F496456

General Info

Members Datasets Scaffolds Average Seq Length
2141 782 2055 177

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0026724|Ga0501073_0026724_994_1602
Length 196
Sequence MRPVAAASAAGERDDSEENVSRIGRAPIPLPDGVTVTIEGQNVSVAGPRGSLRHTVVEPIRVLQEDGVLRVERPTDRAPHRALHGLSRSLVANMVEGVSAGFERRLEIVGVGYRASMRGAALDLAVGYSHTVTIDPPEGITFEVPAPTQVVVRGIDKQAVGQMAARIRQVRPPEPYKGKGIRYAGEAVRRKVGKRA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
13 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
14 2643221640 Caulobacter sp. Root342 Isolate Unclassified
15 2643221642 Caulobacter sp. Root343 Isolate Unclassified
16 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
17 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
18 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
19 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
20 2643221692 Nocardia sp. Root136 Isolate Unclassified
21 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
22 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
23 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
24 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
25 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
26 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
27 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
28 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
29 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
30 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
31 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
32 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
33 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
34 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
35 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
36 2818991435 Caulobacter henricii 536 Isolate Unclassified
37 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
38 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
39 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
40 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
41 2849560528 Caulobacter zeae 410 Isolate Unclassified
42 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
43 2851153111 Caulobacter radicis 736 Isolate Unclassified
44 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
45 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
46 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
47 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
48 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
49 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
50 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
51 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
52 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
53 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
54 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
55 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
56 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
57 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
58 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
59 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
60 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
61 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
62 2928153084 Leifsonia sp. 563 Isolate Unclassified
63 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
64 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
65 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
66 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
67 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
68 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
69 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
70 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
71 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
72 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
73 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
74 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
75 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
76 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
77 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
78 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
79 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
80 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
81 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
82 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
83 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
84 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
85 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
86 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
87 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
88 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
89 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
90 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
91 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
92 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
93 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
94 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
95 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
96 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
98 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
99 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
100 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
101 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
103 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
104 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
105 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
106 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
107 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
110 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
113 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
114 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
115 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
116 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
117 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
118 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
119 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
120 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
121 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
122 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
123 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
124 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
125 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
126 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
127 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
128 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
129 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
130 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
131 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
132 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
133 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
134 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
135 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
