacteria 2048
1333 Ga0395900_0222715 3300037418 Bacteria 1901
1334 Ga0395900_0228090 3300037418 Bacteria 1874
1335 Ga0395900_0249092 3300037418 Bacteria 1778
1336 Ga0395900_0280711 3300037418 Bacteria 1657
1337 Ga0395900_0379967 3300037418 Bacteria 1380
1338 Ga0395900_0421557 3300037418 Bacteria 1295
1339 Ga0395900_0457632 3300037418 Bacteria 1231
1340 Ga0395900_0607856 3300037418 Bacteria 1033
1341 Ga0395898_0002330 3300037466 Bacteria 22662
1342 Ga0395898_0005792 3300037466 Bacteria 13291
1343 Ga0395898_0222638 3300037466 Bacteria 1799
1344 Ga0395898_0269024 3300037466 Bacteria 1625
1345 Ga0395898_0381914 3300037466 Bacteria 1343
1346 Ga0395898_0405858 3300037466 Bacteria 1299
1347 Ga0395898_0429745 3300037466 Bacteria 1258
1348 Ga0395898_0502972 3300037466 Bacteria 1152
1349 Ga0395905_0000549 3300037471 Bacteria 51321
1350 Ga0395905_0003008 3300037471 Bacteria 18269
1351 Ga0395905_0011730 3300037471 Bacteria 8460
1352 Ga0395905_0025382 3300037471 Bacteria 5588
1353 Ga0395905_0025945 3300037471 Bacteria 5524
1354 Ga0395905_0039477 3300037471 Bacteria 4428
1355 Ga0395905_0049982 3300037471 Bacteria 3918
1356 Ga0395905_0057895 3300037471 Bacteria 3624
1357 Ga0395905_0061348 3300037471 Bacteria 3517
1358 Ga0395905_0070304 3300037471 Bacteria 3279
1359 Ga0395905_0092664 3300037471 Bacteria 2833
1360 Ga0395905_0116486 3300037471 Bacteria 2511
1361 Ga0395905_0147893 3300037471 Bacteria 2210
1362 Ga0395905_0161262 3300037471 Bacteria 2107
1363 Ga0395905_0230130 3300037471 Bacteria 1733
1364 Ga0395905_0357692 3300037471 Bacteria 1352
1365 Ga0395905_0674425 3300037471 Bacteria 936
1366 Ga0395905_0731882 3300037471 Bacteria 891
1367 Ga0395905_0744408 3300037471 Bacteria 882
1368 Ga0395905_0834537 3300037471 Bacteria 824
1369 Ga0395905_1157047 3300037471 Bacteria 677
1370 Ga0395901_0001551 3300038443 Bacteria 23807
1371 Ga0395901_0005665 3300038443 Bacteria 12640
1372 Ga0395901_0020119 3300038443 Bacteria 6830
1373 Ga0395901_0052878 3300038443 Bacteria 4221
1374 Ga0395901_0094399 3300038443 Bacteria 3133
1375 Ga0395901_0144737 3300038443 Bacteria 2498
1376 Ga0395901_0164294 3300038443 Bacteria 2331
1377 Ga0395901_0229468 3300038443 Bacteria 1938
1378 Ga0395901_0249274 3300038443 Bacteria 1850
1379 Ga0395901_0401420 3300038443 Bacteria 1408
1380 Ga0395901_0451486 3300038443 Bacteria 1314
1381 Ga0436361_0194409 3300039447 Bacteria 1223
1382 Ga0436361_0504201 3300039447 Bacteria 19088
1383 Ga0436361_0519625 3300039447 Bacteria 2245
1384 Ga0436361_0578689 3300039447 Bacteria 1890
1385 Ga0436361_0693112 3300039447 Bacteria 19122
1386 Ga0436361_0823903 3300039447 Bacteria 2647
1387 Ga0436361_1038070 3300039447 Bacteria 9794
1388 Ga0436361_1077029 3300039447 Bacteria 1348
1389 Ga0436361_1079804 3300039447 Bacteria 1350
1390 Ga0439436_0009101 3300041404 Bacteria 3045
1391 Ga0439436_0019021 3300041404 Bacteria 2051
1392 Ga0439436_0076420 3300041404 Bacteria 933
1393 Ga0439453_0026306 3300041408 Bacteria 1078
1394 Ga0439461_0002207 3300041410 Bacteria 3091
1395 Ga0439466_0037197 3300041411 Bacteria 1640
1396 Ga0439466_0041255 3300041411 Bacteria 1540
1397 Ga0439465_0008385 3300041413 Bacteria 3262
1398 Ga0439465_0108422 3300041413 Bacteria 964
1399 Ga0451787_005332 3300041441 Bacteria 964
1400 Ga0451791_1902637 3300041451 Bacteria 1341
1401 Ga0451793_1802817 3300041452 Bacteria 927
1402 Ga0451797_0384782 3300041453 Bacteria 783
1403 Ga0451800_0567230 3300041459 Bacteria 1121
1404 Ga0451807_2124949 3300041486 Bacteria 1070
1405 Ga0451841_0487782 3300041498 Bacteria 945
1406 Ga0451841_1292268 3300041498 Bacteria 954
1407 Ga0451843_0527458 3300041509 Bacteria 1297
1408 Ga0451853_2414847 3300041512 Bacteria 1555
1409 Ga0451853_3868793 3300041512 Bacteria 961
1410 Ga0439431_0015350 3300041997 Bacteria 1782
1411 Ga0439431_0027054 3300041997 Bacteria 1408
1412 Ga0439431_0031611 3300041997 Bacteria 1316
1413 Ga0439431_0139597 3300041997 Bacteria 684
1414 Ga0439433_0003667 3300041999 Bacteria 3297
1415 Ga0439433_0011247 3300041999 Bacteria 1958
1416 Ga0439441_014564 3300042001 Bacteria 1381
1417 Ga0439442_006923 3300042002 Bacteria 2277
1418 Ga0439445_0003170 3300042004 Bacteria 3685
1419 Ga0439448_0001040 3300042005 Bacteria 6941
1420 Ga0439448_0068742 3300042005 Bacteria 1178
1421 Ga0439448_0073624 3300042005 Bacteria 1140
1422 Ga0439448_0107702 3300042005 Bacteria 950
1423 Ga0439432_005986 3300042006 Bacteria 4363
1424 Ga0439432_012727 3300042006 Bacteria 2872
1425 Ga0439449_0006857 3300042007 Bacteria 4341
1426 Ga0439449_0012119 3300042007 Bacteria 3240
1427 Ga0439449_0043711 3300042007 Bacteria 1663
1428 Ga0439450_013480 3300042008 Bacteria 1643
1429 Ga0439450_044086 3300042008 Bacteria 1044
1430 Ga0439450_116590 3300042008 Bacteria 686
1431 Ga0439452_018636 3300042010 Bacteria 1846
1432 Ga0439452_037183 3300042010 Bacteria 1162
1433 Ga0439452_057352 3300042010 Bacteria 879
1434 Ga0439452_096115 3300042010 Bacteria 638
1435 Ga0439454_008468 3300042011 Bacteria 1315
1436 Ga0439455_0022845 3300042012 Bacteria 1502
1437 Ga0439457_042377 3300042014 Bacteria 1015
1438 Ga0439462_0022089 3300042015 Bacteria 1665
1439 Ga0439462_0030982 3300042015 Bacteria 1415
1440 Ga0450911_004827 3300042115 Bacteria 2162
1441 Ga0450912_001598 3300042116 Bacteria 1413
1442 Ga0450919_000204 3300042121 Bacteria 6554
1443 Ga0450919_016079 3300042121 Bacteria 844
1444 Ga0450890_025210 3300042127 Bacteria 824
1445 Ga0450894_004773 3300042131 Bacteria 1755
1446 Ga0450894_010086 3300042131 Bacteria 1224
1447 Ga0450896_025987 3300042133 Bacteria 872
1448 Ga0450898_005842 3300042134 Bacteria 1874
1449 Ga0450898_024266 3300042134 Bacteria 1083
1450 Ga0450899_002739 3300042135 Bacteria 1905
1451 Ga0450899_009142 3300042135 Bacteria 1089
1452 Ga0450905_024101 3300042142 Bacteria 911
1453 Ga0450906_003636 3300042145 Bacteria 3292
1454 Ga0439446_0056502 3300042156 Bacteria 1180
1455 Ga0439458_0008832 3300042157 Bacteria 2248
1456 Ga0439458_0109816 3300042157 Bacteria 720
1457 Ga0450908_006526 3300042184 Bacteria 2212
1458 Ga0450909_000806 3300042185 Bacteria 4251
1459 Ga0450909_027390 3300042185 Bacteria 860
1460 Ga0450909_031408 3300042185 Bacteria 807
1461 Ga0439434_0015937 3300042435 Bacteria 2242
1462 Ga0439434_0023059 3300042435 Bacteria 1872
1463 Ga0439434_0029556 3300042435 Bacteria 1661
1464 Ga0439435_0062028 3300042436 Bacteria 1091
1465 Ga0439435_0238886 3300042436 Bacteria 609
1466 Ga0439464_0027002 3300042439 Bacteria 1595
1467 Ga0439464_0085708 3300042439 Bacteria 945
1468 Ga0450918_000638 3300042531 Bacteria 7508
1469 Ga0450918_001428 3300042531 Bacteria 4750
1470 Ga0450893_0007673 3300042532 Bacteria 1754
1471 Ga0451577_0022858 3300042876 Bacteria 5707
1472 Ga0451577_0023908 3300042876 Bacteria 5566
1473 Ga0451577_0034775 3300042876 Bacteria 4541
1474 Ga0451577_0038088 3300042876 Bacteria 4325
1475 Ga0451577_0087342 3300042876 Bacteria 2782
1476 Ga0451577_0088912 3300042876 Bacteria 2756
1477 Ga0451577_0110344 3300042876 Bacteria 2460
1478 Ga0451577_0238610 3300042876 Bacteria 1645
1479 Ga0466986_0220048 3300044650 Bacteria 1234
1480 Ga0466986_0313482 3300044650 Bacteria 968
1481 Ga0466969_0004224 3300044656 Bacteria 7630
1482 Ga0466969_0005824 3300044656 Bacteria 6549
1483 Ga0466969_0007725 3300044656 Bacteria 5717
1484 Ga0466969_0010294 3300044656 Bacteria 4960
1485 Ga0466969_0013172 3300044656 Bacteria 4357
1486 Ga0466969_0019552 3300044656 Bacteria 3519
1487 Ga0466969_0032267 3300044656 Bacteria 2662
1488 Ga0466969_0037700 3300044656 Bacteria 2436
1489 Ga0466969_0104456 3300044656 Bacteria 1331
1490 Ga0466969_0168844 3300044656 Bacteria 1003
1491 Ga0466972_0029858 3300044658 Bacteria 2684
1492 Ga0466972_0043958 3300044658 Bacteria 2168
1493 Ga0466972_0064527 3300044658 Bacteria 1752
1494 Ga0466972_0243723 3300044658 Bacteria 840
1495 Ga0466973_0018308 3300044659 Bacteria 6675
1496 Ga0466977_0012392 3300044666 Bacteria 4967
1497 Ga0453683_0009405 3300044673 Bacteria 6523
1498 Ga0453683_0275182 3300044673 Bacteria 1075
1499 Ga0453683_0455521 3300044673 Bacteria 828
1500 Ga0466965_0002098 3300044683 Bacteria 8364
1501 Ga0466965_0003067 3300044683 Bacteria 7277
1502 Ga0466965_0003272 3300044683 Bacteria 7086
1503 Ga0466965_0043592 3300044683 Bacteria 2215
1504 Ga0466965_0048711 3300044683 Bacteria 2099
1505 Ga0466965_0070051 3300044683 Bacteria 1762
1506 Ga0466965_0090033 3300044683 Bacteria 1560
1507 Ga0466965_0110117 3300044683 Bacteria 1414
1508 Ga0466965_0167409 3300044683 Bacteria 1154
1509 Ga0466965_0442869 3300044683 Bacteria 722
1510 Ga0466966_0007868 3300044684 Bacteria 7055
1511 Ga0466966_0028392 3300044684 Bacteria 3644
1512 Ga0466966_0038419 3300044684 Bacteria 3085
1513 Ga0466966_0039346 3300044684 Bacteria 3045
1514 Ga0466966_0046057 3300044684 Bacteria 2786
1515 Ga0466966_0059862 3300044684 Bacteria 2404
1516 Ga0466966_0144128 3300044684 Bacteria 1454
1517 Ga0466961_0017475 3300044693 Bacteria 4608
1518 Ga0466961_0027751 3300044693 Bacteria 3641
1519 Ga0466961_0037792 3300044693 Bacteria 3096
1520 Ga0466961_0039006 3300044693 Bacteria 3045
1521 Ga0466961_0043452 3300044693 Bacteria 2878
1522 Ga0466961_0063986 3300044693 Bacteria 2337
1523 Ga0466961_0100576 3300044693 Bacteria 1821
1524 Ga0466961_0117938 3300044693 Bacteria 1667
1525 Ga0466961_0153554 3300044693 Bacteria 1436
1526 Ga0466961_0162953 3300044693 Bacteria 1389
1527 Ga0466963_0009556 3300044694 Bacteria 5842
1528 Ga0466963_0090105 3300044694 Bacteria 2087
1529 Ga0466963_0093462 3300044694 Bacteria 2050
1530 Ga0466963_0173665 3300044694 Bacteria 1503
1531 Ga0466963_0386634 3300044694 Bacteria 986
1532 Ga0466964_0003612 3300044706 Bacteria 5653
1533 Ga0466964_0003855 3300044706 Bacteria 5505
1534 Ga0466964_0021546 3300044706 Bacteria 2493
1535 Ga0466964_0047297 3300044706 Bacteria 1755
1536 Ga0466964_0055260 3300044706 Bacteria 1639
1537 Ga0453684_0047348 3300044712 Bacteria 5703
1538 Ga0453684_0060229 3300044712 Bacteria 4886
1539 Ga0453684_0162566 3300044712 Bacteria 2639
1540 Ga0453684_0407625 3300044712 Bacteria 1521
1541 Ga0453684_0490247 3300044712 Bacteria 1362
1542 Ga0453684_0493594 3300044712 Bacteria 1357
1543 Ga0453684_0551542 3300044712 Bacteria 1269
1544 Ga0453684_0709781 3300044712 Bacteria 1092
1545 Ga0453684_0860683 3300044712 Bacteria 973
1546 Ga0453684_1321467 3300044712 Bacteria 751
1547 Ga0466971_0009471 3300044719 Bacteria 4253
1548 Ga0466971_0011241 3300044719 Bacteria 3921
1549 Ga0466971_0033896 3300044719 Bacteria 2287
1550 Ga0466971_0103860 3300044719 Bacteria 1307
1551 Ga0466971_0184236 3300044719 Bacteria 982
1552 Ga0466971_0499209 3300044719 Bacteria 600
1553 Ga0466968_0004267 3300044735 Bacteria 5334
1554 Ga0466968_0012025 3300044735 Bacteria 3381
1555 Ga0466968_0065630 3300044735 Bacteria 1571
1556 Ga0466970_0010068 3300044765 Bacteria 4790
1557 Ga0466970_0028435 3300044765 Bacteria 2937
1558 Ga0466970_0029673 3300044765 Bacteria 2881
1559 Ga0466970_0057746 3300044765 Bacteria 2076
1560 Ga0466970_0088676 3300044765 Bacteria 1677
1561 Ga0466970_0180119 3300044765 Bacteria 1172
1562 Ga0466970_0199060 3300044765 Bacteria 1114
1563 Ga0466957_0021202 3300044842 Bacteria 3827
1564 Ga0466957_0034004 3300044842 Bacteria 3057
1565 Ga0466957_0051604 3300044842 Bacteria 2503
1566 Ga0466957_0087267 3300044842 Bacteria 1951
1567 Ga0466957_0167221 3300044842 Bacteria 1431
1568 Ga0466957_0217977 3300044842 Bacteria 1259
1569 Ga0466957_0341302 3300044842 Bacteria 1014
1570 Ga0466960_0010183 3300044901 Bacteria 3901
1571 Ga0466960_0034145 3300044901 Bacteria 2368
1572 Ga0466960_0077720 3300044901 Bacteria 1665
1573 Ga0466960_0083009 3300044901 Bacteria 1618
1574 Ga0466960_0194226 3300044901 Bacteria 1106
1575 Ga0466960_0263327 3300044901 Bacteria 961
1576 Ga0466959_0007498 3300045049 Bacteria 7660
1577 Ga0466959_0009161 3300045049 Bacteria 7029
1578 Ga0466959_0024121 3300045049 Bacteria 4503
1579 Ga0466959_0055270 3300045049 Bacteria 2898
1580 Ga0466959_0074239 3300045049 Bacteria 2459
1581 Ga0466959_0095798 3300045049 Bacteria 2128
1582 Ga0466959_0107908 3300045049 Bacteria 1989
1583 Ga0466959_0182683 3300045049 Bacteria 1466
1584 Ga0466959_0185253 3300045049 Bacteria 1454
1585 Ga0466959_0204553 3300045049 Bacteria 1373
1586 Ga0466959_0262515 3300045049 Bacteria 1188
1587 Ga0466959_0280386 3300045049 Bacteria 1144
1588 Ga0451576_0130414 3300045051 Bacteria 2620
1589 Ga0451576_0209345 3300045051 Bacteria 2036
1590 Ga0451576_0269151 3300045051 Bacteria 1781
1591 Ga0451576_0297567 3300045051 Bacteria 1687
1592 Ga0451576_1146081 3300045051 Bacteria 813
1593 Ga0466958_0012561 3300045836 Bacteria 4801
1594 Ga0466958_0021653 3300045836 Bacteria 3759
1595 Ga0466958_0179680 3300045836 Bacteria 1342
1596 Ga0466958_0181235 3300045836 Bacteria 1336
1597 Ga0466967_0015476 3300045976 Bacteria 5980
1598 Ga0466967_0280019 3300045976 Bacteria 1600
1599 Ga0466967_1162750 3300045976 Bacteria 769
1600 Ga0495617_004204 3300046452 Bacteria 5264
1601 Ga0495627_000182 3300046453 Bacteria 70385
1602 Ga0495627_019307 3300046453 Bacteria 2287
1603 Ga0495627_026656 3300046453 Bacteria 1861
1604 Ga0495627_034787 3300046453 Bacteria 1572
1605 Ga0495627_036030 3300046453 Bacteria 1539
1606 Ga0495592_0000145 3300046454 Bacteria 62850
1607 Ga0495592_0036070 3300046454 Bacteria 3724
1608 Ga0495592_0056442 3300046454 Bacteria 2902
1609 Ga0495592_0207420 3300046454 Bacteria 1318
1610 Ga0495592_0600465 3300046454 Bacteria 671
1611 Ga0495603_0002356 3300046455 Bacteria 11090
1612 Ga0495603_0025195 3300046455 Bacteria 3597
1613 Ga0495603_0164238 3300046455 Bacteria 1287
1614 Ga0495603_0604903 3300046455 Bacteria 628
1615 Ga0495590_0000020 3300046457 Bacteria 212352
1616 Ga0495590_0005309 3300046457 Bacteria 5113
1617 Ga0495590_0009547 3300046457 Bacteria 3681
1618 Ga0495590_0018848 3300046457 Bacteria 2465
1619 Ga0495590_0027267 3300046457 Bacteria 2004
1620 Ga0495590_0027277 3300046457 Bacteria 2004
1621 Ga0495590_0029266 3300046457 Bacteria 1931
1622 Ga0495590_0076055 3300046457 Bacteria 1181
1623 Ga0495591_008200 3300046458 Bacteria 4305
1624 Ga0495591_029214 3300046458 Bacteria 1677
1625 Ga0495629_0025297 3300046459 Bacteria 4221
1626 Ga0495629_0026766 3300046459 Bacteria 4095
1627 Ga0495629_0028245 3300046459 Bacteria 3982
1628 Ga0495629_0047897 3300046459 Bacteria 2997
1629 Ga0495629_0088637 3300046459 Bacteria 2158
1630 Ga0495629_0146767 3300046459 Bacteria 1640
1631 Ga0495638_0000408 3300046460 Bacteria 52490
1632 Ga0495638_0009479 3300046460 Bacteria 6829
1633 Ga0495638_0010010 3300046460 Bacteria 6610
1634 Ga0495641_0060029 3300046461 Bacteria 1719
1635 Ga0495651_0102860 3300046462 Bacteria 2123
1636 Ga0495651_0129655 3300046462 Bacteria 1842
1637 Ga0495651_0134478 3300046462 Bacteria 1801
1638 Ga0495653_0003544 3300046463 Bacteria 12573
1639 Ga0495653_0025764 3300046463 Bacteria 4718
1640 Ga0495653_0060701 3300046463 Bacteria 2863
1641 Ga0495653_0067768 3300046463 Bacteria 2678
1642 Ga0495653_0101828 3300046463 Bacteria 2079
1643 Ga0495653_0158665 3300046463 Bacteria 1572
1644 Ga0495653_0160600 3300046463 Bacteria 1560
1645 Ga0495653_0277337 3300046463 Bacteria 1101
1646 Ga0495650_0009500 3300046471 Bacteria 5522
1647 Ga0495650_0015072 3300046471 Bacteria 3984
1648 Ga0495650_0017326 3300046471 Bacteria 3614
1649 Ga0495650_0017475 3300046471 Bacteria 3595
1650 Ga0495650_0017995 3300046471 Bacteria 3525
1651 Ga0495650_0032252 3300046471 Bacteria 2345
1652 Ga0495650_0037416 3300046471 Bacteria 2113
1653 Ga0495650_0058728 3300046471 Bacteria 1551
1654 Ga0495650_0076484 3300046471 Bacteria 1300
1655 Ga0495580_0002666 3300046472 Bacteria 15486
1656 Ga0495580_0008648 3300046472 Bacteria 8072
1657 Ga0495580_0024354 3300046472 Bacteria 4433
1658 Ga0495580_0047362 3300046472 Bacteria 3047
1659 Ga0495580_0198831 3300046472 Bacteria 1381
1660 Ga0495580_0245555 3300046472 Bacteria 1226
1661 Ga0495580_0395438 3300046472 Bacteria 932
1662 Ga0495580_0455054 3300046472 Bacteria 858
1663 Ga0495582_0013331 3300046473 Bacteria 4524
1664 Ga0495582_0018313 3300046473 Bacteria 3831
1665 Ga0495582_0021204 3300046473 Bacteria 3557
1666 Ga0495605_0003232 3300046474 Bacteria 9782
1667 Ga0495605_0003346 3300046474 Bacteria 9586
1668 Ga0495605_0013696 3300046474 Bacteria 4456
1669 Ga0495605_0017644 3300046474 Bacteria 3839
1670 Ga0495605_0021467 3300046474 Bacteria 3420
1671 Ga0495605_0025249 3300046474 Bacteria 3097
1672 Ga0495605_0055870 3300046474 Bacteria 1905
1673 Ga0495605_0121458 3300046474 Bacteria 1184
1674 Ga0495605_0171539 3300046474 Bacteria 958
1675 Ga0495639_0020269 3300046475 Bacteria 2905
1676 Ga0495639_0052119 3300046475 Bacteria 1862
1677 Ga0495662_0251071 3300046476 Bacteria 871
1678 Ga0495664_0017670 3300046477 Bacteria 4078
1679 Ga0495664_0065539 3300046477 Bacteria 2165
1680 Ga0495664_0227204 3300046477 Bacteria 1129
1681 Ga0495664_0387870 3300046477 Bacteria 839
1682 Ga0495584_0020283 3300046491 Bacteria 3378
1683 Ga0495584_0060945 3300046491 Bacteria 1896
1684 Ga0495584_0088403 3300046491 Bacteria 1562
1685 Ga0495584_0103631 3300046491 Bacteria 1438
1686 Ga0495584_0208667 3300046491 Bacteria 993
1687 Ga0495585_0047201 3300046492 Bacteria 2399
1688 Ga0495585_0049603 3300046492 Bacteria 2330
1689 Ga0495585_0124463 3300046492 Bacteria 1361
1690 Ga0495594_0186729 3300046499 Bacteria 1180
1691 Ga0495596_0005141 3300046500 Bacteria 6230
1692 Ga0495596_0026525 3300046500 Bacteria 2334
1693 Ga0495596_0040721 3300046500 Bacteria 1833
1694 Ga0495596_0062236 3300046500 Bacteria 1453
1695 Ga0495607_0123713 3300046501 Bacteria 1354
1696 Ga0495607_0141517 3300046501 Bacteria 1240
1697 Ga0495607_0173352 3300046501 Bacteria 1087
1698 Ga0495607_0220198 3300046501 Bacteria 928
1699 Ga0495583_0000310 3300046506 Bacteria 77200
1700 Ga0495583_0000517 3300046506 Bacteria 55159
1701 Ga0495583_0007957 3300046506 Bacteria 6561
1702 Ga0495583_0008161 3300046506 Bacteria 6441
1703 Ga0495583_0008959 3300046506 Bacteria 6037
1704 Ga0495583_0013755 3300046506 Bacteria 4495
1705 Ga0495583_0039755 3300046506 Bacteria 2213
1706 Ga0495583_0041060 3300046506 Bacteria 2169
1707 Ga0495583_0059929 3300046506 Bacteria 1703
1708 Ga0495583_0063988 3300046506 Bacteria 1633
1709 Ga0495606_0000600 3300046507 Bacteria 57013
1710 Ga0495606_0007181 3300046507 Bacteria 10052
1711 Ga0495606_0013036 3300046507 Bacteria 6605
1712 Ga0495606_0018493 3300046507 Bacteria 5221
1713 Ga0495606_0019502 3300046507 Bacteria 5042
1714 Ga0495606_0039988 3300046507 Bacteria 3154
1715 Ga0495606_0096989 3300046507 Bacteria 1802
1716 Ga0495606_0097622 3300046507 Bacteria 1794
1717 Ga0495606_0098121 3300046507 Bacteria 1788
1718 Ga0495606_0105627 3300046507 Bacteria 1707
1719 Ga0495606_0109444 3300046507 Bacteria 1668
1720 Ga0495606_0116974 3300046507 Bacteria 1600
1721 Ga0495606_0139596 3300046507 Bacteria 1432
1722 Ga0495606_0149612 3300046507 Bacteria 1371
1723 Ga0495608_0018080 3300046511 Bacteria 4870
1724 Ga0495608_0071597 3300046511 Bacteria 2262
1725 Ga0495608_0132183 3300046511 Bacteria 1596
1726 Ga0495610_0003877 3300046512 Bacteria 11361
1727 Ga0495610_0009271 3300046512 Bacteria 6237
1728 Ga0495610_0018155 3300046512 Bacteria 3981
1729 Ga0495610_0019591 3300046512 Bacteria 3780
1730 Ga0495610_0020302 3300046512 Bacteria 3691
1731 Ga0495610_0023962 3300046512 Bacteria 3303
1732 Ga0495610_0027750 3300046512 Bacteria 3003
1733 Ga0495610_0093040 3300046512 Bacteria 1363
1734 Ga0495610_0104850 3300046512 Bacteria 1261
1735 Ga0495616_0002539 3300046513 Bacteria 12051
1736 Ga0495616_0022828 3300046513 Bacteria 3374
1737 Ga0495616_0053494 3300046513 Bacteria 2006
1738 Ga0495616_0081991 3300046513 Bacteria 1541
1739 Ga0495616_0093754 3300046513 Bacteria 1417
1740 Ga0495616_0117462 3300046513 Bacteria 1230
1741 Ga0495616_0150527 3300046513 Bacteria 1053
1742 Ga0495616_0222708 3300046513 Bacteria 820
1743 Ga0495618_0009815 3300046514 Bacteria 5789
1744 Ga0495618_0043110 3300046514 Bacteria 2846
1745 Ga0495618_0182941 3300046514 Bacteria 1331
1746 Ga0495620_0022756 3300046515 Bacteria 3011
1747 Ga0495620_0052881 3300046515 Bacteria 1722
1748 Ga0495620_0057380 3300046515 Bacteria 1634
1749 Ga0495620_0116613 3300046515 Bacteria 1055
1750 Ga0495628_0015894 3300046516 Bacteria 6281
1751 Ga0495628_0030115 3300046516 Bacteria 4395
1752 Ga0495628_0059703 3300046516 Bacteria 2993
1753 Ga0495628_0063530 3300046516 Bacteria 2892
1754 Ga0495628_0193681 3300046516 Bacteria 1534
1755 Ga0495628_0196542 3300046516 Bacteria 1521
1756 Ga0495630_0020703 3300046517 Bacteria 4852
1757 Ga0495630_0069269 3300046517 Bacteria 2653
1758 Ga0495630_0079487 3300046517 Bacteria 2473
1759 Ga0495630_0110923 3300046517 Bacteria 2078
1760 Ga0495630_0218916 3300046517 Bacteria 1453
1761 Ga0495630_0240673 3300046517 Bacteria 1383
1762 Ga0495631_0000496 3300046518 Bacteria 26216
1763 Ga0495631_0037577 3300046518 Bacteria 2156
1764 Ga0495631_0103090 3300046518 Bacteria 1227
1765 Ga0495631_0139060 3300046518 Bacteria 1043
1766 Ga0495632_0115184 3300046519 Bacteria 1259
1767 Ga0495632_0254542 3300046519 Bacteria 787
1768 Ga0495637_0001714 3300046520 Bacteria 12614
1769 Ga0495637_0013614 3300046520 Bacteria 3857
1770 Ga0495637_0027010 3300046520 Bacteria 2571
1771 Ga0495637_0044618 3300046520 Bacteria 1886
1772 Ga0495637_0074308 3300046520 Bacteria 1365
1773 Ga0495643_0010644 3300046522 Bacteria 5651
1774 Ga0495643_0032093 3300046522 Bacteria 2917
1775 Ga0495643_0065304 3300046522 Bacteria 1921
1776 Ga0495643_0078750 3300046522 Bacteria 1719
1777 Ga0495643_0081093 3300046522 Bacteria 1687
1778 Ga0495643_0085218 3300046522 Bacteria 1638
1779 Ga0495643_0112654 3300046522 Bacteria 1381
1780 Ga0495644_0127721 3300046523 Bacteria 968
1781 Ga0495644_0131545 3300046523 Bacteria 953
1782 Ga0495648_0014819 3300046524 Bacteria 5680
1783 Ga0495648_0032539 3300046524 Bacteria 3419
1784 Ga0495648_0034037 3300046524 Bacteria 3321
1785 Ga0495648_0042742 3300046524 Bacteria 2848
1786 Ga0495648_0049584 3300046524 Bacteria 2572
1787 Ga0495648_0058116 3300046524 Bacteria 2314
1788 Ga0495648_0092684 3300046524 Bacteria 1686
1789 Ga0495648_0147191 3300046524 Bacteria 1232
1790 Ga0495648_0179018 3300046524 Bacteria 1079
1791 Ga0495663_0109352 3300046525 Bacteria 917
1792 Ga0495666_0012848 3300046526 Bacteria 4173
1793 Ga0495666_0014922 3300046526 Bacteria 3867
1794 Ga0495666_0030164 3300046526 Bacteria 2663
1795 Ga0495666_0161837 3300046526 Bacteria 1038
1796 Ga0495666_0174377 3300046526 Bacteria 994
1797 Ga0495666_0192854 3300046526 Bacteria 938
1798 Ga0495666_0316748 3300046526 Bacteria 704
1799 Ga0495642_0004349 3300046528 Bacteria 5500
1800 Ga0495642_0027378 3300046528 Bacteria 2268
1801 Ga0495642_0058360 3300046528 Bacteria 1597
1802 Ga0495642_0061666 3300046528 Bacteria 1556
1803 Ga0495642_0072194 3300046528 Bacteria 1445
1804 Ga0495642_0081958 3300046528 Bacteria 1360
1805 Ga0495642_0355161 3300046528 Bacteria 644
1806 Ga0495652_0022553 3300046529 Bacteria 5585
1807 Ga0495652_0143354 3300046529 Bacteria 1876
1808 Ga0495652_0184160 3300046529 Bacteria 1599
1809 Ga0495654_0000115 3300046530 Bacteria 91440
1810 Ga0495654_0028544 3300046530 Bacteria 2853
1811 Ga0495654_0048413 3300046530 Bacteria 2086
1812 Ga0495654_0056752 3300046530 Bacteria 1892
1813 Ga0495654_0065073 3300046530 Bacteria 1741
1814 Ga0495654_0077602 3300046530 Bacteria 1563
1815 Ga0495654_0077712 3300046530 Bacteria 1561
1816 Ga0495654_0082162 3300046530 Bacteria 1508
1817 Ga0495665_0005644 3300046531 Bacteria 6749
1818 Ga0495665_0018586 3300046531 Bacteria 3734
1819 Ga0495665_0031552 3300046531 Bacteria 2835
1820 Ga0495665_0037619 3300046531 Bacteria 2582
1821 Ga0495665_0046360 3300046531 Bacteria 2307
1822 Ga0495665_0055908 3300046531 Bacteria 2083
1823 Ga0495640_0035349 3300046533 Bacteria 3536
1824 Ga0495640_0038635 3300046533 Bacteria 3356
1825 Ga0495640_0049724 3300046533 Bacteria 2889
1826 Ga0495586_0017712 3300046535 Bacteria 3789
1827 Ga0495586_0034290 3300046535 Bacteria 2725
1828 Ga0495586_0035595 3300046535 Bacteria 2675
1829 Ga0495586_0047556 3300046535 Bacteria 2316
1830 Ga0495587_0012352 3300046536 Bacteria 5379
1831 Ga0495587_0015602 3300046536 Bacteria 4739
1832 Ga0495587_0118398 3300046536 Bacteria 1517
1833 Ga0495587_0245339 3300046536 Bacteria 1007
1834 Ga0495598_0236519 3300046537 Bacteria 672
1835 Ga0495609_0002112 3300046538 Bacteria 12496
1836 Ga0495609_0003741 3300046538 Bacteria 8588
1837 Ga0495609_0005231 3300046538 Bacteria 6903
1838 Ga0495609_0010454 3300046538 Bacteria 4448
1839 Ga0495609_0010718 3300046538 Bacteria 4385
1840 Ga0495609_0040613 3300046538 Bacteria 2093
1841 Ga0495609_0073530 3300046538 Bacteria 1499
1842 Ga0495609_0090084 3300046538 Bacteria 1334
1843 Ga0495609_0191566 3300046538 Bacteria 857
1844 Ga0495621_0043209 3300046539 Bacteria 1589
1845 Ga0495621_0092780 3300046539 Bacteria 1140
1846 Ga0495597_0000060 3300046542 Bacteria 92172
1847 Ga0495597_0008648 3300046542 Bacteria 5090
1848 Ga0495597_0009678 3300046542 Bacteria 4749
1849 Ga0495597_0012910 3300046542 Bacteria 4016
1850 Ga0495597_0014560 3300046542 Bacteria 3741
1851 Ga0495597_0086336 3300046542 Bacteria 1336
1852 Ga0495597_0125768 3300046542 Bacteria 1066
1853 Ga0495597_0133841 3300046542 Bacteria 1026
1854 Ga0495597_0161285 3300046542 Bacteria 915
1855 Ga0495597_0210207 3300046542 Bacteria 776
1856 Ga0495597_0283035 3300046542 Bacteria 646
1857 Ga0495645_0006837 3300046543 Bacteria 7926
1858 Ga0495645_0167830 3300046543 Bacteria 1512
1859 Ga0495645_0291640 3300046543 Bacteria 1069
1860 Ga0495645_0362271 3300046543 Bacteria 932
1861 Ga0495622_0010681 3300046557 Bacteria 4235
1862 Ga0495622_0011082 3300046557 Bacteria 4161
1863 Ga0495622_0075497 3300046557 Bacteria 1553
1864 Ga0495633_0016754 3300046558 Bacteria 3768
1865 Ga0495633_0027612 3300046558 Bacteria 2773
1866 Ga0495633_0035933 3300046558 Bacteria 2376
1867 Ga0495633_0055974 3300046558 Bacteria 1853
1868 Ga0495633_0131615 3300046558 Bacteria 1157
1869 Ga0495633_0148099 3300046558 Bacteria 1084
1870 Ga0495633_0151867 3300046558 Bacteria 1069
1871 Ga0495667_0076074 3300046559 Bacteria 2184
1872 Ga0495667_0192803 3300046559 Bacteria 1305
1873 Ga0495656_0006613 3300046615 Bacteria 4069
1874 Ga0495656_0014634 3300046615 Bacteria 2945
1875 Ga0495656_0040111 3300046615 Bacteria 1949
1876 Ga0495656_0150503 3300046615 Bacteria 1123
1877 Ga0495656_0183208 3300046615 Bacteria 1030
1878 Ga0495668_0007707 3300046616 Bacteria 6842
1879 Ga0495668_0020876 3300046616 Bacteria 3761
1880 Ga0495668_0025580 3300046616 Bacteria 3353
1881 Ga0495668_0067174 3300046616 Bacteria 1972
1882 Ga0495668_0102990 3300046616 Bacteria 1561
1883 Ga0495668_0114897 3300046616 Bacteria 1472
1884 Ga0495668_0353494 3300046616 Bacteria 806
1885 Ga0495634_0018015 3300046642 Bacteria 5032
1886 Ga0495634_0019079 3300046642 Bacteria 4874
1887 Ga0495634_0061366 3300046642 Bacteria 2499
1888 Ga0495634_0160930 3300046642 Bacteria 1415
1889 Ga0495634_0420917 3300046642 Bacteria 791
1890 Ga0495611_0051565 3300046648 Bacteria 1854
1891 Ga0495611_0066175 3300046648 Bacteria 1647
1892 Ga0495611_0135139 3300046648 Bacteria 1151
1893 Ga0495611_0138205 3300046648 Bacteria 1137
1894 Ga0495625_0020104 3300046660 Bacteria 5160
1895 Ga0495625_0021030 3300046660 Bacteria 5029
1896 Ga0495625_0026926 3300046660 Bacteria 4335
1897 Ga0495625_0038358 3300046660 Bacteria 3508
1898 Ga0495625_0069994 3300046660 Bacteria 2464
1899 Ga0495625_0078068 3300046660 Bacteria 2311
1900 Ga0495625_0080616 3300046660 Bacteria 2266
1901 Ga0495625_0134180 3300046660 Bacteria 1675
1902 Ga0495635_0049363 3300046663 Bacteria 2900
1903 Ga0495635_0058762 3300046663 Bacteria 2645
1904 Ga0495635_0106073 3300046663 Bacteria 1919
1905 Ga0495635_0308215 3300046663 Bacteria 1061
1906 Ga0495659_0012672 3300046664 Bacteria 2735
1907 Ga0495659_0020773 3300046664 Bacteria 2208
1908 Ga0495659_0047516 3300046664 Bacteria 1552
1909 Ga0495661_0010615 3300046665 Bacteria 6280
1910 Ga0495661_0018478 3300046665 Bacteria 4584
1911 Ga0495661_0019336 3300046665 Bacteria 4465
1912 Ga0495661_0024058 3300046665 Bacteria 3945
1913 Ga0495661_0037189 3300046665 Bacteria 3040
1914 Ga0495661_0058855 3300046665 Bacteria 2288
1915 Ga0495661_0077557 3300046665 Bacteria 1924
1916 Ga0495661_0111174 3300046665 Bacteria 1527
1917 Ga0495661_0115856 3300046665 Bacteria 1487
1918 Ga0495661_0124105 3300046665 Bacteria 1422
1919 Ga0495661_0239824 3300046665 Bacteria 930
1920 Ga0495588_0010876 3300046674 Bacteria 4252
1921 Ga0495588_0017329 3300046674 Bacteria 3495
1922 Ga0495588_0094967 3300046674 Bacteria 1563
1923 Ga0495588_0098405 3300046674 Bacteria 1536
1924 Ga0495588_0126731 3300046674 Bacteria 1346
1925 Ga0495588_0163270 3300046674 Bacteria 1178
1926 Ga0495657_0038350 3300046675 Bacteria 3298
1927 Ga0495599_0039843 3300046678 Bacteria 2951
1928 Ga0495599_0063346 3300046678 Bacteria 2310
1929 Ga0495599_0107809 3300046678 Bacteria 1735
1930 Ga0495599_0184025 3300046678 Bacteria 1287
1931 Ga0495599_0245214 3300046678 Bacteria 1091
1932 Ga0495623_0023807 3300046679 Bacteria 3950
1933 Ga0495623_0068842 3300046679 Bacteria 2206
1934 Ga0495623_0076509 3300046679 Bacteria 2076
1935 Ga0495623_0089599 3300046679 Bacteria 1890
1936 Ga0495623_0263192 3300046679 Bacteria 965
1937 Ga0495646_0016730 3300046680 Bacteria 4656
1938 Ga0495646_0052255 3300046680 Bacteria 2469
1939 Ga0495646_0081210 3300046680 Bacteria 1889
1940 Ga0495646_0106613 3300046680 Bacteria 1599
1941 Ga0495646_0112768 3300046680 Bacteria 1546
1942 Ga0495646_0487375 3300046680 Bacteria 634
1943 Ga0495658_0049526 3300046683 Bacteria 2373
1944 Ga0495658_0127771 3300046683 Bacteria 1544
1945 Ga0495669_0021103 3300046684 Bacteria 2824
1946 Ga0495669_0026297 3300046684 Bacteria 2543
1947 Ga0495669_0107204 3300046684 Bacteria 1302
1948 Ga0495669_0143402 3300046684 Bacteria 1128
1949 Ga0495613_0024317 3300046689 Bacteria 4512
1950 Ga0495613_0041905 3300046689 Bacteria 3388
1951 Ga0495613_0562952 3300046689 Bacteria 762
1952 Ga0495624_0011204 3300046690 Bacteria 6168
1953 Ga0495624_0047019 3300046690 Bacteria 2742
1954 Ga0495624_0067781 3300046690 Bacteria 2225
1955 Ga0495624_0078632 3300046690 Bacteria 2045
1956 Ga0495624_0131460 3300046690 Bacteria 1534
1957 Ga0495624_0167386 3300046690 Bacteria 1341
1958 Ga0495624_0167474 3300046690 Bacteria 1341
1959 Ga0495670_0036453 3300046691 Bacteria 2450
1960 Ga0495670_0046118 3300046691 Bacteria 2176
1961 Ga0495670_0082751 3300046691 Bacteria 1636
1962 Ga0495671_0008146 3300046692 Bacteria 5913
1963 Ga0495671_0029072 3300046692 Bacteria 2841
1964 Ga0495671_0049468 3300046692 Bacteria 2095
1965 Ga0495671_0078583 3300046692 Bacteria 1617
1966 Ga0495671_0102739 3300046692 Bacteria 1396
1967 Ga0495671_0116767 3300046692 Bacteria 1302
1968 Ga0495671_0140572 3300046692 Bacteria 1176
1969 Ga0495671_0144833 3300046692 Bacteria 1157
1970 Ga0495649_0014801 3300046694 Bacteria 4457