139 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
140 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
141 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
142 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
143 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
144 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
145 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
146 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
147 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
148 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
149 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
150 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
151 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
152 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
153 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
154 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
155 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
156 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
157 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
158 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
159 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
160 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
161 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
162 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
163 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
164 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
165 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
166 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
167 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
168 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
169 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
170 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
171 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
172 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
173 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
174 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
175 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
176 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
177 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
178 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
179 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
180 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
181 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
182 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
183 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
185 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
186 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
187 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
188 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
189 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
190 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
191 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
192 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
193 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
194 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
195 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
196 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
197 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
198 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
199 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
200 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
201 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
202 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
203 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
204 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
205 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
206 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
207 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
208 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
209 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
210 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
211 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
212 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
213 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
214 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
215 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
216 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
217 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
218 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
219 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
220 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
221 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
222 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
223 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
224 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
225 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
226 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
227 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
228 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
229 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
230 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
231 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
232 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
233 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
234 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
235 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
236 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
237 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
238 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
239 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
240 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
241 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
242 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
243 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
244 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
245 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
246 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
247 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
248 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
249 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
250 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
252 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
253 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
254 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
255 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
256 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
257 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
258 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
259 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
260 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
261 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
265 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
269 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
343 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
347 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
348 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
349 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
350 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
351 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
352 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
353 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
354 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
355 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
356 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
357 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
358 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
360 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
361 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
362 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
363 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
364 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
365 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
366 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
367 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
368 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
369 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
370 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
371 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
372 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
373 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
374 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
375 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
376 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
377 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
378 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
379 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
380 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
381 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
382 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
383 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
384 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
385 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
386 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
387 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
388 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
389 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
391 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
396 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
397 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
398 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
399 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
400 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
401 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
402 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
403 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
404 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
405 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
406 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
407 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
408 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
409 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
410 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
411 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
412 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
413 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
414 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
415 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
416 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
417 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
418 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
419 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
420 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
421 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
422 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
423 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
424 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
425 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
426 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
427 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
428 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
429 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
430 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
431 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
432 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
433 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
434 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
435 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
436 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
437 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
438 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
439 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
440 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
441 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
442 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
443 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
444 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
445 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
446 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
447 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
448 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
449 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
450 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
451 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
452 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
453 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
454 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
455 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
456 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
457 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
458 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
459 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
460 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
461 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
462 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
463 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
464 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
465 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
466 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
467 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
468 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
469 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
470 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
471 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
472 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
473 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
474 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
475 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
476 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
477 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
478 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
479 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
480 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
481 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
482 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
483 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
484 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
485 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
486 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
487 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
488 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
489 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
490 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
491 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
492 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
493 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
494 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
495 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
496 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
497 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
498 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
499 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
500 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
501 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
502 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
503 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
504 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
505 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
506 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
507 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
508 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
509 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
510 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
511 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
512 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
513 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
514 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
515 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
516 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
517 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
518 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
519 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
520 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
521 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
522 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
523 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
524 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
525 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
526 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
527 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
528 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
529 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
530 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
531 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
532 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
533 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
534 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
535 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
536 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
537 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
538 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
539 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
540 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
541 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
542 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
543 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
544 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
545 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
546 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
547 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
548 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
549 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
550 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
551 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
552 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
553 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
554 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
555 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
556 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
557 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
558 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
559 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
560 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
561 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
562 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
563 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
564 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
565 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
566 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
567 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
568 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
569 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
570 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
571 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
572 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
573 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
574 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
575 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
576 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
577 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
578 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
579 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
580 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
581 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
582 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
583 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
584 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
585 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
586 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
587 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
588 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
589 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
590 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
591 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
592 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
593 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
594 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
595 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
596 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
597 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
598 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
599 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
600 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
601 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
602 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
603 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
604 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
605 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
616 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
634 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
638 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
639 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
640 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
641 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
642 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
649 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
650 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
651 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
652 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
653 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
654 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
655 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
656 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
657 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
658 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
659 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
660 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
661 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
662 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
663 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
664 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
665 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
666 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
669 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
670 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
671 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
672 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
673 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
674 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
675 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
676 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
677 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
678 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
679 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
680 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
681 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
682 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
683 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
684 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
685 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
686 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
687 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
688 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
689 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
690 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
691 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
692 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
693 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
694 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
695 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
696 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
697 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
698 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
699 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
700 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
701 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
702 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
703 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
704 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
705 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
706 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
707 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
708 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
709 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
710 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
711 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
712 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
713 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
714 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
715 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
716 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
717 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
718 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
719 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
720 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
721 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
722 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
723 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
724 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
725 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
726 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
727 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
728 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
729 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
730 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
731 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
733 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
735 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
736 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
737 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
738 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
739 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
740 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
741 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
742 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
743 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
744 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
745 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
746 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
747 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
748 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
749 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
750 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
751 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
752 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
753 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
754 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
755 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
756 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
757 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
758 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
759 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
760 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
761 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
762 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
763 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