1971 Ga0495649_0015778 3300046694 Bacteria 4295
1972 Ga0495649_0024341 3300046694 Bacteria 3376
1973 Ga0495649_0040459 3300046694 Bacteria 2553
1974 Ga0495649_0053355 3300046694 Bacteria 2188
1975 Ga0495649_0060727 3300046694 Bacteria 2033
1976 Ga0495649_0208509 3300046694 Bacteria 1013
1977 Ga0495649_0325198 3300046694 Bacteria 780
1978 Ga0495589_0005345 3300046794 Bacteria 6776
1979 Ga0495589_0014565 3300046794 Bacteria 4046
1980 Ga0495589_0022141 3300046794 Bacteria 3245
1981 Ga0495589_0043731 3300046794 Bacteria 2228
1982 Ga0495589_0085487 3300046794 Bacteria 1532
1983 Ga0495589_0088958 3300046794 Bacteria 1499
1984 Ga0495589_0103882 3300046794 Bacteria 1373
1985 Ga0495600_0026041 3300046809 Bacteria 3772
1986 Ga0495600_0075615 3300046809 Bacteria 2199
1987 Ga0495600_0127665 3300046809 Bacteria 1653
1988 Ga0495660_0003674 3300046810 Bacteria 9441
1989 Ga0495660_0007171 3300046810 Bacteria 6566
1990 Ga0495660_0016570 3300046810 Bacteria 4248
1991 Ga0495660_0023488 3300046810 Bacteria 3516
1992 Ga0495660_0030863 3300046810 Bacteria 3017
1993 Ga0495660_0054740 3300046810 Bacteria 2161
1994 Ga0495660_0091402 3300046810 Bacteria 1581
1995 Ga0495660_0091812 3300046810 Bacteria 1576
1996 Ga0495660_0107202 3300046810 Bacteria 1430
1997 Ga0495660_0138881 3300046810 Bacteria 1211
1998 Ga0495581_0011795 3300047315 Bacteria 5059
1999 Ga0495581_0012682 3300047315 Bacteria 4882
2000 Ga0495581_0029554 3300047315 Bacteria 3176
2001 Ga0495581_0032726 3300047315 Bacteria 3010
2002 Ga0495581_0084029 3300047315 Bacteria 1844
2003 Ga0495581_0465350 3300047315 Bacteria 736
2004 Ga0495604_0059050 3300047317 Bacteria 2942
2005 Ga0495604_0060212 3300047317 Bacteria 2908
2006 Ga0495604_0098589 3300047317 Bacteria 2152
2007 Ga0495604_0145750 3300047317 Bacteria 1687
2008 Ga0495604_0176845 3300047317 Bacteria 1495
2009 Ga0495604_0214215 3300047317 Bacteria 1329
2010 Ga0495604_0480703 3300047317 Bacteria 808
2011 Ga0495636_0006088 3300047318 Bacteria 4736
2012 Ga0495636_0007040 3300047318 Bacteria 4424
2013 Ga0495636_0010674 3300047318 Bacteria 3630
2014 Ga0495636_0022781 3300047318 Bacteria 2534
2015 Ga0495636_0029313 3300047318 Bacteria 2246
2016 Ga0495674_0030234 3300047319 Bacteria 4926
2017 Ga0495674_0034755 3300047319 Bacteria 4554
2018 Ga0495674_0073837 3300047319 Bacteria 2938
2019 Ga0495674_0100877 3300047319 Bacteria 2456
2020 Ga0495674_0111840 3300047319 Bacteria 2314
2021 Ga0495674_0193452 3300047319 Bacteria 1689
2022 Ga0495674_0418762 3300047319 Bacteria 1079
2023 Ga0495672_0000201 3300047320 Bacteria 85476
2024 Ga0495672_0004638 3300047320 Bacteria 11157
2025 Ga0495672_0017725 3300047320 Bacteria 4753
2026 Ga0495672_0019097 3300047320 Bacteria 4531
2027 Ga0495672_0026706 3300047320 Bacteria 3679
2028 Ga0495672_0059705 3300047320 Bacteria 2205
2029 Ga0495672_0078821 3300047320 Bacteria 1841
2030 Ga0495672_0123210 3300047320 Bacteria 1374
2031 Ga0495672_0140037 3300047320 Bacteria 1264
2032 Ga0495672_0162000 3300047320 Bacteria 1149
2033 Ga0495676_0002384 3300047321 Bacteria 16678
2034 Ga0495676_0040228 3300047321 Bacteria 3860
2035 Ga0495676_0046788 3300047321 Bacteria 3506
2036 Ga0495676_0173448 3300047321 Bacteria 1516
2037 Ga0495676_0237728 3300047321 Bacteria 1248
2038 Ga0495680_0047868 3300047322 Bacteria 3360
2039 Ga0495680_0052699 3300047322 Bacteria 3170
2040 Ga0495680_0057028 3300047322 Bacteria 3022
2041 Ga0495680_0058733 3300047322 Bacteria 2971
2042 Ga0495680_0081403 3300047322 Bacteria 2444
2043 Ga0495680_0172146 3300047322 Bacteria 1567
2044 Ga0495683_0010512 3300047323 Bacteria 4887
2045 Ga0495683_0025191 3300047323 Bacteria 3050
2046 Ga0495683_0026862 3300047323 Bacteria 2946
2047 Ga0495683_0027703 3300047323 Bacteria 2897
2048 Ga0495683_0037022 3300047323 Bacteria 2475
2049 Ga0495683_0037766 3300047323 Bacteria 2447
2050 Ga0495683_0044194 3300047323 Bacteria 2240
2051 Ga0495683_0121251 3300047323 Bacteria 1240
2052 Ga0495687_000370 3300047443 Bacteria 56035
2053 Ga0495687_004642 3300047443 Bacteria 9168
2054 Ga0495687_007822 3300047443 Bacteria 6222
2055 Ga0495687_014326 3300047443 Bacteria 4086
2056 Ga0495687_014570 3300047443 Bacteria 4039
2057 Ga0495687_023948 3300047443 Bacteria 2910
2058 Ga0495687_024856 3300047443 Bacteria 2840
2059 Ga0495687_033356 3300047443 Bacteria 2336
2060 Ga0495687_036882 3300047443 Bacteria 2182
2061 Ga0495687_066393 3300047443 Bacteria 1464
2062 Ga0495687_095647 3300047443 Bacteria 1126
2063 Ga0495675_0016828 3300047444 Bacteria 4624
2064 Ga0495675_0027749 3300047444 Bacteria 3608
2065 Ga0495675_0197261 3300047444 Bacteria 1226
2066 Ga0495675_0264443 3300047444 Bacteria 1029
2067 Ga0495675_0416841 3300047444 Bacteria 781
2068 Ga0495677_0006314 3300047445 Bacteria 4477
2069 Ga0495677_0006510 3300047445 Bacteria 4412
2070 Ga0495677_0028349 3300047445 Bacteria 2033
2071 Ga0495677_0032012 3300047445 Bacteria 1914
2072 Ga0495677_0035730 3300047445 Bacteria 1813
2073 Ga0495677_0054079 3300047445 Bacteria 1481
2074 Ga0495677_0070385 3300047445 Bacteria 1303
2075 Ga0495677_0093603 3300047445 Bacteria 1133
2076 Ga0495677_0097213 3300047445 Bacteria 1112
2077 Ga0495679_005329 3300047446 Bacteria 5716
2078 Ga0495679_006772 3300047446 Bacteria 4876
2079 Ga0495679_006859 3300047446 Bacteria 4832
2080 Ga0495679_023214 3300047446 Bacteria 2106
2081 Ga0495679_052553 3300047446 Bacteria 1218
2082 Ga0495685_001143 3300047447 Bacteria 8102
2083 Ga0495685_001797 3300047447 Bacteria 6613
2084 Ga0495685_009001 3300047447 Bacteria 3329
2085 Ga0495685_079777 3300047447 Bacteria 1090
2086 Ga0495673_0000185 3300047469 Bacteria 100703
2087 Ga0495673_0000338 3300047469 Bacteria 59988
2088 Ga0495673_0019890 3300047469 Bacteria 3354
2089 Ga0495673_0068415 3300047469 Bacteria 1500
2090 Ga0495681_0018699 3300047470 Bacteria 3808
2091 Ga0495681_0041651 3300047470 Bacteria 2228
2092 Ga0495681_0087972 3300047470 Bacteria 1376
2093 Ga0495684_0095557 3300047471 Bacteria 2250
2094 Ga0495684_0125265 3300047471 Bacteria 1933
2095 Ga0495686_0000214 3300047472 Bacteria 106493
2096 Ga0495686_0005000 3300047472 Bacteria 10648
2097 Ga0495686_0015423 3300047472 Bacteria 5217
2098 Ga0495686_0035426 3300047472 Bacteria 3208
2099 Ga0495686_0041880 3300047472 Bacteria 2914
2100 Ga0495686_0116547 3300047472 Bacteria 1596
2101 Ga0495686_0121709 3300047472 Bacteria 1554
2102 Ga0495686_0199994 3300047472 Bacteria 1147
2103 Ga0495686_0203932 3300047472 Bacteria 1133
2104 Ga0495593_0012462 3300047673 Bacteria 4859
2105 Ga0495593_0015440 3300047673 Bacteria 4324
2106 Ga0495593_0016602 3300047673 Bacteria 4150
2107 Ga0495593_0027458 3300047673 Bacteria 3133
2108 Ga0495593_0028076 3300047673 Bacteria 3092
2109 Ga0495593_0063373 3300047673 Bacteria 1930
2110 Ga0495593_0297370 3300047673 Bacteria 807
2111 Ga0495602_0045589 3300048088 Bacteria 3966
2112 Ga0495602_0053905 3300048088 Bacteria 3556
2113 Ga0495602_0058801 3300048088 Bacteria 3362
2114 Ga0495602_0072298 3300048088 Bacteria 2941
2115 Ga0495602_0125944 3300048088 Bacteria 2052
2116 Ga0495602_0147142 3300048088 Bacteria 1857
2117 Ga0495602_0188916 3300048088 Bacteria 1581
2118 Ga0495602_0222519 3300048088 Bacteria 1423
2119 Ga0495614_0008579 3300048089 Bacteria 4544
2120 Ga0495614_0022910 3300048089 Bacteria 2692
2121 Ga0495614_0028604 3300048089 Bacteria 2400
2122 Ga0495614_0041023 3300048089 Bacteria 1985
2123 Ga0495614_0070213 3300048089 Bacteria 1509
2124 Ga0495615_0020588 3300048090 Bacteria 1480
2125 Ga0495615_0053480 3300048090 Bacteria 1046
2126 Ga0495626_0003909 3300048091 Bacteria 9334
2127 Ga0495626_0010744 3300048091 Bacteria 4868
2128 Ga0495626_0016437 3300048091 Bacteria 3756
2129 Ga0495626_0032859 3300048091 Bacteria 2489
2130 Ga0495626_0038095 3300048091 Bacteria 2281
2131 Ga0495626_0071955 3300048091 Bacteria 1552
2132 Ga0495626_0128867 3300048091 Bacteria 1082
2133 Ga0495626_0169623 3300048091 Bacteria 910
2134 Ga0496100_0018888 3300048903 Bacteria 4101
2135 Ga0496100_0036717 3300048903 Bacteria 3093
2136 Ga0496100_0134107 3300048903 Bacteria 1747
2137 Ga0496100_0164102 3300048903 Bacteria 1594
2138 Ga0496100_0226673 3300048903 Bacteria 1373
2139 Ga0496100_0516352 3300048903 Bacteria 922
2140 Ga0496100_0574901 3300048903 Bacteria 873
2141 Ga0496101_0026210 3300048904 Bacteria 4052
2142 Ga0496101_0092023 3300048904 Bacteria 2257
2143 Ga0496101_0100256 3300048904 Bacteria 2166
2144 Ga0496101_0109767 3300048904 Bacteria 2075
2145 Ga0496101_0135051 3300048904 Bacteria 1876
2146 Ga0496101_0369128 3300048904 Bacteria 1128
2147 Ga0496101_0777941 3300048904 Bacteria 755
2148 Ga0496102_0022040 3300048905 Bacteria 5641
2149 Ga0496102_0022350 3300048905 Bacteria 5604
2150 Ga0496102_0036709 3300048905 Bacteria 4416
2151 Ga0496102_0061992 3300048905 Bacteria 3424
2152 Ga0496102_0068828 3300048905 Bacteria 3248
2153 Ga0496102_0137406 3300048905 Bacteria 2290
2154 Ga0496102_0173739 3300048905 Bacteria 2028
2155 Ga0496102_0250326 3300048905 Bacteria 1670
2156 Ga0496102_0270088 3300048905 Bacteria 1603
2157 Ga0496102_0278526 3300048905 Bacteria 1577
2158 Ga0496102_0286852 3300048905 Bacteria 1551
2159 Ga0496102_0302152 3300048905 Bacteria 1508
2160 Ga0496102_0896649 3300048905 Bacteria 808
2161 Ga0496102_1046393 3300048905 Bacteria 736
2162 Ga0496103_0020863 3300048906 Bacteria 3939
2163 Ga0496103_0038048 3300048906 Bacteria 2950
2164 Ga0496103_0056865 3300048906 Bacteria 2428
2165 Ga0496103_0091802 3300048906 Bacteria 1916
2166 Ga0496103_0122155 3300048906 Bacteria 1659
2167 Ga0496103_0144502 3300048906 Bacteria 1522
2168 Ga0496103_0242996 3300048906 Bacteria 1158
2169 Ga0496104_0059129 3300048907 Bacteria 3628
2170 Ga0496104_0077952 3300048907 Bacteria 3157
2171 Ga0496104_0283218 3300048907 Bacteria 1570
2172 Ga0496104_0398525 3300048907 Bacteria 1288
2173 Ga0496104_0580471 3300048907 Bacteria 1031
2174 Ga0496105_0020511 3300048908 Bacteria 5341
2175 Ga0496105_0044920 3300048908 Bacteria 3644
2176 Ga0496105_0121384 3300048908 Bacteria 2154
2177 Ga0496105_0268757 3300048908 Bacteria 1377
2178 Ga0496105_0293722 3300048908 Bacteria 1308
2179 Ga0496105_0310352 3300048908 Bacteria 1266
2180 Ga0496105_0889290 3300048908 Bacteria 672
2181 Ga0496106_0017852 3300048909 Bacteria 5246
2182 Ga0496106_0056405 3300048909 Bacteria 2969
2183 Ga0496106_0155177 3300048909 Bacteria 1807
2184 Ga0496106_0253104 3300048909 Bacteria 1408
2185 Ga0496107_0146296 3300048910 Bacteria 1747
2186 Ga0496107_0248001 3300048910 Bacteria 1325
2187 Ga0496108_0160368 3300048911 Bacteria 1943
2188 Ga0496108_0207932 3300048911 Bacteria 1699
2189 Ga0496108_0870928 3300048911 Bacteria 774
2190 Ga0496108_0909228 3300048911 Bacteria 755
2191 Ga0496109_0173333 3300048912 Bacteria 2024
2192 Ga0496109_0186739 3300048912 Bacteria 1947
2193 Ga0496109_0260435 3300048912 Bacteria 1634
2194 Ga0496109_0983364 3300048912 Bacteria 781
2195 Ga0496110_0049103 3300048913 Bacteria 3700
2196 Ga0496110_0150324 3300048913 Bacteria 2108
2197 Ga0496110_0429986 3300048913 Bacteria 1203
2198 Ga0496111_0070346 3300048914 Bacteria 2545
2199 Ga0496111_0091872 3300048914 Bacteria 2224
2200 Ga0496111_0098471 3300048914 Bacteria 2147
2201 Ga0496112_0059935 3300048915 Bacteria 3750
2202 Ga0496112_0254271 3300048915 Bacteria 1707
2203 Ga0496112_0276634 3300048915 Bacteria 1626
2204 Ga0496112_0306153 3300048915 Bacteria 1534
2205 Ga0496113_0027320 3300048916 Bacteria 4090
2206 Ga0496113_0035860 3300048916 Bacteria 3630
2207 Ga0496113_0099847 3300048916 Bacteria 2248
2208 Ga0496113_0336667 3300048916 Bacteria 1210
2209 Ga0496114_0246003 3300048917 Bacteria 1573
2210 Ga0496114_0254562 3300048917 Bacteria 1545
2211 Ga0496114_0571376 3300048917 Bacteria 998
2212 Ga0496115_0085501 3300048918 Bacteria 2573
2213 Ga0496116_0010680 3300048919 Bacteria 7674
2214 Ga0496116_0059846 3300048919 Bacteria 2474
2215 Ga0496116_0060810 3300048919 Bacteria 2448
2216 Ga0496116_0069669 3300048919 Bacteria 2235
2217 Ga0496116_0127519 3300048919 Bacteria 1458
2218 Ga0496117_0000005 3300048920 Bacteria 777468
2219 Ga0496117_0017967 3300048920 Bacteria 5886
2220 Ga0496117_0047215 3300048920 Bacteria 3090
2221 Ga0496117_0051351 3300048920 Bacteria 2915
2222 Ga0496117_0057807 3300048920 Bacteria 2690
2223 Ga0496117_0091361 3300048920 Bacteria 1958
2224 Ga0496117_0131111 3300048920 Bacteria 1519
2225 Ga0496117_0199280 3300048920 Bacteria 1132
2226 Ga0496117_0235636 3300048920 Bacteria 1008
2227 Ga0496118_0000022 3300048921 Bacteria 438602
2228 Ga0496118_0038754 3300048921 Bacteria 3814
2229 Ga0496118_0045578 3300048921 Bacteria 3421
2230 Ga0496118_0056046 3300048921 Bacteria 2966
2231 Ga0496118_0057908 3300048921 Bacteria 2900
2232 Ga0496118_0074657 3300048921 Bacteria 2422
2233 Ga0496118_0127130 3300048921 Bacteria 1645
2234 Ga0496118_0140811 3300048921 Bacteria 1529
2235 Ga0496118_0164373 3300048921 Bacteria 1366
2236 Ga0496118_0211297 3300048921 Bacteria 1138
2237 Ga0496119_0085089 3300048922 Bacteria 1811
2238 Ga0496119_0389921 3300048922 Bacteria 666
2239 Ga0496120_0124356 3300048923 Bacteria 1329
2240 Ga0496121_0025394 3300048924 Bacteria 5622
2241 Ga0496121_0030997 3300048924 Bacteria 4898
2242 Ga0496121_0080977 3300048924 Bacteria 2571
2243 Ga0496121_0108225 3300048924 Bacteria 2126
2244 Ga0496121_0108575 3300048924 Bacteria 2122
2245 Ga0496121_0263806 3300048924 Bacteria 1187
2246 Ga0496121_0303443 3300048924 Bacteria 1082
2247 Ga0496121_0307982 3300048924 Bacteria 1072
2248 Ga0496121_0535728 3300048924 Bacteria 735
2249 Ga0496122_0004844 3300048925 Bacteria 16393
2250 Ga0496122_0026262 3300048925 Bacteria 5026
2251 Ga0496122_0059460 3300048925 Bacteria 2821
2252 Ga0496122_0077023 3300048925 Bacteria 2344
2253 Ga0496122_0099839 3300048925 Bacteria 1944
2254 Ga0496122_0124807 3300048925 Bacteria 1650
2255 Ga0496122_0194708 3300048925 Bacteria 1192
2256 Ga0496122_0222994 3300048925 Bacteria 1080
2257 Ga0496122_0373062 3300048925 Bacteria 735
2258 Ga0496123_0021652 3300048926 Bacteria 4988
2259 Ga0496123_0031651 3300048926 Bacteria 3845
2260 Ga0496123_0048983 3300048926 Bacteria 2837
2261 Ga0496123_0062474 3300048926 Bacteria 2386
2262 Ga0496123_0069843 3300048926 Bacteria 2202
2263 Ga0496123_0102717 3300048926 Bacteria 1658
2264 Ga0496123_0116785 3300048926 Bacteria 1511
2265 Ga0496123_0123849 3300048926 Bacteria 1447
2266 Ga0496123_0127257 3300048926 Bacteria 1419
2267 Ga0496123_0236328 3300048926 Bacteria 910
2268 Ga0496123_0274817 3300048926 Bacteria 818
2269 Ga0496123_0292735 3300048926 Bacteria 781
2270 Ga0496124_0000604 3300048927 Bacteria 60274
2271 Ga0496124_0031953 3300048927 Bacteria 4655
2272 Ga0496124_0047252 3300048927 Bacteria 3683
2273 Ga0496124_0049152 3300048927 Bacteria 3599
2274 Ga0496124_0106187 3300048927 Bacteria 2267
2275 Ga0496124_0129517 3300048927 Bacteria 2006
2276 Ga0496124_0132720 3300048927 Bacteria 1976
2277 Ga0496124_0150483 3300048927 Bacteria 1826
2278 Ga0496124_0184640 3300048927 Bacteria 1601
2279 Ga0496124_0189119 3300048927 Bacteria 1577
2280 Ga0496124_0215418 3300048927 Bacteria 1449
2281 Ga0496125_0011999 3300048928 Bacteria 8627
2282 Ga0496125_0032425 3300048928 Bacteria 4641
2283 Ga0496125_0034664 3300048928 Bacteria 4443
2284 Ga0496125_0057872 3300048928 Bacteria 3135
2285 Ga0496125_0060592 3300048928 Bacteria 3040
2286 Ga0496125_0063503 3300048928 Bacteria 2944
2287 Ga0496125_0064828 3300048928 Bacteria 2899
2288 Ga0496125_0098800 3300048928 Bacteria 2159
2289 Ga0496125_0106184 3300048928 Bacteria 2050
2290 Ga0496125_0117134 3300048928 Bacteria 1911
2291 Ga0496125_0191114 3300048928 Bacteria 1352
2292 Ga0496125_0272797 3300048928 Bacteria 1053
2293 Ga0496125_0330565 3300048928 Bacteria 919
2294 Ga0496125_0429065 3300048928 Bacteria 764
2295 Ga0496126_0002475 3300048929 Bacteria 24870
2296 Ga0496126_0031527 3300048929 Bacteria 5006
2297 Ga0496126_0034728 3300048929 Bacteria 4732
2298 Ga0496126_0049160 3300048929 Bacteria 3851
2299 Ga0496126_0051073 3300048929 Bacteria 3766
2300 Ga0496126_0113605 3300048929 Bacteria 2357
2301 Ga0496126_0138173 3300048929 Bacteria 2099
2302 Ga0496126_0256051 3300048929 Bacteria 1457
2303 Ga0496126_0407742 3300048929 Bacteria 1101
2304 Ga0496126_0589209 3300048929 Bacteria 877
2305 Ga0466983_0150046 3300048986 Bacteria 1906
2306 Ga0501306_000150 3300049127 Bacteria 4359
2307 Ga0501306_000253 3300049127 Bacteria 3720
2308 Ga0501306_003340 3300049127 Bacteria 1723
2309 Ga0501306_004287 3300049127 Bacteria 1591
2310 Ga0501306_008033 3300049127 Bacteria 1278
2311 Ga0501306_018161 3300049127 Bacteria 960
2312 Ga0501308_000175 3300049128 Bacteria 3509
2313 Ga0501308_000982 3300049128 Bacteria 2129
2314 Ga0501308_002408 3300049128 Bacteria 1638
2315 Ga0501308_003892 3300049128 Bacteria 1410
2316 Ga0501308_006963 3300049128 Bacteria 1173
2317 Ga0501308_010547 3300049128 Bacteria 1028
2318 Ga0501308_019554 3300049128 Bacteria 837
2319 Ga0501309_004241 3300049129 Bacteria 1663
2320 Ga0501309_014170 3300049129 Bacteria 1067
2321 Ga0501309_025359 3300049129 Bacteria 852
2322 Ga0501310_000687 3300049130 Bacteria 2995
2323 Ga0501310_001072 3300049130 Bacteria 2465
2324 Ga0501310_007030 3300049130 Bacteria 1196
2325 Ga0501310_011850 3300049130 Bacteria 992
2326 Ga0501310_027457 3300049130 Bacteria 742
2327 Ga0501341_03017 3300049131 Bacteria 936
2328 Ga0501343_000533 3300049132 Bacteria 2250
2329 Ga0501343_013342 3300049132 Bacteria 688
2330 Ga0501304_000078 3300049160 Bacteria 3406
2331 Ga0501304_001138 3300049160 Bacteria 1639
2332 Ga0501305_005503 3300049161 Bacteria 1538
2333 Ga0501305_006325 3300049161 Bacteria 1467
2334 Ga0501305_009970 3300049161 Bacteria 1260
2335 Ga0501305_027490 3300049161 Bacteria 872
2336 Ga0501305_035234 3300049161 Bacteria 796
2337 Ga0501307_002498 3300049162 Bacteria 1720
2338 Ga0501307_012155 3300049162 Bacteria 1020
2339 Ga0495678_003816 3300049459 Bacteria 9088
2340 Ga0495678_006998 3300049459 Bacteria 5916
2341 Ga0495678_027928 3300049459 Bacteria 2387
2342 Ga0495678_041264 3300049459 Bacteria 1848
2343 Ga0495678_059401 3300049459 Bacteria 1441
2344 Ga0495678_065117 3300049459 Bacteria 1354
2345 Ga0495678_069294 3300049459 Bacteria 1297
2346 Ga0495678_148806 3300049459 Bacteria 758
2347 Ga0495682_0010047 3300049460 Bacteria 3677
2348 Ga0495682_0018830 3300049460 Bacteria 2599
2349 Ga0495682_0022791 3300049460 Bacteria 2341
2350 Ga0495682_0080123 3300049460 Bacteria 1174
2351 Ga0495682_0103261 3300049460 Bacteria 1022
2352 Ga0501292_000933 3300049515 Bacteria 3561
2353 Ga0501297_008381 3300049520 Bacteria 1138
2354 Ga0501298_009717 3300049521 Bacteria 1641
2355 Ga0501311_000165 3300049527 Bacteria 3696
2356 Ga0501311_009998 3300049527 Bacteria 1144
2357 Ga0501312_012905 3300049528 Bacteria 1155
2358 Ga0501312_016062 3300049528 Bacteria 1067
2359 Ga0501313_000756 3300049529 Bacteria 2434
2360 Ga0501313_001122 3300049529 Bacteria 2196
2361 Ga0501313_005178 3300049529 Bacteria 1367
2362 Ga0501315_000244 3300049531 Bacteria 3399
2363 Ga0501315_000556 3300049531 Bacteria 2665
2364 Ga0501315_002286 3300049531 Bacteria 1779
2365 Ga0501315_003217 3300049531 Bacteria 1616
2366 Ga0501315_003289 3300049531 Bacteria 1603
2367 Ga0501315_005372 3300049531 Bacteria 1385
2368 Ga0501316_000848 3300049532 Bacteria 2366
2369 Ga0501316_006293 3300049532 Bacteria 1260
2370 Ga0501316_007780 3300049532 Bacteria 1172
2371 Ga0501317_001775 3300049533 Bacteria 1930
2372 Ga0501317_018559 3300049533 Bacteria 921
2373 Ga0501317_043131 3300049533 Bacteria 695
2374 Ga0501319_000641 3300049535 Bacteria 1757
2375 Ga0501319_001588 3300049535 Bacteria 1339
2376 Ga0501319_001774 3300049535 Bacteria 1298
2377 Ga0501319_008162 3300049535 Bacteria 801
2378 Ga0501320_001958 3300049536 Bacteria 1590
2379 Ga0501320_003150 3300049536 Bacteria 1378
2380 Ga0501320_003152 3300049536 Bacteria 1378
2381 Ga0501321_006970 3300049537 Bacteria 1163
2382 Ga0501321_011853 3300049537 Bacteria 979
2383 Ga0501321_041318 3300049537 Bacteria 650
2384 Ga0501323_007809 3300049539 Bacteria 1229
2385 Ga0501323_008445 3300049539 Bacteria 1195
2386 Ga0501324_000146 3300049540 Bacteria 3029
2387 Ga0501324_002902 3300049540 Bacteria 1281
2388 Ga0501324_004453 3300049540 Bacteria 1114
2389 Ga0501325_005150 3300049541 Bacteria 1030
2390 Ga0501325_005517 3300049541 Bacteria 1008
2391 Ga0501325_012169 3300049541 Bacteria 806
2392 Ga0501326_05350 3300049542 Bacteria 698
2393 Ga0501331_07737 3300049547 Bacteria 643
2394 Ga0501335_002254 3300049551 Bacteria 1552
2395 Ga0501335_002270 3300049551 Bacteria 1548
2396 Ga0501336_001604 3300049552 Bacteria 1373
2397 Ga0501337_003827 3300049553 Bacteria 967
2398 Ga0501031_0021734 3300049568 Bacteria 4182
2399 Ga0501032_0447997 3300049569 Bacteria 827
2400 Ga0501034_0034857 3300049571 Bacteria 5103
2401 Ga0501034_0040683 3300049571 Bacteria 4704
2402 Ga0501037_0347332 3300049573 Bacteria 1024
2403 Ga0501043_0172838 3300049579 Bacteria 1685
2404 Ga0501046_0179980 3300049580 Bacteria 1581
2405 Ga0501047_0161758 3300049581 Bacteria 2110
2406 Ga0501071_0058886 3300049587 Bacteria 2778
2407 Ga0501076_0236038 3300049592 Bacteria 1495
2408 Ga0501222_000123 3300049662 Bacteria 16880
2409 Ga0501227_001669 3300049665 Bacteria 4945
2410 Ga0501240_002498 3300049673 Bacteria 1958
2411 Ga0501249_011012 3300049679 Bacteria 1895
2412 Ga0501249_019775 3300049679 Bacteria 1462
2413 Ga0501257_003951 3300049686 Bacteria 3216
2414 Ga0501225_0010979 3300049705 Bacteria 2554
2415 Ga0501234_014155 3300049707 Bacteria 1252
2416 Ga0501080_0035081 3300049742 Bacteria 4683
2417 Ga0501262_001632 3300049759 Bacteria 2516
2418 Ga0501262_003431 3300049759 Bacteria 1814
2419 Ga0501265_000831 3300049762 Bacteria 3413
2420 Ga0501266_055142 3300049763 Bacteria 623
2421 Ga0501269_015818 3300049766 Bacteria 927
2422 Ga0501273_033478 3300049770 Bacteria 739
2423 Ga0501279_003775 3300049775 Bacteria 1982
2424 Ga0501279_017957 3300049775 Bacteria 993
2425 Ga0501279_032048 3300049775 Bacteria 782
2426 Ga0501281_01859 3300049777 Bacteria 1588
2427 Ga0501035_0032626 3300049822 Bacteria 4737
2428 Ga0501035_0035964 3300049822 Bacteria 4492
2429 Ga0501035_0131976 3300049822 Bacteria 2177
2430 Ga0501044_0266977 3300049823 Bacteria 1648
2431 Ga0501045_0033343 3300049824 Bacteria 3733
2432 nmdc:mga03683_11904_c1 3300050489 Bacteria 3163
2433 nmdc:mga03683_12404_c1 3300050489 Bacteria 3112
2434 nmdc:mga03683_188631_c1 3300050489 Bacteria 943
2435 nmdc:mga03683_44553_c1 3300050489 Bacteria 1834
2436 nmdc:mga03683_58070_c1 3300050489 Bacteria 1630
2437 nmdc:mga03683_85310_c1 3300050489 Bacteria 1369
2438 nmdc:mga03683_91985_c1 3300050489 Bacteria 1324
2439 nmdc:mga03n38_77480_c1 3300050490 Bacteria 1554
2440 nmdc:mga03n38_79853_c1 3300050490 Bacteria 1535
2441 nmdc:mga03n38_8620_c1 3300050490 Bacteria 3668
2442 nmdc:mga00v17_20109_c1 3300050491 Bacteria 3821
2443 nmdc:mga00v17_20356_c1 3300050491 Bacteria 3800
2444 nmdc:mga00v17_402023_c1 3300050491 Bacteria 890
2445 nmdc:mga00v17_99027_c1 3300050491 Bacteria 1839
2446 nmdc:mga0yw44_130233_c1 3300050492 Bacteria 1628
2447 nmdc:mga0yw44_23722_c1 3300050492 Bacteria 3461
2448 nmdc:mga0yw44_46433_c1 3300050492 Bacteria 2608
2449 nmdc:mga0yw44_8441_c1 3300050492 Bacteria 5133
2450 nmdc:mga0k408_10237_c1 3300050493 Bacteria 5069
2451 nmdc:mga0k408_112063_c1 3300050493 Bacteria 1613
2452 nmdc:mga0k408_114249_c1 3300050493 Bacteria 1597
2453 nmdc:mga0k408_136853_c1 3300050493 Bacteria 1456
2454 nmdc:mga0k408_144166_c1 3300050493 Bacteria 1418
2455 nmdc:mga0k408_169869_c1 3300050493 Bacteria 1300
2456 nmdc:mga0k408_195629_c1 3300050493 Bacteria 1207
2457 nmdc:mga0k408_2170_c1 3300050493 Bacteria 10530
2458 nmdc:mga0k408_32661_c1 3300050493 Bacteria 2417
2459 nmdc:mga0k408_36153_c2 3300050493 Bacteria 1238
2460 nmdc:mga0k408_390207_c1 3300050493 Bacteria 829
2461 nmdc:mga0k408_39362_c1 3300050493 Bacteria 2716
2462 nmdc:mga0k408_42542_c1 3300050493 Bacteria 2617
2463 nmdc:mga0k408_67516_c1 3300050493 Bacteria 2084
2464 nmdc:mga0k408_82211_c1 3300050493 Bacteria 1887
2465 nmdc:mga0k408_8725_c2 3300050493 Bacteria 1701
2466 nmdc:mga0k408_93324_c2 3300050493 Bacteria 1356
2467 nmdc:mga0k408_94665_c1 3300050493 Bacteria 1757
2468 nmdc:mga06z11_182512_c1 3300050494 Bacteria 1211
2469 nmdc:mga06z11_371103_c1 3300050494 Bacteria 859
2470 nmdc:mga06z11_71761_c1 3300050494 Bacteria 1834
2471 nmdc:mga07m45_10461_c1 3300050496 Bacteria 4847
2472 nmdc:mga07m45_122949_c1 3300050496 Bacteria 1500
2473 nmdc:mga07m45_122954_c1 3300050496 Bacteria 1500
2474 nmdc:mga07m45_249471_c1 3300050496 Bacteria 1033
2475 nmdc:mga07m45_291892_c1 3300050496 Bacteria 949
2476 nmdc:mga07m45_320498_c1 3300050496 Bacteria 901
2477 nmdc:mga07m45_33254_c2 3300050496 Bacteria 2480
2478 nmdc:mga07m45_34668_c1 3300050496 Bacteria 2806
2479 nmdc:mga07m45_3600_c1 3300050496 Bacteria 7218
2480 nmdc:mga07m45_39978_c1 3300050496 Bacteria 2624
2481 nmdc:mga07m45_46653_c1 3300050496 Bacteria 2435
2482 nmdc:mga07m45_5926_c1 3300050496 Bacteria 6133
2483 nmdc:mga07m45_7669_c1 3300050496 Bacteria 5522
2484 nmdc:mga07m45_89556_c1 3300050496 Bacteria 1762
2485 nmdc:mga07m45_92366_c1 3300050496 Bacteria 1735
2486 nmdc:mga07m45_95626_c1 3300050496 Bacteria 1704
2487 nmdc:mga05p37_47362_c1 3300050507 Bacteria 5287
2488 nmdc:mga09592_305885_c1 3300050508 Bacteria 1378
2489 nmdc:mga0qj67_153033_c1 3300050509 Bacteria 1871
2490 nmdc:mga0qj67_546410_c1 3300050509 Bacteria 929
2491 nmdc:mga0sz30_26643_c1 3300050516 Bacteria 2371
2492 nmdc:mga0sz30_7083_c1 3300050516 Bacteria 4194
2493 nmdc:mga0sz30_76932_c1 3300050516 Bacteria 1441
2494 Ga0500610_0025814 3300053079 Bacteria 2934
2495 Ga0500635_0000036 3300053080 Bacteria 94740
2496 Ga0500578_0027920 3300053086 Bacteria 3624
2497 Ga0500643_047129 3300053087 Bacteria 1243
2498 Ga0500643_049944 3300053087 Bacteria 1198
2499 Ga0500644_0041508 3300053088 Bacteria 1528
2500 Ga0500651_0010789 3300053093 Bacteria 5488
2501 Ga0500566_0172237 3300053094 Bacteria 1118
2502 Ga0500641_0147556 3300053096 Bacteria 1016
2503 Ga0500562_036918 3300053108 Bacteria 1296
2504 Ga0500571_000048 3300053110 Bacteria 37193
2505 Ga0500572_018555 3300053111 Bacteria 1804
2506 Ga0500572_059958 3300053111 Bacteria 1155
2507 Ga0500593_042744 3300053117 Bacteria 2023
2508 Ga0500593_058228 3300053117 Bacteria 1701
2509 Ga0500593_162039 3300053117 Bacteria 854
2510 Ga0500594_0000241 3300053118 Bacteria 13211
2511 Ga0500594_0002841 3300053118 Bacteria 3778
2512 Ga0500594_0032955 3300053118 Bacteria 1375
2513 Ga0500597_065205 3300053120 Bacteria 1568
2514 Ga0500607_051342 3300053121 Bacteria 2192
2515 Ga0500608_015572 3300053122 Bacteria 3419
2516 Ga0500608_024309 3300053122 Bacteria 2828
2517 Ga0500618_004294 3300053125 Bacteria 4610
2518 Ga0500628_024876 3300053129 Bacteria 1247
2519 Ga0500652_037941 3300053131 Bacteria 1925
2520 Ga0500655_004933 3300053133 Bacteria 2397
2521 Ga0500655_067808 3300053133 Bacteria 724
2522 Ga0500658_0027750 3300053134 Bacteria 2192
2523 Ga0500658_0046712 3300053134 Bacteria 1754
2524 Ga0500658_0159392 3300053134 Bacteria 1021
2525 Ga0500559_0001032 3300053136 Bacteria 17050
2526 Ga0500559_0021378 3300053136 Bacteria 2742
2527 Ga0500559_0112531 3300053136 Bacteria 1262
2528 Ga0500559_0141278 3300053136 Bacteria 1127
2529 Ga0500564_036515 3300053138 Bacteria 2267
2530 Ga0500564_117766 3300053138 Bacteria 1160
2531 Ga0500568_0033035 3300053139 Bacteria 2125
2532 Ga0500568_0054766 3300053139 Bacteria 1559
2533 Ga0500568_0065837 3300053139 Bacteria 1394
2534 Ga0500574_009578 3300053141 Bacteria 2110
2535 Ga0500589_037940 3300053147 Bacteria 2249
2536 Ga0500616_0013250 3300053153 Bacteria 4795
2537 Ga0500622_0003393 3300053156 Bacteria 10713
2538 Ga0500622_0006410 3300053156 Bacteria 6827
2539 Ga0500624_018702 3300053157 Bacteria 1094
2540 Ga0500627_0098952 3300053158 Bacteria 1308
2541 Ga0500634_0089893 3300053161 Bacteria 1562
2542 Ga0500638_077509 3300053162 Bacteria 1581
2543 Ga0500636_0057033 3300053177 Bacteria 2286
2544 Ga0500636_0139701 3300053177 Bacteria 1342
2545 Ga0500645_007257 3300053730 Bacteria 3876
2546 Ga0500645_010915 3300053730 Bacteria 2984
2547 Ga0500645_075427 3300053730 Bacteria 965
2548 Ga0500565_005793 3300053734 Bacteria 1108
2549 Ga0500596_010257 3300053735 Bacteria 1450
2550 Ga0500587_003497 3300053739 Bacteria 2190
2551 Ga0500661_011693 3300055283 Bacteria 1586
2552 Ga0590071_080235 3300059421 Bacteria 811
2553 Ga0590075_028322 3300059424 Bacteria 1415
2554 Ga0590075_088345 3300059424 Bacteria 804
2555 Ga0587084_002143 3300059477 Bacteria 2005
2556 Ga0587084_003762 3300059477 Bacteria 1690
2557 Ga0587084_006452 3300059477 Bacteria 1425
2558 Ga0587084_012498 3300059477 Bacteria 1151
2559 Ga0587084_017838 3300059477 Bacteria 1029
2560 Ga0587084_026827 3300059477 Bacteria 902
2561 Ga0587084_026918 3300059477 Bacteria 901
2562 Ga0587084_036053 3300059477 Bacteria 820
2563 Ga0587093_001802 3300059478 Bacteria 1885
2564 Ga0587093_003356 3300059478 Bacteria 1567
2565 Ga0587093_012940 3300059478 Bacteria 1020
2566 Ga0587093_016083 3300059478 Bacteria 951
2567 Ga0587093_024341 3300059478 Bacteria 833
2568 Ga0587066_002048 3300059490 Bacteria 2157
2569 Ga0587066_057002 3300059490 Bacteria 787
2570 Ga0587070_003017 3300059491 Bacteria 1975
2571 Ga0587070_009698 3300059491 Bacteria 1399
2572 Ga0587070_024879 3300059491 Bacteria 1040
2573 Ga0587073_0000405 3300059492 Bacteria 3811
2574 Ga0587073_0037085 3300059492 Bacteria 1042
2575 Ga0587073_0056881 3300059492 Bacteria 905
2576 Ga0587077_008903 3300059493 Bacteria 1508
2577 Ga0587077_009273 3300059493 Bacteria 1489
2578 Ga0587077_017635 3300059493 Bacteria 1219
2579 Ga0587077_018132 3300059493 Bacteria 1208
2580 Ga0587077_056847 3300059493 Bacteria 836
2581 Ga0587080_003728 3300059503 Bacteria 1923
2582 Ga0587080_008427 3300059503 Bacteria 1477
2583 Ga0587080_021637 3300059503 Bacteria 1059
2584 Ga0587082_000814 3300059504 Bacteria 2909
2585 Ga0587082_006811 3300059504 Bacteria 1539
2586 Ga0587082_019229 3300059504 Bacteria 1095
2587 Ga0587082_029541 3300059504 Bacteria 947
2588 Ga0587082_056537 3300059504 Bacteria 763
2589 Ga0587083_0001894 3300059505 Bacteria 2480
2590 Ga0587083_0002412 3300059505 Bacteria 2327
2591 Ga0587083_0005385 3300059505 Bacteria 1847
2592 Ga0587083_0012271 3300059505 Bacteria 1434
2593 Ga0587083_0030301 3300059505 Bacteria 1072
2594 Ga0587083_0039159 3300059505 Bacteria 984
2595 Ga0587083_0084012 3300059505 Bacteria 764
2596 Ga0587085_019471 3300059506 Bacteria 1017
2597 Ga0587085_022289 3300059506 Bacteria 975
2598 Ga0587086_000667 3300059507 Bacteria 2638
2599 Ga0587086_001217 3300059507 Bacteria 2160
2600 Ga0587086_003732 3300059507 Bacteria 1551
2601 Ga0587086_005430 3300059507 Bacteria 1379
2602 Ga0587088_001458 3300059508 Bacteria 2461
2603 Ga0587088_006876 3300059508 Bacteria 1552
2604 Ga0587088_011197 3300059508 Bacteria 1331
2605 Ga0587088_059497 3300059508 Bacteria 770
2606 Ga0587088_066917 3300059508 Bacteria 741