764 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
765 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
766 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
767 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
768 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
769 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
770 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
771 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
772 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
773 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
774 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
775 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
776 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
779 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
780 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
781 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
782 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.55
Metatranscriptomes 9.43
Isolates 4.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 6.91
Nodule 0.05
Rhizoplane 5.7
Rhizosphere 81.32
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002100 3300000549 Bacteria 2834
2 JGI24749J21850_1006022 3300002076 Bacteria 1690
3 JGI24035J26624_1000912 3300002126 Bacteria 2802
4 JGI24033J26618_1000637 3300002155 Bacteria 3366
5 JGI24033J26618_1000726 3300002155 Unclassified 3157
6 JGI24742J22300_10018588 3300002244 Bacteria 1178
7 JGI24751J29686_10000650 3300002459 Bacteria 8778
8 JGI24751J29686_10016465 3300002459 Bacteria 1524
9 Ga0006759J45824_1017000 3300003163 Bacteria 1346
10 JGI25153J46596_10043753 3300003215 Bacteria 1353
11 Ga0006758J48902_1026514 3300003300 Bacteria 861
12 Ga0006777J48905_1063427 3300003308 Bacteria 1037
13 rootL2_10038024 3300003322 Bacteria 1870
14 Ga0006781J51513_1017202 3300003568 Bacteria 956
15 Ga0007409J51694_1099612 3300003575 Bacteria 920
16 Ga0007416J51690_1018963 3300003577 Bacteria 2541
17 Ga0006562J51391_1097499 3300003578 Bacteria 1790
18 Ga0007429J51699_1082617 3300003579 Bacteria 933
19 Ga0032354_1008702 3300003693 Bacteria 2398
20 Ga0032354_1059984 3300003693 Bacteria 693
21 Ga0006780_1011098 3300003735 Bacteria 808
22 Ga0055526_1009783 3300003771 Bacteria 4557
23 Ga0055537_1001243 3300003773 Bacteria 10661
24 Ga0055534_1014923 3300003784 Bacteria 1440
25 Ga0055528_1008934 3300003790 Bacteria 4234
26 Ga0055530_10006621 3300003791 Bacteria 5118
27 Ga0055531_10004281 3300003794 Bacteria 8764
28 Ga0055531_10016789 3300003794 Bacteria 3133
29 Ga0058859_10112101 3300004798 Bacteria 1932
30 Ga0058863_11894902 3300004799 Bacteria 732
31 Ga0058861_10162389 3300004800 Bacteria 944
32 Ga0058861_11930681 3300004800 Bacteria 689
33 Ga0058860_10083617 3300004801 Bacteria 2251
34 Ga0058860_12204180 3300004801 Bacteria 818
35 Ga0065165_1002762 3300005262 Bacteria 13954
36 Ga0065165_1027151 3300005262 Bacteria 1871
37 Ga0065714_10028292 3300005288 Bacteria 1002
38 Ga0065714_10039350 3300005288 Bacteria 945
39 Ga0070658_10067818 3300005327 Bacteria 2915
40 Ga0070658_10133044 3300005327 Bacteria 2073
41 Ga0070658_10343132 3300005327 Bacteria 1277
42 Ga0070658_10584380 3300005327 Bacteria 967
43 Ga0070683_100081513 3300005329 Bacteria 3029
44 Ga0070683_100323389 3300005329 Bacteria 1468
45 Ga0070690_100023918 3300005330 Bacteria 3753
46 Ga0070670_100000958 3300005331 Bacteria 22640
47 Ga0070670_100067478 3300005331 Bacteria 3069
48 Ga0070670_100770170 3300005331 Bacteria 868
49 Ga0070670_100879486 3300005331 Bacteria 812
50 Ga0070677_10043737 3300005333 Bacteria 1779
51 Ga0068869_100043595 3300005334 Bacteria 3223
52 Ga0068869_100144909 3300005334 Bacteria 1837
53 Ga0068869_100407447 3300005334 Bacteria 1119
54 Ga0070666_10143334 3300005335 Bacteria 1665
55 Ga0070666_10206799 3300005335 Bacteria 1382
56 Ga0070680_100006095 3300005336 Bacteria 9137
57 Ga0070680_100071832 3300005336 Bacteria 2844
58 Ga0068868_100039367 3300005338 Bacteria 3674
59 Ga0068868_100092225 3300005338 Bacteria 2441
60 Ga0068868_100314712 3300005338 Bacteria 1332
61 Ga0068868_100476488 3300005338 Bacteria 1089
62 Ga0070660_100146286 3300005339 Bacteria 1898
63 Ga0070689_100182830 3300005340 Bacteria 1704
64 Ga0070691_10009448 3300005341 Bacteria 4450
65 Ga0070691_10035939 3300005341 Bacteria 2334
66 Ga0070691_10040879 3300005341 Bacteria 2191
67 Ga0070691_10101956 3300005341 Bacteria 1426
68 Ga0070687_100205728 3300005343 Bacteria 1196
69 Ga0070661_100020772 3300005344 Bacteria 4684
70 Ga0070692_10141576 3300005345 Bacteria 1362
71 Ga0070668_100002473 3300005347 Bacteria 13591
72 Ga0070668_100005674 3300005347 Bacteria 9250
73 Ga0070668_100023377 3300005347 Bacteria 4674
74 Ga0070668_100049055 3300005347 Bacteria 3248
75 Ga0070668_100104434 3300005347 Bacteria 2249
76 Ga0070668_100104823 3300005347 Bacteria 2245
77 Ga0070668_100114247 3300005347 Bacteria 2151
78 Ga0070668_100128011 3300005347 Bacteria 2035
79 Ga0070669_100021730 3300005353 Bacteria 4587
80 Ga0070669_100273788 3300005353 Bacteria 1351
81 Ga0070675_100017277 3300005354 Bacteria 5731
82 Ga0070675_100019885 3300005354 Bacteria 5356
83 Ga0070675_100409703 3300005354 Bacteria 1210
84 Ga0070675_100761997 3300005354 Bacteria 884
85 Ga0070671_100004934 3300005355 Bacteria 10613
86 Ga0070671_100006755 3300005355 Bacteria 9181
87 Ga0070671_100049752 3300005355 Bacteria 3487
88 Ga0070671_100235904 3300005355 Bacteria 1552
89 Ga0070671_100539378 3300005355 Bacteria 1005
90 Ga0070674_100095404 3300005356 Bacteria 2156
91 Ga0070674_100109721 3300005356 Bacteria 2024
92 Ga0070673_100014103 3300005364 Bacteria 5552
93 Ga0070673_100714822 3300005364 Bacteria 921
94 Ga0070659_100022607 3300005366 Bacteria 4801
95 Ga0070659_100216613 3300005366 Bacteria 1579
96 Ga0070667_100006266 3300005367 Bacteria 9889
97 Ga0070667_100011523 3300005367 Bacteria 7311
98 Ga0070667_100013914 3300005367 Bacteria 6652
99 Ga0070667_100078188 3300005367 Bacteria 2826
100 Ga0070667_100081570 3300005367 Bacteria 2768
101 Ga0070667_100134831 3300005367 Bacteria 2158
102 Ga0070667_100357303 3300005367 Bacteria 1323
103 Ga0070703_10105878 3300005406 Bacteria 999
104 Ga0070714_100409185 3300005435 Bacteria 1284
105 Ga0070713_101714653 3300005436 Bacteria 610
106 Ga0070711_100078839 3300005439 Bacteria 2341
107 Ga0070705_100013049 3300005440 Bacteria 4240
108 Ga0070705_100037779 3300005440 Bacteria 2726
109 Ga0070705_100044587 3300005440 Bacteria 2548
110 Ga0070705_100174325 3300005440 Bacteria 1450
111 Ga0070705_100206927 3300005440 Bacteria 1349
112 Ga0070705_100304553 3300005440 Bacteria 1143
113 Ga0070700_100073217 3300005441 Bacteria 2192
114 Ga0070700_100202413 3300005441 Bacteria 1395
115 Ga0070700_100205068 3300005441 Bacteria 1387
116 Ga0070700_100241031 3300005441 Bacteria 1292
117 Ga0070700_100292977 3300005441 Bacteria 1185
118 Ga0070708_100006790 3300005445 Bacteria 9119
119 Ga0070708_100149394 3300005445 Bacteria 2172
120 Ga0070663_100201623 3300005455 Bacteria 1553
121 Ga0070678_100005141 3300005456 Bacteria 7516
122 Ga0070678_100087740 3300005456 Bacteria 2376
123 Ga0070678_100120082 3300005456 Bacteria 2071
124 Ga0070678_100152381 3300005456 Bacteria 1863
125 Ga0070662_100014250 3300005457 Bacteria 5306
126 Ga0070662_100050032 3300005457 Bacteria 3014
127 Ga0070662_100076756 3300005457 Bacteria 2477
128 Ga0070662_100275605 3300005457 Bacteria 1360
129 Ga0070681_10040928 3300005458 Bacteria 4642
130 Ga0070681_10042882 3300005458 Bacteria 4533
131 Ga0070681_10114267 3300005458 Bacteria 2639
132 Ga0070681_10186789 3300005458 Bacteria 1993
133 Ga0070681_10985059 3300005458 Bacteria 763
134 Ga0068867_101019187 3300005459 Bacteria 752
135 Ga0070685_10018528 3300005466 Bacteria 3745
136 Ga0070685_10118986 3300005466 Bacteria 1638
137 Ga0070707_100006906 3300005468 Bacteria 10515
138 Ga0070707_100033729 3300005468 Bacteria 4881
139 Ga0070698_100014515 3300005471 Bacteria 8316
140 Ga0070698_100017647 3300005471 Bacteria 7520
141 Ga0070699_100032426 3300005518 Bacteria 4511
142 Ga0070679_100042115 3300005530 Bacteria 4547
143 Ga0070679_100226119 3300005530 Bacteria 1831
144 Ga0070679_100261840 3300005530 Bacteria 1685
145 Ga0070679_101195285 3300005530 Bacteria 705
146 Ga0070679_101400156 3300005530 Bacteria 645
147 Ga0070684_100032950 3300005535 Bacteria 4420
148 Ga0070684_100199462 3300005535 Bacteria 1822
149 Ga0070684_100841607 3300005535 Bacteria 858
150 Ga0070697_100343238 3300005536 Bacteria 1289
151 Ga0070697_100472740 3300005536 Bacteria 1094
152 Ga0068853_100541991 3300005539 Bacteria 1101
153 Ga0070672_100037907 3300005543 Bacteria 3680
154 Ga0070672_100166292 3300005543 Bacteria 1832
155 Ga0070686_100013633 3300005544 Bacteria 4662
156 Ga0070686_100051189 3300005544 Bacteria 2628
157 Ga0070695_100099797 3300005545 Bacteria 1953
158 Ga0070695_100404583 3300005545 Bacteria 1036
159 Ga0070695_100508680 3300005545 Bacteria 933
160 Ga0070696_100004194 3300005546 Bacteria 9602
161 Ga0070696_100008489 3300005546 Bacteria 6876
162 Ga0070696_100050957 3300005546 Bacteria 2878
163 Ga0070696_100076045 3300005546 Bacteria 2370
164 Ga0070696_100440169 3300005546 Bacteria 1027
165 Ga0070696_100707729 3300005546 Bacteria 822
166 Ga0070696_100843543 3300005546 Bacteria 757
167 Ga0070665_100000121 3300005548 Bacteria 147683
168 Ga0070665_100006341 3300005548 Bacteria 12070
169 Ga0070665_100029959 3300005548 Bacteria 5477
170 Ga0070665_100070803 3300005548 Bacteria 3494
171 Ga0070665_100071556 3300005548 Bacteria 3474
172 Ga0070665_100088661 3300005548 Bacteria 3099
173 Ga0070665_100166338 3300005548 Bacteria 2207
174 Ga0070665_100582852 3300005548 Bacteria 1131
175 Ga0070704_100103646 3300005549 Bacteria 2149
176 Ga0070704_100279897 3300005549 Bacteria 1381
177 Ga0070704_100578514 3300005549 Bacteria 984
178 Ga0068855_100018024 3300005563 Bacteria 8484
179 Ga0068855_100067956 3300005563 Bacteria 4150
180 Ga0068855_100074983 3300005563 Bacteria 3928
181 Ga0068855_100861195 3300005563 Bacteria 960
182 Ga0068855_101027957 3300005563 Bacteria 864
183 Ga0070664_100023793 3300005564 Bacteria 5060
184 Ga0070664_100445214 3300005564 Bacteria 1189
185 Ga0070664_100492882 3300005564 Bacteria 1129
186 Ga0070664_100499798 3300005564 Bacteria 1121
187 Ga0068857_100394244 3300005577 Bacteria 1287
188 Ga0068857_100890587 3300005577 Bacteria 853
189 Ga0068854_100195338 3300005578 Bacteria 1588
190 Ga0068854_100216989 3300005578 Bacteria 1511
191 Ga0068854_100236565 3300005578 Bacteria 1452
192 Ga0068854_100912852 3300005578 Bacteria 772
193 Ga0068856_100043556 3300005614 Bacteria 4416
194 Ga0068856_100384103 3300005614 Bacteria 1424
195 Ga0068856_100391407 3300005614 Bacteria 1410
196 Ga0068856_100602406 3300005614 Bacteria 1120
197 Ga0070702_100003273 3300005615 Bacteria 7215
198 Ga0070702_100069906 3300005615 Bacteria 2070
199 Ga0070702_100183485 3300005615 Bacteria 1371
200 Ga0068852_100109130 3300005616 Bacteria 2512
201 Ga0068859_100001281 3300005617 Bacteria 25688
202 Ga0068859_100415479 3300005617 Bacteria 1441
203 Ga0068859_100429757 3300005617 Bacteria 1417
204 Ga0068864_100000263 3300005618 Bacteria 47003
205 Ga0068864_100008221 3300005618 Bacteria 8605
206 Ga0068864_100050052 3300005618 Bacteria 3595
207 Ga0068864_100274288 3300005618 Bacteria 1572
208 Ga0068864_100854981 3300005618 Bacteria 896
209 Ga0068866_10013084 3300005718 Bacteria 3630
210 Ga0068866_10013518 3300005718 Bacteria 3584
211 Ga0068866_10033637 3300005718 Bacteria 2489
212 Ga0068866_10267377 3300005718 Bacteria 1054
213 Ga0068866_10316892 3300005718 Bacteria 980
214 Ga0068861_100015733 3300005719 Bacteria 5339
215 Ga0068861_100019757 3300005719 Bacteria 4814
216 Ga0068861_100116966 3300005719 Bacteria 2145
217 Ga0068861_101451468 3300005719 Bacteria 672
218 Ga0068861_101473182 3300005719 Bacteria 667
219 Ga0068851_10030212 3300005834 Bacteria 2686
220 Ga0068870_10000375 3300005840 Bacteria 16758
221 Ga0068870_10051146 3300005840 Bacteria 2186
222 Ga0068863_100000694 3300005841 Bacteria 33782
223 Ga0068863_100004023 3300005841 Bacteria 14519
224 Ga0068863_100013521 3300005841 Bacteria 7874
225 Ga0068863_100058583 3300005841 Bacteria 3644
226 Ga0068863_100088718 3300005841 Bacteria 2931
227 Ga0068858_100000270 3300005842 Bacteria 55629
228 Ga0068858_100007271 3300005842 Bacteria 10730
229 Ga0068858_100196267 3300005842 Bacteria 1908
230 Ga0068858_100262915 3300005842 Bacteria 1641
231 Ga0068858_100864333 3300005842 Bacteria 884
232 Ga0068860_100001684 3300005843 Bacteria 23610
233 Ga0068860_100010284 3300005843 Bacteria 9258
234 Ga0068860_100055504 3300005843 Bacteria 3766
235 Ga0068860_100373448 3300005843 Bacteria 1407
236 Ga0068862_100007110 3300005844 Bacteria 9298
237 Ga0068862_100053766 3300005844 Bacteria 3447
238 Ga0068862_100072571 3300005844 Bacteria 2973
239 Ga0068862_100094860 3300005844 Bacteria 2602
240 Ga0068862_100334272 3300005844 Bacteria 1402
241 Ga0068862_100381530 3300005844 Bacteria 1315
242 Ga0081455_10014194 3300005937 Bacteria 7822
243 Ga0081455_10035927 3300005937 Bacteria 4419
244 Ga0081455_10048479 3300005937 Bacteria 3670
245 Ga0081455_10101402 3300005937 Bacteria 2310
246 Ga0081455_10331245 3300005937 Bacteria 1081
247 Ga0081538_10002670 3300005981 Bacteria 17202
248 Ga0081538_10073417 3300005981 Bacteria 1869
249 Ga0081540_1007820 3300005983 Bacteria 7562
250 Ga0081539_10008891 3300005985 Bacteria 8576
251 Ga0081539_10027263 3300005985 Bacteria 3622
252 Ga0081539_10137035 3300005985 Bacteria 1194
253 Ga0075365_10006324 3300006038 Bacteria 6505
254 Ga0075365_10374925 3300006038 Bacteria 1004
255 Ga0075364_10001038 3300006051 Bacteria 14772
256 Ga0075432_10014356 3300006058 Bacteria 2699
257 Ga0075432_10104569 3300006058 Bacteria 1049
258 Ga0070715_10014627 3300006163 Bacteria 2910
259 Ga0070716_100369409 3300006173 Bacteria 1021
260 Ga0070712_100218724 3300006175 Bacteria 1507
261 Ga0070712_100830163 3300006175 Bacteria 794
262 Ga0075362_10006228 3300006177 Bacteria 4435
263 Ga0075362_10237312 3300006177 Bacteria 894
264 Ga0075367_10001012 3300006178 Bacteria 11557
265 Ga0075367_10064400 3300006178 Bacteria 2193
266 Ga0075367_10316816 3300006178 Bacteria 983
267 Ga0075369_10020903 3300006186 Bacteria 2684
268 Ga0075366_10007868 3300006195 Bacteria 5897
269 Ga0075366_10060203 3300006195 Bacteria 2256
270 Ga0075366_10065097 3300006195 Bacteria 2168
271 Ga0075366_10287405 3300006195 Bacteria 1005
272 Ga0097621_100367617 3300006237 Bacteria 1282