2607 Ga0587090_000276 3300059510 Bacteria 3924
2608 Ga0587090_001097 3300059510 Bacteria 2624
2609 Ga0587090_002303 3300059510 Bacteria 2083
2610 Ga0587090_003488 3300059510 Bacteria 1832
2611 Ga0587090_005242 3300059510 Bacteria 1615
2612 Ga0587090_006735 3300059510 Bacteria 1487
2613 Ga0587090_007045 3300059510 Bacteria 1464
2614 Ga0587090_008382 3300059510 Bacteria 1385
2615 Ga0587090_008460 3300059510 Bacteria 1381
2616 Ga0587090_010003 3300059510 Bacteria 1306
2617 Ga0587090_013784 3300059510 Bacteria 1173
2618 Ga0587090_016688 3300059510 Bacteria 1100
2619 Ga0587090_019222 3300059510 Bacteria 1052
2620 Ga0587090_024277 3300059510 Bacteria 971
2621 Ga0587090_075244 3300059510 Bacteria 667
2622 Ga0587091_002980 3300059511 Bacteria 2079
2623 Ga0587091_012189 3300059511 Bacteria 1356
2624 Ga0587092_005373 3300059512 Bacteria 1577
2625 Ga0587092_008000 3300059512 Bacteria 1386
2626 Ga0587092_010269 3300059512 Bacteria 1277
2627 Ga0587092_068803 3300059512 Bacteria 677
2628 Ga0587094_002657 3300059513 Bacteria 1867
2629 Ga0587094_003513 3300059513 Bacteria 1716
2630 Ga0587094_003743 3300059513 Bacteria 1682
2631 Ga0587094_014220 3300059513 Bacteria 1085
2632 Ga0587094_023777 3300059513 Bacteria 909
2633 Ga0587094_026346 3300059513 Bacteria 877
2634 Ga0587095_000862 3300059514 Bacteria 1720
2635 Ga0587095_001423 3300059514 Bacteria 1470
2636 Ga0587095_002200 3300059514 Bacteria 1292
2637 Ga0587098_002133 3300059604 Bacteria 1634
2638 Ga0587098_006295 3300059604 Bacteria 1198
2639 Ga0587106_007244 3300059605 Bacteria 1340
2640 Ga0587106_011000 3300059605 Bacteria 1184
2641 Ga0587106_033812 3300059605 Bacteria 835
2642 Ga0587125_000574 3300059607 Bacteria 2242
2643 Ga0587125_006552 3300059607 Bacteria 1105
2644 Ga0587101_000225 3300059623 Bacteria 3438
2645 Ga0587101_000524 3300059623 Bacteria 2775
2646 Ga0587101_001341 3300059623 Bacteria 2095
2647 Ga0587101_002989 3300059623 Bacteria 1678
2648 Ga0587101_007290 3300059623 Bacteria 1300
2649 Ga0587101_023984 3300059623 Bacteria 902
2650 Ga0587109_043738 3300059624 Bacteria 897
2651 Ga0587109_064924 3300059624 Bacteria 777
2652 Ga0587113_005868 3300059625 Bacteria 1027
2653 Ga0587115_011948 3300059626 Bacteria 1102
2654 Ga0587127_007967 3300059629 Bacteria 782
2655 Ga0587128_001221 3300059630 Bacteria 2348
2656 Ga0587128_012593 3300059630 Bacteria 1178
2657 Ga0587128_019693 3300059630 Bacteria 1024
2658 Ga0587128_020264 3300059630 Bacteria 1014
2659 Ga0587128_044583 3300059630 Bacteria 788
2660 Ga0587128_060363 3300059630 Bacteria 715
2661 Ga0587062_001796 3300059639 Bacteria 1935
2662 Ga0587062_013745 3300059639 Bacteria 1059
2663 Ga0587062_025636 3300059639 Bacteria 869
2664 Ga0587067_011515 3300059640 Bacteria 1363
2665 Ga0587067_029171 3300059640 Bacteria 1007
2666 Ga0587068_003974 3300059641 Bacteria 1927
2667 Ga0587068_006027 3300059641 Bacteria 1681
2668 Ga0587068_006343 3300059641 Bacteria 1653
2669 Ga0587068_012253 3300059641 Bacteria 1306
2670 Ga0587068_015569 3300059641 Bacteria 1197
2671 Ga0587068_020378 3300059641 Bacteria 1083
2672 Ga0587068_026722 3300059641 Bacteria 978
2673 Ga0587068_029120 3300059641 Bacteria 948
2674 Ga0587069_000151 3300059642 Bacteria 4141
2675 Ga0587069_000921 3300059642 Bacteria 2494
2676 Ga0587072_000009 3300059643 Bacteria 12860
2677 Ga0587072_000838 3300059643 Bacteria 3457
2678 Ga0587072_004420 3300059643 Bacteria 2042
2679 Ga0587072_004903 3300059643 Bacteria 1973
2680 Ga0587072_009593 3300059643 Bacteria 1550
2681 Ga0587072_018195 3300059643 Bacteria 1219
2682 Ga0587072_028594 3300059643 Bacteria 1029
2683 Ga0587075_002302 3300059644 Bacteria 2003
2684 Ga0587075_006342 3300059644 Bacteria 1449
2685 Ga0587075_008983 3300059644 Bacteria 1292
2686 Ga0587075_017383 3300059644 Bacteria 1033
2687 Ga0587076_000445 3300059645 Bacteria 3337
2688 Ga0587076_000769 3300059645 Bacteria 2890
2689 Ga0587076_002704 3300059645 Bacteria 2021
2690 Ga0587078_001338 3300059646 Bacteria 2169
2691 Ga0587078_006229 3300059646 Bacteria 1292
2692 Ga0587078_006884 3300059646 Bacteria 1244
2693 Ga0587078_016675 3300059646 Bacteria 896
2694 Ga0587078_023445 3300059646 Bacteria 794
2695 Ga0587079_000436 3300059647 Bacteria 3627
2696 Ga0587079_007421 3300059647 Bacteria 1641
2697 Ga0587079_027012 3300059647 Bacteria 1077
2698 Ga0587079_042010 3300059647 Bacteria 927
2699 Ga0587079_060424 3300059647 Bacteria 820
2700 Ga0587100_005792 3300059648 Bacteria 931
2701 Ga0587100_005983 3300059648 Bacteria 923
2702 Ga0587102_000673 3300059649 Bacteria 2076
2703 Ga0587102_001335 3300059649 Bacteria 1704
2704 Ga0587102_005975 3300059649 Bacteria 1092
2705 Ga0587107_000129 3300059652 Bacteria 3794
2706 Ga0587107_003848 3300059652 Bacteria 1485
2707 Ga0587107_006816 3300059652 Bacteria 1266
2708 Ga0587108_000129 3300059653 Bacteria 3147
2709 Ga0587108_000215 3300059653 Bacteria 2673
2710 Ga0587110_001895 3300059654 Bacteria 1590
2711 Ga0587119_001725 3300059658 Bacteria 1859
2712 Ga0587119_005176 3300059658 Bacteria 1325
2713 Ga0587120_000930 3300059659 Bacteria 1689
2714 Ga0587124_002273 3300059660 Bacteria 1337
2715 Ga0587124_006311 3300059660 Bacteria 973
2716 Ga0587124_008184 3300059660 Bacteria 893
2717 Ga0587060_004583 3300060243 Bacteria 1054
2718 Ga0587071_000779 3300060344 Bacteria 3530
2719 Ga0587071_004113 3300060344 Bacteria 2143
2720 Ga0587071_004178 3300060344 Bacteria 2131
2721 Ga0587071_005752 3300060344 Bacteria 1911
2722 Ga0587071_013321 3300060344 Bacteria 1415
2723 Ga0587071_014546 3300060344 Bacteria 1369
2724 Ga0587071_070421 3300060344 Bacteria 761
2725 Ga0587071_085965 3300060344 Bacteria 707
2726 Ga0587111_0005555 3300060346 Bacteria 1953
2727 Ga0587111_0006057 3300060346 Bacteria 1899
2728 Ga0587111_0006348 3300060346 Bacteria 1871
2729 Ga0587111_0009091 3300060346 Bacteria 1666
2730 Ga0587111_0017348 3300060346 Bacteria 1341
2731 Ga0587111_0030168 3300060346 Bacteria 1102
2732 Ga0587111_0039444 3300060346 Bacteria 1001
2733 Ga0587111_0048790 3300060346 Bacteria 928
2734 Ga0587111_0062722 3300060346 Bacteria 849
2735 Ga0466962_0004024 3300061719 Bacteria 7042
2736 Ga0466962_0009181 3300061719 Bacteria 4736
2737 Ga0466962_0016604 3300061719 Bacteria 3550
2738 Ga0466962_0025912 3300061719 Bacteria 2815
2739 Ga0466962_0046866 3300061719 Bacteria 2065
2740 Ga0466962_0093965 3300061719 Bacteria 1438
2741 Ga0466962_0161457 3300061719 Bacteria 1089

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1014646 Ga0055534_10146462 177
2 iso_pu_bacteria 2515154123 2515692609 179
3 3300042876 Ga0451577_0038088 Ga0451577_0038088_3737_4300 180
4 3300044712 Ga0453684_0551542 Ga0453684_0551542_35_598 180
5 3300050494 nmdc:mga06z11_71761_c1 nmdc:mga06z11_71761_c1_454_1086 180
6 3300009148 Ga0105243_10058416 Ga0105243_100584164 181
7 3300009553 Ga0105249_10677686 Ga0105249_106776863 181
8 3300028800 Ga0265338_10006209 Ga0265338_100062099 181
9 3300039447 Ga0436361_1079804 Ga0436361_1079804_31_594 181
10 3300049535 Ga0501319_000641 Ga0501319_000641_95_721 181
11 3300053730 Ga0500645_075427 Ga0500645_075427_159_716 181
12 3300001904 JGI24736J21556_1003444 JGI24736J21556_10034442 182
13 3300001904 JGI24736J21556_1012627 JGI24736J21556_10126271 182
14 3300001915 JGI24741J21665_1015120 JGI24741J21665_10151201 182
15 3300001979 JGI24740J21852_10002263 JGI24740J21852_100022637 182
16 3300001979 JGI24740J21852_10038645 JGI24740J21852_100386451 182
17 3300001989 JGI24739J22299_10038309 JGI24739J22299_100383093 182
18 3300001989 JGI24739J22299_10043184 JGI24739J22299_100431842 182
19 3300001989 JGI24739J22299_10043914 JGI24739J22299_100439144 182
20 3300001989 JGI24739J22299_10093767 JGI24739J22299_100937672 182
21 3300001989 JGI24739J22299_10164206 JGI24739J22299_101642061 182
22 3300001990 JGI24737J22298_10026240 JGI24737J22298_100262401 182
23 3300001990 JGI24737J22298_10045012 JGI24737J22298_100450121 182
24 3300002067 JGI24735J21928_10004283 JGI24735J21928_100042834 182
25 3300002067 JGI24735J21928_10016824 JGI24735J21928_100168244 182
26 3300002067 JGI24735J21928_10019195 JGI24735J21928_100191953 182
27 3300002067 JGI24735J21928_10034358 JGI24735J21928_100343582 182
28 3300002067 JGI24735J21928_10045175 JGI24735J21928_100451754 182
29 3300002067 JGI24735J21928_10093462 JGI24735J21928_100934622 182
30 3300002075 JGI24738J21930_10000269 JGI24738J21930_100002698 182
31 3300002705 JGI25156J39149_1014169 JGI25156J39149_10141692 182
32 3300002705 JGI25156J39149_1021755 JGI25156J39149_10217552 182
33 3300002705 JGI25156J39149_1032885 JGI25156J39149_10328851 182
34 3300003162 Ga0006778J45830_1042439 Ga0006778J45830_10424393 182
35 3300003214 JGI25165J46597_1000973 JGI25165J46597_10009735 182
36 3300003308 Ga0006777J48905_1035131 Ga0006777J48905_10351314 182
37 3300003354 JGI25160J50197_1002205 JGI25160J50197_10022057 182
38 3300003479 Ga0006556J51387_1013499 Ga0006556J51387_10134997 182
39 3300003544 Ga0007417J51691_1044568 Ga0007417J51691_10445682 182
40 3300003565 Ga0006560J51390_1019398 Ga0006560J51390_10193984 182
41 3300003567 Ga0006554J51385_1014759 Ga0006554J51385_10147597 182
42 3300003575 Ga0007409J51694_1015401 Ga0007409J51694_10154017 182
43 3300003577 Ga0007416J51690_1034163 Ga0007416J51690_10341633 182
44 3300003579 Ga0007429J51699_1013683 Ga0007429J51699_10136833 182
45 3300003579 Ga0007429J51699_1053830 Ga0007429J51699_10538301 182
46 3300003693 Ga0032354_1024828 Ga0032354_10248284 182
47 3300003756 Ga0055533_1007666 Ga0055533_10076662 182
48 3300003756 Ga0055533_1009803 Ga0055533_10098032 182
49 3300003758 Ga0055532_1000904 Ga0055532_10009047 182
50 3300003760 Ga0055527_1000706 Ga0055527_10007067 182
51 3300003761 Ga0055535_1001743 Ga0055535_10017437 182
52 3300003762 Ga0055542_1000994 Ga0055542_10009943 182
53 3300003762 Ga0055542_1009264 Ga0055542_10092643 182
54 3300003762 Ga0055542_1016625 Ga0055542_10166251 182
55 3300003763 Ga0055529_1001229 Ga0055529_10012297 182
56 3300003790 Ga0055528_1003884 Ga0055528_10038846 182
57 3300003856 Ga0058692_1008521 Ga0058692_10085213 182
58 3300003856 Ga0058692_1009145 Ga0058692_10091451 182
59 3300004798 Ga0058859_11827169 Ga0058859_118271697 182
60 3300004801 Ga0058860_10027197 Ga0058860_100271973 182
61 3300005262 Ga0065165_1002163 Ga0065165_10021634 182
62 3300005327 Ga0070658_10022814 Ga0070658_100228146 182
63 3300005327 Ga0070658_10144359 Ga0070658_101443593 182
64 3300005327 Ga0070658_10212708 Ga0070658_102127083 182
65 3300005331 Ga0070670_100642709 Ga0070670_1006427091 182
66 3300005335 Ga0070666_10041480 Ga0070666_100414803 182
67 3300005337 Ga0070682_100162046 Ga0070682_1001620463 182
68 3300005339 Ga0070660_100004872 Ga0070660_1000048724 182
69 3300005339 Ga0070660_100164599 Ga0070660_1001645992 182
70 3300005339 Ga0070660_100245380 Ga0070660_1002453801 182
71 3300005339 Ga0070660_100363154 Ga0070660_1003631541 182
72 3300005344 Ga0070661_100154369 Ga0070661_1001543692 182
73 3300005347 Ga0070668_100145349 Ga0070668_1001453493 182
74 3300005366 Ga0070659_100004507 Ga0070659_1000045077 182
75 3300005366 Ga0070659_100254295 Ga0070659_1002542951 182
76 3300005367 Ga0070667_100137525 Ga0070667_1001375254 182
77 3300005455 Ga0070663_100307186 Ga0070663_1003071861 182
78 3300005455 Ga0070663_100787529 Ga0070663_1007875291 182
79 3300005456 Ga0070678_100167594 Ga0070678_1001675943 182
80 3300005548 Ga0070665_100133750 Ga0070665_1001337504 182
81 3300005563 Ga0068855_100097026 Ga0068855_1000970264 182
82 3300005578 Ga0068854_100380776 Ga0068854_1003807761 182
83 3300005614 Ga0068856_100496881 Ga0068856_1004968812 182
84 3300005616 Ga0068852_100209083 Ga0068852_1002090832 182
85 3300005616 Ga0068852_100626586 Ga0068852_1006265862 182
86 3300005842 Ga0068858_100387388 Ga0068858_1003873883 182
87 3300005843 Ga0068860_100961425 Ga0068860_1009614252 182
88 3300005844 Ga0068862_100227610 Ga0068862_1002276102 182
89 3300005937 Ga0081455_10221316 Ga0081455_102213162 182
90 3300009011 Ga0105251_10025374 Ga0105251_100253744 182
91 3300009011 Ga0105251_10026606 Ga0105251_100266065 182
92 3300009011 Ga0105251_10199732 Ga0105251_101997322 182
93 3300009036 Ga0105244_10072576 Ga0105244_100725764 182
94 3300009092 Ga0105250_10095376 Ga0105250_100953761 182
95 3300009092 Ga0105250_10097901 Ga0105250_100979011 182
96 3300009093 Ga0105240_10028244 Ga0105240_100282444 182
97 3300009093 Ga0105240_10268174 Ga0105240_102681743 182
98 3300009093 Ga0105240_10347499 Ga0105240_103474992 182
99 3300009093 Ga0105240_11021466 Ga0105240_110214662 182
100 3300009098 Ga0105245_10190805 Ga0105245_101908053 182
101 3300009176 Ga0105242_11490658 Ga0105242_114906581 182
102 3300009545 Ga0105237_10023654 Ga0105237_100236544 182
103 3300009545 Ga0105237_10088934 Ga0105237_100889344 182
104 3300009545 Ga0105237_11000138 Ga0105237_110001382 182
105 3300009551 Ga0105238_10135101 Ga0105238_101351014 182
106 3300009551 Ga0105238_10399640 Ga0105238_103996401 182
107 3300009551 Ga0105238_11320723 Ga0105238_113207231 182
108 3300010375 Ga0105239_10014369 Ga0105239_100143694 182
109 3300010375 Ga0105239_10143278 Ga0105239_101432784 182
110 3300010375 Ga0105239_10566710 Ga0105239_105667102 182
111 3300011119 Ga0105246_10115841 Ga0105246_101158413 182
112 3300011119 Ga0105246_10228328 Ga0105246_102283282 182
113 3300013100 Ga0157373_10026424 Ga0157373_100264245 182
114 3300013102 Ga0157371_10056239 Ga0157371_100562394 182
115 3300013104 Ga0157370_10020339 Ga0157370_100203396 182
116 3300013104 Ga0157370_10406076 Ga0157370_104060763 182
117 3300013105 Ga0157369_10052190 Ga0157369_100521904 182
118 3300013105 Ga0157369_10056080 Ga0157369_100560806 182
119 3300013105 Ga0157369_10079398 Ga0157369_100793984 182
120 3300013105 Ga0157369_10359801 Ga0157369_103598011 182
121 3300013105 Ga0157369_10365342 Ga0157369_103653424 182
122 3300013105 Ga0157369_10871364 Ga0157369_108713641 182
123 3300013296 Ga0157374_10382671 Ga0157374_103826712 182
124 3300013306 Ga0163162_10278756 Ga0163162_102787562 182
125 3300013307 Ga0157372_10250785 Ga0157372_102507853 182
126 3300013307 Ga0157372_10318860 Ga0157372_103188602 182
127 3300014497 Ga0182008_10070591 Ga0182008_100705912 182
128 3300014497 Ga0182008_10192012 Ga0182008_101920122 182
129 3300015262 Ga0182007_10006260 Ga0182007_100062603 182
130 3300015265 Ga0182005_1027054 Ga0182005_10270543 182
131 3300016635 Ga0183361_10015 Ga0183361_100158 182
132 3300019181 Ga0184594_127158 Ga0184594_1271581 182
133 3300020069 Ga0197907_10126445 Ga0197907_101264453 182
134 3300020069 Ga0197907_10464023 Ga0197907_104640234 182
135 3300020070 Ga0206356_11000981 Ga0206356_110009813 182
136 3300020075 Ga0206349_1060179 Ga0206349_10601791 182
137 3300020076 Ga0206355_1487813 Ga0206355_14878134 182
138 3300020076 Ga0206355_1531200 Ga0206355_15312006 182
139 3300020078 Ga0206352_11049024 Ga0206352_110490244 182
140 3300020080 Ga0206350_10154136 Ga0206350_101541366 182
141 3300020080 Ga0206350_10252000 Ga0206350_102520004 182
142 3300020080 Ga0206350_10703408 Ga0206350_107034084 182
143 3300020081 Ga0206354_10999262 Ga0206354_109992622 182
144 3300020081 Ga0206354_11062004 Ga0206354_110620044 182
145 3300020082 Ga0206353_10874677 Ga0206353_108746771 182
146 3300020082 Ga0206353_11555147 Ga0206353_115551472 182
147 3300021361 Ga0213872_10013483 Ga0213872_100134834 182
148 3300021361 Ga0213872_10105856 Ga0213872_101058562 182
149 3300022467 Ga0224712_10000449 Ga0224712_100004496 182
150 3300022467 Ga0224712_10093976 Ga0224712_100939763 182
151 3300025225 Ga0209566_100606 Ga0209566_10060612 182
152 3300025226 Ga0209674_102782 Ga0209674_1027824 182
153 3300025228 Ga0209672_100073 Ga0209672_100073173 182
154 3300025228 Ga0209672_100717 Ga0209672_1007171 182
155 3300025228 Ga0209672_100718 Ga0209672_1007181 182
156 3300025228 Ga0209672_101679 Ga0209672_1016794 182
157 3300025229 Ga0209147_100093 Ga0209147_100093173 182
158 3300025229 Ga0209147_100853 Ga0209147_1008539 182
159 3300025229 Ga0209147_103483 Ga0209147_1034834 182
160 3300025230 Ga0209563_103356 Ga0209563_1033562 182
161 3300025231 Ga0207427_103146 Ga0207427_1031465 182
162 3300025242 Ga0209258_100140 Ga0209258_100140173 182
163 3300025242 Ga0209258_102011 Ga0209258_1020111 182
164 3300025242 Ga0209258_102012 Ga0209258_1020126 182
165 3300025246 Ga0209646_1033258 Ga0209646_10332581 182
166 3300025253 Ga0209677_109701 Ga0209677_1097012 182
167 3300025254 Ga0209148_1000140 Ga0209148_1000140174 182
168 3300025254 Ga0209148_1000990 Ga0209148_100099012 182
169 3300025256 Ga0209759_1002023 Ga0209759_10020235 182
170 3300025256 Ga0209759_1005734 Ga0209759_10057345 182
171 3300025256 Ga0209759_1005917 Ga0209759_10059175 182
172 3300025256 Ga0209759_1006000 Ga0209759_10060004 182
173 3300025256 Ga0209759_1014035 Ga0209759_10140353 182
174 3300025256 Ga0209759_1018278 Ga0209759_10182782 182
175 3300025261 Ga0209233_1000612 Ga0209233_100061212 182
176 3300025272 Ga0209455_1000125 Ga0209455_1000125174 182
177 3300025272 Ga0209455_1001203 Ga0209455_10012037 182
178 3300025273 Ga0209673_1001644 Ga0209673_10016447 182
179 3300025284 Ga0209130_1012392 Ga0209130_10123922 182
180 3300025295 Ga0209564_1006016 Ga0209564_10060166 182
181 3300025295 Ga0209564_1009674 Ga0209564_10096743 182
182 3300025302 Ga0207426_1001110 Ga0207426_100111020 182
183 3300025302 Ga0207426_1005868 Ga0207426_10058682 182
184 3300025711 Ga0207696_1062568 Ga0207696_10625682 182
185 3300025735 Ga0207713_1001520 Ga0207713_100152012 182
186 3300025735 Ga0207713_1039596 Ga0207713_10395964 182
187 3300025900 Ga0207710_10132240 Ga0207710_101322403 182
188 3300025903 Ga0207680_10032158 Ga0207680_100321584 182
189 3300025904 Ga0207647_10005195 Ga0207647_100051954 182
190 3300025904 Ga0207647_10045927 Ga0207647_100459274 182
191 3300025904 Ga0207647_10127112 Ga0207647_101271122 182
192 3300025904 Ga0207647_10162471 Ga0207647_101624713 182
193 3300025904 Ga0207647_10344992 Ga0207647_103449922 182
194 3300025904 Ga0207647_10345276 Ga0207647_103452761 182
195 3300025909 Ga0207705_10001508 Ga0207705_100015084 182
196 3300025909 Ga0207705_10052423 Ga0207705_100524234 182
197 3300025909 Ga0207705_10574504 Ga0207705_105745041 182
198 3300025913 Ga0207695_10006996 Ga0207695_100069967 182
199 3300025913 Ga0207695_10146618 Ga0207695_101466184 182
200 3300025913 Ga0207695_10257734 Ga0207695_102577342 182
201 3300025913 Ga0207695_10803533 Ga0207695_108035332 182
202 3300025913 Ga0207695_10838610 Ga0207695_108386102 182
203 3300025914 Ga0207671_10048974 Ga0207671_100489744 182
204 3300025914 Ga0207671_10062151 Ga0207671_100621514 182
205 3300025914 Ga0207671_10075831 Ga0207671_100758314 182
206 3300025914 Ga0207671_10698362 Ga0207671_106983621 182
207 3300025919 Ga0207657_10149710 Ga0207657_101497102 182
208 3300025919 Ga0207657_10168368 Ga0207657_101683682 182
209 3300025919 Ga0207657_10196766 Ga0207657_101967662 182
210 3300025919 Ga0207657_10232907 Ga0207657_102329072 182
211 3300025920 Ga0207649_10149744 Ga0207649_101497443 182
212 3300025924 Ga0207694_10013926 Ga0207694_100139264 182
213 3300025924 Ga0207694_10031994 Ga0207694_100319945 182
214 3300025924 Ga0207694_10351670 Ga0207694_103516703 182
215 3300025932 Ga0207690_10000040 Ga0207690_10000040124 182
216 3300025934 Ga0207686_10173261 Ga0207686_101732612 182
217 3300025941 Ga0207711_10004250 Ga0207711_100042507 182
218 3300025941 Ga0207711_10039773 Ga0207711_100397735 182
219 3300025949 Ga0207667_10004067 Ga0207667_100040674 182
220 3300025949 Ga0207667_10024497 Ga0207667_100244973 182
221 3300025949 Ga0207667_10134865 Ga0207667_101348654 182
222 3300025961 Ga0207712_10269592 Ga0207712_102695923 182
223 3300025972 Ga0207668_10200922 Ga0207668_102009224 182
224 3300025981 Ga0207640_10231581 Ga0207640_102315812 182
225 3300025986 Ga0207658_10063510 Ga0207658_100635104 182
226 3300026067 Ga0207678_10021697 Ga0207678_100216976 182
227 3300026067 Ga0207678_10080010 Ga0207678_100800104 182
228 3300026067 Ga0207678_10282516 Ga0207678_102825164 182
229 3300026078 Ga0207702_10032656 Ga0207702_100326565 182
230 3300026142 Ga0207698_10087736 Ga0207698_100877362 182
231 3300026142 Ga0207698_10125231 Ga0207698_101252312 182
232 3300027312 Ga0209371_1000983 Ga0209371_100098312 182
233 3300027312 Ga0209371_1003035 Ga0209371_10030354 182
234 3300028379 Ga0268266_10331612 Ga0268266_103316123 182
235 3300028381 Ga0268264_10632083 Ga0268264_106320832 182
236 3300028800 Ga0265338_10004458 Ga0265338_100044584 182
237 3300030083 Ga0237817_12115 Ga0237817_121152 182
238 3300030500 Ga0268256_1000914 Ga0268256_10009149 182
239 3300030500 Ga0268256_1002721 Ga0268256_10027214 182
240 3300030836 Ga0265767_100423 Ga0265767_1004233 182
241 3300030863 Ga0265766_1000765 Ga0265766_10007653 182
242 3300030863 Ga0265766_1006226 Ga0265766_10062262 182
243 3300030942 Ga0247549_100840 Ga0247549_1008402 182
244 3300030963 Ga0265768_100968 Ga0265768_1009683 182
245 3300031548 Ga0307408_100023998 Ga0307408_1000239984 182
246 3300031814 Ga0247548_102090 Ga0247548_1020902 182
247 3300031911 Ga0307412_10017396 Ga0307412_100173966 182
248 3300032002 Ga0307416_100102646 Ga0307416_1001026464 182
249 3300036458 Ga0310112_001706 Ga0310112_001706_962_1519 182
250 3300037312 Ga0395899_0000080 Ga0395899_0000080_168671_169228 182
251 3300037312 Ga0395899_0028671 Ga0395899_0028671_681_1238 182
252 3300037418 Ga0395900_0000087 Ga0395900_0000087_2341_2898 182
253 3300037418 Ga0395900_0108339 Ga0395900_0108339_459_1019 182
254 3300037418 Ga0395900_0154436 Ga0395900_0154436_686_1243 182
255 3300037418 Ga0395900_0228090 Ga0395900_0228090_684_1241 182
256 3300037418 Ga0395900_0421557 Ga0395900_0421557_222_779 182
257 3300037418 Ga0395900_0607856 Ga0395900_0607856_395_955 182
258 3300037466 Ga0395898_0002330 Ga0395898_0002330_684_1241 182
259 3300037466 Ga0395898_0005792 Ga0395898_0005792_12049_12606 182
260 3300037466 Ga0395898_0222638 Ga0395898_0222638_760_1317 182
261 3300037466 Ga0395898_0429745 Ga0395898_0429745_286_843 182
262 3300037471 Ga0395905_0003008 Ga0395905_0003008_17023_17580 182
263 3300037471 Ga0395905_0230130 Ga0395905_0230130_838_1395 182
264 3300038443 Ga0395901_0001551 Ga0395901_0001551_22567_23124 182
265 3300038443 Ga0395901_0005665 Ga0395901_0005665_686_1243 182
266 3300038443 Ga0395901_0052878 Ga0395901_0052878_684_1241 182
267 3300038443 Ga0395901_0451486 Ga0395901_0451486_535_1092 182
268 3300039447 Ga0436361_1077029 Ga0436361_1077029_649_1206 182
269 3300042005 Ga0439448_0001040 Ga0439448_0001040_5700_6260 182
270 3300042185 Ga0450909_027390 Ga0450909_027390_301_849 182
271 3300044650 Ga0466986_0313482 Ga0466986_0313482_39_596 182
272 3300044656 Ga0466969_0005824 Ga0466969_0005824_5204_5761 182
273 3300044656 Ga0466969_0007725 Ga0466969_0007725_680_1240 182
274 3300044656 Ga0466969_0019552 Ga0466969_0019552_753_1310 182
275 3300044659 Ga0466973_0018308 Ga0466973_0018308_2200_2757 182
276 3300044683 Ga0466965_0002098 Ga0466965_0002098_7121_7678 182
277 3300044683 Ga0466965_0003272 Ga0466965_0003272_1702_2259 182
278 3300044683 Ga0466965_0442869 Ga0466965_0442869_140_697 182
279 3300044684 Ga0466966_0028392 Ga0466966_0028392_663_1223 182
280 3300044684 Ga0466966_0039346 Ga0466966_0039346_1803_2360 182
281 3300044684 Ga0466966_0046057 Ga0466966_0046057_558_1115 182
282 3300044684 Ga0466966_0144128 Ga0466966_0144128_278_835 182
283 3300044693 Ga0466961_0037792 Ga0466961_0037792_679_1236 182
284 3300044693 Ga0466961_0039006 Ga0466961_0039006_1803_2360 182
285 3300044693 Ga0466961_0043452 Ga0466961_0043452_697_1257 182
286 3300044693 Ga0466961_0100576 Ga0466961_0100576_85_642 182
287 3300044693 Ga0466961_0153554 Ga0466961_0153554_166_723 182
288 3300044693 Ga0466961_0162953 Ga0466961_0162953_686_1243 182
289 3300044694 Ga0466963_0009556 Ga0466963_0009556_4631_5188 182
290 3300044694 Ga0466963_0093462 Ga0466963_0093462_825_1382 182
291 3300044706 Ga0466964_0003855 Ga0466964_0003855_4265_4822 182
292 3300044719 Ga0466971_0011241 Ga0466971_0011241_2679_3236 182
293 3300044719 Ga0466971_0103860 Ga0466971_0103860_669_1226 182
294 3300044719 Ga0466971_0184236 Ga0466971_0184236_85_642 182
295 3300044719 Ga0466971_0499209 Ga0466971_0499209_10_567 182
296 3300044765 Ga0466970_0010068 Ga0466970_0010068_3553_4110 182
297 3300044765 Ga0466970_0199060 Ga0466970_0199060_302_859 182
298 3300044842 Ga0466957_0051604 Ga0466957_0051604_687_1244 182
299 3300044842 Ga0466957_0217977 Ga0466957_0217977_282_842 182
300 3300044842 Ga0466957_0341302 Ga0466957_0341302_77_634 182
301 3300044901 Ga0466960_0034145 Ga0466960_0034145_78_635 182
302 3300045049 Ga0466959_0024121 Ga0466959_0024121_3262_3822 182
303 3300045049 Ga0466959_0074239 Ga0466959_0074239_1795_2352 182
304 3300045049 Ga0466959_0107908 Ga0466959_0107908_714_1271 182
305 3300045049 Ga0466959_0185253 Ga0466959_0185253_212_769 182
306 3300045836 Ga0466958_0021653 Ga0466958_0021653_176_733 182
307 3300045976 Ga0466967_1162750 Ga0466967_1162750_31_588 182
308 3300046454 Ga0495592_0036070 Ga0495592_0036070_2349_2906 182
309 3300046454 Ga0495592_0056442 Ga0495592_0056442_1787_2344 182
310 3300046454 Ga0495592_0207420 Ga0495592_0207420_502_1059 182
311 3300046455 Ga0495603_0002356 Ga0495603_0002356_686_1243 182
312 3300046455 Ga0495603_0025195 Ga0495603_0025195_849_1406 182
313 3300046455 Ga0495603_0604903 Ga0495603_0604903_42_599 182
314 3300046457 Ga0495590_0009547 Ga0495590_0009547_2123_2680 182
315 3300046457 Ga0495590_0076055 Ga0495590_0076055_269_826 182
316 3300046458 Ga0495591_029214 Ga0495591_029214_439_996 182
317 3300046459 Ga0495629_0025297 Ga0495629_0025297_750_1307 182
318 3300046459 Ga0495629_0026766 Ga0495629_0026766_811_1368 182
319 3300046459 Ga0495629_0028245 Ga0495629_0028245_2312_2869 182
320 3300046459 Ga0495629_0047897 Ga0495629_0047897_741_1298 182
321 3300046459 Ga0495629_0088637 Ga0495629_0088637_733_1290 182
322 3300046460 Ga0495638_0009479 Ga0495638_0009479_776_1333 182
323 3300046461 Ga0495641_0060029 Ga0495641_0060029_65_622 182
324 3300046462 Ga0495651_0102860 Ga0495651_0102860_729_1286 182
325 3300046462 Ga0495651_0129655 Ga0495651_0129655_760_1317 182
326 3300046463 Ga0495653_0060701 Ga0495653_0060701_686_1243 182
327 3300046463 Ga0495653_0067768 Ga0495653_0067768_1671_2228 182
328 3300046463 Ga0495653_0101828 Ga0495653_0101828_451_1008 182
329 3300046463 Ga0495653_0158665 Ga0495653_0158665_744_1301 182
330 3300046463 Ga0495653_0160600 Ga0495653_0160600_315_872 182
331 3300046471 Ga0495650_0015072 Ga0495650_0015072_2745_3302 182
332 3300046471 Ga0495650_0037416 Ga0495650_0037416_1021_1578 182
333 3300046472 Ga0495580_0002666 Ga0495580_0002666_14479_15036 182
334 3300046472 Ga0495580_0024354 Ga0495580_0024354_683_1240 182
335 3300046472 Ga0495580_0047362 Ga0495580_0047362_451_1008 182
336 3300046472 Ga0495580_0198831 Ga0495580_0198831_307_864 182
337 3300046472 Ga0495580_0395438 Ga0495580_0395438_260_817 182
338 3300046472 Ga0495580_0455054 Ga0495580_0455054_69_626 182
339 3300046473 Ga0495582_0018313 Ga0495582_0018313_369_926 182
340 3300046473 Ga0495582_0021204 Ga0495582_0021204_2182_2739 182
341 3300046474 Ga0495605_0021467 Ga0495605_0021467_669_1226 182
342 3300046474 Ga0495605_0025249 Ga0495605_0025249_2274_2831 182
343 3300046476 Ga0495662_0251071 Ga0495662_0251071_193_750 182
344 3300046477 Ga0495664_0017670 Ga0495664_0017670_2852_3409 182
345 3300046477 Ga0495664_0065539 Ga0495664_0065539_699_1256 182
346 3300046477 Ga0495664_0227204 Ga0495664_0227204_362_919 182
347 3300046477 Ga0495664_0387870 Ga0495664_0387870_219_776 182
348 3300046491 Ga0495584_0208667 Ga0495584_0208667_107_664 182
349 3300046500 Ga0495596_0026525 Ga0495596_0026525_195_752 182
350 3300046500 Ga0495596_0062236 Ga0495596_0062236_271_828 182
351 3300046506 Ga0495583_0007957 Ga0495583_0007957_5216_5773 182
352 3300046506 Ga0495583_0008161 Ga0495583_0008161_1352_1909 182
353 3300046507 Ga0495606_0018493 Ga0495606_0018493_1021_1578 182
354 3300046507 Ga0495606_0096989 Ga0495606_0096989_86_643 182
355 3300046507 Ga0495606_0097622 Ga0495606_0097622_493_1050 182
356 3300046507 Ga0495606_0098121 Ga0495606_0098121_489_1046 182
357 3300046511 Ga0495608_0018080 Ga0495608_0018080_1398_1955 182
358 3300046511 Ga0495608_0132183 Ga0495608_0132183_668_1225 182
359 3300046512 Ga0495610_0019591 Ga0495610_0019591_2336_2893 182
360 3300046513 Ga0495616_0150527 Ga0495616_0150527_452_1009 182
361 3300046514 Ga0495618_0009815 Ga0495618_0009815_3194_3751 182
362 3300046514 Ga0495618_0043110 Ga0495618_0043110_719_1276 182
363 3300046514 Ga0495618_0182941 Ga0495618_0182941_412_969 182
364 3300046515 Ga0495620_0052881 Ga0495620_0052881_1031_1588 182
365 3300046515 Ga0495620_0057380 Ga0495620_0057380_195_752 182
366 3300046516 Ga0495628_0015894 Ga0495628_0015894_3996_4553 182
367 3300046516 Ga0495628_0030115 Ga0495628_0030115_3156_3713 182
368 3300046516 Ga0495628_0059703 Ga0495628_0059703_680_1237 182
369 3300046516 Ga0495628_0063530 Ga0495628_0063530_711_1268 182
370 3300046516 Ga0495628_0193681 Ga0495628_0193681_956_1513 182
371 3300046516 Ga0495628_0196542 Ga0495628_0196542_460_1017 182
372 3300046517 Ga0495630_0020703 Ga0495630_0020703_1416_1973 182
373 3300046517 Ga0495630_0069269 Ga0495630_0069269_1674_2231 182
374 3300046517 Ga0495630_0079487 Ga0495630_0079487_1759_2316 182
375 3300046517 Ga0495630_0218916 Ga0495630_0218916_234_791 182
376 3300046517 Ga0495630_0240673 Ga0495630_0240673_670_1227 182
377 3300046524 Ga0495648_0014819 Ga0495648_0014819_4441_4998 182
378 3300046524 Ga0495648_0032539 Ga0495648_0032539_45_602 182
379 3300046524 Ga0495648_0049584 Ga0495648_0049584_1334_1891 182
380 3300046524 Ga0495648_0058116 Ga0495648_0058116_686_1243 182
381 3300046524 Ga0495648_0179018 Ga0495648_0179018_455_1012 182
382 3300046526 Ga0495666_0012848 Ga0495666_0012848_2867_3424 182
383 3300046526 Ga0495666_0014922 Ga0495666_0014922_750_1307 182
384 3300046526 Ga0495666_0030164 Ga0495666_0030164_411_968 182
385 3300046526 Ga0495666_0174377 Ga0495666_0174377_141_698 182
386 3300046526 Ga0495666_0316748 Ga0495666_0316748_12_569 182
387 3300046528 Ga0495642_0355161 Ga0495642_0355161_64_621 182
388 3300046529 Ga0495652_0022553 Ga0495652_0022553_4343_4900 182
389 3300046529 Ga0495652_0143354 Ga0495652_0143354_1093_1650 182
390 3300046529 Ga0495652_0184160 Ga0495652_0184160_906_1463 182
391 3300046530 Ga0495654_0077602 Ga0495654_0077602_685_1242 182
392 3300046531 Ga0495665_0005644 Ga0495665_0005644_686_1243 182
393 3300046531 Ga0495665_0018586 Ga0495665_0018586_507_1064 182
394 3300046531 Ga0495665_0031552 Ga0495665_0031552_686_1243 182
395 3300046531 Ga0495665_0037619 Ga0495665_0037619_957_1514 182
396 3300046533 Ga0495640_0035349 Ga0495640_0035349_750_1307 182
397 3300046533 Ga0495640_0038635 Ga0495640_0038635_2387_2944 182
398 3300046533 Ga0495640_0049724 Ga0495640_0049724_1675_2232 182
399 3300046535 Ga0495586_0017712 Ga0495586_0017712_2547_3104 182
400 3300046535 Ga0495586_0047556 Ga0495586_0047556_840_1397 182
401 3300046536 Ga0495587_0012352 Ga0495587_0012352_760_1317 182
402 3300046536 Ga0495587_0245339 Ga0495587_0245339_376_933 182
403 3300046538 Ga0495609_0090084 Ga0495609_0090084_663_1220 182
404 3300046542 Ga0495597_0009678 Ga0495597_0009678_124_681 182
405 3300046542 Ga0495597_0125768 Ga0495597_0125768_498_1055 182
406 3300046542 Ga0495597_0161285 Ga0495597_0161285_205_762 182
407 3300046542 Ga0495597_0283035 Ga0495597_0283035_39_587 182
408 3300046543 Ga0495645_0006837 Ga0495645_0006837_4044_4601 182
409 3300046543 Ga0495645_0167830 Ga0495645_0167830_206_763 182
410 3300046543 Ga0495645_0291640 Ga0495645_0291640_407_964 182
411 3300046557 Ga0495622_0011082 Ga0495622_0011082_1485_2042 182
412 3300046559 Ga0495667_0192803 Ga0495667_0192803_414_971 182
413 3300046642 Ga0495634_0018015 Ga0495634_0018015_1416_1973 182
414 3300046642 Ga0495634_0061366 Ga0495634_0061366_323_880 182
415 3300046642 Ga0495634_0160930 Ga0495634_0160930_373_930 182
416 3300046642 Ga0495634_0420917 Ga0495634_0420917_60_617 182
417 3300046648 Ga0495611_0135139 Ga0495611_0135139_96_653 182
418 3300046663 Ga0495635_0049363 Ga0495635_0049363_1672_2229 182
419 3300046663 Ga0495635_0058762 Ga0495635_0058762_1416_1973 182
420 3300046663 Ga0495635_0106073 Ga0495635_0106073_291_848 182
421 3300046663 Ga0495635_0308215 Ga0495635_0308215_31_588 182
422 3300046665 Ga0495661_0010615 Ga0495661_0010615_1480_2037 182
423 3300046665 Ga0495661_0024058 Ga0495661_0024058_2952_3509 182
424 3300046674 Ga0495588_0017329 Ga0495588_0017329_2600_3157 182
425 3300046675 Ga0495657_0038350 Ga0495657_0038350_315_872 182
426 3300046678 Ga0495599_0039843 Ga0495599_0039843_696_1253 182
427 3300046678 Ga0495599_0063346 Ga0495599_0063346_1497_2054 182
428 3300046678 Ga0495599_0107809 Ga0495599_0107809_475_1032 182
429 3300046678 Ga0495599_0245214 Ga0495599_0245214_477_1034 182
430 3300046679 Ga0495623_0023807 Ga0495623_0023807_1650_2207 182
431 3300046679 Ga0495623_0089599 Ga0495623_0089599_750_1307 182
432 3300046679 Ga0495623_0263192 Ga0495623_0263192_96_653 182
433 3300046680 Ga0495646_0016730 Ga0495646_0016730_1758_2315 182
434 3300046680 Ga0495646_0052255 Ga0495646_0052255_324_881 182
435 3300046680 Ga0495646_0081210 Ga0495646_0081210_660_1217 182
436 3300046680 Ga0495646_0106613 Ga0495646_0106613_620_1177 182
437 3300046680 Ga0495646_0112768 Ga0495646_0112768_252_809 182
438 3300046680 Ga0495646_0487375 Ga0495646_0487375_63_620 182
439 3300046684 Ga0495669_0107204 Ga0495669_0107204_50_607 182
440 3300046684 Ga0495669_0143402 Ga0495669_0143402_482_1039 182
441 3300046689 Ga0495613_0024317 Ga0495613_0024317_3522_4079 182
442 3300046689 Ga0495613_0041905 Ga0495613_0041905_2314_2871 182
443 3300046690 Ga0495624_0011204 Ga0495624_0011204_686_1243 182
444 3300046690 Ga0495624_0047019 Ga0495624_0047019_1442_1999 182
445 3300046690 Ga0495624_0067781 Ga0495624_0067781_1416_1973 182
446 3300046690 Ga0495624_0131460 Ga0495624_0131460_479_1036 182
447 3300046694 Ga0495649_0040459 Ga0495649_0040459_1478_2035 182
448 3300046794 Ga0495589_0005345 Ga0495589_0005345_1744_2301 182
449 3300046794 Ga0495589_0103882 Ga0495589_0103882_541_1098 182
450 3300046809 Ga0495600_0026041 Ga0495600_0026041_666_1223 182
451 3300046809 Ga0495600_0127665 Ga0495600_0127665_748_1305 182
452 3300047315 Ga0495581_0012682 Ga0495581_0012682_1779_2336 182
453 3300047315 Ga0495581_0029554 Ga0495581_0029554_2230_2787 182
454 3300047315 Ga0495581_0032726 Ga0495581_0032726_760_1317 182
455 3300047317 Ga0495604_0059050 Ga0495604_0059050_1740_2297 182
456 3300047317 Ga0495604_0060212 Ga0495604_0060212_377_934 182
457 3300047317 Ga0495604_0176845 Ga0495604_0176845_686_1243 182
458 3300047317 Ga0495604_0214215 Ga0495604_0214215_350_907 182
459 3300047317 Ga0495604_0480703 Ga0495604_0480703_207_764 182
460 3300047319 Ga0495674_0030234 Ga0495674_0030234_2641_3198 182
461 3300047319 Ga0495674_0034755 Ga0495674_0034755_3254_3811 182
462 3300047319 Ga0495674_0073837 Ga0495674_0073837_686_1243 182
463 3300047319 Ga0495674_0100877 Ga0495674_0100877_662_1219 182
464 3300047319 Ga0495674_0111840 Ga0495674_0111840_686_1243 182
465 3300047319 Ga0495674_0193452 Ga0495674_0193452_228_785 182
466 3300047319 Ga0495674_0418762 Ga0495674_0418762_325_882 182
467 3300047320 Ga0495672_0004638 Ga0495672_0004638_9890_10447 182
468 3300047320 Ga0495672_0017725 Ga0495672_0017725_658_1215 182
469 3300047320 Ga0495672_0123210 Ga0495672_0123210_135_692 182
470 3300047320 Ga0495672_0162000 Ga0495672_0162000_394_951 182
471 3300047321 Ga0495676_0040228 Ga0495676_0040228_2618_3175 182
472 3300047321 Ga0495676_0046788 Ga0495676_0046788_2499_3056 182
473 3300047321 Ga0495676_0237728 Ga0495676_0237728_241_798 182
474 3300047322 Ga0495680_0047868 Ga0495680_0047868_2734_3291 182
475 3300047322 Ga0495680_0052699 Ga0495680_0052699_868_1425 182
476 3300047322 Ga0495680_0057028 Ga0495680_0057028_750_1307 182
477 3300047322 Ga0495680_0058733 Ga0495680_0058733_1729_2286 182
478 3300047322 Ga0495680_0172146 Ga0495680_0172146_107_664 182
479 3300047323 Ga0495683_0026862 Ga0495683_0026862_658_1215 182
480 3300047323 Ga0495683_0027703 Ga0495683_0027703_1682_2239 182
481 3300047323 Ga0495683_0037022 Ga0495683_0037022_1169_1726 182
482 3300047323 Ga0495683_0044194 Ga0495683_0044194_439_996 182
483 3300047443 Ga0495687_004642 Ga0495687_004642_686_1243 182
484 3300047443 Ga0495687_023948 Ga0495687_023948_1671_2228 182
485 3300047443 Ga0495687_095647 Ga0495687_095647_337_894 182
486 3300047444 Ga0495675_0016828 Ga0495675_0016828_1513_2070 182
487 3300047444 Ga0495675_0027749 Ga0495675_0027749_2385_2942 182
488 3300047444 Ga0495675_0264443 Ga0495675_0264443_206_763 182
489 3300047444 Ga0495675_0416841 Ga0495675_0416841_32_589 182
490 3300047445 Ga0495677_0028349 Ga0495677_0028349_801_1358 182
491 3300047446 Ga0495679_005329 Ga0495679_005329_741_1298 182
492 3300047446 Ga0495679_006772 Ga0495679_006772_3634_4191 182
493 3300047446 Ga0495679_006859 Ga0495679_006859_3580_4137 182
494 3300047469 Ga0495673_0019890 Ga0495673_0019890_216_773 182
495 3300047469 Ga0495673_0068415 Ga0495673_0068415_272_829 182
496 3300047471 Ga0495684_0095557 Ga0495684_0095557_1621_2178 182
497 3300047471 Ga0495684_0125265 Ga0495684_0125265_415_972 182
498 3300047472 Ga0495686_0000214 Ga0495686_0000214_694_1251 182
499 3300047673 Ga0495593_0015440 Ga0495593_0015440_1740_2297 182
500 3300047673 Ga0495593_0016602 Ga0495593_0016602_2916_3473 182
501 3300047673 Ga0495593_0027458 Ga0495593_0027458_2152_2709 182
502 3300047673 Ga0495593_0063373 Ga0495593_0063373_574_1131 182
503 3300048088 Ga0495602_0045589 Ga0495602_0045589_1740_2297 182
504 3300048088 Ga0495602_0053905 Ga0495602_0053905_2256_2813 182
505 3300048088 Ga0495602_0072298 Ga0495602_0072298_1699_2256 182
506 3300048088 Ga0495602_0125944 Ga0495602_0125944_678_1235 182
507 3300048088 Ga0495602_0147142 Ga0495602_0147142_1015_1572 182
508 3300048088 Ga0495602_0222519 Ga0495602_0222519_709_1266 182
509 3300048089 Ga0495614_0022910 Ga0495614_0022910_438_995 182
510 3300048089 Ga0495614_0028604 Ga0495614_0028604_1416_1973 182
511 3300048089 Ga0495614_0041023 Ga0495614_0041023_610_1167 182
512 3300048091 Ga0495626_0038095 Ga0495626_0038095_871_1428 182
513 3300048091 Ga0495626_0071955 Ga0495626_0071955_507_1064 182
514 3300048091 Ga0495626_0169623 Ga0495626_0169623_248_805 182
515 3300048903 Ga0496100_0036717 Ga0496100_0036717_1747_2304 182
516 3300048903 Ga0496100_0134107 Ga0496100_0134107_683_1240 182
517 3300048903 Ga0496100_0226673 Ga0496100_0226673_166_723 182
518 3300048903 Ga0496100_0574901 Ga0496100_0574901_155_712 182
519 3300048904 Ga0496101_0026210 Ga0496101_0026210_2813_3370 182
520 3300048904 Ga0496101_0092023 Ga0496101_0092023_945_1502 182
521 3300048904 Ga0496101_0135051 Ga0496101_0135051_666_1223 182
522 3300048904 Ga0496101_0369128 Ga0496101_0369128_427_984 182
523 3300048905 Ga0496102_0022040 Ga0496102_0022040_4416_4973 182
524 3300048905 Ga0496102_0022350 Ga0496102_0022350_680_1237 182
525 3300048905 Ga0496102_0061992 Ga0496102_0061992_777_1334 182
526 3300048905 Ga0496102_0302152 Ga0496102_0302152_750_1307 182
527 3300048905 Ga0496102_1046393 Ga0496102_1046393_21_578 182
528 3300048906 Ga0496103_0020863 Ga0496103_0020863_2704_3261 182
529 3300048906 Ga0496103_0038048 Ga0496103_0038048_396_953 182
530 3300048906 Ga0496103_0056865 Ga0496103_0056865_1747_2304 182
531 3300048907 Ga0496104_0077952 Ga0496104_0077952_2515_3072 182
532 3300048907 Ga0496104_0283218 Ga0496104_0283218_252_809 182
533 3300048907 Ga0496104_0398525 Ga0496104_0398525_357_914 182
534 3300048907 Ga0496104_0580471 Ga0496104_0580471_149_706 182
535 3300048908 Ga0496105_0044920 Ga0496105_0044920_975_1532 182
536 3300048908 Ga0496105_0121384 Ga0496105_0121384_1265_1822 182
537 3300048908 Ga0496105_0268757 Ga0496105_0268757_769_1326 182
538 3300048908 Ga0496105_0889290 Ga0496105_0889290_37_594 182
539 3300048909 Ga0496106_0017852 Ga0496106_0017852_4025_4582 182
540 3300048909 Ga0496106_0056405 Ga0496106_0056405_492_1049 182
541 3300048910 Ga0496107_0146296 Ga0496107_0146296_876_1433 182
542 3300048913 Ga0496110_0049103 Ga0496110_0049103_2136_2693 182
543 3300048915 Ga0496112_0059935 Ga0496112_0059935_2867_3424 182
544 3300048915 Ga0496112_0254271 Ga0496112_0254271_683_1240 182
545 3300048915 Ga0496112_0276634 Ga0496112_0276634_283_840 182
546 3300048916 Ga0496113_0027320 Ga0496113_0027320_683_1240 182
547 3300048916 Ga0496113_0035860 Ga0496113_0035860_111_668 182
548 3300048917 Ga0496114_0254562 Ga0496114_0254562_378_935 182
549 3300048917 Ga0496114_0571376 Ga0496114_0571376_214_771 182
550 3300048918 Ga0496115_0085501 Ga0496115_0085501_1346_1903 182
551 3300048919 Ga0496116_0059846 Ga0496116_0059846_482_1039 182
552 3300048919 Ga0496116_0069669 Ga0496116_0069669_1001_1558 182
553 3300048919 Ga0496116_0127519 Ga0496116_0127519_652_1209 182
554 3300048920 Ga0496117_0017967 Ga0496117_0017967_4650_5207 182
555 3300048920 Ga0496117_0047215 Ga0496117_0047215_1590_2147 182
556 3300048920 Ga0496117_0057807 Ga0496117_0057807_2110_2667 182
557 3300048920 Ga0496117_0091361 Ga0496117_0091361_1019_1576 182
558 3300048920 Ga0496117_0131111 Ga0496117_0131111_446_1003 182
559 3300048920 Ga0496117_0199280 Ga0496117_0199280_244_801 182
560 3300048920 Ga0496117_0235636 Ga0496117_0235636_256_813 182
561 3300048921 Ga0496118_0038754 Ga0496118_0038754_2572_3129 182
562 3300048921 Ga0496118_0056046 Ga0496118_0056046_2075_2632 182
563 3300048921 Ga0496118_0057908 Ga0496118_0057908_742_1299 182
564 3300048921 Ga0496118_0127130 Ga0496118_0127130_760_1317 182
565 3300048921 Ga0496118_0140811 Ga0496118_0140811_295_852 182
566 3300048921 Ga0496118_0164373 Ga0496118_0164373_304_861 182
567 3300048921 Ga0496118_0211297 Ga0496118_0211297_73_630 182
568 3300048922 Ga0496119_0085089 Ga0496119_0085089_954_1511 182
569 3300048922 Ga0496119_0389921 Ga0496119_0389921_23_580 182
570 3300048924 Ga0496121_0080977 Ga0496121_0080977_66_623 182
571 3300048924 Ga0496121_0108225 Ga0496121_0108225_304_861 182
572 3300048924 Ga0496121_0263806 Ga0496121_0263806_298_855 182
573 3300048924 Ga0496121_0303443 Ga0496121_0303443_460_1017 182
574 3300048924 Ga0496121_0307982 Ga0496121_0307982_276_833 182
575 3300048925 Ga0496122_0124807 Ga0496122_0124807_790_1347 182
576 3300048926 Ga0496123_0048983 Ga0496123_0048983_782_1339 182
577 3300048926 Ga0496123_0127257 Ga0496123_0127257_197_754 182
578 3300048926 Ga0496123_0236328 Ga0496123_0236328_323_880 182
579 3300048926 Ga0496123_0274817 Ga0496123_0274817_21_578 182
580 3300048927 Ga0496124_0047252 Ga0496124_0047252_556_1113 182
581 3300048928 Ga0496125_0032425 Ga0496125_0032425_647_1204 182
582 3300048928 Ga0496125_0117134 Ga0496125_0117134_330_887 182
583 3300048929 Ga0496126_0002475 Ga0496126_0002475_23035_23592 182
584 3300048929 Ga0496126_0034728 Ga0496126_0034728_2039_2596 182
585 3300048929 Ga0496126_0049160 Ga0496126_0049160_823_1380 182
586 3300048929 Ga0496126_0051073 Ga0496126_0051073_2432_2989 182
587 3300048929 Ga0496126_0407742 Ga0496126_0407742_272_829 182
588 3300048929 Ga0496126_0589209 Ga0496126_0589209_82_639 182
589 3300048986 Ga0466983_0150046 Ga0466983_0150046_303_860 182
590 3300049130 Ga0501310_027457 Ga0501310_027457_11_559 182
591 3300049459 Ga0495678_041264 Ga0495678_041264_500_1057 182
592 3300049459 Ga0495678_065117 Ga0495678_065117_465_1022 182
593 3300049460 Ga0495682_0010047 Ga0495682_0010047_500_1057 182
594 3300049460 Ga0495682_0018830 Ga0495682_0018830_683_1240 182
595 3300049460 Ga0495682_0103261 Ga0495682_0103261_126_683 182
596 3300049587 Ga0501071_0058886 Ga0501071_0058886_348_920 182
597 3300049592 Ga0501076_0236038 Ga0501076_0236038_356_928 182
598 3300049824 Ga0501045_0033343 Ga0501045_0033343_938_1510 182
599 3300059477 Ga0587084_003762 Ga0587084_003762_714_1271 182
600 3300059477 Ga0587084_012498 Ga0587084_012498_172_729 182
601 3300059477 Ga0587084_036053 Ga0587084_036053_60_617 182
602 3300059478 Ga0587093_012940 Ga0587093_012940_149_706 182
603 3300059478 Ga0587093_016083 Ga0587093_016083_56_613 182
604 3300059491 Ga0587070_003017 Ga0587070_003017_504_1061 182
605 3300059491 Ga0587070_024879 Ga0587070_024879_50_607 182
606 3300059492 Ga0587073_0056881 Ga0587073_0056881_167_724 182
607 3300059493 Ga0587077_018132 Ga0587077_018132_222_779 182
608 3300059503 Ga0587080_008427 Ga0587080_008427_222_779 182
609 3300059503 Ga0587080_021637 Ga0587080_021637_161_718 182
610 3300059505 Ga0587083_0012271 Ga0587083_0012271_497_1054 182
611 3300059505 Ga0587083_0030301 Ga0587083_0030301_251_808 182
612 3300059505 Ga0587083_0039159 Ga0587083_0039159_49_606 182
613 3300059505 Ga0587083_0084012 Ga0587083_0084012_60_617 182
614 3300059506 Ga0587085_019471 Ga0587085_019471_156_713 182
615 3300059507 Ga0587086_005430 Ga0587086_005430_167_724 182
616 3300059508 Ga0587088_059497 Ga0587088_059497_49_606 182
617 3300059510 Ga0587090_001097 Ga0587090_001097_323_880 182
618 3300059510 Ga0587090_006735 Ga0587090_006735_248_805 182
619 3300059510 Ga0587090_008382 Ga0587090_008382_176_733 182
620 3300059510 Ga0587090_008460 Ga0587090_008460_168_725 182
621 3300059510 Ga0587090_016688 Ga0587090_016688_413_970 182
622 3300059510 Ga0587090_019222 Ga0587090_019222_352_909 182
623 3300059510 Ga0587090_024277 Ga0587090_024277_55_612 182
624 3300059512 Ga0587092_010269 Ga0587092_010269_675_1232 182
625 3300059513 Ga0587094_003743 Ga0587094_003743_780_1337 182
626 3300059513 Ga0587094_026346 Ga0587094_026346_55_612 182
627 3300059514 Ga0587095_002200 Ga0587095_002200_478_1035 182
628 3300059604 Ga0587098_006295 Ga0587098_006295_192_749 182
629 3300059623 Ga0587101_007290 Ga0587101_007290_291_848 182
630 3300059623 Ga0587101_023984 Ga0587101_023984_287_844 182
631 3300059630 Ga0587128_001221 Ga0587128_001221_236_793 182
632 3300059630 Ga0587128_019693 Ga0587128_019693_46_603 182
633 3300059639 Ga0587062_025636 Ga0587062_025636_269_826 182
634 3300059640 Ga0587067_011515 Ga0587067_011515_250_807 182
635 3300059641 Ga0587068_003974 Ga0587068_003974_165_722 182
636 3300059641 Ga0587068_029120 Ga0587068_029120_239_796 182
637 3300059643 Ga0587072_004420 Ga0587072_004420_627_1184 182
638 3300059643 Ga0587072_004903 Ga0587072_004903_849_1406 182
639 3300059643 Ga0587072_028594 Ga0587072_028594_204_761 182
640 3300059644 Ga0587075_017383 Ga0587075_017383_231_788 182
641 3300059646 Ga0587078_006229 Ga0587078_006229_372_929 182
642 3300059646 Ga0587078_016675 Ga0587078_016675_288_845 182
643 3300059647 Ga0587079_027012 Ga0587079_027012_309_866 182
644 3300059647 Ga0587079_042010 Ga0587079_042010_288_845 182
645 3300059647 Ga0587079_060424 Ga0587079_060424_111_668 182
646 3300059648 Ga0587100_005792 Ga0587100_005792_60_617 182
647 3300059648 Ga0587100_005983 Ga0587100_005983_285_842 182
648 3300059649 Ga0587102_005975 Ga0587102_005975_156_713 182
649 3300059652 Ga0587107_003848 Ga0587107_003848_567_1124 182
650 3300059660 Ga0587124_002273 Ga0587124_002273_150_707 182
651 3300059660 Ga0587124_006311 Ga0587124_006311_265_822 182
652 3300060344 Ga0587071_004113 Ga0587071_004113_860_1417 182
653 3300060344 Ga0587071_004178 Ga0587071_004178_946_1503 182
654 3300060344 Ga0587071_013321 Ga0587071_013321_198_755 182
655 3300060344 Ga0587071_085965 Ga0587071_085965_50_607 182
656 3300060346 Ga0587111_0006348 Ga0587111_0006348_107_664 182
657 3300060346 Ga0587111_0009091 Ga0587111_0009091_671_1228 182
658 3300060346 Ga0587111_0048790 Ga0587111_0048790_119_676 182
659 3300061719 Ga0466962_0016604 Ga0466962_0016604_2887_3444 182
660 3300061719 Ga0466962_0161457 Ga0466962_0161457_59_616 182
661 iso_pu_bacteria 2834641062 2834642637 182
662 iso_pu_bacteria 8003400568 8003402129 182
663 3300005844 Ga0068862_100071686 Ga0068862_1000716864 183
664 3300006048 Ga0075363_100086452 Ga0075363_1000864524 183
665 3300006177 Ga0075362_10079547 Ga0075362_100795472 183
666 3300006178 Ga0075367_10069422 Ga0075367_100694223 183
667 3300006195 Ga0075366_10140740 Ga0075366_101407403 183
668 3300006195 Ga0075366_10150220 Ga0075366_101502202 183
669 3300025961 Ga0207712_10263692 Ga0207712_102636923 183
670 3300026089 Ga0207648_10269905 Ga0207648_102699053 183
671 3300028380 Ga0268265_10307045 Ga0268265_103070454 183
672 3300041486 Ga0451807_2124949 Ga0451807_2124949_378_971 183
673 3300049131 Ga0501341_03017 Ga0501341_03017_45_599 183
674 3300049536 Ga0501320_001958 Ga0501320_001958_992_1543 183
675 3300049540 Ga0501324_002902 Ga0501324_002902_42_593 183
676 3300050492 nmdc:mga0yw44_46433_c1 nmdc:mga0yw44_46433_c1_323_916 183
677 3300053177 Ga0500636_0139701 Ga0500636_0139701_299_850 183
678 iso_pu_bacteria 2513237150 2513957870 183
679 iso_pu_bacteria 2513237165 2514045819 183
680 iso_pu_bacteria 2643221585 2643933852 183
681 iso_pu_bacteria 2643221656 2644315346 183
682 iso_pu_bacteria 2858688981 2858694118 183
683 iso_pu_bacteria 2901300506 2901305744 183
684 iso_pu_bacteria 644736347 644749278 183
685 3300005616 Ga0068852_101450198 Ga0068852_1014501981 184
686 3300028794 Ga0307515_10070127 Ga0307515_100701272 184
687 3300028794 Ga0307515_10160207 Ga0307515_101602074 184
688 3300044656 Ga0466969_0104456 Ga0466969_0104456_120_677 184
689 3300044666 Ga0466977_0012392 Ga0466977_0012392_3629_4186 184
690 3300046520 Ga0495637_0044618 Ga0495637_0044618_532_1167 184
691 3300046542 Ga0495597_0008648 Ga0495597_0008648_3692_4303 184
692 3300046692 Ga0495671_0144833 Ga0495671_0144833_184_810 184
693 3300046694 Ga0495649_0060727 Ga0495649_0060727_965_1591 184
694 3300049128 Ga0501308_010547 Ga0501308_010547_80_673 184
695 3300049571 Ga0501034_0040683 Ga0501034_0040683_3320_3922 184
696 3300049579 Ga0501043_0172838 Ga0501043_0172838_249_851 184
697 3300049580 Ga0501046_0179980 Ga0501046_0179980_713_1315 184
698 3300049581 Ga0501047_0161758 Ga0501047_0161758_681_1283 184
699 3300049822 Ga0501035_0032626 Ga0501035_0032626_3324_3926 184
700 3300049823 Ga0501044_0266977 Ga0501044_0266977_378_980 184
701 3300050493 nmdc:mga0k408_94665_c1 nmdc:mga0k408_94665_c1_826_1407 184
702 3300050509 nmdc:mga0qj67_546410_c1 nmdc:mga0qj67_546410_c1_216_833 184
703 iso_pu_bacteria 2521172590 2521560846 184
704 iso_pu_bacteria 2551306416 2553008126 184
705 iso_pu_bacteria 2643221644 2644248153 184
706 iso_pu_bacteria 2738543013 2739249840 184
707 iso_pu_bacteria 2765235838 2765567280 184
708 iso_pu_bacteria 2808606386 2808984193 184
709 iso_pu_bacteria 2808606415 2809131997 184
710 iso_pu_bacteria 2808606419 2809151620 184
711 iso_pu_bacteria 2818991449 2819618851 184
712 iso_pu_bacteria 2839094727 2839095492 184
713 iso_pu_bacteria 2852618963 2852622920 184
714 iso_pu_bacteria 2904439833 2904445258 184
715 iso_pu_bacteria 2904530477 2904533797 184
716 iso_pu_bacteria 2904584206 2904589366 184
717 iso_pu_bacteria 2904589729 2904595069 184
718 iso_pu_bacteria 2904601388 2904606733 184
719 iso_pu_bacteria 2919046199 2919050777 184
720 iso_pu_bacteria 2919079590 2919084999 184
721 iso_pu_bacteria 2923510766 2923514687 184
722 iso_pu_bacteria 2928130867 2928135735 184
723 3300005455 Ga0070663_100001491 Ga0070663_1000014919 185
724 3300026067 Ga0207678_10004336 Ga0207678_100043367 185
725 3300027876 Ga0209974_10040219 Ga0209974_100402192 185
726 3300031901 Ga0307406_10141214 Ga0307406_101412142 185
727 3300042005 Ga0439448_0107702 Ga0439448_0107702_14_616 185
728 3300042876 Ga0451577_0023908 Ga0451577_0023908_4293_4874 185
729 3300044658 Ga0466972_0064527 Ga0466972_0064527_923_1531 185
730 3300044683 Ga0466965_0070051 Ga0466965_0070051_775_1383 185
731 3300044712 Ga0453684_0047348 Ga0453684_0047348_700_1281 185
732 3300044712 Ga0453684_0860683 Ga0453684_0860683_168_731 185
733 3300045051 Ga0451576_0209345 Ga0451576_0209345_753_1316 185
734 3300045051 Ga0451576_0297567 Ga0451576_0297567_763_1344 185
735 3300046471 Ga0495650_0017475 Ga0495650_0017475_738_1343 185
736 3300046512 Ga0495610_0023962 Ga0495610_0023962_515_1150 185
737 3300053118 Ga0500594_0002841 Ga0500594_0002841_2886_3512 185
738 iso_pu_bacteria 2857564685 2857567909 185
739 iso_pu_bacteria 2904479285 2904479288 185
740 3300003187 JGI25151J46595_10043576 JGI25151J46595_100435761 186
741 3300003187 JGI25151J46595_10047464 JGI25151J46595_100474642 186
742 3300003187 JGI25151J46595_10052920 JGI25151J46595_100529201 186
743 3300003771 Ga0055526_1034131 Ga0055526_10341311 186
744 3300003773 Ga0055537_1017808 Ga0055537_10178081 186
745 3300003775 Ga0055524_1014273 Ga0055524_10142733 186
746 3300003775 Ga0055524_1023907 Ga0055524_10239073 186
747 3300003781 Ga0055536_1000672 Ga0055536_100067216 186
748 3300003784 Ga0055534_1015575 Ga0055534_10155751 186
749 3300003792 Ga0055540_1059854 Ga0055540_10598541 186
750 3300005456 Ga0070678_100891314 Ga0070678_1008913141 186
751 3300006948 Ga0099826_10000093 Ga0099826_100000934 186
752 3300025263 Ga0209565_1002110 Ga0209565_10021104 186
753 3300025263 Ga0209565_1024371 Ga0209565_10243712 186
754 3300025273 Ga0209673_1021223 Ga0209673_10212234 186
755 3300025284 Ga0209130_1027614 Ga0209130_10276142 186
756 3300025291 Ga0209675_1009998 Ga0209675_10099982 186
757 3300025291 Ga0209675_1013946 Ga0209675_10139464 186
758 3300025291 Ga0209675_1022955 Ga0209675_10229553 186
759 3300025292 Ga0209676_1001412 Ga0209676_100141217 186
760 3300025294 Ga0209025_1015058 Ga0209025_10150584 186
761 3300025294 Ga0209025_1017025 Ga0209025_10170254 186
762 3300025294 Ga0209025_1050329 Ga0209025_10503292 186
763 3300025294 Ga0209025_1051369 Ga0209025_10513694 186
764 3300025294 Ga0209025_1053063 Ga0209025_10530634 186
765 3300025295 Ga0209564_1011746 Ga0209564_10117463 186
766 3300025295 Ga0209564_1031796 Ga0209564_10317962 186
767 3300025295 Ga0209564_1033355 Ga0209564_10333554 186
768 3300025297 Ga0209758_1006747 Ga0209758_10067477 186
769 3300025299 Ga0209256_1005253 Ga0209256_10052534 186
770 3300025299 Ga0209256_1018394 Ga0209256_10183944 186
771 3300025303 Ga0209051_1022225 Ga0209051_10222254 186
772 3300025303 Ga0209051_1028249 Ga0209051_10282494 186
773 3300025899 Ga0207642_10067330 Ga0207642_100673302 186
774 3300025937 Ga0207669_10585916 Ga0207669_105859162 186
775 3300026089 Ga0207648_10327016 Ga0207648_103270162 186
776 3300027666 Ga0209282_1000137 Ga0209282_100013715 186
777 3300031456 Ga0307513_10018777 Ga0307513_100187779 186
778 3300037471 Ga0395905_0049982 Ga0395905_0049982_1308_1874 186
779 3300042010 Ga0439452_037183 Ga0439452_037183_392_973 186
780 3300046474 Ga0495605_0017644 Ga0495605_0017644_709_1290 186
781 3300046491 Ga0495584_0088403 Ga0495584_0088403_355_936 186
782 3300046500 Ga0495596_0005141 Ga0495596_0005141_3122_3703 186
783 3300046512 Ga0495610_0009271 Ga0495610_0009271_3587_4168 186
784 3300046665 Ga0495661_0019336 Ga0495661_0019336_2079_2660 186
785 3300046692 Ga0495671_0008146 Ga0495671_0008146_2363_2944 186
786 3300048924 Ga0496121_0025394 Ga0496121_0025394_2475_3056 186
787 3300048925 Ga0496122_0099839 Ga0496122_0099839_517_1098 186
788 3300049571 Ga0501034_0034857 Ga0501034_0034857_736_1317 186
789 3300059493 Ga0587077_056847 Ga0587077_056847_89_670 186
790 3300059507 Ga0587086_001217 Ga0587086_001217_262_843 186
791 3300059510 Ga0587090_002303 Ga0587090_002303_179_760 186
792 3300059624 Ga0587109_064924 Ga0587109_064924_149_730 186
793 3300059639 Ga0587062_013745 Ga0587062_013745_200_781 186
794 3300059660 Ga0587124_008184 Ga0587124_008184_137_718 186
795 iso_pu_bacteria 2643221660 2644338461 186
796 iso_pu_bacteria 2928115317 2928120559 186
797 3300005334 Ga0068869_100128507 Ga0068869_1001285074 187
798 3300025942 Ga0207689_10183273 Ga0207689_101832734 187
799 3300028794 Ga0307515_10000672 Ga0307515_1000067271 187
800 3300028794 Ga0307515_10137104 Ga0307515_101371044 187
801 3300031456 Ga0307513_10045162 Ga0307513_100451626 187
802 3300033180 Ga0307510_10427069 Ga0307510_104270691 187
803 3300044712 Ga0453684_0060229 Ga0453684_0060229_825_1406 187
804 3300044712 Ga0453684_1321467 Ga0453684_1321467_11_586 187
805 3300045836 Ga0466958_0181235 Ga0466958_0181235_632_1261 187
806 3300046463 Ga0495653_0003544 Ga0495653_0003544_721_1338 187
807 3300046471 Ga0495650_0009500 Ga0495650_0009500_4174_4791 187
808 3300046507 Ga0495606_0039988 Ga0495606_0039988_875_1492 187
809 3300046520 Ga0495637_0013614 Ga0495637_0013614_2441_3058 187
810 3300046530 Ga0495654_0000115 Ga0495654_0000115_90024_90641 187
811 3300047446 Ga0495679_023214 Ga0495679_023214_275_892 187
812 3300047469 Ga0495673_0000338 Ga0495673_0000338_57765_58412 187
813 3300048905 Ga0496102_0036709 Ga0496102_0036709_989_1573 187
814 3300048909 Ga0496106_0253104 Ga0496106_0253104_65_694 187
815 3300048923 Ga0496120_0124356 Ga0496120_0124356_529_1146 187
816 3300048926 Ga0496123_0069843 Ga0496123_0069843_893_1510 187
817 3300048927 Ga0496124_0132720 Ga0496124_0132720_930_1547 187
818 3300049535 Ga0501319_008162 Ga0501319_008162_11_577 187
819 iso_pu_bacteria 2513020051 2513228104 187
820 iso_pu_bacteria 2585428057 2587730936 187
821 iso_pu_bacteria 2585428058 2587737152 187
822 iso_pu_bacteria 2596583598 2597031681 187
823 iso_pu_bacteria 2599185178 2599448146 187
824 iso_pu_bacteria 2643221592 2643971584 187
825 iso_pu_bacteria 2643221603 2644030561 187
826 iso_pu_bacteria 2643221625 2644142856 187
827 iso_pu_bacteria 2643221648 2644275773 187
828 iso_pu_bacteria 2643221658 2644325612 187
829 iso_pu_bacteria 2643221672 2644401001 187
830 iso_pu_bacteria 2738541307 2738882600 187
831 iso_pu_bacteria 2842733646 2842737334 187
832 iso_pu_bacteria 2842747753 2842749930 187
833 iso_pu_bacteria 2885192300 2885195785 187
834 iso_pu_bacteria 2885266251 2885269563 187
835 iso_pu_bacteria 2900577576 2900581883 187
836 iso_pu_bacteria 2904541872 2904545839 187
837 iso_pu_bacteria 2928058823 2928063762 187
838 iso_pu_bacteria 2929160207 2929161025 187
839 iso_pu_bacteria 2939631187 2939633693 187
840 iso_pu_bacteria 2954767861 2954770385 187
841 3300003163 Ga0006759J45824_1037313 Ga0006759J45824_10373133 188
842 3300003544 Ga0007417J51691_1025655 Ga0007417J51691_10256554 188
843 3300003574 Ga0007410J51695_1045991 Ga0007410J51695_10459912 188
844 3300003575 Ga0007409J51694_1024015 Ga0007409J51694_10240155 188
845 3300003577 Ga0007416J51690_1031581 Ga0007416J51690_10315815 188
846 3300003613 Ga0007415J51800_108879 Ga0007415J51800_1088793 188
847 3300003693 Ga0032354_1035910 Ga0032354_10359104 188
848 3300003752 Ga0055539_1002407 Ga0055539_10024074 188
849 3300003756 Ga0055533_1003837 Ga0055533_10038374 188
850 3300003759 Ga0055525_1001833 Ga0055525_10018334 188
851 3300003775 Ga0055524_1005244 Ga0055524_10052444 188
852 3300003784 Ga0055534_1003672 Ga0055534_10036725 188
853 3300003791 Ga0055530_10014213 Ga0055530_100142134 188
854 3300003792 Ga0055540_1004941 Ga0055540_10049413 188
855 3300003794 Ga0055531_10034017 Ga0055531_100340171 188
856 3300003841 Ga0055541_1003620 Ga0055541_10036204 188
857 3300005331 Ga0070670_100172020 Ga0070670_1001720203 188
858 3300005344 Ga0070661_100005763 Ga0070661_1000057634 188
859 3300005344 Ga0070661_100174709 Ga0070661_1001747094 188
860 3300005354 Ga0070675_100588843 Ga0070675_1005888431 188
861 3300005356 Ga0070674_100149580 Ga0070674_1001495803 188
862 3300005366 Ga0070659_100047642 Ga0070659_1000476423 188
863 3300005457 Ga0070662_100169496 Ga0070662_1001694963 188
864 3300005564 Ga0070664_100048424 Ga0070664_1000484245 188
865 3300005614 Ga0068856_100679718 Ga0068856_1006797182 188
866 3300005618 Ga0068864_100201546 Ga0068864_1002015464 188
867 3300005834 Ga0068851_10071502 Ga0068851_100715023 188
868 3300005841 Ga0068863_100042419 Ga0068863_1000424196 188
869 3300006195 Ga0075366_10037482 Ga0075366_100374824 188
870 3300006195 Ga0075366_10057020 Ga0075366_100570204 188
871 3300006195 Ga0075366_10126196 Ga0075366_101261962 188
872 3300006358 Ga0068871_100146732 Ga0068871_1001467324 188
873 3300006946 Ga0079104_1001225 Ga0079104_10012254 188
874 3300009036 Ga0105244_10019926 Ga0105244_100199265 188
875 3300009093 Ga0105240_10021815 Ga0105240_100218154 188
876 3300009177 Ga0105248_10407962 Ga0105248_104079624 188
877 3300009551 Ga0105238_10002020 Ga0105238_100020204 188
878 3300010375 Ga0105239_10030541 Ga0105239_100305416 188
879 3300011119 Ga0105246_10453176 Ga0105246_104531762 188
880 3300013308 Ga0157375_10521342 Ga0157375_105213421 188
881 3300015261 Ga0182006_1101103 Ga0182006_11011032 188
882 3300025224 Ga0209784_100035 Ga0209784_100035120 188
883 3300025225 Ga0209566_100040 Ga0209566_100040120 188
884 3300025226 Ga0209674_100057 Ga0209674_100057120 188
885 3300025230 Ga0209563_100059 Ga0209563_100059120 188
886 3300025253 Ga0209677_100036 Ga0209677_100036120 188
887 3300025263 Ga0209565_1012279 Ga0209565_10122792 188
888 3300025284 Ga0209130_1006752 Ga0209130_10067524 188
889 3300025291 Ga0209675_1006318 Ga0209675_10063185 188
890 3300025291 Ga0209675_1007235 Ga0209675_10072356 188
891 3300025292 Ga0209676_1004462 Ga0209676_10044626 188
892 3300025298 Ga0209050_1001097 Ga0209050_10010974 188
893 3300025299 Ga0209256_1000045 Ga0209256_1000045261 188
894 3300025303 Ga0209051_1000004 Ga0209051_1000004942 188
895 3300025304 Ga0209257_1002681 Ga0209257_10026814 188
896 3300025304 Ga0209257_1011934 Ga0209257_10119346 188
897 3300025728 Ga0207655_1146634 Ga0207655_11466341 188
898 3300025903 Ga0207680_10440776 Ga0207680_104407762 188
899 3300025913 Ga0207695_10003953 Ga0207695_100039534 188
900 3300025914 Ga0207671_10178519 Ga0207671_101785194 188
901 3300025920 Ga0207649_10023583 Ga0207649_100235833 188
902 3300025920 Ga0207649_10360582 Ga0207649_103605822 188
903 3300025924 Ga0207694_10001435 Ga0207694_100014354 188
904 3300025925 Ga0207650_10084743 Ga0207650_100847432 188
905 3300025932 Ga0207690_10041702 Ga0207690_100417024 188
906 3300025941 Ga0207711_10269379 Ga0207711_102693791 188
907 3300025945 Ga0207679_10001142 Ga0207679_1000114212 188
908 3300025945 Ga0207679_10079943 Ga0207679_100799433 188
909 3300025949 Ga0207667_10042185 Ga0207667_100421854 188
910 3300025981 Ga0207640_10169293 Ga0207640_101692932 188
911 3300026095 Ga0207676_10101836 Ga0207676_101018364 188
912 3300027111 Ga0209281_1001178 Ga0209281_100117812 188
913 3300028786 Ga0307517_10225417 Ga0307517_102254172 188
914 3300028794 Ga0307515_10043121 Ga0307515_100431216 188
915 3300028794 Ga0307515_10116889 Ga0307515_101168893 188
916 3300028794 Ga0307515_10143289 Ga0307515_101432894 188
917 3300031507 Ga0307509_10067896 Ga0307509_100678965 188
918 3300031507 Ga0307509_10150221 Ga0307509_101502213 188
919 3300031507 Ga0307509_10194269 Ga0307509_101942693 188
920 3300031507 Ga0307509_10303949 Ga0307509_103039494 188
921 3300031616 Ga0307508_10098724 Ga0307508_100987243 188
922 3300031649 Ga0307514_10120122 Ga0307514_101201222 188
923 3300031730 Ga0307516_10000048 Ga0307516_1000004847 188
924 3300031911 Ga0307412_10113582 Ga0307412_101135824 188
925 3300033180 Ga0307510_10124844 Ga0307510_101248442 188
926 3300033180 Ga0307510_10177363 Ga0307510_101773632 188
927 3300036401 Ga0373937_0030010 Ga0373937_0030010_349_933 188
928 3300039447 Ga0436361_1038070 Ga0436361_1038070_710_1300 188
929 3300041441 Ga0451787_005332 Ga0451787_005332_120_707 188
930 3300041997 Ga0439431_0139597 Ga0439431_0139597_41_616 188
931 3300042121 Ga0450919_000204 Ga0450919_000204_1307_1891 188
932 3300042156 Ga0439446_0056502 Ga0439446_0056502_453_1028 188
933 3300042435 Ga0439434_0029556 Ga0439434_0029556_393_977 188
934 3300042436 Ga0439435_0238886 Ga0439435_0238886_10_594 188
935 3300042531 Ga0450918_000638 Ga0450918_000638_6157_6741 188
936 3300042876 Ga0451577_0022858 Ga0451577_0022858_1727_2320 188
937 3300042876 Ga0451577_0034775 Ga0451577_0034775_736_1314 188
938 3300042876 Ga0451577_0088912 Ga0451577_0088912_904_1479 188
939 3300044658 Ga0466972_0043958 Ga0466972_0043958_1127_1717 188
940 3300044673 Ga0453683_0275182 Ga0453683_0275182_181_756 188
941 3300044712 Ga0453684_0162566 Ga0453684_0162566_458_1042 188
942 3300044712 Ga0453684_0490247 Ga0453684_0490247_672_1247 188
943 3300045051 Ga0451576_1146081 Ga0451576_1146081_27_617 188
944 3300046683 Ga0495658_0127771 Ga0495658_0127771_381_971 188
945 3300048091 Ga0495626_0128867 Ga0495626_0128867_336_926 188
946 3300048917 Ga0496114_0246003 Ga0496114_0246003_112_696 188
947 3300049529 Ga0501313_005178 Ga0501313_005178_766_1344 188
948 3300049535 Ga0501319_001588 Ga0501319_001588_22_609 188
949 3300049536 Ga0501320_003150 Ga0501320_003150_509_1135 188
950 3300049540 Ga0501324_000146 Ga0501324_000146_520_1146 188
951 3300050489 nmdc:mga03683_85310_c1 nmdc:mga03683_85310_c1_279_857 188
952 3300050493 nmdc:mga0k408_112063_c1 nmdc:mga0k408_112063_c1_716_1300 188
953 3300050493 nmdc:mga0k408_144166_c1 nmdc:mga0k408_144166_c1_678_1262 188
954 3300050493 nmdc:mga0k408_32661_c1 nmdc:mga0k408_32661_c1_153_731 188
955 3300050493 nmdc:mga0k408_67516_c1 nmdc:mga0k408_67516_c1_706_1290 188
956 3300053156 Ga0500622_0003393 Ga0500622_0003393_9341_9925 188
957 3300060346 Ga0587111_0017348 Ga0587111_0017348_87_662 188
958 iso_pu_bacteria 2643221556 2643799318 188
959 iso_pu_bacteria 2643221684 2644472512 188
960 iso_pu_bacteria 2738541280 2738738194 188
961 iso_pu_bacteria 2738541300 2738843000 188
962 iso_pu_bacteria 2738543018 2739273748 188
963 iso_pu_bacteria 2738543030 2739342792 188
964 3300002077 JGI24744J21845_10023566 JGI24744J21845_100235661 189
965 3300003162 Ga0006778J45830_1009154 Ga0006778J45830_10091546 189
966 3300003305 Ga0006770J48903_1008186 Ga0006770J48903_10081867 189
967 3300003308 Ga0006777J48905_1021980 Ga0006777J48905_10219808 189
968 3300003693 Ga0032354_1085038 Ga0032354_10850382 189
969 3300005295 Ga0065707_10007320 Ga0065707_100073205 189
970 3300005331 Ga0070670_100316063 Ga0070670_1003160631 189
971 3300005335 Ga0070666_10749580 Ga0070666_107495801 189
972 3300005338 Ga0068868_100090414 Ga0068868_1000904142 189
973 3300005355 Ga0070671_100161442 Ga0070671_1001614424 189
974 3300005456 Ga0070678_100628016 Ga0070678_1006280162 189
975 3300005456 Ga0070678_100773994 Ga0070678_1007739941 189
976 3300005457 Ga0070662_100013879 Ga0070662_1000138795 189
977 3300005457 Ga0070662_100200968 Ga0070662_1002009682 189
978 3300005459 Ga0068867_100072766 Ga0068867_1000727662 189
979 3300005459 Ga0068867_100123267 Ga0068867_1001232674 189
980 3300005577 Ga0068857_100405816 Ga0068857_1004058162 189
981 3300005578 Ga0068854_100029412 Ga0068854_1000294124 189
982 3300005616 Ga0068852_100196220 Ga0068852_1001962203 189
983 3300005617 Ga0068859_100108192 Ga0068859_1001081922 189
984 3300005617 Ga0068859_100270429 Ga0068859_1002704294 189
985 3300005618 Ga0068864_100261657 Ga0068864_1002616572 189
986 3300005841 Ga0068863_100042406 Ga0068863_1000424064 189
987 3300005843 Ga0068860_100375170 Ga0068860_1003751704 189
988 3300006038 Ga0075365_10410059 Ga0075365_104100592 189
989 3300006048 Ga0075363_100160082 Ga0075363_1001600822 189
990 3300006048 Ga0075363_100242403 Ga0075363_1002424032 189
991 3300006048 Ga0075363_100343882 Ga0075363_1003438822 189
992 3300006048 Ga0075363_100362887 Ga0075363_1003628872 189
993 3300006051 Ga0075364_10240995 Ga0075364_102409952 189
994 3300006177 Ga0075362_10002336 Ga0075362_100023366 189
995 3300006177 Ga0075362_10101894 Ga0075362_101018943 189
996 3300006177 Ga0075362_10124262 Ga0075362_101242622 189
997 3300006177 Ga0075362_10173186 Ga0075362_101731861 189
998 3300006178 Ga0075367_10199983 Ga0075367_101999832 189
999 3300006178 Ga0075367_10234089 Ga0075367_102340892 189
1000 3300006178 Ga0075367_10453671 Ga0075367_104536711 189
1001 3300006178 Ga0075367_10674102 Ga0075367_106741021 189
1002 3300006186 Ga0075369_10212084 Ga0075369_102120841 189
1003 3300006195 Ga0075366_10019914 Ga0075366_100199143 189
1004 3300006195 Ga0075366_10048077 Ga0075366_100480774 189
1005 3300006195 Ga0075366_10158241 Ga0075366_101582412 189
1006 3300006195 Ga0075366_10392069 Ga0075366_103920692 189
1007 3300006353 Ga0075370_10203742 Ga0075370_102037421 189
1008 3300006353 Ga0075370_10315062 Ga0075370_103150621 189
1009 3300006353 Ga0075370_10386668 Ga0075370_103866682 189
1010 3300006881 Ga0068865_100357587 Ga0068865_1003575872 189
1011 3300006931 Ga0097620_100108193 Ga0097620_1001081932 189
1012 3300006931 Ga0097620_100270432 Ga0097620_1002704324 189
1013 3300009098 Ga0105245_11311935 Ga0105245_113119351 189
1014 3300009148 Ga0105243_10115013 Ga0105243_101150133 189
1015 3300009148 Ga0105243_10407367 Ga0105243_104073672 189
1016 3300009174 Ga0105241_10257043 Ga0105241_102570433 189
1017 3300010375 Ga0105239_10149771 Ga0105239_101497714 189
1018 3300013297 Ga0157378_10322527 Ga0157378_103225273 189
1019 3300013297 Ga0157378_11077392 Ga0157378_110773921 189
1020 3300014325 Ga0163163_10583739 Ga0163163_105837392 189
1021 3300014497 Ga0182008_10005790 Ga0182008_100057904 189
1022 3300014745 Ga0157377_10000420 Ga0157377_1000042013 189
1023 3300014969 Ga0157376_10517136 Ga0157376_105171361 189
1024 3300015262 Ga0182007_10032705 Ga0182007_100327054 189
1025 3300025899 Ga0207642_10071102 Ga0207642_100711023 189
1026 3300025914 Ga0207671_10020608 Ga0207671_100206082 189
1027 3300025927 Ga0207687_10182177 Ga0207687_101821773 189
1028 3300025931 Ga0207644_10028855 Ga0207644_100288555 189
1029 3300025932 Ga0207690_10371213 Ga0207690_103712132 189
1030 3300025933 Ga0207706_10034769 Ga0207706_100347694 189
1031 3300025933 Ga0207706_10050422 Ga0207706_100504225 189
1032 3300025935 Ga0207709_10007814 Ga0207709_100078146 189
1033 3300025935 Ga0207709_10362242 Ga0207709_103622422 189
1034 3300025938 Ga0207704_10060670 Ga0207704_100606702 189
1035 3300025981 Ga0207640_10060779 Ga0207640_100607793 189
1036 3300026023 Ga0207677_10046409 Ga0207677_100464094 189
1037 3300026023 Ga0207677_10069847 Ga0207677_100698472 189
1038 3300026041 Ga0207639_10129777 Ga0207639_101297774 189
1039 3300026089 Ga0207648_10020968 Ga0207648_100209684 189
1040 3300026095 Ga0207676_10084960 Ga0207676_100849602 189
1041 3300026116 Ga0207674_10233402 Ga0207674_102334022 189
1042 3300026121 Ga0207683_10279799 Ga0207683_102797992 189
1043 3300026121 Ga0207683_10855470 Ga0207683_108554702 189
1044 3300026142 Ga0207698_10151787 Ga0207698_101517872 189
1045 3300026142 Ga0207698_10345981 Ga0207698_103459812 189
1046 3300026142 Ga0207698_10366592 Ga0207698_103665924 189
1047 3300028381 Ga0268264_10306835 Ga0268264_103068351 189
1048 3300028794 Ga0307515_10504308 Ga0307515_105043082 189
1049 3300030522 Ga0307512_10193679 Ga0307512_101936792 189
1050 3300031456 Ga0307513_10159168 Ga0307513_101591683 189
1051 3300031507 Ga0307509_10131886 Ga0307509_101318863 189
1052 3300031616 Ga0307508_10378134 Ga0307508_103781342 189
1053 3300031730 Ga0307516_10098740 Ga0307516_100987403 189
1054 3300031730 Ga0307516_10134248 Ga0307516_101342483 189
1055 3300033180 Ga0307510_10085086 Ga0307510_100850864 189
1056 3300033180 Ga0307510_10133051 Ga0307510_101330514 189
1057 3300034816 Ga0373930_0047422 Ga0373930_0047422_23_619 189
1058 3300035089 Ga0373944_0006036 Ga0373944_0006036_392_964 189
1059 3300035111 Ga0373923_0250142 Ga0373923_0250142_208_804 189
1060 3300035171 Ga0373946_0300657 Ga0373946_0300657_208_780 189
1061 3300035172 Ga0373955_0530117 Ga0373955_0530117_134_706 189
1062 3300035242 Ga0373962_0071990 Ga0373962_0071990_341_937 189
1063 3300035691 Ga0373931_0038363 Ga0373931_0038363_720_1316 189
1064 3300035695 Ga0373927_0032480 Ga0373927_0032480_421_993 189
1065 3300037068 Ga0373925_0171488 Ga0373925_0171488_991_1563 189
1066 3300039447 Ga0436361_0519625 Ga0436361_0519625_805_1377 189
1067 3300041413 Ga0439465_0108422 Ga0439465_0108422_245_829 189
1068 3300041997 Ga0439431_0031611 Ga0439431_0031611_13_597 189
1069 3300042005 Ga0439448_0068742 Ga0439448_0068742_474_1046 189
1070 3300042005 Ga0439448_0073624 Ga0439448_0073624_14_598 189
1071 3300042014 Ga0439457_042377 Ga0439457_042377_309_893 189
1072 3300042135 Ga0450899_002739 Ga0450899_002739_271_855 189
1073 3300042157 Ga0439458_0109816 Ga0439458_0109816_91_675 189
1074 3300044658 Ga0466972_0029858 Ga0466972_0029858_1224_1808 189
1075 3300044683 Ga0466965_0048711 Ga0466965_0048711_717_1301 189
1076 3300044901 Ga0466960_0010183 Ga0466960_0010183_601_1185 189
1077 3300044901 Ga0466960_0263327 Ga0466960_0263327_207_791 189
1078 3300046454 Ga0495592_0000145 Ga0495592_0000145_62004_62591 189
1079 3300046457 Ga0495590_0027277 Ga0495590_0027277_1134_1718 189
1080 3300046512 Ga0495610_0093040 Ga0495610_0093040_719_1303 189
1081 3300046512 Ga0495610_0104850 Ga0495610_0104850_341_928 189
1082 3300046513 Ga0495616_0053494 Ga0495616_0053494_960_1544 189
1083 3300046517 Ga0495630_0110923 Ga0495630_0110923_399_995 189
1084 3300046518 Ga0495631_0139060 Ga0495631_0139060_136_720 189
1085 3300046519 Ga0495632_0254542 Ga0495632_0254542_86_673 189
1086 3300046526 Ga0495666_0161837 Ga0495666_0161837_48_644 189
1087 3300046528 Ga0495642_0072194 Ga0495642_0072194_612_1202 189
1088 3300046535 Ga0495586_0035595 Ga0495586_0035595_328_900 189
1089 3300046660 Ga0495625_0069994 Ga0495625_0069994_1692_2276 189
1090 3300046683 Ga0495658_0049526 Ga0495658_0049526_1212_1784 189
1091 3300046690 Ga0495624_0167386 Ga0495624_0167386_704_1300 189
1092 3300047443 Ga0495687_014570 Ga0495687_014570_2856_3440 189
1093 3300047443 Ga0495687_066393 Ga0495687_066393_131_715 189
1094 3300047673 Ga0495593_0297370 Ga0495593_0297370_71_667 189
1095 3300048905 Ga0496102_0173739 Ga0496102_0173739_723_1310 189
1096 3300049128 Ga0501308_019554 Ga0501308_019554_208_792 189
1097 3300049763 Ga0501266_055142 Ga0501266_055142_25_606 189
1098 3300050489 nmdc:mga03683_11904_c1 nmdc:mga03683_11904_c1_1527_2111 189
1099 3300050489 nmdc:mga03683_44553_c1 nmdc:mga03683_44553_c1_740_1324 189
1100 3300050489 nmdc:mga03683_58070_c1 nmdc:mga03683_58070_c1_748_1335 189
1101 3300050489 nmdc:mga03683_91985_c1 nmdc:mga03683_91985_c1_613_1197 189
1102 3300050492 nmdc:mga0yw44_23722_c1 nmdc:mga0yw44_23722_c1_2195_2779 189
1103 3300050493 nmdc:mga0k408_10237_c1 nmdc:mga0k408_10237_c1_3769_4356 189
1104 3300050493 nmdc:mga0k408_136853_c1 nmdc:mga0k408_136853_c1_655_1239 189
1105 3300050493 nmdc:mga0k408_2170_c1 nmdc:mga0k408_2170_c1_6133_6732 189
1106 3300050493 nmdc:mga0k408_36153_c2 nmdc:mga0k408_36153_c2_68_655 189
1107 3300050493 nmdc:mga0k408_390207_c1 nmdc:mga0k408_390207_c1_16_600 189
1108 3300050493 nmdc:mga0k408_42542_c1 nmdc:mga0k408_42542_c1_1418_2002 189
1109 3300050493 nmdc:mga0k408_82211_c1 nmdc:mga0k408_82211_c1_872_1465 189
1110 3300050494 nmdc:mga06z11_182512_c1 nmdc:mga06z11_182512_c1_393_977 189
1111 3300050494 nmdc:mga06z11_371103_c1 nmdc:mga06z11_371103_c1_237_821 189
1112 3300050496 nmdc:mga07m45_122949_c1 nmdc:mga07m45_122949_c1_185_769 189
1113 3300050496 nmdc:mga07m45_122954_c1 nmdc:mga07m45_122954_c1_177_761 189
1114 3300050496 nmdc:mga07m45_249471_c1 nmdc:mga07m45_249471_c1_425_1018 189
1115 3300050496 nmdc:mga07m45_34668_c1 nmdc:mga07m45_34668_c1_740_1327 189
1116 3300050496 nmdc:mga07m45_39978_c1 nmdc:mga07m45_39978_c1_238_822 189
1117 3300050516 nmdc:mga0sz30_26643_c1 nmdc:mga0sz30_26643_c1_1259_1843 189
1118 3300053087 Ga0500643_047129 Ga0500643_047129_325_912 189
1119 3300053118 Ga0500594_0000241 Ga0500594_0000241_11300_11887 189
1120 3300053133 Ga0500655_067808 Ga0500655_067808_105_692 189
1121 3300053134 Ga0500658_0027750 Ga0500658_0027750_861_1445 189
1122 3300053136 Ga0500559_0001032 Ga0500559_0001032_720_1307 189
1123 3300053138 Ga0500564_036515 Ga0500564_036515_888_1475 189
1124 3300053139 Ga0500568_0054766 Ga0500568_0054766_659_1246 189
1125 3300053139 Ga0500568_0065837 Ga0500568_0065837_598_1182 189
1126 3300053156 Ga0500622_0006410 Ga0500622_0006410_5521_6108 189
1127 3300053739 Ga0500587_003497 Ga0500587_003497_718_1305 189
1128 iso_pu_bacteria 2599185214 2599621307 189
1129 iso_pu_bacteria 2599185226 2599675326 189
1130 iso_pu_bacteria 2599185227 2599678076 189
1131 iso_pu_bacteria 2599185229 2599690818 189
1132 iso_pu_bacteria 2643221554 2643789312 189
1133 iso_pu_bacteria 2643221628 2644161146 189
1134 iso_pu_bacteria 2643221638 2644212913 189
1135 iso_pu_bacteria 2643221645 2644251647 189
1136 iso_pu_bacteria 2738541277 2738723138 189
1137 iso_pu_bacteria 2738541297 2738826686 189
1138 iso_pu_bacteria 2738541357 2739150483 189
1139 iso_pu_bacteria 2738543003 2739192402 189
1140 iso_pu_bacteria 2738543019 2739283869 189
1141 iso_pu_bacteria 2738543026 2739318879 189
1142 iso_pu_bacteria 2738543029 2739337120 189
1143 iso_pu_bacteria 2808606418 2809145971 189
1144 iso_pu_bacteria 2818991446 2819602809 189
1145 iso_pu_bacteria 2831265667 2831270165 189
1146 iso_pu_bacteria 2838054893 2838061788 189
1147 iso_pu_bacteria 2842677519 2842681455 189
1148 iso_pu_bacteria 2857553236 2857556366 189
1149 iso_pu_bacteria 2885198086 2885201411 189
1150 iso_pu_bacteria 2885211737 2885215065 189
1151 iso_pu_bacteria 2899924645 2899927925 189
1152 iso_pu_bacteria 2904424332 2904427830 189
1153 iso_pu_bacteria 2904449895 2904454251 189
1154 iso_pu_bacteria 2904456579 2904462988 189
1155 iso_pu_bacteria 2919462493 2919467941 189
1156 iso_pu_bacteria 2919476304 2919476869 189
1157 iso_pu_bacteria 2928037797 2928042447 189
1158 iso_pu_bacteria 2928044640 2928048472 189
1159 iso_pu_bacteria 2928051484 2928054797 189
1160 iso_pu_bacteria 2928064002 2928068216 189
1161 iso_pu_bacteria 2928070936 2928073895 189
1162 iso_pu_bacteria 2929520902 2929524999 189
1163 iso_pu_bacteria 2945909444 2945915904 189
1164 iso_pu_bacteria 2945945610 2945950143 189
1165 iso_pu_bacteria 2945984333 2945988664 189
1166 iso_pu_bacteria 8047673197 8047676179 189
1167 3300003841 Ga0055541_1016711 Ga0055541_10167111 190
1168 3300005289 Ga0065704_10154776 Ga0065704_101547761 190
1169 3300005327 Ga0070658_10130175 Ga0070658_101301753 190
1170 3300005344 Ga0070661_100781199 Ga0070661_1007811991 190
1171 3300005353 Ga0070669_100095132 Ga0070669_1000951323 190
1172 3300005365 Ga0070688_100472065 Ga0070688_1004720652 190
1173 3300005436 Ga0070713_100757445 Ga0070713_1007574451 190
1174 3300005459 Ga0068867_100901526 Ga0068867_1009015262 190
1175 3300005467 Ga0070706_100007906 Ga0070706_1000079065 190
1176 3300005468 Ga0070707_100037509 Ga0070707_1000375093 190
1177 3300005518 Ga0070699_100118437 Ga0070699_1001184374 190
1178 3300005563 Ga0068855_100196836 Ga0068855_1001968364 190
1179 3300005617 Ga0068859_100190283 Ga0068859_1001902833 190
1180 3300005843 Ga0068860_100042655 Ga0068860_1000426553 190
1181 3300006178 Ga0075367_10137116 Ga0075367_101371162 190
1182 3300006195 Ga0075366_10084492 Ga0075366_100844922 190
1183 3300006237 Ga0097621_101363971 Ga0097621_1013639711 190
1184 3300006353 Ga0075370_10017419 Ga0075370_100174195 190
1185 3300006353 Ga0075370_10130476 Ga0075370_101304763 190
1186 3300006931 Ga0097620_100190298 Ga0097620_1001902983 190
1187 3300009093 Ga0105240_11677126 Ga0105240_116771261 190
1188 3300009545 Ga0105237_11181785 Ga0105237_111817851 190
1189 3300013102 Ga0157371_10000710 Ga0157371_100007104 190
1190 3300013306 Ga0163162_10336003 Ga0163162_103360032 190
1191 3300013308 Ga0157375_10837518 Ga0157375_108375182 190
1192 3300014968 Ga0157379_10704450 Ga0157379_107044501 190
1193 3300015261 Ga0182006_1013810 Ga0182006_10138104 190
1194 3300017792 Ga0163161_10059881 Ga0163161_100598814 190
1195 3300017792 Ga0163161_10216950 Ga0163161_102169503 190
1196 3300025303 Ga0209051_1043557 Ga0209051_10435572 190
1197 3300025909 Ga0207705_10427123 Ga0207705_104271232 190
1198 3300025910 Ga0207684_10003400 Ga0207684_100034003 190
1199 3300025923 Ga0207681_10017982 Ga0207681_100179825 190
1200 3300025941 Ga0207711_10595213 Ga0207711_105952132 190
1201 3300026088 Ga0207641_10261812 Ga0207641_102618124 190
1202 3300026095 Ga0207676_10776783 Ga0207676_107767831 190
1203 3300026121 Ga0207683_11292542 Ga0207683_112925421 190
1204 3300026142 Ga0207698_11288690 Ga0207698_112886901 190
1205 3300027360 Ga0209969_1011740 Ga0209969_10117402 190
1206 3300027395 Ga0209996_1000589 Ga0209996_10005897 190
1207 3300027471 Ga0209995_1001072 Ga0209995_10010722 190
1208 3300027526 Ga0209968_1000400 Ga0209968_10004004 190
1209 3300027543 Ga0209999_1000995 Ga0209999_10009956 190
1210 3300027614 Ga0209970_1000399 Ga0209970_10003996 190
1211 3300027695 Ga0209966_1000297 Ga0209966_100029712 190
1212 3300027876 Ga0209974_10016726 Ga0209974_100167261 190
1213 3300027876 Ga0209974_10022170 Ga0209974_100221703 190
1214 3300028794 Ga0307515_10011833 Ga0307515_1001183312 190
1215 3300031548 Ga0307408_100224051 Ga0307408_1002240511 190
1216 3300032002 Ga0307416_100334660 Ga0307416_1003346604 190
1217 3300032005 Ga0307411_10870321 Ga0307411_108703211 190
1218 3300037471 Ga0395905_0025382 Ga0395905_0025382_656_1243 190
1219 3300037471 Ga0395905_0057895 Ga0395905_0057895_2177_2752 190
1220 3300041452 Ga0451793_1802817 Ga0451793_1802817_280_873 190
1221 3300044656 Ga0466969_0032267 Ga0466969_0032267_1334_1912 190
1222 3300044656 Ga0466969_0037700 Ga0466969_0037700_210_797 190
1223 3300044683 Ga0466965_0090033 Ga0466965_0090033_207_785 190
1224 3300044684 Ga0466966_0059862 Ga0466966_0059862_1809_2387 190
1225 3300044693 Ga0466961_0017475 Ga0466961_0017475_808_1395 190
1226 3300044693 Ga0466961_0063986 Ga0466961_0063986_751_1329 190
1227 3300044694 Ga0466963_0090105 Ga0466963_0090105_819_1397 190
1228 3300044706 Ga0466964_0021546 Ga0466964_0021546_1015_1593 190
1229 3300044706 Ga0466964_0055260 Ga0466964_0055260_427_1014 190
1230 3300044719 Ga0466971_0009471 Ga0466971_0009471_2926_3504 190
1231 3300044735 Ga0466968_0065630 Ga0466968_0065630_390_980 190
1232 3300044765 Ga0466970_0028435 Ga0466970_0028435_751_1329 190
1233 3300044842 Ga0466957_0034004 Ga0466957_0034004_196_774 190
1234 3300044842 Ga0466957_0167221 Ga0466957_0167221_393_989 190
1235 3300045049 Ga0466959_0007498 Ga0466959_0007498_750_1328 190
1236 3300045049 Ga0466959_0055270 Ga0466959_0055270_1089_1676 190
1237 3300045836 Ga0466958_0012561 Ga0466958_0012561_944_1522 190
1238 3300045976 Ga0466967_0015476 Ga0466967_0015476_3676_4254 190
1239 3300045976 Ga0466967_0280019 Ga0466967_0280019_89_676 190
1240 3300046474 Ga0495605_0121458 Ga0495605_0121458_113_706 190
1241 3300048908 Ga0496105_0293722 Ga0496105_0293722_399_974 190
1242 3300048911 Ga0496108_0909228 Ga0496108_0909228_23_598 190
1243 3300048925 Ga0496122_0004844 Ga0496122_0004844_12286_12879 190
1244 3300048926 Ga0496123_0021652 Ga0496123_0021652_3488_4081 190
1245 3300048926 Ga0496123_0102717 Ga0496123_0102717_175_762 190
1246 3300048927 Ga0496124_0031953 Ga0496124_0031953_3382_3975 190
1247 3300049515 Ga0501292_000933 Ga0501292_000933_145_738 190
1248 3300049520 Ga0501297_008381 Ga0501297_008381_478_1071 190
1249 3300049521 Ga0501298_009717 Ga0501298_009717_671_1264 190
1250 3300049686 Ga0501257_003951 Ga0501257_003951_1682_2275 190
1251 3300049759 Ga0501262_001632 Ga0501262_001632_1480_2073 190
1252 3300049762 Ga0501265_000831 Ga0501265_000831_927_1520 190
1253 3300049770 Ga0501273_033478 Ga0501273_033478_131_724 190
1254 3300049777 Ga0501281_01859 Ga0501281_01859_83_676 190
1255 3300049822 Ga0501035_0131976 Ga0501035_0131976_795_1373 190
1256 3300050496 nmdc:mga07m45_10461_c1 nmdc:mga07m45_10461_c1_889_1464 190
1257 3300050496 nmdc:mga07m45_291892_c1 nmdc:mga07m45_291892_c1_110_703 190
1258 3300053134 Ga0500658_0159392 Ga0500658_0159392_188_775 190
1259 3300059512 Ga0587092_068803 Ga0587092_068803_13_588 190
1260 3300061719 Ga0466962_0004024 Ga0466962_0004024_6014_6601 190
1261 3300061719 Ga0466962_0009181 Ga0466962_0009181_751_1329 190
1262 iso_pu_bacteria 2643221664 2644356008 190
1263 iso_pu_bacteria 2643221683 2644469696 190
1264 iso_pu_bacteria 2721755523 2722881270 190
1265 iso_pu_bacteria 2839138175 2839144749 190
1266 iso_pu_bacteria 2928084124 2928086175 190
1267 iso_pu_bacteria 2945972063 2945975210 190
1268 3300001915 JGI24741J21665_1002533 JGI24741J21665_10025334 191
1269 3300001979 JGI24740J21852_10042360 JGI24740J21852_100423601 191
1270 3300002705 JGI25156J39149_1006073 JGI25156J39149_10060734 191
1271 3300002705 JGI25156J39149_1023191 JGI25156J39149_10231911 191
1272 3300002705 JGI25156J39149_1027974 JGI25156J39149_10279741 191
1273 3300002738 JGI25154J39366_1002655 JGI25154J39366_10026556 191
1274 3300002738 JGI25154J39366_1003448 JGI25154J39366_10034483 191
1275 3300002741 JGI25157J39369_1000533 JGI25157J39369_100053317 191
1276 3300002772 JGI25164J39214_1001514 JGI25164J39214_10015147 191
1277 3300002774 JGI25150J39212_1001674 JGI25150J39212_10016749 191
1278 3300003163 Ga0006759J45824_1011840 Ga0006759J45824_10118407 191
1279 3300003163 Ga0006759J45824_1054940 Ga0006759J45824_10549401 191
1280 3300003215 JGI25153J46596_10025429 JGI25153J46596_100254293 191
1281 3300003215 JGI25153J46596_10026468 JGI25153J46596_100264683 191
1282 3300003291 Ga0007421J48921_105529 Ga0007421J48921_1055291 191
1283 3300003300 Ga0006758J48902_1008629 Ga0006758J48902_10086293 191
1284 3300003305 Ga0006770J48903_1043850 Ga0006770J48903_10438502 191
1285 3300003308 Ga0006777J48905_1091911 Ga0006777J48905_10919111 191
1286 3300003320 rootH2_10100020 rootH2_101000203 191
1287 3300003323 rootH1_10213140 rootH1_102131401 191
1288 3300003479 Ga0006556J51387_1016726 Ga0006556J51387_10167267 191
1289 3300003544 Ga0007417J51691_1010301 Ga0007417J51691_10103014 191
1290 3300003558 Ga0006558J51389_1020499 Ga0006558J51389_10204992 191
1291 3300003565 Ga0006560J51390_1014141 Ga0006560J51390_10141417 191
1292 3300003574 Ga0007410J51695_1007231 Ga0007410J51695_10072317 191
1293 3300003574 Ga0007410J51695_1013246 Ga0007410J51695_10132463 191
1294 3300003575 Ga0007409J51694_1004205 Ga0007409J51694_10042054 191
1295 3300003577 Ga0007416J51690_1008732 Ga0007416J51690_10087324 191
1296 3300003578 Ga0006562J51391_1022410 Ga0006562J51391_10224102 191
1297 3300003579 Ga0007429J51699_1048446 Ga0007429J51699_10484463 191
1298 3300003611 Ga0007411J51799_105052 Ga0007411J51799_1050524 191
1299 3300003693 Ga0032354_1011615 Ga0032354_10116154 191
1300 3300003693 Ga0032354_1080619 Ga0032354_10806192 191
1301 3300003751 Ga0055538_1005237 Ga0055538_10052371 191
1302 3300003751 Ga0055538_1005242 Ga0055538_10052421 191
1303 3300003752 Ga0055539_1001825 Ga0055539_10018254 191
1304 3300003752 Ga0055539_1005916 Ga0055539_10059161 191
1305 3300003752 Ga0055539_1005933 Ga0055539_10059331 191
1306 3300003756 Ga0055533_1000312 Ga0055533_10003124 191
1307 3300003756 Ga0055533_1000367 Ga0055533_100036713 191
1308 3300003756 Ga0055533_1005172 Ga0055533_10051723 191
1309 3300003758 Ga0055532_1000810 Ga0055532_10008104 191
1310 3300003759 Ga0055525_1001045 Ga0055525_10010453 191
1311 3300003759 Ga0055525_1001619 Ga0055525_10016194 191
1312 3300003760 Ga0055527_1000854 Ga0055527_10008546 191
1313 3300003761 Ga0055535_1001602 Ga0055535_10016024 191
1314 3300003761 Ga0055535_1009842 Ga0055535_10098421 191
1315 3300003762 Ga0055542_1004878 Ga0055542_10048783 191
1316 3300003763 Ga0055529_1001065 Ga0055529_10010657 191
1317 3300003763 Ga0055529_1001175 Ga0055529_10011754 191
1318 3300003771 Ga0055526_1001586 Ga0055526_10015864 191
1319 3300003781 Ga0055536_1033135 Ga0055536_10331353 191
1320 3300003791 Ga0055530_10020908 Ga0055530_100209082 191
1321 3300003794 Ga0055531_10026230 Ga0055531_100262303 191
1322 3300003841 Ga0055541_1010550 Ga0055541_10105501 191
1323 3300003841 Ga0055541_1017810 Ga0055541_10178101 191
1324 3300004798 Ga0058859_10118627 Ga0058859_101186275 191
1325 3300004801 Ga0058860_10069139 Ga0058860_100691392 191
1326 3300004801 Ga0058860_12214629 Ga0058860_122146292 191
1327 3300005262 Ga0065165_1013838 Ga0065165_10138384 191
1328 3300005289 Ga0065704_10158451 Ga0065704_101584512 191
1329 3300005293 Ga0065715_10242832 Ga0065715_102428321 191
1330 3300005327 Ga0070658_10274106 Ga0070658_102741064 191
1331 3300005333 Ga0070677_10075653 Ga0070677_100756532 191
1332 3300005334 Ga0068869_100075056 Ga0068869_1000750564 191
1333 3300005337 Ga0070682_100049501 Ga0070682_1000495014 191
1334 3300005339 Ga0070660_100054384 Ga0070660_1000543844 191
1335 3300005344 Ga0070661_100012369 Ga0070661_1000123696 191
1336 3300005344 Ga0070661_100103030 Ga0070661_1001030304 191
1337 3300005347 Ga0070668_100039490 Ga0070668_1000394904 191
1338 3300005347 Ga0070668_100152914 Ga0070668_1001529143 191
1339 3300005353 Ga0070669_100036662 Ga0070669_1000366624 191
1340 3300005354 Ga0070675_100491793 Ga0070675_1004917931 191
1341 3300005354 Ga0070675_100724187 Ga0070675_1007241871 191
1342 3300005356 Ga0070674_100454834 Ga0070674_1004548342 191
1343 3300005364 Ga0070673_100101877 Ga0070673_1001018774 191
1344 3300005364 Ga0070673_101053663 Ga0070673_1010536631 191
1345 3300005366 Ga0070659_100022490 Ga0070659_1000224904 191
1346 3300005366 Ga0070659_100039486 Ga0070659_1000394864 191
1347 3300005366 Ga0070659_100210997 Ga0070659_1002109974 191
1348 3300005441 Ga0070700_100103999 Ga0070700_1001039993 191
1349 3300005445 Ga0070708_100722927 Ga0070708_1007229272 191
1350 3300005455 Ga0070663_100002790 Ga0070663_1000027903 191
1351 3300005455 Ga0070663_100066928 Ga0070663_1000669282 191
1352 3300005457 Ga0070662_100213204 Ga0070662_1002132042 191
1353 3300005457 Ga0070662_100368402 Ga0070662_1003684021 191
1354 3300005466 Ga0070685_10340272 Ga0070685_103402722 191
1355 3300005530 Ga0070679_100565941 Ga0070679_1005659412 191
1356 3300005539 Ga0068853_101028218 Ga0068853_1010282181 191
1357 3300005539 Ga0068853_101363889 Ga0068853_1013638891 191
1358 3300005543 Ga0070672_100289802 Ga0070672_1002898023 191
1359 3300005548 Ga0070665_101433398 Ga0070665_1014333981 191
1360 3300005563 Ga0068855_100070674 Ga0068855_1000706745 191
1361 3300005563 Ga0068855_100364578 Ga0068855_1003645783 191
1362 3300005564 Ga0070664_100000356 Ga0070664_1000003564 191
1363 3300005564 Ga0070664_100031876 Ga0070664_1000318764 191
1364 3300005564 Ga0070664_100139315 Ga0070664_1001393154 191
1365 3300005577 Ga0068857_100006407 Ga0068857_1000064074 191
1366 3300005577 Ga0068857_100132782 Ga0068857_1001327823 191
1367 3300005578 Ga0068854_100008705 Ga0068854_1000087056 191
1368 3300005578 Ga0068854_100060898 Ga0068854_1000608984 191
1369 3300005578 Ga0068854_100253397 Ga0068854_1002533971 191
1370 3300005614 Ga0068856_100017010 Ga0068856_1000170106 191
1371 3300005614 Ga0068856_100139940 Ga0068856_1001399403 191
1372 3300005614 Ga0068856_100424493 Ga0068856_1004244933 191
1373 3300005616 Ga0068852_100108612 Ga0068852_1001086122 191
1374 3300005718 Ga0068866_10231068 Ga0068866_102310681 191
1375 3300005842 Ga0068858_100342202 Ga0068858_1003422022 191
1376 3300005843 Ga0068860_100058871 Ga0068860_1000588715 191
1377 3300005843 Ga0068860_100186597 Ga0068860_1001865973 191
1378 3300005843 Ga0068860_100356883 Ga0068860_1003568831 191
1379 3300005844 Ga0068862_100195814 Ga0068862_1001958142 191
1380 3300005844 Ga0068862_100517618 Ga0068862_1005176181 191
1381 3300006038 Ga0075365_10148664 Ga0075365_101486642 191
1382 3300006048 Ga0075363_100009222 Ga0075363_1000092227 191
1383 3300006051 Ga0075364_10022236 Ga0075364_100222363 191
1384 3300006177 Ga0075362_10096575 Ga0075362_100965751 191
1385 3300006186 Ga0075369_10208542 Ga0075369_102085421 191
1386 3300006195 Ga0075366_10020376 Ga0075366_100203764 191
1387 3300006195 Ga0075366_10138697 Ga0075366_101386972 191
1388 3300006195 Ga0075366_10202859 Ga0075366_102028592 191
1389 3300006237 Ga0097621_100176041 Ga0097621_1001760412 191
1390 3300006237 Ga0097621_100321030 Ga0097621_1003210302 191
1391 3300006237 Ga0097621_100879263 Ga0097621_1008792632 191
1392 3300006353 Ga0075370_10010622 Ga0075370_100106223 191
1393 3300006353 Ga0075370_10018877 Ga0075370_100188775 191
1394 3300006353 Ga0075370_10020081 Ga0075370_100200816 191
1395 3300006881 Ga0068865_100089515 Ga0068865_1000895153 191
1396 3300009036 Ga0105244_10287104 Ga0105244_102871042 191
1397 3300009036 Ga0105244_10345120 Ga0105244_103451201 191
1398 3300009093 Ga0105240_10127654 Ga0105240_101276543 191
1399 3300009093 Ga0105240_10949647 Ga0105240_109496471 191
1400 3300009147 Ga0114129_10090756 Ga0114129_100907566 191
1401 3300009148 Ga0105243_10053700 Ga0105243_100537004 191
1402 3300009148 Ga0105243_10082803 Ga0105243_100828033 191
1403 3300009545 Ga0105237_10229198 Ga0105237_102291982 191
1404 3300009551 Ga0105238_10118991 Ga0105238_101189914 191
1405 3300009551 Ga0105238_10476928 Ga0105238_104769282 191
1406 3300009553 Ga0105249_10089955 Ga0105249_100899554 191
1407 3300010375 Ga0105239_10258543 Ga0105239_102585433 191
1408 3300010375 Ga0105239_10385566 Ga0105239_103855663 191
1409 3300012513 Ga0157326_1032962 Ga0157326_10329621 191
1410 3300013100 Ga0157373_10004374 Ga0157373_100043744 191
1411 3300013102 Ga0157371_10005586 Ga0157371_100055864 191
1412 3300013104 Ga0157370_10009078 Ga0157370_100090784 191
1413 3300013104 Ga0157370_10295926 Ga0157370_102959261 191
1414 3300013105 Ga0157369_10014756 Ga0157369_100147567 191
1415 3300013105 Ga0157369_10330101 Ga0157369_103301012 191
1416 3300013296 Ga0157374_10230020 Ga0157374_102300202 191
1417 3300013297 Ga0157378_10004819 Ga0157378_100048199 191
1418 3300013306 Ga0163162_10120962 Ga0163162_101209624 191
1419 3300013306 Ga0163162_10132202 Ga0163162_101322022 191
1420 3300013307 Ga0157372_10007032 Ga0157372_100070324 191
1421 3300013308 Ga0157375_10154272 Ga0157375_101542723 191
1422 3300013308 Ga0157375_10281193 Ga0157375_102811933 191
1423 3300014325 Ga0163163_11655822 Ga0163163_116558221 191
1424 3300014326 Ga0157380_10045061 Ga0157380_100450614 191
1425 3300014497 Ga0182008_10026855 Ga0182008_100268554 191
1426 3300014497 Ga0182008_10054466 Ga0182008_100544664 191
1427 3300014497 Ga0182008_10081586 Ga0182008_100815862 191
1428 3300014497 Ga0182008_10337231 Ga0182008_103372311 191
1429 3300014968 Ga0157379_10114119 Ga0157379_101141194 191
1430 3300014968 Ga0157379_10172914 Ga0157379_101729144 191
1431 3300014968 Ga0157379_10955801 Ga0157379_109558011 191
1432 3300014969 Ga0157376_10209205 Ga0157376_102092052 191
1433 3300014969 Ga0157376_10469954 Ga0157376_104699542 191
1434 3300015261 Ga0182006_1007795 Ga0182006_10077954 191
1435 3300015261 Ga0182006_1008556 Ga0182006_10085565 191
1436 3300015261 Ga0182006_1048397 Ga0182006_10483973 191
1437 3300015261 Ga0182006_1067629 Ga0182006_10676293 191
1438 3300015261 Ga0182006_1104497 Ga0182006_11044972 191
1439 3300015262 Ga0182007_10014740 Ga0182007_100147404 191
1440 3300015262 Ga0182007_10024596 Ga0182007_100245962 191
1441 3300015262 Ga0182007_10025073 Ga0182007_100250734 191
1442 3300015265 Ga0182005_1027929 Ga0182005_10279294 191
1443 3300015265 Ga0182005_1059936 Ga0182005_10599362 191
1444 3300015265 Ga0182005_1093621 Ga0182005_10936211 191
1445 3300015683 Ga0183362_10014 Ga0183362_1001434 191
1446 3300017792 Ga0163161_10068372 Ga0163161_100683724 191
1447 3300017792 Ga0163161_11063663 Ga0163161_110636631 191
1448 3300020069 Ga0197907_10276287 Ga0197907_102762874 191
1449 3300020070 Ga0206356_11570777 Ga0206356_115707773 191
1450 3300020075 Ga0206349_1520604 Ga0206349_15206041 191
1451 3300020075 Ga0206349_1521794 Ga0206349_15217941 191
1452 3300020076 Ga0206355_1003085 Ga0206355_10030854 191
1453 3300020077 Ga0206351_10898479 Ga0206351_108984794 191
1454 3300020078 Ga0206352_10576776 Ga0206352_105767762 191
1455 3300020080 Ga0206350_11654024 Ga0206350_116540242 191
1456 3300020610 Ga0154015_1218269 Ga0154015_12182697 191
1457 3300022467 Ga0224712_10016134 Ga0224712_100161344 191
1458 3300025224 Ga0209784_101495 Ga0209784_1014952 191
1459 3300025224 Ga0209784_101598 Ga0209784_1015983 191
1460 3300025224 Ga0209784_102871 Ga0209784_1028712 191
1461 3300025225 Ga0209566_100422 Ga0209566_10042221 191
1462 3300025225 Ga0209566_102009 Ga0209566_1020092 191
1463 3300025226 Ga0209674_100067 Ga0209674_100067163 191
1464 3300025226 Ga0209674_100310 Ga0209674_10031021 191
1465 3300025226 Ga0209674_103534 Ga0209674_1035343 191
1466 3300025226 Ga0209674_104927 Ga0209674_1049274 191
1467 3300025228 Ga0209672_100291 Ga0209672_10029121 191
1468 3300025228 Ga0209672_104561 Ga0209672_1045614 191
1469 3300025229 Ga0209147_100090 Ga0209147_100090175 191
1470 3300025230 Ga0209563_100068 Ga0209563_100068163 191
1471 3300025230 Ga0209563_100200 Ga0209563_10020021 191
1472 3300025231 Ga0207427_100260 Ga0207427_1002604 191
1473 3300025242 Ga0209258_100130 Ga0209258_100130174 191
1474 3300025242 Ga0209258_103442 Ga0209258_1034424 191
1475 3300025242 Ga0209258_103546 Ga0209258_1035464 191
1476 3300025245 Ga0207425_1000767 Ga0207425_10007674 191
1477 3300025245 Ga0207425_1035268 Ga0207425_10352682 191
1478 3300025246 Ga0209646_1000348 Ga0209646_10003488 191
1479 3300025246 Ga0209646_1000434 Ga0209646_10004344 191
1480 3300025250 Ga0209026_1000004 Ga0209026_1000004727 191
1481 3300025250 Ga0209026_1006910 Ga0209026_10069102 191
1482 3300025250 Ga0209026_1025543 Ga0209026_10255431 191
1483 3300025253 Ga0209677_100043 Ga0209677_100043230 191
1484 3300025253 Ga0209677_101729 Ga0209677_1017294 191
1485 3300025253 Ga0209677_104488 Ga0209677_1044884 191
1486 3300025253 Ga0209677_105221 Ga0209677_1052214 191
1487 3300025254 Ga0209148_1003649 Ga0209148_10036494 191
1488 3300025254 Ga0209148_1004793 Ga0209148_10047934 191
1489 3300025256 Ga0209759_1000979 Ga0209759_10009794 191
1490 3300025256 Ga0209759_1008706 Ga0209759_10087067 191
1491 3300025256 Ga0209759_1010247 Ga0209759_10102473 191
1492 3300025256 Ga0209759_1012596 Ga0209759_10125963 191
1493 3300025256 Ga0209759_1019396 Ga0209759_10193963 191
1494 3300025256 Ga0209759_1031246 Ga0209759_10312461 191
1495 3300025258 Ga0209129_1001020 Ga0209129_10010204 191
1496 3300025263 Ga0209565_1008373 Ga0209565_10083732 191
1497 3300025272 Ga0209455_1000083 Ga0209455_1000083157 191
1498 3300025272 Ga0209455_1000119 Ga0209455_10001198 191
1499 3300025273 Ga0209673_1008361 Ga0209673_10083613 191
1500 3300025273 Ga0209673_1013243 Ga0209673_10132433 191
1501 3300025292 Ga0209676_1035438 Ga0209676_10354383 191
1502 3300025294 Ga0209025_1052014 Ga0209025_10520144 191
1503 3300025295 Ga0209564_1002159 Ga0209564_10021594 191
1504 3300025297 Ga0209758_1006572 Ga0209758_10065726 191
1505 3300025297 Ga0209758_1006647 Ga0209758_10066476 191
1506 3300025298 Ga0209050_1002318 Ga0209050_10023184 191
1507 3300025298 Ga0209050_1017496 Ga0209050_10174963 191
1508 3300025299 Ga0209256_1011472 Ga0209256_10114723 191
1509 3300025303 Ga0209051_1003790 Ga0209051_10037904 191
1510 3300025303 Ga0209051_1009985 Ga0209051_10099856 191
1511 3300025304 Ga0209257_1013612 Ga0209257_10136125 191
1512 3300025304 Ga0209257_1019267 Ga0209257_10192673 191
1513 3300025315 Ga0207697_10202928 Ga0207697_102029281 191
1514 3300025728 Ga0207655_1010082 Ga0207655_10100824 191
1515 3300025893 Ga0207682_10039674 Ga0207682_100396742 191
1516 3300025899 Ga0207642_10138655 Ga0207642_101386552 191
1517 3300025904 Ga0207647_10091999 Ga0207647_100919991 191
1518 3300025904 Ga0207647_10222493 Ga0207647_102224932 191
1519 3300025907 Ga0207645_10038999 Ga0207645_100389995 191
1520 3300025907 Ga0207645_10216452 Ga0207645_102164522 191
1521 3300025909 Ga0207705_10087321 Ga0207705_100873213 191
1522 3300025911 Ga0207654_10297594 Ga0207654_102975942 191
1523 3300025913 Ga0207695_10010308 Ga0207695_100103087 191
1524 3300025913 Ga0207695_10145282 Ga0207695_101452823 191
1525 3300025919 Ga0207657_10006550 Ga0207657_100065503 191
1526 3300025920 Ga0207649_10000400 Ga0207649_100004004 191
1527 3300025920 Ga0207649_10056050 Ga0207649_100560504 191
1528 3300025923 Ga0207681_10053074 Ga0207681_100530741 191
1529 3300025924 Ga0207694_10035665 Ga0207694_100356654 191
1530 3300025932 Ga0207690_10039670 Ga0207690_100396704 191
1531 3300025932 Ga0207690_10143986 Ga0207690_101439862 191
1532 3300025932 Ga0207690_10208665 Ga0207690_102086654 191
1533 3300025932 Ga0207690_10393682 Ga0207690_103936822 191
1534 3300025934 Ga0207686_10246300 Ga0207686_102463002 191
1535 3300025935 Ga0207709_10008524 Ga0207709_100085243 191
1536 3300025935 Ga0207709_10078134 Ga0207709_100781342 191
1537 3300025935 Ga0207709_10090432 Ga0207709_100904323 191
1538 3300025937 Ga0207669_10411976 Ga0207669_104119762 191
1539 3300025938 Ga0207704_10278481 Ga0207704_102784814 191
1540 3300025940 Ga0207691_10248075 Ga0207691_102480752 191
1541 3300025940 Ga0207691_10291287 Ga0207691_102912872 191
1542 3300025942 Ga0207689_10025938 Ga0207689_100259384 191
1543 3300025945 Ga0207679_10000032 Ga0207679_100000324 191
1544 3300025945 Ga0207679_10018738 Ga0207679_100187384 191
1545 3300025945 Ga0207679_10078880 Ga0207679_100788802 191
1546 3300025945 Ga0207679_10999273 Ga0207679_109992732 191
1547 3300025949 Ga0207667_10187117 Ga0207667_101871173 191
1548 3300025949 Ga0207667_10189105 Ga0207667_101891053 191
1549 3300025960 Ga0207651_10323312 Ga0207651_103233122 191
1550 3300025960 Ga0207651_10522087 Ga0207651_105220872 191
1551 3300025972 Ga0207668_10048418 Ga0207668_100484184 191
1552 3300025981 Ga0207640_10006255 Ga0207640_100062554 191
1553 3300025981 Ga0207640_10027602 Ga0207640_100276024 191
1554 3300025981 Ga0207640_10211871 Ga0207640_102118712 191
1555 3300025986 Ga0207658_10179572 Ga0207658_101795722 191
1556 3300026035 Ga0207703_10648776 Ga0207703_106487762 191
1557 3300026067 Ga0207678_10019676 Ga0207678_100196766 191
1558 3300026067 Ga0207678_10040548 Ga0207678_100405484 191
1559 3300026067 Ga0207678_10065451 Ga0207678_100654512 191
1560 3300026075 Ga0207708_10131899 Ga0207708_101318993 191
1561 3300026078 Ga0207702_10005063 Ga0207702_100050634 191
1562 3300026078 Ga0207702_10087015 Ga0207702_100870154 191
1563 3300026116 Ga0207674_10012636 Ga0207674_100126367 191
1564 3300026116 Ga0207674_10079818 Ga0207674_100798184 191
1565 3300026116 Ga0207674_10170117 Ga0207674_101701173 191
1566 3300026118 Ga0207675_100032434 Ga0207675_1000324344 191
1567 3300026118 Ga0207675_100481424 Ga0207675_1004814242 191
1568 3300026121 Ga0207683_10128046 Ga0207683_101280463 191
1569 3300026121 Ga0207683_10205720 Ga0207683_102057202 191
1570 3300026142 Ga0207698_10516516 Ga0207698_105165162 191
1571 3300027866 Ga0209813_10005815 Ga0209813_100058154 191
1572 3300028380 Ga0268265_10026744 Ga0268265_100267444 191
1573 3300028380 Ga0268265_10087074 Ga0268265_100870743 191
1574 3300028381 Ga0268264_10045122 Ga0268264_100451224 191
1575 3300028381 Ga0268264_10183974 Ga0268264_101839742 191
1576 3300028381 Ga0268264_10969594 Ga0268264_109695942 191
1577 3300028666 Ga0265336_10000371 Ga0265336_1000037112 191
1578 3300028794 Ga0307515_10001585 Ga0307515_1000158544 191
1579 3300028794 Ga0307515_10007261 Ga0307515_100072612 191
1580 3300028794 Ga0307515_10038449 Ga0307515_100384494 191
1581 3300028794 Ga0307515_10352315 Ga0307515_103523152 191
1582 3300029957 Ga0265324_10000673 Ga0265324_1000067318 191
1583 3300030521 Ga0307511_10075303 Ga0307511_100753034 191
1584 3300030522 Ga0307512_10118308 Ga0307512_101183083 191
1585 3300030736 Ga0316180_1046416 Ga0316180_10464161 191
1586 3300031251 Ga0265327_10005256 Ga0265327_100052566 191
1587 3300031251 Ga0265327_10085436 Ga0265327_100854363 191
1588 3300031456 Ga0307513_10044156 Ga0307513_100441569 191
1589 3300031456 Ga0307513_10338142 Ga0307513_103381421 191
1590 3300031507 Ga0307509_10284399 Ga0307509_102843992 191
1591 3300031548 Ga0307408_100124993 Ga0307408_1001249933 191
1592 3300031616 Ga0307508_10593071 Ga0307508_105930711 191
1593 3300031649 Ga0307514_10002935 Ga0307514_1000293512 191
1594 3300031730 Ga0307516_10026131 Ga0307516_100261314 191
1595 3300031730 Ga0307516_10107067 Ga0307516_101070672 191
1596 3300031838 Ga0307518_10007543 Ga0307518_100075434 191
1597 3300031911 Ga0307412_10041167 Ga0307412_100411674 191
1598 3300032002 Ga0307416_100537972 Ga0307416_1005379721 191
1599 3300035086 Ga0373934_0076377 Ga0373934_0076377_22_600 191
1600 3300035691 Ga0373931_0035690 Ga0373931_0035690_590_1168 191
1601 3300035692 Ga0373935_0344967 Ga0373935_0344967_78_656 191
1602 3300037312 Ga0395899_0005833 Ga0395899_0005833_8305_8886 191
1603 3300037312 Ga0395899_0043190 Ga0395899_0043190_800_1384 191
1604 3300037312 Ga0395899_0534785 Ga0395899_0534785_92_676 191
1605 3300037418 Ga0395900_0082284 Ga0395900_0082284_454_1038 191
1606 3300037418 Ga0395900_0195712 Ga0395900_0195712_112_693 191
1607 3300037418 Ga0395900_0222715 Ga0395900_0222715_992_1576 191
1608 3300037418 Ga0395900_0249092 Ga0395900_0249092_906_1490 191
1609 3300037466 Ga0395898_0405858 Ga0395898_0405858_151_729 191
1610 3300037466 Ga0395898_0502972 Ga0395898_0502972_225_809 191
1611 3300037471 Ga0395905_0000549 Ga0395905_0000549_50327_50902 191
1612 3300037471 Ga0395905_0011730 Ga0395905_0011730_6902_7483 191
1613 3300037471 Ga0395905_0092664 Ga0395905_0092664_680_1270 191
1614 3300037471 Ga0395905_0116486 Ga0395905_0116486_758_1336 191
1615 3300037471 Ga0395905_0674425 Ga0395905_0674425_264_842 191
1616 3300037471 Ga0395905_0834537 Ga0395905_0834537_215_793 191
1617 3300038443 Ga0395901_0020119 Ga0395901_0020119_5336_5914 191
1618 3300038443 Ga0395901_0164294 Ga0395901_0164294_989_1570 191
1619 3300038443 Ga0395901_0249274 Ga0395901_0249274_98_682 191
1620 3300039447 Ga0436361_0693112 Ga0436361_0693112_721_1320 191
1621 3300039447 Ga0436361_0823903 Ga0436361_0823903_17_601 191
1622 3300041404 Ga0439436_0009101 Ga0439436_0009101_1648_2244 191
1623 3300041404 Ga0439436_0019021 Ga0439436_0019021_700_1299 191
1624 3300041408 Ga0439453_0026306 Ga0439453_0026306_238_837 191
1625 3300041411 Ga0439466_0037197 Ga0439466_0037197_987_1583 191
1626 3300041411 Ga0439466_0041255 Ga0439466_0041255_637_1236 191
1627 3300041413 Ga0439465_0008385 Ga0439465_0008385_1920_2516 191
1628 3300041459 Ga0451800_0567230 Ga0451800_0567230_479_1069 191
1629 3300041498 Ga0451841_1292268 Ga0451841_1292268_243_821 191
1630 3300041997 Ga0439431_0027054 Ga0439431_0027054_562_1161 191
1631 3300041999 Ga0439433_0003667 Ga0439433_0003667_639_1235 191
1632 3300041999 Ga0439433_0011247 Ga0439433_0011247_728_1327 191
1633 3300042004 Ga0439445_0003170 Ga0439445_0003170_1708_2304 191
1634 3300042006 Ga0439432_005986 Ga0439432_005986_2989_3585 191
1635 3300042006 Ga0439432_012727 Ga0439432_012727_1173_1772 191
1636 3300042007 Ga0439449_0012119 Ga0439449_0012119_634_1233 191
1637 3300042010 Ga0439452_018636 Ga0439452_018636_546_1142 191
1638 3300042010 Ga0439452_096115 Ga0439452_096115_17_607 191
1639 3300042012 Ga0439455_0022845 Ga0439455_0022845_223_813 191
1640 3300042015 Ga0439462_0022089 Ga0439462_0022089_335_934 191
1641 3300042015 Ga0439462_0030982 Ga0439462_0030982_639_1235 191
1642 3300042131 Ga0450894_010086 Ga0450894_010086_290_889 191
1643 3300042133 Ga0450896_025987 Ga0450896_025987_125_724 191
1644 3300042435 Ga0439434_0015937 Ga0439434_0015937_346_942 191
1645 3300042439 Ga0439464_0085708 Ga0439464_0085708_310_888 191
1646 3300042876 Ga0451577_0110344 Ga0451577_0110344_833_1414 191
1647 3300044650 Ga0466986_0220048 Ga0466986_0220048_240_824 191
1648 3300044656 Ga0466969_0004224 Ga0466969_0004224_4483_5061 191
1649 3300044656 Ga0466969_0010294 Ga0466969_0010294_3604_4197 191
1650 3300044658 Ga0466972_0243723 Ga0466972_0243723_25_609 191
1651 3300044673 Ga0453683_0455521 Ga0453683_0455521_130_711 191
1652 3300044683 Ga0466965_0003067 Ga0466965_0003067_5940_6518 191
1653 3300044683 Ga0466965_0043592 Ga0466965_0043592_707_1288 191
1654 3300044683 Ga0466965_0110117 Ga0466965_0110117_138_737 191
1655 3300044684 Ga0466966_0007868 Ga0466966_0007868_4676_5254 191
1656 3300044684 Ga0466966_0038419 Ga0466966_0038419_124_705 191
1657 3300044693 Ga0466961_0027751 Ga0466961_0027751_2304_2882 191
1658 3300044693 Ga0466961_0117938 Ga0466961_0117938_800_1384 191
1659 3300044694 Ga0466963_0173665 Ga0466963_0173665_791_1369 191
1660 3300044694 Ga0466963_0386634 Ga0466963_0386634_188_772 191
1661 3300044706 Ga0466964_0003612 Ga0466964_0003612_4365_4943 191
1662 3300044706 Ga0466964_0047297 Ga0466964_0047297_878_1462 191
1663 3300044712 Ga0453684_0709781 Ga0453684_0709781_477_1058 191
1664 3300044719 Ga0466971_0033896 Ga0466971_0033896_950_1528 191
1665 3300044735 Ga0466968_0004267 Ga0466968_0004267_3565_4143 191
1666 3300044765 Ga0466970_0029673 Ga0466970_0029673_1358_1936 191
1667 3300044765 Ga0466970_0057746 Ga0466970_0057746_596_1183 191
1668 3300044765 Ga0466970_0088676 Ga0466970_0088676_295_879 191
1669 3300044842 Ga0466957_0021202 Ga0466957_0021202_2154_2732 191
1670 3300044842 Ga0466957_0087267 Ga0466957_0087267_287_871 191
1671 3300044901 Ga0466960_0077720 Ga0466960_0077720_879_1463 191
1672 3300044901 Ga0466960_0083009 Ga0466960_0083009_377_955 191
1673 3300044901 Ga0466960_0194226 Ga0466960_0194226_262_861 191
1674 3300045049 Ga0466959_0009161 Ga0466959_0009161_4650_5228 191
1675 3300045049 Ga0466959_0182683 Ga0466959_0182683_178_762 191
1676 3300045049 Ga0466959_0262515 Ga0466959_0262515_207_800 191
1677 3300045836 Ga0466958_0179680 Ga0466958_0179680_25_603 191
1678 3300046453 Ga0495627_019307 Ga0495627_019307_815_1417 191
1679 3300046454 Ga0495592_0600465 Ga0495592_0600465_63_641 191
1680 3300046457 Ga0495590_0027267 Ga0495590_0027267_1072_1650 191
1681 3300046462 Ga0495651_0134478 Ga0495651_0134478_1131_1709 191
1682 3300046475 Ga0495639_0020269 Ga0495639_0020269_685_1287 191
1683 3300046475 Ga0495639_0052119 Ga0495639_0052119_1249_1827 191
1684 3300046492 Ga0495585_0049603 Ga0495585_0049603_1015_1593 191
1685 3300046506 Ga0495583_0000517 Ga0495583_0000517_32666_33244 191
1686 3300046506 Ga0495583_0008959 Ga0495583_0008959_4590_5201 191
1687 3300046507 Ga0495606_0000600 Ga0495606_0000600_6099_6677 191
1688 3300046507 Ga0495606_0007181 Ga0495606_0007181_8101_8691 191
1689 3300046507 Ga0495606_0105627 Ga0495606_0105627_66_644 191
1690 3300046511 Ga0495608_0071597 Ga0495608_0071597_472_1050 191
1691 3300046515 Ga0495620_0022756 Ga0495620_0022756_1562_2164 191
1692 3300046528 Ga0495642_0058360 Ga0495642_0058360_888_1490 191
1693 3300046538 Ga0495609_0040613 Ga0495609_0040613_689_1291 191
1694 3300046539 Ga0495621_0043209 Ga0495621_0043209_619_1221 191
1695 3300046539 Ga0495621_0092780 Ga0495621_0092780_192_788 191
1696 3300046543 Ga0495645_0362271 Ga0495645_0362271_94_672 191
1697 3300046615 Ga0495656_0006613 Ga0495656_0006613_688_1284 191
1698 3300046660 Ga0495625_0080616 Ga0495625_0080616_885_1463 191
1699 3300046665 Ga0495661_0111174 Ga0495661_0111174_293_895 191
1700 3300046674 Ga0495588_0094967 Ga0495588_0094967_263_865 191
1701 3300046674 Ga0495588_0163270 Ga0495588_0163270_25_627 191
1702 3300046684 Ga0495669_0026297 Ga0495669_0026297_45_647 191
1703 3300046689 Ga0495613_0562952 Ga0495613_0562952_103_705 191
1704 3300046690 Ga0495624_0167474 Ga0495624_0167474_264_866 191
1705 3300046692 Ga0495671_0140572 Ga0495671_0140572_229_831 191
1706 3300046694 Ga0495649_0015778 Ga0495649_0015778_846_1424 191
1707 3300046810 Ga0495660_0023488 Ga0495660_0023488_946_1524 191
1708 3300046810 Ga0495660_0107202 Ga0495660_0107202_107_709 191
1709 3300047315 Ga0495581_0465350 Ga0495581_0465350_85_687 191
1710 3300047318 Ga0495636_0006088 Ga0495636_0006088_3371_3979 191
1711 3300047318 Ga0495636_0010674 Ga0495636_0010674_2720_3328 191
1712 3300047323 Ga0495683_0037766 Ga0495683_0037766_872_1450 191
1713 3300047445 Ga0495677_0054079 Ga0495677_0054079_462_1064 191
1714 3300047472 Ga0495686_0015423 Ga0495686_0015423_1046_1624 191
1715 3300048089 Ga0495614_0070213 Ga0495614_0070213_55_657 191
1716 3300048903 Ga0496100_0164102 Ga0496100_0164102_697_1299 191
1717 3300048903 Ga0496100_0516352 Ga0496100_0516352_84_662 191
1718 3300048904 Ga0496101_0109767 Ga0496101_0109767_411_1013 191
1719 3300048905 Ga0496102_0068828 Ga0496102_0068828_1835_2449 191
1720 3300048905 Ga0496102_0270088 Ga0496102_0270088_691_1299 191
1721 3300048905 Ga0496102_0278526 Ga0496102_0278526_91_693 191
1722 3300048905 Ga0496102_0286852 Ga0496102_0286852_878_1480 191
1723 3300048906 Ga0496103_0122155 Ga0496103_0122155_46_648 191
1724 3300048906 Ga0496103_0242996 Ga0496103_0242996_314_922 191
1725 3300048907 Ga0496104_0059129 Ga0496104_0059129_2390_2992 191
1726 3300048908 Ga0496105_0020511 Ga0496105_0020511_1047_1649 191
1727 3300048909 Ga0496106_0155177 Ga0496106_0155177_241_843 191
1728 3300048911 Ga0496108_0160368 Ga0496108_0160368_684_1286 191
1729 3300048911 Ga0496108_0207932 Ga0496108_0207932_703_1281 191
1730 3300048911 Ga0496108_0870928 Ga0496108_0870928_62_655 191
1731 3300048912 Ga0496109_0173333 Ga0496109_0173333_560_1162 191
1732 3300048912 Ga0496109_0260435 Ga0496109_0260435_908_1501 191
1733 3300048913 Ga0496110_0150324 Ga0496110_0150324_517_1119 191
1734 3300048914 Ga0496111_0098471 Ga0496111_0098471_862_1464 191
1735 3300048916 Ga0496113_0336667 Ga0496113_0336667_363_965 191
1736 3300048919 Ga0496116_0060810 Ga0496116_0060810_844_1446 191
1737 3300048920 Ga0496117_0051351 Ga0496117_0051351_707_1309 191
1738 3300048921 Ga0496118_0045578 Ga0496118_0045578_2091_2693 191
1739 3300048924 Ga0496121_0030997 Ga0496121_0030997_2899_3492 191
1740 3300048927 Ga0496124_0000604 Ga0496124_0000604_54331_54921 191
1741 3300048928 Ga0496125_0098800 Ga0496125_0098800_1232_1825 191
1742 3300048928 Ga0496125_0330565 Ga0496125_0330565_88_672 191
1743 3300049127 Ga0501306_003340 Ga0501306_003340_463_1056 191
1744 3300049127 Ga0501306_008033 Ga0501306_008033_369_959 191
1745 3300049127 Ga0501306_018161 Ga0501306_018161_332_916 191
1746 3300049128 Ga0501308_002408 Ga0501308_002408_689_1282 191
1747 3300049132 Ga0501343_013342 Ga0501343_013342_25_603 191
1748 3300049161 Ga0501305_006325 Ga0501305_006325_460_1053 191
1749 3300049161 Ga0501305_027490 Ga0501305_027490_39_632 191
1750 3300049459 Ga0495678_148806 Ga0495678_148806_136_738 191
1751 3300049528 Ga0501312_012905 Ga0501312_012905_435_1028 191
1752 3300049532 Ga0501316_007780 Ga0501316_007780_126_725 191
1753 3300049533 Ga0501317_043131 Ga0501317_043131_54_647 191
1754 3300049536 Ga0501320_003152 Ga0501320_003152_598_1176 191
1755 3300049537 Ga0501321_006970 Ga0501321_006970_11_601 191
1756 3300049537 Ga0501321_041318 Ga0501321_041318_32_610 191
1757 3300049539 Ga0501323_008445 Ga0501323_008445_240_851 191
1758 3300049541 Ga0501325_012169 Ga0501325_012169_170_763 191
1759 3300049547 Ga0501331_07737 Ga0501331_07737_18_611 191
1760 3300049551 Ga0501335_002254 Ga0501335_002254_162_737 191
1761 3300049551 Ga0501335_002270 Ga0501335_002270_929_1519 191
1762 3300049552 Ga0501336_001604 Ga0501336_001604_671_1261 191
1763 3300049662 Ga0501222_000123 Ga0501222_000123_15533_16147 191
1764 3300050489 nmdc:mga03683_12404_c1 nmdc:mga03683_12404_c1_642_1241 191
1765 3300050490 nmdc:mga03n38_8620_c1 nmdc:mga03n38_8620_c1_642_1241 191
1766 3300050491 nmdc:mga00v17_20356_c1 nmdc:mga00v17_20356_c1_1136_1735 191
1767 3300050492 nmdc:mga0yw44_130233_c1 nmdc:mga0yw44_130233_c1_703_1302 191
1768 3300050493 nmdc:mga0k408_195629_c1 nmdc:mga0k408_195629_c1_533_1111 191
1769 3300050493 nmdc:mga0k408_39362_c1 nmdc:mga0k408_39362_c1_731_1330 191
1770 3300050493 nmdc:mga0k408_8725_c2 nmdc:mga0k408_8725_c2_931_1509 191
1771 3300050493 nmdc:mga0k408_93324_c2 nmdc:mga0k408_93324_c2_344_943 191
1772 3300050496 nmdc:mga07m45_33254_c2 nmdc:mga07m45_33254_c2_382_984 191
1773 3300050496 nmdc:mga07m45_3600_c1 nmdc:mga07m45_3600_c1_4555_5154 191
1774 3300050496 nmdc:mga07m45_46653_c1 nmdc:mga07m45_46653_c1_11_610 191
1775 3300050496 nmdc:mga07m45_5926_c1 nmdc:mga07m45_5926_c1_4763_5341 191
1776 3300050496 nmdc:mga07m45_7669_c1 nmdc:mga07m45_7669_c1_3980_4573 191
1777 3300050507 nmdc:mga05p37_47362_c1 nmdc:mga05p37_47362_c1_4003_4581 191
1778 3300050516 nmdc:mga0sz30_7083_c1 nmdc:mga0sz30_7083_c1_2752_3351 191
1779 3300053079 Ga0500610_0025814 Ga0500610_0025814_713_1315 191
1780 3300053080 Ga0500635_0000036 Ga0500635_0000036_93336_93914 191
1781 3300053086 Ga0500578_0027920 Ga0500578_0027920_715_1314 191
1782 3300053111 Ga0500572_059958 Ga0500572_059958_90_668 191
1783 3300053117 Ga0500593_058228 Ga0500593_058228_321_923 191
1784 3300053121 Ga0500607_051342 Ga0500607_051342_788_1390 191
1785 3300053122 Ga0500608_015572 Ga0500608_015572_1966_2544 191
1786 3300053122 Ga0500608_024309 Ga0500608_024309_1995_2597 191
1787 3300053131 Ga0500652_037941 Ga0500652_037941_760_1338 191
1788 3300053136 Ga0500559_0021378 Ga0500559_0021378_1191_1769 191
1789 3300053138 Ga0500564_117766 Ga0500564_117766_421_999 191
1790 3300053147 Ga0500589_037940 Ga0500589_037940_243_821 191
1791 3300053158 Ga0500627_0098952 Ga0500627_0098952_275_877 191
1792 3300053177 Ga0500636_0057033 Ga0500636_0057033_709_1287 191
1793 3300055283 Ga0500661_011693 Ga0500661_011693_795_1373 191
1794 3300059477 Ga0587084_002143 Ga0587084_002143_245_841 191
1795 3300059477 Ga0587084_006452 Ga0587084_006452_692_1273 191
1796 3300059477 Ga0587084_017838 Ga0587084_017838_245_847 191
1797 3300059477 Ga0587084_026827 Ga0587084_026827_80_664 191
1798 3300059477 Ga0587084_026918 Ga0587084_026918_80_664 191
1799 3300059478 Ga0587093_001802 Ga0587093_001802_609_1190 191
1800 3300059478 Ga0587093_024341 Ga0587093_024341_174_770 191
1801 3300059490 Ga0587066_002048 Ga0587066_002048_624_1205 191
1802 3300059490 Ga0587066_057002 Ga0587066_057002_65_643 191
1803 3300059491 Ga0587070_009698 Ga0587070_009698_222_803 191
1804 3300059492 Ga0587073_0037085 Ga0587073_0037085_170_751 191
1805 3300059493 Ga0587077_008903 Ga0587077_008903_280_861 191
1806 3300059493 Ga0587077_009273 Ga0587077_009273_632_1213 191
1807 3300059493 Ga0587077_017635 Ga0587077_017635_197_778 191
1808 3300059503 Ga0587080_003728 Ga0587080_003728_726_1307 191
1809 3300059504 Ga0587082_000814 Ga0587082_000814_1512_2093 191
1810 3300059504 Ga0587082_019229 Ga0587082_019229_127_711 191
1811 3300059504 Ga0587082_029541 Ga0587082_029541_13_597 191
1812 3300059504 Ga0587082_056537 Ga0587082_056537_123_701 191
1813 3300059505 Ga0587083_0001894 Ga0587083_0001894_1635_2219 191
1814 3300059505 Ga0587083_0002412 Ga0587083_0002412_740_1324 191
1815 3300059505 Ga0587083_0005385 Ga0587083_0005385_835_1413 191
1816 3300059507 Ga0587086_003732 Ga0587086_003732_592_1173 191
1817 3300059508 Ga0587088_001458 Ga0587088_001458_1653_2234 191
1818 3300059508 Ga0587088_006876 Ga0587088_006876_363_947 191
1819 3300059508 Ga0587088_011197 Ga0587088_011197_271_855 191
1820 3300059508 Ga0587088_066917 Ga0587088_066917_61_663 191
1821 3300059510 Ga0587090_003488 Ga0587090_003488_797_1378 191
1822 3300059510 Ga0587090_005242 Ga0587090_005242_235_831 191
1823 3300059510 Ga0587090_007045 Ga0587090_007045_313_894 191
1824 3300059510 Ga0587090_010003 Ga0587090_010003_269_850 191
1825 3300059510 Ga0587090_013784 Ga0587090_013784_310_912 191
1826 3300059510 Ga0587090_075244 Ga0587090_075244_27_605 191
1827 3300059511 Ga0587091_012189 Ga0587091_012189_229_810 191
1828 3300059512 Ga0587092_008000 Ga0587092_008000_225_806 191
1829 3300059513 Ga0587094_002657 Ga0587094_002657_890_1471 191
1830 3300059513 Ga0587094_003513 Ga0587094_003513_594_1175 191
1831 3300059513 Ga0587094_023777 Ga0587094_023777_84_668 191
1832 3300059514 Ga0587095_000862 Ga0587095_000862_334_915 191
1833 3300059604 Ga0587098_002133 Ga0587098_002133_1005_1589 191
1834 3300059605 Ga0587106_011000 Ga0587106_011000_334_915 191
1835 3300059605 Ga0587106_033812 Ga0587106_033812_56_652 191
1836 3300059607 Ga0587125_006552 Ga0587125_006552_343_924 191
1837 3300059623 Ga0587101_000524 Ga0587101_000524_1468_2049 191
1838 3300059623 Ga0587101_001341 Ga0587101_001341_1268_1864 191
1839 3300059623 Ga0587101_002989 Ga0587101_002989_388_969 191
1840 3300059624 Ga0587109_043738 Ga0587109_043738_85_681 191
1841 3300059626 Ga0587115_011948 Ga0587115_011948_312_893 191
1842 3300059629 Ga0587127_007967 Ga0587127_007967_171_749 191
1843 3300059630 Ga0587128_012593 Ga0587128_012593_415_996 191
1844 3300059630 Ga0587128_044583 Ga0587128_044583_125_709 191
1845 3300059640 Ga0587067_029171 Ga0587067_029171_69_653 191
1846 3300059641 Ga0587068_006027 Ga0587068_006027_356_940 191
1847 3300059641 Ga0587068_012253 Ga0587068_012253_269_850 191
1848 3300059641 Ga0587068_015569 Ga0587068_015569_243_824 191
1849 3300059641 Ga0587068_020378 Ga0587068_020378_153_731 191
1850 3300059641 Ga0587068_026722 Ga0587068_026722_190_786 191
1851 3300059642 Ga0587069_000151 Ga0587069_000151_2229_2813 191
1852 3300059642 Ga0587069_000921 Ga0587069_000921_241_822 191
1853 3300059643 Ga0587072_000009 Ga0587072_000009_740_1324 191
1854 3300059643 Ga0587072_000838 Ga0587072_000838_2618_3220 191
1855 3300059643 Ga0587072_009593 Ga0587072_009593_486_1067 191
1856 3300059643 Ga0587072_018195 Ga0587072_018195_399_977 191
1857 3300059644 Ga0587075_002302 Ga0587075_002302_655_1236 191
1858 3300059644 Ga0587075_008983 Ga0587075_008983_303_887 191
1859 3300059645 Ga0587076_000445 Ga0587076_000445_1125_1709 191
1860 3300059645 Ga0587076_000769 Ga0587076_000769_637_1218 191
1861 3300059645 Ga0587076_002704 Ga0587076_002704_1195_1791 191
1862 3300059646 Ga0587078_001338 Ga0587078_001338_1127_1708 191
1863 3300059646 Ga0587078_023445 Ga0587078_023445_130_714 191
1864 3300059647 Ga0587079_000436 Ga0587079_000436_610_1191 191
1865 3300059647 Ga0587079_007421 Ga0587079_007421_951_1535 191
1866 3300059649 Ga0587102_001335 Ga0587102_001335_446_1027 191
1867 3300059652 Ga0587107_006816 Ga0587107_006816_347_928 191
1868 3300059658 Ga0587119_005176 Ga0587119_005176_554_1135 191
1869 3300060243 Ga0587060_004583 Ga0587060_004583_164_745 191
1870 3300060344 Ga0587071_000779 Ga0587071_000779_709_1290 191
1871 3300060344 Ga0587071_014546 Ga0587071_014546_20_598 191
1872 3300060344 Ga0587071_070421 Ga0587071_070421_134_718 191
1873 3300060346 Ga0587111_0006057 Ga0587111_0006057_580_1161 191
1874 3300060346 Ga0587111_0030168 Ga0587111_0030168_271_852 191
1875 3300060346 Ga0587111_0039444 Ga0587111_0039444_41_625 191
1876 3300060346 Ga0587111_0062722 Ga0587111_0062722_34_636 191
1877 3300061719 Ga0466962_0025912 Ga0466962_0025912_201_785 191
1878 3300061719 Ga0466962_0046866 Ga0466962_0046866_728_1306 191
1879 3300003161 Ga0006765J45826_105488 Ga0006765J45826_1054883 192
1880 3300003162 Ga0006778J45830_1013353 Ga0006778J45830_10133533 192
1881 3300003163 Ga0006759J45824_1008312 Ga0006759J45824_10083124 192
1882 3300003163 Ga0006759J45824_1008313 Ga0006759J45824_10083132 192
1883 3300003300 Ga0006758J48902_1003362 Ga0006758J48902_10033627 192
1884 3300003693 Ga0032354_1003507 Ga0032354_10035073 192
1885 3300003735 Ga0006780_1004575 Ga0006780_10045757 192
1886 3300006880 Ga0075429_100079292 Ga0075429_1000792927 192
1887 3300014326 Ga0157380_10347176 Ga0157380_103471762 192
1888 3300020076 Ga0206355_1517176 Ga0206355_15171761 192
1889 3300025940 Ga0207691_10148158 Ga0207691_101481583 192
1890 3300027378 Ga0209981_1001130 Ga0209981_10011305 192
1891 3300027876 Ga0209974_10006186 Ga0209974_100061866 192
1892 3300030731 Ga0316177_1138179 Ga0316177_11381791 192
1893 3300030735 Ga0316178_1018733 Ga0316178_10187332 192
1894 3300030736 Ga0316180_1160791 Ga0316180_11607913 192
1895 3300030742 Ga0316183_1020377 Ga0316183_10203771 192
1896 3300032002 Ga0307416_101425911 Ga0307416_1014259111 192
1897 3300035692 Ga0373935_0201381 Ga0373935_0201381_357_956 192
1898 3300037312 Ga0395899_0036811 Ga0395899_0036811_1612_2208 192
1899 3300037418 Ga0395900_0077379 Ga0395900_0077379_1870_2466 192
1900 3300038443 Ga0395901_0094399 Ga0395901_0094399_1623_2252 192
1901 3300041410 Ga0439461_0002207 Ga0439461_0002207_2466_3074 192
1902 3300041509 Ga0451843_0527458 Ga0451843_0527458_605_1219 192
1903 3300041512 Ga0451853_3868793 Ga0451853_3868793_285_878 192
1904 3300042001 Ga0439441_014564 Ga0439441_014564_114_713 192
1905 3300042007 Ga0439449_0006857 Ga0439449_0006857_2892_3491 192
1906 3300042008 Ga0439450_044086 Ga0439450_044086_250_852 192
1907 3300042010 Ga0439452_057352 Ga0439452_057352_62_664 192
1908 3300042011 Ga0439454_008468 Ga0439454_008468_345_947 192
1909 3300042116 Ga0450912_001598 Ga0450912_001598_164_763 192
1910 3300042127 Ga0450890_025210 Ga0450890_025210_119_721 192
1911 3300042134 Ga0450898_024266 Ga0450898_024266_30_629 192
1912 3300042157 Ga0439458_0008832 Ga0439458_0008832_863_1465 192
1913 3300042436 Ga0439435_0062028 Ga0439435_0062028_245_844 192
1914 3300042439 Ga0439464_0027002 Ga0439464_0027002_914_1516 192
1915 3300042532 Ga0450893_0007673 Ga0450893_0007673_558_1160 192
1916 3300044656 Ga0466969_0013172 Ga0466969_0013172_3335_3943 192
1917 3300044735 Ga0466968_0012025 Ga0466968_0012025_1963_2589 192
1918 3300045049 Ga0466959_0095798 Ga0466959_0095798_710_1318 192
1919 3300045051 Ga0451576_0269151 Ga0451576_0269151_472_1095 192
1920 3300046453 Ga0495627_034787 Ga0495627_034787_40_666 192
1921 3300046455 Ga0495603_0164238 Ga0495603_0164238_186_812 192
1922 3300046457 Ga0495590_0005309 Ga0495590_0005309_898_1524 192
1923 3300046457 Ga0495590_0018848 Ga0495590_0018848_932_1570 192
1924 3300046458 Ga0495591_008200 Ga0495591_008200_850_1488 192
1925 3300046460 Ga0495638_0000408 Ga0495638_0000408_51434_52060 192
1926 3300046463 Ga0495653_0277337 Ga0495653_0277337_278_901 192
1927 3300046472 Ga0495580_0008648 Ga0495580_0008648_5643_6266 192
1928 3300046473 Ga0495582_0013331 Ga0495582_0013331_734_1357 192
1929 3300046474 Ga0495605_0003232 Ga0495605_0003232_1948_2574 192
1930 3300046474 Ga0495605_0013696 Ga0495605_0013696_2971_3597 192
1931 3300046474 Ga0495605_0055870 Ga0495605_0055870_732_1358 192
1932 3300046491 Ga0495584_0060945 Ga0495584_0060945_683_1309 192
1933 3300046499 Ga0495594_0186729 Ga0495594_0186729_460_1086 192
1934 3300046500 Ga0495596_0040721 Ga0495596_0040721_457_1095 192
1935 3300046501 Ga0495607_0123713 Ga0495607_0123713_91_717 192
1936 3300046501 Ga0495607_0141517 Ga0495607_0141517_154_819 192
1937 3300046501 Ga0495607_0173352 Ga0495607_0173352_392_1015 192
1938 3300046501 Ga0495607_0220198 Ga0495607_0220198_165_791 192
1939 3300046506 Ga0495583_0000310 Ga0495583_0000310_75862_76488 192
1940 3300046507 Ga0495606_0019502 Ga0495606_0019502_3376_3987 192
1941 3300046512 Ga0495610_0018155 Ga0495610_0018155_739_1377 192
1942 3300046513 Ga0495616_0002539 Ga0495616_0002539_3960_4583 192
1943 3300046513 Ga0495616_0022828 Ga0495616_0022828_1795_2451 192
1944 3300046513 Ga0495616_0222708 Ga0495616_0222708_44_670 192
1945 3300046515 Ga0495620_0116613 Ga0495620_0116613_208_831 192
1946 3300046518 Ga0495631_0037577 Ga0495631_0037577_917_1555 192
1947 3300046518 Ga0495631_0103090 Ga0495631_0103090_65_691 192
1948 3300046520 Ga0495637_0001714 Ga0495637_0001714_878_1516 192
1949 3300046522 Ga0495643_0078750 Ga0495643_0078750_646_1269 192
1950 3300046522 Ga0495643_0085218 Ga0495643_0085218_565_1188 192
1951 3300046522 Ga0495643_0112654 Ga0495643_0112654_296_922 192
1952 3300046523 Ga0495644_0127721 Ga0495644_0127721_245_871 192
1953 3300046523 Ga0495644_0131545 Ga0495644_0131545_245_856 192
1954 3300046524 Ga0495648_0092684 Ga0495648_0092684_936_1547 192
1955 3300046524 Ga0495648_0147191 Ga0495648_0147191_451_1077 192
1956 3300046525 Ga0495663_0109352 Ga0495663_0109352_199_813 192
1957 3300046526 Ga0495666_0192854 Ga0495666_0192854_219_842 192
1958 3300046528 Ga0495642_0027378 Ga0495642_0027378_732_1358 192
1959 3300046528 Ga0495642_0061666 Ga0495642_0061666_649_1260 192
1960 3300046530 Ga0495654_0048413 Ga0495654_0048413_863_1441 192
1961 3300046530 Ga0495654_0056752 Ga0495654_0056752_894_1505 192
1962 3300046530 Ga0495654_0077712 Ga0495654_0077712_399_1025 192
1963 3300046531 Ga0495665_0046360 Ga0495665_0046360_936_1559 192
1964 3300046538 Ga0495609_0002112 Ga0495609_0002112_10804_11460 192
1965 3300046538 Ga0495609_0003741 Ga0495609_0003741_7160_7786 192
1966 3300046538 Ga0495609_0073530 Ga0495609_0073530_613_1236 192
1967 3300046538 Ga0495609_0191566 Ga0495609_0191566_81_707 192
1968 3300046542 Ga0495597_0014560 Ga0495597_0014560_24_653 192
1969 3300046542 Ga0495597_0086336 Ga0495597_0086336_430_1044 192
1970 3300046558 Ga0495633_0131615 Ga0495633_0131615_49_687 192
1971 3300046558 Ga0495633_0151867 Ga0495633_0151867_172_783 192
1972 3300046615 Ga0495656_0040111 Ga0495656_0040111_1207_1833 192
1973 3300046615 Ga0495656_0150503 Ga0495656_0150503_45_671 192
1974 3300046616 Ga0495668_0067174 Ga0495668_0067174_156_782 192
1975 3300046616 Ga0495668_0102990 Ga0495668_0102990_72_698 192
1976 3300046616 Ga0495668_0114897 Ga0495668_0114897_701_1315 192
1977 3300046642 Ga0495634_0019079 Ga0495634_0019079_3355_3978 192
1978 3300046648 Ga0495611_0051565 Ga0495611_0051565_1030_1653 192
1979 3300046648 Ga0495611_0066175 Ga0495611_0066175_711_1349 192
1980 3300046648 Ga0495611_0138205 Ga0495611_0138205_282_893 192
1981 3300046660 Ga0495625_0020104 Ga0495625_0020104_3822_4448 192
1982 3300046664 Ga0495659_0012672 Ga0495659_0012672_1208_1822 192
1983 3300046664 Ga0495659_0020773 Ga0495659_0020773_845_1456 192
1984 3300046665 Ga0495661_0037189 Ga0495661_0037189_2347_2973 192
1985 3300046665 Ga0495661_0058855 Ga0495661_0058855_459_1115 192
1986 3300046665 Ga0495661_0124105 Ga0495661_0124105_732_1358 192
1987 3300046679 Ga0495623_0068842 Ga0495623_0068842_652_1275 192
1988 3300046691 Ga0495670_0082751 Ga0495670_0082751_983_1609 192
1989 3300046692 Ga0495671_0049468 Ga0495671_0049468_743_1354 192
1990 3300046692 Ga0495671_0078583 Ga0495671_0078583_65_691 192
1991 3300046692 Ga0495671_0116767 Ga0495671_0116767_521_1147 192
1992 3300046694 Ga0495649_0014801 Ga0495649_0014801_730_1368 192
1993 3300046694 Ga0495649_0024341 Ga0495649_0024341_1184_1807 192
1994 3300046794 Ga0495589_0022141 Ga0495589_0022141_1853_2509 192
1995 3300046794 Ga0495589_0043731 Ga0495589_0043731_889_1515 192
1996 3300046794 Ga0495589_0085487 Ga0495589_0085487_711_1334 192
1997 3300046794 Ga0495589_0088958 Ga0495589_0088958_663_1301 192
1998 3300046809 Ga0495600_0075615 Ga0495600_0075615_616_1239 192
1999 3300046810 Ga0495660_0007171 Ga0495660_0007171_949_1560 192
2000 3300046810 Ga0495660_0016570 Ga0495660_0016570_245_871 192
2001 3300046810 Ga0495660_0138881 Ga0495660_0138881_454_1080 192
2002 3300047317 Ga0495604_0098589 Ga0495604_0098589_727_1350 192
2003 3300047318 Ga0495636_0007040 Ga0495636_0007040_713_1339 192
2004 3300047320 Ga0495672_0000201 Ga0495672_0000201_84040_84666 192
2005 3300047320 Ga0495672_0026706 Ga0495672_0026706_769_1380 192
2006 3300047320 Ga0495672_0059705 Ga0495672_0059705_777_1415 192
2007 3300047320 Ga0495672_0140037 Ga0495672_0140037_63_689 192
2008 3300047323 Ga0495683_0010512 Ga0495683_0010512_287_913 192
2009 3300047323 Ga0495683_0025191 Ga0495683_0025191_878_1516 192
2010 3300047443 Ga0495687_000370 Ga0495687_000370_713_1339 192
2011 3300047443 Ga0495687_007822 Ga0495687_007822_4859_5485 192
2012 3300047443 Ga0495687_014326 Ga0495687_014326_737_1393 192
2013 3300047443 Ga0495687_036882 Ga0495687_036882_824_1447 192
2014 3300047445 Ga0495677_0006314 Ga0495677_0006314_459_1115 192
2015 3300047445 Ga0495677_0032012 Ga0495677_0032012_576_1202 192
2016 3300047445 Ga0495677_0093603 Ga0495677_0093603_63_701 192
2017 3300047445 Ga0495677_0097213 Ga0495677_0097213_450_1073 192
2018 3300047446 Ga0495679_052553 Ga0495679_052553_171_797 192
2019 3300047447 Ga0495685_001143 Ga0495685_001143_140_766 192
2020 3300047447 Ga0495685_079777 Ga0495685_079777_269_892 192
2021 3300047472 Ga0495686_0035426 Ga0495686_0035426_371_994 192
2022 3300047472 Ga0495686_0041880 Ga0495686_0041880_824_1435 192
2023 3300047472 Ga0495686_0121709 Ga0495686_0121709_494_1105 192
2024 3300047472 Ga0495686_0203932 Ga0495686_0203932_322_948 192
2025 3300048091 Ga0495626_0032859 Ga0495626_0032859_971_1627 192
2026 3300048927 Ga0496124_0129517 Ga0496124_0129517_867_1493 192
2027 3300049130 Ga0501310_001072 Ga0501310_001072_987_1601 192
2028 3300049130 Ga0501310_011850 Ga0501310_011850_60_662 192
2029 3300049162 Ga0501307_012155 Ga0501307_012155_162_773 192
2030 3300049459 Ga0495678_006998 Ga0495678_006998_4153_4779 192
2031 3300049459 Ga0495678_027928 Ga0495678_027928_959_1597 192
2032 3300049459 Ga0495678_069294 Ga0495678_069294_135_761 192
2033 3300049460 Ga0495682_0080123 Ga0495682_0080123_11_634 192
2034 3300049527 Ga0501311_009998 Ga0501311_009998_310_909 192
2035 3300049531 Ga0501315_005372 Ga0501315_005372_524_1138 192
2036 3300049679 Ga0501249_011012 Ga0501249_011012_707_1321 192
2037 3300049742 Ga0501080_0035081 Ga0501080_0035081_822_1433 192
2038 3300049822 Ga0501035_0035964 Ga0501035_0035964_2406_3035 192
2039 3300050508 nmdc:mga09592_305885_c1 nmdc:mga09592_305885_c1_686_1288 192
2040 3300050509 nmdc:mga0qj67_153033_c1 nmdc:mga0qj67_153033_c1_426_1028 192
2041 3300059421 Ga0590071_080235 Ga0590071_080235_117_716 192
2042 3300059424 Ga0590075_028322 Ga0590075_028322_526_1125 192
2043 3300059424 Ga0590075_088345 Ga0590075_088345_145_744 192
2044 3300059478 Ga0587093_003356 Ga0587093_003356_904_1527 192
2045 3300059492 Ga0587073_0000405 Ga0587073_0000405_1952_2575 192
2046 3300059507 Ga0587086_000667 Ga0587086_000667_1173_1796 192
2047 3300059641 Ga0587068_006343 Ga0587068_006343_250_873 192
2048 3300059644 Ga0587075_006342 Ga0587075_006342_661_1284 192
2049 3300059649 Ga0587102_000673 Ga0587102_000673_200_823 192
2050 3300059652 Ga0587107_000129 Ga0587107_000129_494_1117 192
2051 3300060346 Ga0587111_0005555 Ga0587111_0005555_1092_1715 192
2052 3300061719 Ga0466962_0093965 Ga0466962_0093965_536_1144 192
2053 iso_pu_bacteria 2600255292 2601667098 192
2054 iso_pu_bacteria 2857547612 2857548994 192
2055 iso_pu_bacteria 2885080285 2885080588 192
2056 iso_pu_bacteria 2932410948 2932416620 192
2057 iso_pu_bacteria 2932416698 2932422364 192
2058 2162886007 SwRhRL2b_contig_787748 SwRhRL2b_0582.00005940 193
2059 3300001990 JGI24737J22298_10011277 JGI24737J22298_100112775 193
2060 3300002738 JGI25154J39366_1001113 JGI25154J39366_10011138 193
2061 3300002773 JGI25152J39213_1008855 JGI25152J39213_10088553 193
2062 3300002773 JGI25152J39213_1011126 JGI25152J39213_10111262 193
2063 3300002773 JGI25152J39213_1039625 JGI25152J39213_10396251 193
2064 3300002774 JGI25150J39212_1005229 JGI25150J39212_10052293 193
2065 3300002774 JGI25150J39212_1014310 JGI25150J39212_10143103 193
2066 3300002774 JGI25150J39212_1018303 JGI25150J39212_10183031 193
2067 3300002987 JGI25159J45721_1003731 JGI25159J45721_10037316 193
2068 3300002987 JGI25159J45721_1013430 JGI25159J45721_10134302 193
2069 3300003187 JGI25151J46595_10019549 JGI25151J46595_100195491 193
2070 3300003215 JGI25153J46596_10007546 JGI25153J46596_100075466 193
2071 3300003288 Ga0007428J48920_101816 Ga0007428J48920_1018163 193
2072 3300003323 rootH1_10071175 rootH1_100711753 193
2073 3300003354 JGI25160J50197_1010648 JGI25160J50197_10106485 193
2074 3300003354 JGI25160J50197_1016863 JGI25160J50197_10168634 193
2075 3300003374 JGI25161J50226_1008369 JGI25161J50226_10083691 193
2076 3300003374 JGI25161J50226_1015430 JGI25161J50226_10154301 193
2077 3300003544 Ga0007417J51691_1002081 Ga0007417J51691_10020814 193
2078 3300003544 Ga0007417J51691_1012480 Ga0007417J51691_10124803 193
2079 3300003559 Ga0007427J51700_104977 Ga0007427J51700_1049773 193
2080 3300003574 Ga0007410J51695_1002863 Ga0007410J51695_10028632 193
2081 3300003577 Ga0007416J51690_1005419 Ga0007416J51690_10054192 193
2082 3300003578 Ga0006562J51391_1010419 Ga0006562J51391_10104194 193
2083 3300003579 Ga0007429J51699_1009554 Ga0007429J51699_10095547 193
2084 3300003611 Ga0007411J51799_105765 Ga0007411J51799_1057653 193
2085 3300003613 Ga0007415J51800_105799 Ga0007415J51800_1057993 193
2086 3300003693 Ga0032354_1003508 Ga0032354_10035082 193
2087 3300003759 Ga0055525_1000147 Ga0055525_100014771 193
2088 3300003761 Ga0055535_1001280 Ga0055535_10012809 193
2089 3300003762 Ga0055542_1000965 Ga0055542_10009653 193
2090 3300003763 Ga0055529_1000375 Ga0055529_100037533 193
2091 3300003771 Ga0055526_1016495 Ga0055526_10164953 193
2092 3300003771 Ga0055526_1021258 Ga0055526_10212584 193
2093 3300003771 Ga0055526_1021298 Ga0055526_10212984 193
2094 3300003771 Ga0055526_1032408 Ga0055526_10324081 193
2095 3300003771 Ga0055526_1050126 Ga0055526_10501261 193
2096 3300003773 Ga0055537_1004461 Ga0055537_10044614 193
2097 3300003773 Ga0055537_1004555 Ga0055537_10045554 193
2098 3300003773 Ga0055537_1007354 Ga0055537_10073543 193
2099 3300003773 Ga0055537_1012735 Ga0055537_10127352 193
2100 3300003775 Ga0055524_1032548 Ga0055524_10325481 193
2101 3300003775 Ga0055524_1035570 Ga0055524_10355701 193
2102 3300003775 Ga0055524_1039973 Ga0055524_10399733 193
2103 3300003781 Ga0055536_1015419 Ga0055536_10154193 193
2104 3300003781 Ga0055536_1018706 Ga0055536_10187063 193
2105 3300003784 Ga0055534_1004800 Ga0055534_10048004 193
2106 3300003784 Ga0055534_1006810 Ga0055534_10068104 193
2107 3300003784 Ga0055534_1007786 Ga0055534_10077863 193
2108 3300003790 Ga0055528_1007975 Ga0055528_10079757 193
2109 3300003790 Ga0055528_1012187 Ga0055528_10121874 193
2110 3300003791 Ga0055530_10017613 Ga0055530_100176133 193
2111 3300003792 Ga0055540_1024669 Ga0055540_10246691 193
2112 3300003794 Ga0055531_10008751 Ga0055531_100087516 193
2113 3300003794 Ga0055531_10040055 Ga0055531_100400553 193
2114 3300004625 Ga0055543_1013180 Ga0055543_10131804 193
2115 3300005262 Ga0065165_1003318 Ga0065165_10033183 193
2116 3300005262 Ga0065165_1012211 Ga0065165_10122114 193
2117 3300005262 Ga0065165_1037975 Ga0065165_10379752 193
2118 3300005289 Ga0065704_10305018 Ga0065704_103050181 193
2119 3300005295 Ga0065707_10142183 Ga0065707_101421833 193
2120 3300005329 Ga0070683_100062099 Ga0070683_1000620992 193
2121 3300005334 Ga0068869_100160311 Ga0068869_1001603112 193
2122 3300005338 Ga0068868_100410448 Ga0068868_1004104482 193
2123 3300005356 Ga0070674_100317106 Ga0070674_1003171062 193
2124 3300005365 Ga0070688_100617168 Ga0070688_1006171681 193
2125 3300005366 Ga0070659_100315784 Ga0070659_1003157842 193
2126 3300005366 Ga0070659_100563182 Ga0070659_1005631821 193
2127 3300005455 Ga0070663_100324767 Ga0070663_1003247672 193
2128 3300005535 Ga0070684_100335993 Ga0070684_1003359933 193
2129 3300005539 Ga0068853_100254548 Ga0068853_1002545482 193
2130 3300005577 Ga0068857_100025716 Ga0068857_1000257166 193
2131 3300005577 Ga0068857_100274956 Ga0068857_1002749563 193
2132 3300005578 Ga0068854_100377989 Ga0068854_1003779893 193
2133 3300005614 Ga0068856_100087143 Ga0068856_1000871433 193
2134 3300005718 Ga0068866_10248192 Ga0068866_102481922 193
2135 3300005834 Ga0068851_10017555 Ga0068851_100175554 193
2136 3300005834 Ga0068851_10112534 Ga0068851_101125342 193
2137 3300006048 Ga0075363_100016273 Ga0075363_1000162735 193
2138 3300006177 Ga0075362_10066228 Ga0075362_100662284 193
2139 3300006177 Ga0075362_10179662 Ga0075362_101796621 193
2140 3300006186 Ga0075369_10019408 Ga0075369_100194084 193
2141 3300006195 Ga0075366_10121189 Ga0075366_101211891 193
2142 3300006237 Ga0097621_100018618 Ga0097621_1000186186 193
2143 3300006353 Ga0075370_10259042 Ga0075370_102590422 193
2144 3300006358 Ga0068871_100137146 Ga0068871_1001371464 193
2145 3300006881 Ga0068865_100044877 Ga0068865_1000448774 193
2146 3300006946 Ga0079104_1025741 Ga0079104_10257414 193
2147 3300006946 Ga0079104_1030065 Ga0079104_10300652 193
2148 3300006948 Ga0099826_10029122 Ga0099826_100291226 193
2149 3300009036 Ga0105244_10015476 Ga0105244_100154766 193
2150 3300009036 Ga0105244_10028299 Ga0105244_100282994 193
2151 3300009036 Ga0105244_10134277 Ga0105244_101342772 193
2152 3300009093 Ga0105240_10209527 Ga0105240_102095274 193
2153 3300009098 Ga0105245_10043502 Ga0105245_100435025 193
2154 3300009148 Ga0105243_10016441 Ga0105243_100164416 193
2155 3300009174 Ga0105241_10062554 Ga0105241_100625542 193
2156 3300009174 Ga0105241_10173179 Ga0105241_101731794 193
2157 3300009177 Ga0105248_10182225 Ga0105248_101822254 193
2158 3300009545 Ga0105237_10140721 Ga0105237_101407214 193
2159 3300009545 Ga0105237_10253389 Ga0105237_102533894 193
2160 3300009551 Ga0105238_10070225 Ga0105238_100702256 193
2161 3300009829 Ga0130086_1005042 Ga0130086_10050423 193
2162 3300009829 Ga0130086_1075241 Ga0130086_10752413 193
2163 3300009829 Ga0130086_1091490 Ga0130086_10914902 193
2164 3300009850 Ga0130085_1017480 Ga0130085_10174803 193
2165 3300009850 Ga0130085_1078041 Ga0130085_10780413 193
2166 3300009850 Ga0130085_1107450 Ga0130085_11074502 193
2167 3300012502 Ga0157347_1001133 Ga0157347_10011333 193
2168 3300012505 Ga0157339_1001144 Ga0157339_10011443 193
2169 3300013100 Ga0157373_10148144 Ga0157373_101481444 193
2170 3300013100 Ga0157373_10210267 Ga0157373_102102672 193
2171 3300013104 Ga0157370_10272082 Ga0157370_102720823 193
2172 3300013104 Ga0157370_10463365 Ga0157370_104633652 193
2173 3300013307 Ga0157372_10036644 Ga0157372_100366444 193
2174 3300013308 Ga0157375_10902937 Ga0157375_109029372 193
2175 3300014969 Ga0157376_10284121 Ga0157376_102841213 193
2176 3300015265 Ga0182005_1001566 Ga0182005_10015664 193
2177 3300015265 Ga0182005_1029495 Ga0182005_10294952 193
2178 3300017792 Ga0163161_10089105 Ga0163161_100891053 193
2179 3300020070 Ga0206356_10084425 Ga0206356_100844255 193
2180 3300020070 Ga0206356_11852297 Ga0206356_118522971 193
2181 3300020070 Ga0206356_11852813 Ga0206356_118528132 193
2182 3300020077 Ga0206351_10512755 Ga0206351_105127554 193
2183 3300020078 Ga0206352_11304994 Ga0206352_113049942 193
2184 3300020080 Ga0206350_10694065 Ga0206350_106940651 193
2185 3300020082 Ga0206353_10877119 Ga0206353_108771192 193
2186 3300021361 Ga0213872_10052983 Ga0213872_100529832 193
2187 3300021361 Ga0213872_10067471 Ga0213872_100674711 193
2188 3300022467 Ga0224712_10033458 Ga0224712_100334582 193
2189 3300025208 Ga0209436_101414 Ga0209436_1014147 193
2190 3300025208 Ga0209436_101521 Ga0209436_1015217 193
2191 3300025228 Ga0209672_108028 Ga0209672_1080282 193
2192 3300025229 Ga0209147_102542 Ga0209147_1025426 193
2193 3300025230 Ga0209563_100011 Ga0209563_100011649 193
2194 3300025242 Ga0209258_100793 Ga0209258_10079313 193
2195 3300025245 Ga0207425_1001042 Ga0207425_10010427 193
2196 3300025245 Ga0207425_1007941 Ga0207425_10079414 193
2197 3300025246 Ga0209646_1000246 Ga0209646_100024637 193
2198 3300025253 Ga0209677_111325 Ga0209677_1113253 193
2199 3300025254 Ga0209148_1000666 Ga0209148_100066625 193
2200 3300025258 Ga0209129_1001630 Ga0209129_10016304 193
2201 3300025258 Ga0209129_1009319 Ga0209129_10093193 193
2202 3300025258 Ga0209129_1013076 Ga0209129_10130762 193
2203 3300025263 Ga0209565_1002835 Ga0209565_10028356 193
2204 3300025263 Ga0209565_1003275 Ga0209565_10032756 193
2205 3300025263 Ga0209565_1006443 Ga0209565_10064434 193
2206 3300025263 Ga0209565_1010529 Ga0209565_10105293 193
2207 3300025263 Ga0209565_1026547 Ga0209565_10265472 193
2208 3300025272 Ga0209455_1000303 Ga0209455_100030334 193
2209 3300025273 Ga0209673_1000463 Ga0209673_10004634 193
2210 3300025273 Ga0209673_1003465 Ga0209673_10034657 193
2211 3300025273 Ga0209673_1004929 Ga0209673_10049294 193
2212 3300025273 Ga0209673_1005984 Ga0209673_10059846 193
2213 3300025273 Ga0209673_1020687 Ga0209673_10206873 193
2214 3300025273 Ga0209673_1036397 Ga0209673_10363972 193
2215 3300025284 Ga0209130_1002838 Ga0209130_10028387 193
2216 3300025284 Ga0209130_1003951 Ga0209130_10039514 193
2217 3300025284 Ga0209130_1014066 Ga0209130_10140663 193
2218 3300025284 Ga0209130_1044975 Ga0209130_10449752 193
2219 3300025291 Ga0209675_1000186 Ga0209675_10001864 193
2220 3300025291 Ga0209675_1002952 Ga0209675_10029524 193
2221 3300025291 Ga0209675_1004701 Ga0209675_10047014 193
2222 3300025291 Ga0209675_1009571 Ga0209675_10095714 193
2223 3300025291 Ga0209675_1044513 Ga0209675_10445131 193
2224 3300025292 Ga0209676_1001219 Ga0209676_100121922 193
2225 3300025292 Ga0209676_1011169 Ga0209676_10111694 193
2226 3300025294 Ga0209025_1001281 Ga0209025_100128117 193
2227 3300025294 Ga0209025_1014425 Ga0209025_10144256 193
2228 3300025295 Ga0209564_1000027 Ga0209564_1000027439 193
2229 3300025295 Ga0209564_1000230 Ga0209564_100023098 193
2230 3300025295 Ga0209564_1006926 Ga0209564_10069266 193
2231 3300025295 Ga0209564_1013777 Ga0209564_10137774 193
2232 3300025295 Ga0209564_1019927 Ga0209564_10199273 193
2233 3300025297 Ga0209758_1000295 Ga0209758_100029575 193
2234 3300025297 Ga0209758_1011259 Ga0209758_10112596 193
2235 3300025297 Ga0209758_1017275 Ga0209758_10172755 193
2236 3300025298 Ga0209050_1000052 Ga0209050_1000052300 193
2237 3300025298 Ga0209050_1000292 Ga0209050_100029279 193
2238 3300025298 Ga0209050_1023398 Ga0209050_10233983 193
2239 3300025298 Ga0209050_1041802 Ga0209050_10418023 193
2240 3300025298 Ga0209050_1048101 Ga0209050_10481012 193
2241 3300025299 Ga0209256_1004685 Ga0209256_10046857 193
2242 3300025299 Ga0209256_1006716 Ga0209256_10067164 193
2243 3300025299 Ga0209256_1012344 Ga0209256_10123444 193
2244 3300025299 Ga0209256_1027830 Ga0209256_10278304 193
2245 3300025299 Ga0209256_1046975 Ga0209256_10469752 193
2246 3300025302 Ga0207426_1002480 Ga0207426_10024808 193
2247 3300025302 Ga0207426_1005297 Ga0207426_10052976 193
2248 3300025303 Ga0209051_1003269 Ga0209051_10032696 193
2249 3300025303 Ga0209051_1003409 Ga0209051_10034097 193
2250 3300025303 Ga0209051_1021880 Ga0209051_10218803 193
2251 3300025303 Ga0209051_1036341 Ga0209051_10363414 193
2252 3300025304 Ga0209257_1000015 Ga0209257_1000015589 193
2253 3300025304 Ga0209257_1000295 Ga0209257_100029582 193
2254 3300025304 Ga0209257_1018291 Ga0209257_10182914 193
2255 3300025304 Ga0209257_1027519 Ga0209257_10275192 193
2256 3300025321 Ga0207656_10033689 Ga0207656_100336891 193
2257 3300025728 Ga0207655_1003094 Ga0207655_100309411 193
2258 3300025728 Ga0207655_1006903 Ga0207655_10069036 193
2259 3300025728 Ga0207655_1051288 Ga0207655_10512883 193
2260 3300025899 Ga0207642_10095766 Ga0207642_100957663 193
2261 3300025909 Ga0207705_10230320 Ga0207705_102303202 193
2262 3300025911 Ga0207654_10002179 Ga0207654_1000217910 193
2263 3300025911 Ga0207654_10216219 Ga0207654_102162192 193
2264 3300025913 Ga0207695_10401694 Ga0207695_104016943 193
2265 3300025913 Ga0207695_10769596 Ga0207695_107695961 193
2266 3300025913 Ga0207695_10891333 Ga0207695_108913332 193
2267 3300025914 Ga0207671_10014095 Ga0207671_100140952 193
2268 3300025917 Ga0207660_10067750 Ga0207660_100677504 193
2269 3300025924 Ga0207694_10295775 Ga0207694_102957753 193
2270 3300025926 Ga0207659_10736222 Ga0207659_107362221 193
2271 3300025927 Ga0207687_10025583 Ga0207687_100255832 193
2272 3300025932 Ga0207690_10207371 Ga0207690_102073712 193
2273 3300025933 Ga0207706_10313632 Ga0207706_103136324 193
2274 3300025935 Ga0207709_10032052 Ga0207709_100320522 193
2275 3300025935 Ga0207709_10055004 Ga0207709_100550044 193
2276 3300025935 Ga0207709_10267835 Ga0207709_102678352 193
2277 3300025938 Ga0207704_10095815 Ga0207704_100958152 193
2278 3300025940 Ga0207691_10316183 Ga0207691_103161831 193
2279 3300025942 Ga0207689_10012387 Ga0207689_100123876 193
2280 3300025942 Ga0207689_10550196 Ga0207689_105501962 193
2281 3300025949 Ga0207667_10143578 Ga0207667_101435783 193
2282 3300026023 Ga0207677_10017168 Ga0207677_100171684 193
2283 3300026067 Ga0207678_10127772 Ga0207678_101277723 193
2284 3300026078 Ga0207702_10365744 Ga0207702_103657442 193
2285 3300026095 Ga0207676_11091490 Ga0207676_110914901 193
2286 3300026116 Ga0207674_10021420 Ga0207674_100214206 193
2287 3300026116 Ga0207674_10170614 Ga0207674_101706143 193
2288 3300026142 Ga0207698_10191213 Ga0207698_101912132 193
2289 3300027111 Ga0209281_1008175 Ga0209281_10081753 193
2290 3300027111 Ga0209281_1020381 Ga0209281_10203812 193
2291 3300027666 Ga0209282_1017523 Ga0209282_10175236 193
2292 3300027907 Ga0207428_10254643 Ga0207428_102546432 193
2293 3300030731 Ga0316177_1221459 Ga0316177_12214592 193
2294 3300030732 Ga0316176_1055008 Ga0316176_10550084 193
2295 3300030733 Ga0314311_1059830 Ga0314311_10598306 193
2296 3300030734 Ga0316179_1105638 Ga0316179_11056384 193
2297 3300030735 Ga0316178_1002350 Ga0316178_10023503 193
2298 3300030742 Ga0316183_1084751 Ga0316183_10847514 193
2299 3300030744 Ga0316181_1106969 Ga0316181_11069695 193
2300 3300030744 Ga0316181_1150418 Ga0316181_11504183 193
2301 3300031548 Ga0307408_100144522 Ga0307408_1001445223 193
2302 3300031730 Ga0307516_10309306 Ga0307516_103093063 193
2303 3300031901 Ga0307406_10152032 Ga0307406_101520322 193
2304 3300031911 Ga0307412_10209891 Ga0307412_102098912 193
2305 3300031911 Ga0307412_10212367 Ga0307412_102123674 193
2306 3300031911 Ga0307412_10321911 Ga0307412_103219112 193
2307 3300031995 Ga0307409_100814027 Ga0307409_1008140272 193
2308 3300032002 Ga0307416_100004760 Ga0307416_1000047608 193
2309 3300032004 Ga0307414_10045630 Ga0307414_100456303 193
2310 3300032005 Ga0307411_10491575 Ga0307411_104915752 193
2311 3300037312 Ga0395899_0079269 Ga0395899_0079269_1663_2277 193
2312 3300037312 Ga0395899_0102269 Ga0395899_0102269_413_1033 193
2313 3300037418 Ga0395900_0048471 Ga0395900_0048471_3259_3858 193
2314 3300037418 Ga0395900_0280711 Ga0395900_0280711_324_944 193
2315 3300037418 Ga0395900_0379967 Ga0395900_0379967_522_1139 193
2316 3300037466 Ga0395898_0269024 Ga0395898_0269024_637_1257 193
2317 3300037471 Ga0395905_0025945 Ga0395905_0025945_3179_3784 193
2318 3300037471 Ga0395905_0039477 Ga0395905_0039477_211_816 193
2319 3300037471 Ga0395905_0147893 Ga0395905_0147893_299_907 193
2320 3300037471 Ga0395905_0731882 Ga0395905_0731882_75_695 193
2321 3300037471 Ga0395905_0744408 Ga0395905_0744408_17_631 193
2322 3300038443 Ga0395901_0229468 Ga0395901_0229468_646_1266 193
2323 3300039447 Ga0436361_0194409 Ga0436361_0194409_69_680 193
2324 3300039447 Ga0436361_0578689 Ga0436361_0578689_453_1067 193
2325 3300041453 Ga0451797_0384782 Ga0451797_0384782_31_636 193
2326 3300041498 Ga0451841_0487782 Ga0451841_0487782_163_801 193
2327 3300041512 Ga0451853_2414847 Ga0451853_2414847_792_1421 193
2328 3300041997 Ga0439431_0015350 Ga0439431_0015350_697_1308 193
2329 3300042002 Ga0439442_006923 Ga0439442_006923_859_1470 193
2330 3300042008 Ga0439450_013480 Ga0439450_013480_940_1554 193
2331 3300042008 Ga0439450_116590 Ga0439450_116590_44_643 193
2332 3300042121 Ga0450919_016079 Ga0450919_016079_224_826 193
2333 3300042131 Ga0450894_004773 Ga0450894_004773_216_827 193
2334 3300042134 Ga0450898_005842 Ga0450898_005842_604_1215 193
2335 3300042135 Ga0450899_009142 Ga0450899_009142_125_736 193
2336 3300042142 Ga0450905_024101 Ga0450905_024101_95_697 193
2337 3300042145 Ga0450906_003636 Ga0450906_003636_1770_2381 193
2338 3300042184 Ga0450908_006526 Ga0450908_006526_676_1287 193
2339 3300042185 Ga0450909_031408 Ga0450909_031408_136_747 193
2340 3300042435 Ga0439434_0023059 Ga0439434_0023059_861_1472 193
2341 3300042531 Ga0450918_001428 Ga0450918_001428_731_1342 193
2342 3300044656 Ga0466969_0168844 Ga0466969_0168844_29_643 193
2343 3300044673 Ga0453683_0009405 Ga0453683_0009405_771_1376 193
2344 3300044683 Ga0466965_0167409 Ga0466965_0167409_219_833 193
2345 3300044765 Ga0466970_0180119 Ga0466970_0180119_308_922 193
2346 3300045049 Ga0466959_0204553 Ga0466959_0204553_702_1316 193
2347 3300045051 Ga0451576_0130414 Ga0451576_0130414_1140_1745 193
2348 3300046452 Ga0495617_004204 Ga0495617_004204_3916_4533 193
2349 3300046453 Ga0495627_000182 Ga0495627_000182_1009_1623 193
2350 3300046453 Ga0495627_026656 Ga0495627_026656_636_1253 193
2351 3300046453 Ga0495627_036030 Ga0495627_036030_308_919 193
2352 3300046457 Ga0495590_0000020 Ga0495590_0000020_1411_2025 193
2353 3300046457 Ga0495590_0029266 Ga0495590_0029266_824_1438 193
2354 3300046459 Ga0495629_0146767 Ga0495629_0146767_760_1371 193
2355 3300046460 Ga0495638_0010010 Ga0495638_0010010_846_1475 193
2356 3300046463 Ga0495653_0025764 Ga0495653_0025764_3177_3788 193
2357 3300046471 Ga0495650_0017326 Ga0495650_0017326_748_1362 193
2358 3300046471 Ga0495650_0017995 Ga0495650_0017995_2187_2801 193
2359 3300046471 Ga0495650_0032252 Ga0495650_0032252_856_1470 193
2360 3300046471 Ga0495650_0058728 Ga0495650_0058728_216_845 193
2361 3300046471 Ga0495650_0076484 Ga0495650_0076484_216_845 193
2362 3300046472 Ga0495580_0245555 Ga0495580_0245555_67_678 193
2363 3300046474 Ga0495605_0003346 Ga0495605_0003346_7622_8236 193
2364 3300046474 Ga0495605_0171539 Ga0495605_0171539_102_713 193
2365 3300046491 Ga0495584_0020283 Ga0495584_0020283_443_1057 193
2366 3300046491 Ga0495584_0103631 Ga0495584_0103631_640_1251 193
2367 3300046492 Ga0495585_0047201 Ga0495585_0047201_274_891 193
2368 3300046492 Ga0495585_0124463 Ga0495585_0124463_640_1251 193
2369 3300046506 Ga0495583_0013755 Ga0495583_0013755_714_1343 193
2370 3300046506 Ga0495583_0039755 Ga0495583_0039755_931_1542 193
2371 3300046506 Ga0495583_0041060 Ga0495583_0041060_727_1341 193
2372 3300046506 Ga0495583_0059929 Ga0495583_0059929_1016_1627 193
2373 3300046507 Ga0495606_0013036 Ga0495606_0013036_5271_5885 193
2374 3300046507 Ga0495606_0109444 Ga0495606_0109444_804_1433 193
2375 3300046507 Ga0495606_0116974 Ga0495606_0116974_235_849 193
2376 3300046507 Ga0495606_0139596 Ga0495606_0139596_806_1417 193
2377 3300046507 Ga0495606_0149612 Ga0495606_0149612_709_1323 193
2378 3300046512 Ga0495610_0003877 Ga0495610_0003877_3651_4265 193
2379 3300046512 Ga0495610_0027750 Ga0495610_0027750_1667_2284 193
2380 3300046513 Ga0495616_0093754 Ga0495616_0093754_748_1374 193
2381 3300046513 Ga0495616_0117462 Ga0495616_0117462_156_767 193
2382 3300046519 Ga0495632_0115184 Ga0495632_0115184_447_1058 193
2383 3300046520 Ga0495637_0027010 Ga0495637_0027010_991_1620 193
2384 3300046522 Ga0495643_0010644 Ga0495643_0010644_3484_4098 193
2385 3300046522 Ga0495643_0032093 Ga0495643_0032093_725_1354 193
2386 3300046522 Ga0495643_0065304 Ga0495643_0065304_551_1165 193
2387 3300046524 Ga0495648_0034037 Ga0495648_0034037_1979_2608 193
2388 3300046524 Ga0495648_0042742 Ga0495648_0042742_714_1343 193
2389 3300046528 Ga0495642_0004349 Ga0495642_0004349_3205_3834 193
2390 3300046528 Ga0495642_0081958 Ga0495642_0081958_310_921 193
2391 3300046530 Ga0495654_0065073 Ga0495654_0065073_553_1179 193
2392 3300046530 Ga0495654_0082162 Ga0495654_0082162_682_1299 193
2393 3300046531 Ga0495665_0055908 Ga0495665_0055908_975_1586 193
2394 3300046535 Ga0495586_0034290 Ga0495586_0034290_1617_2228 193
2395 3300046536 Ga0495587_0015602 Ga0495587_0015602_854_1465 193
2396 3300046536 Ga0495587_0118398 Ga0495587_0118398_473_1087 193
2397 3300046537 Ga0495598_0236519 Ga0495598_0236519_10_621 193
2398 3300046538 Ga0495609_0005231 Ga0495609_0005231_735_1346 193
2399 3300046538 Ga0495609_0010454 Ga0495609_0010454_3032_3646 193
2400 3300046538 Ga0495609_0010718 Ga0495609_0010718_1953_2582 193
2401 3300046542 Ga0495597_0012910 Ga0495597_0012910_3116_3745 193
2402 3300046542 Ga0495597_0133841 Ga0495597_0133841_141_755 193
2403 3300046542 Ga0495597_0210207 Ga0495597_0210207_10_621 193
2404 3300046557 Ga0495622_0010681 Ga0495622_0010681_749_1378 193
2405 3300046557 Ga0495622_0075497 Ga0495622_0075497_686_1315 193
2406 3300046558 Ga0495633_0016754 Ga0495633_0016754_810_1424 193
2407 3300046558 Ga0495633_0035933 Ga0495633_0035933_266_895 193
2408 3300046558 Ga0495633_0055974 Ga0495633_0055974_266_895 193
2409 3300046558 Ga0495633_0148099 Ga0495633_0148099_172_798 193
2410 3300046559 Ga0495667_0076074 Ga0495667_0076074_736_1347 193
2411 3300046615 Ga0495656_0014634 Ga0495656_0014634_969_1562 193
2412 3300046615 Ga0495656_0183208 Ga0495656_0183208_171_782 193
2413 3300046616 Ga0495668_0007707 Ga0495668_0007707_941_1555 193
2414 3300046616 Ga0495668_0020876 Ga0495668_0020876_1959_2573 193
2415 3300046616 Ga0495668_0025580 Ga0495668_0025580_780_1379 193
2416 3300046616 Ga0495668_0353494 Ga0495668_0353494_140_754 193
2417 3300046660 Ga0495625_0021030 Ga0495625_0021030_873_1484 193
2418 3300046660 Ga0495625_0026926 Ga0495625_0026926_853_1464 193
2419 3300046660 Ga0495625_0078068 Ga0495625_0078068_1168_1797 193
2420 3300046660 Ga0495625_0134180 Ga0495625_0134180_571_1182 193
2421 3300046664 Ga0495659_0047516 Ga0495659_0047516_713_1324 193
2422 3300046665 Ga0495661_0018478 Ga0495661_0018478_2961_3572 193
2423 3300046665 Ga0495661_0077557 Ga0495661_0077557_416_1033 193
2424 3300046665 Ga0495661_0115856 Ga0495661_0115856_79_696 193
2425 3300046665 Ga0495661_0239824 Ga0495661_0239824_65_676 193
2426 3300046674 Ga0495588_0010876 Ga0495588_0010876_839_1453 193
2427 3300046674 Ga0495588_0098405 Ga0495588_0098405_272_865 193
2428 3300046674 Ga0495588_0126731 Ga0495588_0126731_218_829 193
2429 3300046678 Ga0495599_0184025 Ga0495599_0184025_482_1093 193
2430 3300046679 Ga0495623_0076509 Ga0495623_0076509_498_1109 193
2431 3300046684 Ga0495669_0021103 Ga0495669_0021103_790_1401 193
2432 3300046690 Ga0495624_0078632 Ga0495624_0078632_867_1478 193
2433 3300046691 Ga0495670_0036453 Ga0495670_0036453_1026_1637 193
2434 3300046691 Ga0495670_0046118 Ga0495670_0046118_748_1374 193
2435 3300046692 Ga0495671_0029072 Ga0495671_0029072_744_1361 193
2436 3300046692 Ga0495671_0102739 Ga0495671_0102739_721_1332 193
2437 3300046694 Ga0495649_0053355 Ga0495649_0053355_880_1491 193
2438 3300046694 Ga0495649_0208509 Ga0495649_0208509_68_709 193
2439 3300046694 Ga0495649_0325198 Ga0495649_0325198_62_676 193
2440 3300046810 Ga0495660_0030863 Ga0495660_0030863_1611_2222 193
2441 3300046810 Ga0495660_0054740 Ga0495660_0054740_247_864 193
2442 3300046810 Ga0495660_0091402 Ga0495660_0091402_271_900 193
2443 3300046810 Ga0495660_0091812 Ga0495660_0091812_810_1421 193
2444 3300047315 Ga0495581_0011795 Ga0495581_0011795_1053_1664 193
2445 3300047315 Ga0495581_0084029 Ga0495581_0084029_899_1510 193
2446 3300047317 Ga0495604_0145750 Ga0495604_0145750_579_1190 193
2447 3300047318 Ga0495636_0022781 Ga0495636_0022781_704_1315 193
2448 3300047318 Ga0495636_0029313 Ga0495636_0029313_1535_2128 193
2449 3300047320 Ga0495672_0019097 Ga0495672_0019097_3172_3786 193
2450 3300047321 Ga0495676_0173448 Ga0495676_0173448_827_1438 193
2451 3300047322 Ga0495680_0081403 Ga0495680_0081403_938_1549 193
2452 3300047323 Ga0495683_0121251 Ga0495683_0121251_464_1075 193
2453 3300047443 Ga0495687_024856 Ga0495687_024856_1396_2010 193
2454 3300047443 Ga0495687_033356 Ga0495687_033356_266_880 193
2455 3300047444 Ga0495675_0197261 Ga0495675_0197261_398_1009 193
2456 3300047445 Ga0495677_0006510 Ga0495677_0006510_3122_3733 193
2457 3300047445 Ga0495677_0035730 Ga0495677_0035730_759_1352 193
2458 3300047447 Ga0495685_001797 Ga0495685_001797_244_855 193
2459 3300047447 Ga0495685_009001 Ga0495685_009001_2426_3019 193
2460 3300047469 Ga0495673_0000185 Ga0495673_0000185_7503_8120 193
2461 3300047470 Ga0495681_0018699 Ga0495681_0018699_1081_1692 193
2462 3300047470 Ga0495681_0041651 Ga0495681_0041651_1079_1690 193
2463 3300047470 Ga0495681_0087972 Ga0495681_0087972_37_651 193
2464 3300047472 Ga0495686_0005000 Ga0495686_0005000_9234_9833 193
2465 3300047472 Ga0495686_0116547 Ga0495686_0116547_672_1286 193
2466 3300047472 Ga0495686_0199994 Ga0495686_0199994_294_911 193
2467 3300047673 Ga0495593_0012462 Ga0495593_0012462_1067_1678 193
2468 3300048088 Ga0495602_0058801 Ga0495602_0058801_1142_1753 193
2469 3300048088 Ga0495602_0188916 Ga0495602_0188916_155_769 193
2470 3300048090 Ga0495615_0020588 Ga0495615_0020588_231_860 193
2471 3300048091 Ga0495626_0010744 Ga0495626_0010744_2041_2682 193
2472 3300048091 Ga0495626_0016437 Ga0495626_0016437_920_1534 193
2473 3300048903 Ga0496100_0018888 Ga0496100_0018888_3117_3728 193
2474 3300048904 Ga0496101_0100256 Ga0496101_0100256_873_1484 193
2475 3300048904 Ga0496101_0777941 Ga0496101_0777941_23_622 193
2476 3300048905 Ga0496102_0137406 Ga0496102_0137406_805_1422 193
2477 3300048905 Ga0496102_0250326 Ga0496102_0250326_938_1555 193
2478 3300048906 Ga0496103_0091802 Ga0496103_0091802_1051_1665 193
2479 3300048908 Ga0496105_0310352 Ga0496105_0310352_424_1038 193
2480 3300048910 Ga0496107_0248001 Ga0496107_0248001_669_1283 193
2481 3300048912 Ga0496109_0186739 Ga0496109_0186739_130_744 193
2482 3300048912 Ga0496109_0983364 Ga0496109_0983364_129_743 193
2483 3300048913 Ga0496110_0429986 Ga0496110_0429986_25_639 193
2484 3300048914 Ga0496111_0091872 Ga0496111_0091872_538_1152 193
2485 3300048915 Ga0496112_0306153 Ga0496112_0306153_433_1050 193
2486 3300048916 Ga0496113_0099847 Ga0496113_0099847_1423_2034 193
2487 3300048925 Ga0496122_0077023 Ga0496122_0077023_964_1575 193
2488 3300048925 Ga0496122_0194708 Ga0496122_0194708_154_771 193
2489 3300048925 Ga0496122_0373062 Ga0496122_0373062_19_633 193
2490 3300048926 Ga0496123_0031651 Ga0496123_0031651_1623_2234 193
2491 3300048926 Ga0496123_0123849 Ga0496123_0123849_642_1256 193
2492 3300048927 Ga0496124_0049152 Ga0496124_0049152_709_1320 193
2493 3300048927 Ga0496124_0150483 Ga0496124_0150483_729_1343 193
2494 3300048927 Ga0496124_0215418 Ga0496124_0215418_649_1263 193
2495 3300048928 Ga0496125_0060592 Ga0496125_0060592_1496_2107 193
2496 3300048928 Ga0496125_0063503 Ga0496125_0063503_1590_2207 193
2497 3300048928 Ga0496125_0272797 Ga0496125_0272797_414_1028 193
2498 3300048929 Ga0496126_0031527 Ga0496126_0031527_3864_4481 193
2499 3300049127 Ga0501306_000150 Ga0501306_000150_669_1262 193
2500 3300049127 Ga0501306_000253 Ga0501306_000253_635_1246 193
2501 3300049127 Ga0501306_004287 Ga0501306_004287_218_829 193
2502 3300049128 Ga0501308_000175 Ga0501308_000175_2737_3351 193
2503 3300049128 Ga0501308_000982 Ga0501308_000982_1206_1811 193
2504 3300049128 Ga0501308_003892 Ga0501308_003892_334_945 193
2505 3300049128 Ga0501308_006963 Ga0501308_006963_461_1063 193
2506 3300049129 Ga0501309_004241 Ga0501309_004241_629_1240 193
2507 3300049129 Ga0501309_014170 Ga0501309_014170_430_1023 193
2508 3300049129 Ga0501309_025359 Ga0501309_025359_28_648 193
2509 3300049130 Ga0501310_000687 Ga0501310_000687_543_1154 193
2510 3300049130 Ga0501310_007030 Ga0501310_007030_341_961 193
2511 3300049132 Ga0501343_000533 Ga0501343_000533_728_1342 193
2512 3300049160 Ga0501304_000078 Ga0501304_000078_2619_3233 193
2513 3300049160 Ga0501304_001138 Ga0501304_001138_451_1071 193
2514 3300049161 Ga0501305_005503 Ga0501305_005503_680_1288 193
2515 3300049161 Ga0501305_009970 Ga0501305_009970_63_656 193
2516 3300049162 Ga0501307_002498 Ga0501307_002498_613_1212 193
2517 3300049459 Ga0495678_003816 Ga0495678_003816_925_1539 193
2518 3300049459 Ga0495678_059401 Ga0495678_059401_314_928 193
2519 3300049527 Ga0501311_000165 Ga0501311_000165_2659_3258 193
2520 3300049529 Ga0501313_000756 Ga0501313_000756_732_1343 193
2521 3300049529 Ga0501313_001122 Ga0501313_001122_499_1092 193
2522 3300049531 Ga0501315_000244 Ga0501315_000244_2134_2745 193
2523 3300049531 Ga0501315_000556 Ga0501315_000556_1531_2130 193
2524 3300049531 Ga0501315_002286 Ga0501315_002286_351_962 193
2525 3300049531 Ga0501315_003217 Ga0501315_003217_541_1158 193
2526 3300049531 Ga0501315_003289 Ga0501315_003289_474_1067 193
2527 3300049532 Ga0501316_000848 Ga0501316_000848_732_1343 193
2528 3300049532 Ga0501316_006293 Ga0501316_006293_431_1048 193
2529 3300049533 Ga0501317_001775 Ga0501317_001775_920_1531 193
2530 3300049533 Ga0501317_018559 Ga0501317_018559_14_625 193
2531 3300049535 Ga0501319_001774 Ga0501319_001774_428_1039 193
2532 3300049537 Ga0501321_011853 Ga0501321_011853_335_940 193
2533 3300049539 Ga0501323_007809 Ga0501323_007809_257_868 193
2534 3300049540 Ga0501324_004453 Ga0501324_004453_291_902 193
2535 3300049542 Ga0501326_05350 Ga0501326_05350_19_618 193
2536 3300049553 Ga0501337_003827 Ga0501337_003827_185_796 193
2537 3300049568 Ga0501031_0021734 Ga0501031_0021734_642_1241 193
2538 3300049569 Ga0501032_0447997 Ga0501032_0447997_174_779 193
2539 3300049665 Ga0501227_001669 Ga0501227_001669_2766_3359 193
2540 3300049679 Ga0501249_019775 Ga0501249_019775_412_1023 193
2541 3300049705 Ga0501225_0010979 Ga0501225_0010979_1486_2097 193
2542 3300049707 Ga0501234_014155 Ga0501234_014155_576_1175 193
2543 3300049759 Ga0501262_003431 Ga0501262_003431_767_1378 193
2544 3300049766 Ga0501269_015818 Ga0501269_015818_21_641 193
2545 3300049775 Ga0501279_003775 Ga0501279_003775_442_1035 193
2546 3300049775 Ga0501279_017957 Ga0501279_017957_47_646 193
2547 3300049775 Ga0501279_032048 Ga0501279_032048_151_762 193
2548 3300050490 nmdc:mga03n38_79853_c1 nmdc:mga03n38_79853_c1_204_833 193
2549 3300050493 nmdc:mga0k408_169869_c1 nmdc:mga0k408_169869_c1_603_1211 193
2550 3300050496 nmdc:mga07m45_92366_c1 nmdc:mga07m45_92366_c1_284_895 193
2551 3300050496 nmdc:mga07m45_95626_c1 nmdc:mga07m45_95626_c1_898_1512 193
2552 3300050516 nmdc:mga0sz30_76932_c1 nmdc:mga0sz30_76932_c1_594_1205 193
2553 3300053111 Ga0500572_018555 Ga0500572_018555_247_858 193
2554 3300053125 Ga0500618_004294 Ga0500618_004294_3291_3905 193
2555 3300053136 Ga0500559_0112531 Ga0500559_0112531_558_1172 193
2556 3300053136 Ga0500559_0141278 Ga0500559_0141278_273_884 193
2557 3300053735 Ga0500596_010257 Ga0500596_010257_614_1225 193
2558 3300059504 Ga0587082_006811 Ga0587082_006811_511_1128 193
2559 3300059506 Ga0587085_022289 Ga0587085_022289_199_813 193
2560 3300059510 Ga0587090_000276 Ga0587090_000276_2882_3496 193
2561 3300059511 Ga0587091_002980 Ga0587091_002980_929_1543 193
2562 3300059512 Ga0587092_005373 Ga0587092_005373_727_1341 193
2563 3300059513 Ga0587094_014220 Ga0587094_014220_294_908 193
2564 3300059514 Ga0587095_001423 Ga0587095_001423_200_814 193
2565 3300059605 Ga0587106_007244 Ga0587106_007244_561_1175 193
2566 3300059607 Ga0587125_000574 Ga0587125_000574_427_1041 193
2567 3300059623 Ga0587101_000225 Ga0587101_000225_2628_3242 193
2568 3300059625 Ga0587113_005868 Ga0587113_005868_58_672 193
2569 3300059630 Ga0587128_020264 Ga0587128_020264_346_960 193
2570 3300059630 Ga0587128_060363 Ga0587128_060363_80_685 193
2571 3300059639 Ga0587062_001796 Ga0587062_001796_889_1506 193
2572 3300059646 Ga0587078_006884 Ga0587078_006884_198_815 193
2573 3300059653 Ga0587108_000129 Ga0587108_000129_2276_2887 193
2574 3300059653 Ga0587108_000215 Ga0587108_000215_512_1126 193
2575 3300059654 Ga0587110_001895 Ga0587110_001895_727_1341 193
2576 3300059658 Ga0587119_001725 Ga0587119_001725_852_1469 193
2577 3300059659 Ga0587120_000930 Ga0587120_000930_731_1348 193
2578 3300060344 Ga0587071_005752 Ga0587071_005752_252_866 193
2579 iso_pu_bacteria 2547132374 2548501913 193
2580 iso_pu_bacteria 2643221570 2643866456 193
2581 iso_pu_bacteria 2643221596 2643991865 193
2582 iso_pu_bacteria 2643221652 2644293264 193
2583 iso_pu_bacteria 2643221717 2644647268 193
2584 iso_pu_bacteria 2842718218 2842722042 193
2585 iso_pu_bacteria 2932422444 2932426046 193
2586 iso_pu_bacteria 2974320154 2974321843 193
2587 iso_pu_bacteria 2990710928 2990714499 193
2588 2162886007 SwRhRL2b_contig_976277 SwRhRL2b_0969.00003870 194
2589 3300002704 JGI25155J39150_1000033 JGI25155J39150_100003390 194
2590 3300002705 JGI25156J39149_1000043 JGI25156J39149_100004390 194
2591 3300002738 JGI25154J39366_1000062 JGI25154J39366_10000624 194
2592 3300002739 JGI25158J39367_1002309 JGI25158J39367_10023093 194
2593 3300002741 JGI25157J39369_1000060 JGI25157J39369_100006090 194
2594 3300002773 JGI25152J39213_1016985 JGI25152J39213_10169853 194
2595 3300002774 JGI25150J39212_1008078 JGI25150J39212_10080781 194
2596 3300002774 JGI25150J39212_1033063 JGI25150J39212_10330631 194
2597 3300002987 JGI25159J45721_1008095 JGI25159J45721_10080954 194
2598 3300002987 JGI25159J45721_1008470 JGI25159J45721_10084704 194
2599 3300002987 JGI25159J45721_1018433 JGI25159J45721_10184331 194
2600 3300003187 JGI25151J46595_10060773 JGI25151J46595_100607731 194
2601 3300003215 JGI25153J46596_10042510 JGI25153J46596_100425103 194
2602 3300003354 JGI25160J50197_1013215 JGI25160J50197_10132154 194
2603 3300003374 JGI25161J50226_1001064 JGI25161J50226_10010647 194
2604 3300003374 JGI25161J50226_1009336 JGI25161J50226_10093361 194
2605 3300003771 Ga0055526_1013133 Ga0055526_10131332 194
2606 3300003771 Ga0055526_1033851 Ga0055526_10338511 194
2607 3300003773 Ga0055537_1006936 Ga0055537_10069363 194
2608 3300003773 Ga0055537_1014924 Ga0055537_10149243 194
2609 3300003773 Ga0055537_1024076 Ga0055537_10240761 194
2610 3300003775 Ga0055524_1004310 Ga0055524_10043106 194
2611 3300003775 Ga0055524_1034239 Ga0055524_10342391 194
2612 3300003781 Ga0055536_1014497 Ga0055536_10144973 194
2613 3300003781 Ga0055536_1037401 Ga0055536_10374012 194
2614 3300003784 Ga0055534_1007419 Ga0055534_10074192 194
2615 3300003784 Ga0055534_1015624 Ga0055534_10156243 194
2616 3300003790 Ga0055528_1003799 Ga0055528_10037996 194
2617 3300003790 Ga0055528_1028580 Ga0055528_10285804 194
2618 3300003791 Ga0055530_10014192 Ga0055530_100141923 194
2619 3300003792 Ga0055540_1002657 Ga0055540_10026573 194
2620 3300003794 Ga0055531_10013115 Ga0055531_100131152 194
2621 3300003794 Ga0055531_10039892 Ga0055531_100398923 194
2622 3300004625 Ga0055543_1006838 Ga0055543_10068383 194
2623 3300005262 Ga0065165_1017368 Ga0065165_10173683 194
2624 3300005288 Ga0065714_10013518 Ga0065714_100135186 194
2625 3300005289 Ga0065704_10083470 Ga0065704_100834704 194
2626 3300005339 Ga0070660_100310601 Ga0070660_1003106012 194
2627 3300005341 Ga0070691_10203478 Ga0070691_102034781 194
2628 3300005344 Ga0070661_100296955 Ga0070661_1002969552 194
2629 3300005435 Ga0070714_100707887 Ga0070714_1007078872 194
2630 3300005457 Ga0070662_100085953 Ga0070662_1000859533 194
2631 3300005458 Ga0070681_10349156 Ga0070681_103491562 194
2632 3300005467 Ga0070706_100979923 Ga0070706_1009799231 194
2633 3300005530 Ga0070679_100218727 Ga0070679_1002187274 194
2634 3300005530 Ga0070679_100864591 Ga0070679_1008645911 194
2635 3300005539 Ga0068853_100146388 Ga0068853_1001463883 194
2636 3300005539 Ga0068853_100148083 Ga0068853_1001480832 194
2637 3300005563 Ga0068855_100327924 Ga0068855_1003279242 194
2638 3300005577 Ga0068857_100544615 Ga0068857_1005446152 194
2639 3300005578 Ga0068854_100256449 Ga0068854_1002564493 194
2640 3300005614 Ga0068856_100397719 Ga0068856_1003977193 194
2641 3300006038 Ga0075365_10139156 Ga0075365_101391562 194
2642 3300006048 Ga0075363_100038090 Ga0075363_1000380903 194
2643 3300006051 Ga0075364_10039645 Ga0075364_100396454 194
2644 3300006058 Ga0075432_10046990 Ga0075432_100469902 194
2645 3300006177 Ga0075362_10054648 Ga0075362_100546482 194
2646 3300006177 Ga0075362_10058911 Ga0075362_100589112 194
2647 3300006195 Ga0075366_10039994 Ga0075366_100399944 194
2648 3300006353 Ga0075370_10105513 Ga0075370_101055133 194
2649 3300006353 Ga0075370_10196767 Ga0075370_101967672 194
2650 3300006946 Ga0079104_1000460 Ga0079104_100046029 194
2651 3300006948 Ga0099826_10034336 Ga0099826_100343365 194
2652 3300009036 Ga0105244_10278352 Ga0105244_102783521 194
2653 3300009092 Ga0105250_10000429 Ga0105250_100004294 194
2654 3300009093 Ga0105240_10084275 Ga0105240_100842754 194
2655 3300009148 Ga0105243_10007089 Ga0105243_100070894 194
2656 3300009174 Ga0105241_10349146 Ga0105241_103491462 194
2657 3300009176 Ga0105242_10011101 Ga0105242_100111014 194
2658 3300009551 Ga0105238_10472703 Ga0105238_104727032 194
2659 3300017792 Ga0163161_10188599 Ga0163161_101885994 194
2660 3300025206 Ga0209435_100041 Ga0209435_10004190 194
2661 3300025208 Ga0209436_110176 Ga0209436_1101762 194
2662 3300025208 Ga0209436_122652 Ga0209436_1226522 194
2663 3300025245 Ga0207425_1001095 Ga0207425_10010957 194
2664 3300025245 Ga0207425_1004830 Ga0207425_10048306 194
2665 3300025245 Ga0207425_1011687 Ga0207425_10116871 194
2666 3300025246 Ga0209646_1000144 Ga0209646_100014490 194
2667 3300025250 Ga0209026_1000159 Ga0209026_100015990 194
2668 3300025256 Ga0209759_1000001 Ga0209759_10000012619 194
2669 3300025258 Ga0209129_1000204 Ga0209129_100020449 194
2670 3300025258 Ga0209129_1014488 Ga0209129_10144882 194
2671 3300025263 Ga0209565_1006554 Ga0209565_10065544 194
2672 3300025263 Ga0209565_1008022 Ga0209565_10080223 194
2673 3300025273 Ga0209673_1000687 Ga0209673_10006874 194
2674 3300025273 Ga0209673_1013310 Ga0209673_10133104 194
2675 3300025284 Ga0209130_1000146 Ga0209130_10001464 194
2676 3300025284 Ga0209130_1003943 Ga0209130_10039434 194
2677 3300025291 Ga0209675_1000121 Ga0209675_10001214 194
2678 3300025291 Ga0209675_1009879 Ga0209675_10098794 194
2679 3300025292 Ga0209676_1000073 Ga0209676_1000073109 194
2680 3300025292 Ga0209676_1007865 Ga0209676_10078654 194
2681 3300025294 Ga0209025_1025048 Ga0209025_10250484 194
2682 3300025294 Ga0209025_1027439 Ga0209025_10274394 194
2683 3300025294 Ga0209025_1035567 Ga0209025_10355674 194
2684 3300025295 Ga0209564_1007105 Ga0209564_10071056 194
2685 3300025295 Ga0209564_1007309 Ga0209564_10073094 194
2686 3300025295 Ga0209564_1010601 Ga0209564_10106014 194
2687 3300025297 Ga0209758_1000442 Ga0209758_100044249 194
2688 3300025298 Ga0209050_1000008 Ga0209050_1000008954 194
2689 3300025298 Ga0209050_1038475 Ga0209050_10384752 194
2690 3300025299 Ga0209256_1000168 Ga0209256_10001684 194
2691 3300025299 Ga0209256_1006866 Ga0209256_10068666 194
2692 3300025302 Ga0207426_1002317 Ga0207426_10023174 194
2693 3300025302 Ga0207426_1005398 Ga0207426_10053984 194
2694 3300025302 Ga0207426_1010324 Ga0207426_10103244 194
2695 3300025303 Ga0209051_1000005 Ga0209051_1000005954 194
2696 3300025304 Ga0209257_1000031 Ga0209257_1000031544 194
2697 3300025304 Ga0209257_1019494 Ga0209257_10194943 194
2698 3300025304 Ga0209257_1042245 Ga0209257_10422452 194
2699 3300025711 Ga0207696_1001013 Ga0207696_100101311 194
2700 3300025912 Ga0207707_10238214 Ga0207707_102382142 194
2701 3300025913 Ga0207695_10266941 Ga0207695_102669412 194
2702 3300025921 Ga0207652_10037372 Ga0207652_100373725 194
2703 3300025921 Ga0207652_10215068 Ga0207652_102150682 194
2704 3300025922 Ga0207646_10100505 Ga0207646_101005053 194
2705 3300025929 Ga0207664_10209408 Ga0207664_102094082 194
2706 3300025934 Ga0207686_10006427 Ga0207686_100064276 194
2707 3300025935 Ga0207709_10000152 Ga0207709_1000015268 194
2708 3300025981 Ga0207640_10217641 Ga0207640_102176412 194
2709 3300026041 Ga0207639_10224461 Ga0207639_102244612 194
2710 3300026041 Ga0207639_10238048 Ga0207639_102380482 194
2711 3300026067 Ga0207678_10733358 Ga0207678_107333582 194
2712 3300026116 Ga0207674_10677146 Ga0207674_106771461 194
2713 3300027111 Ga0209281_1000072 Ga0209281_1000072110 194
2714 3300027666 Ga0209282_1174937 Ga0209282_11749372 194
2715 3300031238 Ga0265332_10002454 Ga0265332_100024546 194
2716 3300031456 Ga0307513_10009971 Ga0307513_100099714 194
2717 3300031711 Ga0265314_10092358 Ga0265314_100923584 194
2718 3300031711 Ga0265314_10139277 Ga0265314_101392772 194
2719 3300031712 Ga0265342_10109472 Ga0265342_101094724 194
2720 3300031712 Ga0265342_10260371 Ga0265342_102603711 194
2721 3300031901 Ga0307406_10091681 Ga0307406_100916812 194
2722 3300031911 Ga0307412_10234358 Ga0307412_102343582 194
2723 3300037312 Ga0395899_0130815 Ga0395899_0130815_618_1220 194
2724 3300037418 Ga0395900_0457632 Ga0395900_0457632_234_836 194
2725 3300037466 Ga0395898_0381914 Ga0395898_0381914_194_796 194
2726 3300037471 Ga0395905_0061348 Ga0395905_0061348_2345_2956 194
2727 3300037471 Ga0395905_0161262 Ga0395905_0161262_1252_1854 194
2728 3300037471 Ga0395905_1157047 Ga0395905_1157047_58_666 194
2729 3300038443 Ga0395901_0401420 Ga0395901_0401420_450_1052 194
2730 3300041404 Ga0439436_0076420 Ga0439436_0076420_38_646 194
2731 3300041451 Ga0451791_1902637 Ga0451791_1902637_630_1226 194
2732 3300042007 Ga0439449_0043711 Ga0439449_0043711_249_857 194
2733 3300042185 Ga0450909_000806 Ga0450909_000806_3293_3901 194
2734 3300042876 Ga0451577_0087342 Ga0451577_0087342_256_864 194
2735 3300042876 Ga0451577_0238610 Ga0451577_0238610_547_1131 194
2736 3300044712 Ga0453684_0407625 Ga0453684_0407625_140_724 194
2737 3300046506 Ga0495583_0063988 Ga0495583_0063988_824_1444 194
2738 3300046512 Ga0495610_0020302 Ga0495610_0020302_132_752 194
2739 3300046513 Ga0495616_0081991 Ga0495616_0081991_712_1332 194
2740 3300046518 Ga0495631_0000496 Ga0495631_0000496_5105_5725 194
2741 3300046530 Ga0495654_0028544 Ga0495654_0028544_1338_1958 194
2742 3300046660 Ga0495625_0038358 Ga0495625_0038358_713_1333 194
2743 3300047321 Ga0495676_0002384 Ga0495676_0002384_12026_12646 194
2744 3300047673 Ga0495593_0028076 Ga0495593_0028076_676_1296 194
2745 3300048089 Ga0495614_0008579 Ga0495614_0008579_710_1330 194
2746 3300048090 Ga0495615_0053480 Ga0495615_0053480_331_927 194
2747 3300048906 Ga0496103_0144502 Ga0496103_0144502_770_1393 194
2748 3300048921 Ga0496118_0074657 Ga0496118_0074657_736_1356 194
2749 3300048924 Ga0496121_0535728 Ga0496121_0535728_62_682 194
2750 3300048926 Ga0496123_0292735 Ga0496123_0292735_20_640 194
2751 3300048927 Ga0496124_0106187 Ga0496124_0106187_751_1383 194
2752 3300048927 Ga0496124_0189119 Ga0496124_0189119_155_775 194
2753 3300048928 Ga0496125_0064828 Ga0496125_0064828_2191_2811 194
2754 3300049161 Ga0501305_035234 Ga0501305_035234_154_765 194
2755 3300049528 Ga0501312_016062 Ga0501312_016062_55_687 194
2756 3300049541 Ga0501325_005150 Ga0501325_005150_239_832 194
2757 3300050489 nmdc:mga03683_188631_c1 nmdc:mga03683_188631_c1_97_717 194
2758 3300050490 nmdc:mga03n38_77480_c1 nmdc:mga03n38_77480_c1_388_1008 194
2759 3300050491 nmdc:mga00v17_20109_c1 nmdc:mga00v17_20109_c1_2254_2862 194
2760 3300050491 nmdc:mga00v17_99027_c1 nmdc:mga00v17_99027_c1_136_756 194
2761 3300050492 nmdc:mga0yw44_8441_c1 nmdc:mga0yw44_8441_c1_3116_3736 194
2762 3300050493 nmdc:mga0k408_114249_c1 nmdc:mga0k408_114249_c1_907_1527 194
2763 3300050496 nmdc:mga07m45_320498_c1 nmdc:mga07m45_320498_c1_143_751 194
2764 3300050496 nmdc:mga07m45_89556_c1 nmdc:mga07m45_89556_c1_388_996 194
2765 3300053087 Ga0500643_049944 Ga0500643_049944_227_847 194
2766 3300053088 Ga0500644_0041508 Ga0500644_0041508_226_834 194
2767 3300053093 Ga0500651_0010789 Ga0500651_0010789_4572_5192 194
2768 3300053094 Ga0500566_0172237 Ga0500566_0172237_314_922 194
2769 3300053096 Ga0500641_0147556 Ga0500641_0147556_340_936 194
2770 3300053110 Ga0500571_000048 Ga0500571_000048_30888_31508 194
2771 3300053117 Ga0500593_042744 Ga0500593_042744_717_1313 194
2772 3300053118 Ga0500594_0032955 Ga0500594_0032955_414_1034 194
2773 3300053120 Ga0500597_065205 Ga0500597_065205_281_901 194
2774 3300053129 Ga0500628_024876 Ga0500628_024876_604_1212 194
2775 3300053133 Ga0500655_004933 Ga0500655_004933_305_925 194
2776 3300053134 Ga0500658_0046712 Ga0500658_0046712_710_1330 194
2777 3300053139 Ga0500568_0033035 Ga0500568_0033035_712_1332 194
2778 3300053141 Ga0500574_009578 Ga0500574_009578_1053_1673 194
2779 3300053153 Ga0500616_0013250 Ga0500616_0013250_3464_4084 194
2780 3300053157 Ga0500624_018702 Ga0500624_018702_148_768 194
2781 3300053161 Ga0500634_0089893 Ga0500634_0089893_289_909 194
2782 3300053162 Ga0500638_077509 Ga0500638_077509_702_1322 194
2783 3300053730 Ga0500645_007257 Ga0500645_007257_526_1134 194
2784 3300053730 Ga0500645_010915 Ga0500645_010915_725_1333 194
2785 3300053734 Ga0500565_005793 Ga0500565_005793_217_837 194
2786 iso_pu_bacteria 2643221609 2644057303 194
2787 iso_pu_bacteria 2643221611 2644072600 194
2788 iso_pu_bacteria 2738543012 2739241567 194
2789 iso_pu_bacteria 2816332133 2816471129 194
2790 3300005289 Ga0065704_10343003 Ga0065704_103430032 195
2791 3300006058 Ga0075432_10037401 Ga0075432_100374014 195
2792 3300006195 Ga0075366_10004740 Ga0075366_100047404 195
2793 3300006353 Ga0075370_10099076 Ga0075370_100990762 195
2794 3300012512 Ga0157327_1003396 Ga0157327_10033962 195
2795 3300017792 Ga0163161_10469741 Ga0163161_104697412 195
2796 3300021361 Ga0213872_10036563 Ga0213872_100365634 195
2797 3300025949 Ga0207667_10809941 Ga0207667_108099412 195
2798 3300027907 Ga0207428_10207028 Ga0207428_102070284 195
2799 3300031456 Ga0307513_10493074 Ga0307513_104930741 195
2800 3300031901 Ga0307406_10743456 Ga0307406_107434562 195
2801 3300032004 Ga0307414_10006142 Ga0307414_100061426 195
2802 3300035691 Ga0373931_0404444 Ga0373931_0404444_160_747 195
2803 3300037312 Ga0395899_0073220 Ga0395899_0073220_652_1254 195
2804 3300037471 Ga0395905_0070304 Ga0395905_0070304_738_1340 195
2805 3300037471 Ga0395905_0357692 Ga0395905_0357692_481_1083 195
2806 3300038443 Ga0395901_0144737 Ga0395901_0144737_1416_2018 195
2807 3300039447 Ga0436361_0504201 Ga0436361_0504201_744_1331 195
2808 3300042115 Ga0450911_004827 Ga0450911_004827_680_1267 195
2809 3300044712 Ga0453684_0493594 Ga0453684_0493594_566_1156 195
2810 3300045049 Ga0466959_0280386 Ga0466959_0280386_134_757 195
2811 3300048905 Ga0496102_0896649 Ga0496102_0896649_61_681 195
2812 3300048924 Ga0496121_0108575 Ga0496121_0108575_852_1439 195
2813 3300048925 Ga0496122_0222994 Ga0496122_0222994_352_939 195
2814 3300048926 Ga0496123_0116785 Ga0496123_0116785_161_754 195
2815 3300048928 Ga0496125_0034664 Ga0496125_0034664_683_1270 195
2816 3300048928 Ga0496125_0106184 Ga0496125_0106184_593_1180 195
2817 3300048928 Ga0496125_0191114 Ga0496125_0191114_671_1258 195
2818 3300048928 Ga0496125_0429065 Ga0496125_0429065_119_712 195
2819 3300048929 Ga0496126_0138173 Ga0496126_0138173_531_1118 195
2820 3300049541 Ga0501325_005517 Ga0501325_005517_403_990 195
2821 3300049673 Ga0501240_002498 Ga0501240_002498_1261_1890 195
2822 3300053108 Ga0500562_036918 Ga0500562_036918_484_1071 195
2823 3300053117 Ga0500593_162039 Ga0500593_162039_240_827 195
2824 3300009036 Ga0105244_10039890 Ga0105244_100398904 196
2825 3300014497 Ga0182008_10004539 Ga0182008_100045396 196
2826 3300015261 Ga0182006_1000186 Ga0182006_10001864 196
2827 3300015262 Ga0182007_10000202 Ga0182007_100002024 196
2828 3300015265 Ga0182005_1001571 Ga0182005_10015714 196
2829 3300017792 Ga0163161_10238636 Ga0163161_102386364 196
2830 3300025254 Ga0209148_1000323 Ga0209148_100032349 196
2831 3300031548 Ga0307408_100081636 Ga0307408_1000816364 196
2832 3300032004 Ga0307414_10822634 Ga0307414_108226342 196
2833 3300046520 Ga0495637_0074308 Ga0495637_0074308_241_879 196
2834 3300046522 Ga0495643_0081093 Ga0495643_0081093_746_1378 196
2835 3300046558 Ga0495633_0027612 Ga0495633_0027612_650_1276 196
2836 3300046794 Ga0495589_0014565 Ga0495589_0014565_2412_3044 196
2837 3300046810 Ga0495660_0003674 Ga0495660_0003674_785_1417 196
2838 3300047320 Ga0495672_0078821 Ga0495672_0078821_860_1492 196
2839 3300047445 Ga0495677_0070385 Ga0495677_0070385_410_1042 196
2840 3300048091 Ga0495626_0003909 Ga0495626_0003909_746_1378 196
2841 3300048914 Ga0496111_0070346 Ga0496111_0070346_1249_1875 196
2842 3300048919 Ga0496116_0010680 Ga0496116_0010680_4709_5335 196
2843 3300048920 Ga0496117_0000005 Ga0496117_0000005_429961_430587 196
2844 3300048921 Ga0496118_0000022 Ga0496118_0000022_8016_8642 196
2845 3300048925 Ga0496122_0026262 Ga0496122_0026262_3094_3720 196
2846 3300048926 Ga0496123_0062474 Ga0496123_0062474_1072_1698 196
2847 3300048927 Ga0496124_0184640 Ga0496124_0184640_313_939 196
2848 3300048928 Ga0496125_0011999 Ga0496125_0011999_713_1339 196
2849 3300048929 Ga0496126_0256051 Ga0496126_0256051_343_969 196
2850 3300049460 Ga0495682_0022791 Ga0495682_0022791_1031_1657 196
2851 3300049573 Ga0501037_0347332 Ga0501037_0347332_179_769 196
2852 2162886007 SwRhRL2b_contig_2635680 SwRhRL2b_0839.00000250 197
2853 2162886007 SwRhRL2b_contig_93034 SwRhRL2b_0779.00003120 197
2854 3300005289 Ga0065704_10082542 Ga0065704_100825424 197
2855 3300027876 Ga0209974_10043408 Ga0209974_100434082 197
2856 3300031238 Ga0265332_10000018 Ga0265332_10000018115 197
2857 3300031548 Ga0307408_100048129 Ga0307408_1000481294 197
2858 3300031548 Ga0307408_100348986 Ga0307408_1003489863 197
2859 3300031711 Ga0265314_10000126 Ga0265314_10000126100 197
2860 3300031901 Ga0307406_10042504 Ga0307406_100425043 197
2861 3300032002 Ga0307416_100759428 Ga0307416_1007594281 197
2862 3300046542 Ga0495597_0000060 Ga0495597_0000060_89989_90582 197
2863 3300048925 Ga0496122_0059460 Ga0496122_0059460_1528_2124 197
2864 3300048928 Ga0496125_0057872 Ga0496125_0057872_980_1576 197
2865 3300048929 Ga0496126_0113605 Ga0496126_0113605_846_1442 197
2866 3300050491 nmdc:mga00v17_402023_c1 nmdc:mga00v17_402023_c1_74_667 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

19

124

0.95

PF00467

KOW

KOW motif

142

173

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvq-assembly1.cif.gz_G solution structure of nuse:nusg-ctd complex 0.9598 143 197
8exy-assembly1.cif.gz_G m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp 0.9265 24 128
6c6u-assembly1.cif.gz_N cryoem structure of e.coli rna polymerase elongation complex bound with nusg 0.9225 23 132
4ytl-assembly2.cif.gz_B structure of the kow2-kow3 domain of transcription elongation factor spt5. 0.9128 144 197
5xog-assembly1.cif.gz_W rna polymerase ii elongation complex bound with spt5 kow5 and elf1 0.899 146 194
ID Description Score Start End Superfamily
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9904 144 197 2.30.30.30
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9681 142 197 2.30.30.30
2kvqG00 Mainly Beta;Roll;SH3 type barrels.; 0.9598 143 197 2.30.30.30
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9517 142 197 2.30.30.30
af_P9WIU9_43_152_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.9454 24 128 3.30.70.940
ID Description Score Start End GO Terms
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 1.003 141 197 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A3R7WK22-F1-model_v4 deleted 1.002 144 197
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 0.9858 141 197 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A3R7WK22-F1-model_v4 deleted 0.9836 144 197
AF-A0A3D5CEE0-F1-model_v4 Transcription termination/antitermination protein NusG 0.9724 142 197 GO:0005829
GO:0006353
GO:0031564
GO:0032784

Feature Viewer

pLDDT pTM Quality
80.09 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map