273 Ga0097621_100818543 3300006237 Bacteria 864
274 Ga0075370_10019956 3300006353 Bacteria 3654
275 Ga0075370_10087766 3300006353 Bacteria 1792
276 Ga0075370_10306181 3300006353 Bacteria 945
277 Ga0075370_10727877 3300006353 Bacteria 603
278 Ga0068871_100031253 3300006358 Bacteria 4198
279 Ga0068871_100092158 3300006358 Bacteria 2527
280 Ga0075428_100010442 3300006844 Bacteria 10313
281 Ga0075428_100087947 3300006844 Bacteria 3389
282 Ga0075428_100235990 3300006844 Bacteria 1973
283 Ga0075428_100333483 3300006844 Bacteria 1629
284 Ga0075430_100000285 3300006846 Bacteria 35539
285 Ga0075430_100112480 3300006846 Bacteria 2270
286 Ga0075430_100147527 3300006846 Bacteria 1959
287 Ga0075430_100150096 3300006846 Bacteria 1941
288 Ga0075430_100155229 3300006846 Bacteria 1906
289 Ga0075431_100000899 3300006847 Bacteria 26201
290 Ga0075431_100034918 3300006847 Bacteria 5179
291 Ga0075431_100124871 3300006847 Bacteria 2656
292 Ga0075433_10006179 3300006852 Bacteria 9447
293 Ga0075433_10008128 3300006852 Bacteria 8355
294 Ga0075433_10018245 3300006852 Bacteria 5828
295 Ga0075434_100005718 3300006871 Bacteria 11357
296 Ga0075434_100025716 3300006871 Bacteria 5762
297 Ga0075429_100000228 3300006880 Bacteria 38162
298 Ga0075429_100127604 3300006880 Bacteria 2224
299 Ga0075429_100132193 3300006880 Bacteria 2183
300 Ga0075429_100376674 3300006880 Bacteria 1243
301 Ga0068865_100031091 3300006881 Bacteria 3557
302 Ga0068865_100042110 3300006881 Bacteria 3112
303 Ga0068865_100292920 3300006881 Bacteria 1300
304 Ga0075436_100088522 3300006914 Bacteria 2151
305 Ga0075436_100090350 3300006914 Bacteria 2129
306 Ga0097620_100001281 3300006931 Bacteria 25688
307 Ga0097620_100415496 3300006931 Bacteria 1441
308 Ga0097620_100429721 3300006931 Bacteria 1417
309 Ga0079104_1007846 3300006946 Bacteria 3808
310 Ga0075435_100005575 3300007076 Bacteria 8811
311 Ga0075435_100010943 3300007076 Bacteria 6649
312 Ga0105251_10011731 3300009011 Bacteria 4990
313 Ga0105251_10013458 3300009011 Bacteria 4576
314 Ga0105251_10239691 3300009011 Bacteria 817
315 Ga0105244_10007192 3300009036 Bacteria 7100
316 Ga0105250_10003109 3300009092 Bacteria 7986
317 Ga0105250_10085986 3300009092 Bacteria 1277
318 Ga0105240_10013835 3300009093 Bacteria 11052
319 Ga0105240_10162906 3300009093 Bacteria 2647
320 Ga0105240_10207291 3300009093 Bacteria 2293
321 Ga0105240_10369970 3300009093 Bacteria 1621
322 Ga0105240_10382210 3300009093 Bacteria 1590
323 Ga0105240_10592490 3300009093 Bacteria 1221
324 Ga0105240_10646104 3300009093 Bacteria 1160
325 Ga0105240_10718939 3300009093 Bacteria 1088
326 Ga0111539_10036756 3300009094 Bacteria 5918
327 Ga0111539_10360723 3300009094 Bacteria 1691
328 Ga0111539_10406545 3300009094 Bacteria 1585
329 Ga0105245_10022916 3300009098 Bacteria 5479
330 Ga0105245_10049066 3300009098 Bacteria 3778
331 Ga0105245_10062833 3300009098 Bacteria 3351
332 Ga0105245_10126910 3300009098 Bacteria 2389
333 Ga0105245_10156777 3300009098 Bacteria 2157
334 Ga0105245_10389733 3300009098 Bacteria 1390
335 Ga0105245_10506970 3300009098 Bacteria 1223
336 Ga0105245_10602058 3300009098 Bacteria 1126
337 Ga0105245_10675311 3300009098 Bacteria 1065
338 Ga0105245_10999553 3300009098 Bacteria 881
339 Ga0105247_10052455 3300009101 Bacteria 2515
340 Ga0105247_10094235 3300009101 Bacteria 1905
341 Ga0105247_10293539 3300009101 Bacteria 1125
342 Ga0114129_10007341 3300009147 Bacteria 15690
343 Ga0114129_10028692 3300009147 Bacteria 7885
344 Ga0114129_10039220 3300009147 Bacteria 6678
345 Ga0114129_10079992 3300009147 Bacteria 4544
346 Ga0114129_10157389 3300009147 Bacteria 3106
347 Ga0114129_10201453 3300009147 Bacteria 2695
348 Ga0114129_10208861 3300009147 Bacteria 2641
349 Ga0114129_10289259 3300009147 Bacteria 2187
350 Ga0114129_10831253 3300009147 Bacteria 1176
351 Ga0105243_10003350 3300009148 Bacteria 12999
352 Ga0105243_10004939 3300009148 Bacteria 10446
353 Ga0105243_10018421 3300009148 Bacteria 5289
354 Ga0105243_10029366 3300009148 Bacteria 4227
355 Ga0105243_10120876 3300009148 Bacteria 2208
356 Ga0105243_10503564 3300009148 Bacteria 1148
357 Ga0105243_10671510 3300009148 Bacteria 1007
358 Ga0105243_10752857 3300009148 Bacteria 955
359 Ga0105243_11071468 3300009148 Bacteria 813
360 Ga0105241_10096984 3300009174 Bacteria 2336
361 Ga0105241_10166634 3300009174 Bacteria 1816
362 Ga0105242_10003352 3300009176 Bacteria 12463
363 Ga0105242_10007115 3300009176 Bacteria 8634
364 Ga0105242_10045359 3300009176 Bacteria 3562
365 Ga0105242_10047469 3300009176 Bacteria 3487
366 Ga0105242_10078881 3300009176 Bacteria 2749
367 Ga0105242_10205316 3300009176 Bacteria 1752
368 Ga0105242_10410072 3300009176 Bacteria 1267
369 Ga0105242_10516396 3300009176 Bacteria 1139
370 Ga0105248_10026397 3300009177 Bacteria 6461
371 Ga0105248_10044644 3300009177 Bacteria 4970
372 Ga0105248_10086390 3300009177 Bacteria 3530
373 Ga0105248_10089402 3300009177 Bacteria 3467
374 Ga0105248_10168671 3300009177 Bacteria 2467
375 Ga0105248_10178500 3300009177 Bacteria 2393
376 Ga0105248_10180513 3300009177 Bacteria 2379
377 Ga0105248_10222577 3300009177 Bacteria 2124
378 Ga0105248_10563249 3300009177 Bacteria 1285
379 Ga0105248_10619254 3300009177 Bacteria 1221
380 Ga0105248_10678976 3300009177 Bacteria 1162
381 Ga0105237_10301784 3300009545 Bacteria 1605
382 Ga0105237_10362248 3300009545 Bacteria 1454
383 Ga0105237_10769858 3300009545 Bacteria 969
384 Ga0105238_10147975 3300009551 Bacteria 2325
385 Ga0105238_10228969 3300009551 Bacteria 1836
386 Ga0105238_10295500 3300009551 Bacteria 1603
387 Ga0105238_10377821 3300009551 Bacteria 1408
388 Ga0105238_10455947 3300009551 Bacteria 1276
389 Ga0105238_10542512 3300009551 Bacteria 1167
390 Ga0105238_10566717 3300009551 Bacteria 1141
391 Ga0105238_10658009 3300009551 Bacteria 1058
392 Ga0105238_11474645 3300009551 Bacteria 709
393 Ga0105238_11704200 3300009551 Bacteria 661
394 Ga0105249_10010200 3300009553 Bacteria 8253
395 Ga0105249_10014593 3300009553 Bacteria 6944
396 Ga0105249_10085350 3300009553 Bacteria 2942
397 Ga0105249_10200258 3300009553 Bacteria 1954
398 Ga0105249_10329165 3300009553 Bacteria 1541
399 Ga0105249_10338536 3300009553 Bacteria 1520
400 Ga0105249_10463175 3300009553 Bacteria 1308
401 Ga0105249_10565610 3300009553 Bacteria 1189
402 Ga0105249_10914107 3300009553 Bacteria 945
403 Ga0105249_11446201 3300009553 Bacteria 759
404 Ga0099796_10268884 3300010159 Bacteria 713
405 Ga0105239_10247557 3300010375 Bacteria 2002
406 Ga0105239_10413421 3300010375 Bacteria 1527
407 Ga0105239_10548759 3300010375 Bacteria 1316
408 Ga0105239_10584854 3300010375 Bacteria 1273
409 Ga0105239_10604321 3300010375 Bacteria 1251
410 Ga0105239_10788988 3300010375 Bacteria 1088
411 Ga0105239_11048261 3300010375 Bacteria 938
412 Ga0105239_11414849 3300010375 Bacteria 803
413 Ga0105246_10042888 3300011119 Bacteria 3066
414 Ga0105246_10045805 3300011119 Bacteria 2981
415 Ga0105246_10200648 3300011119 Bacteria 1550
416 Ga0157346_1005968 3300012480 Bacteria 770
417 Ga0157314_1011798 3300012500 Bacteria 776
418 Ga0157342_1045627 3300012507 Bacteria 601
419 Ga0157373_10072419 3300013100 Bacteria 2432
420 Ga0157371_10011651 3300013102 Bacteria 6758
421 Ga0157371_10024138 3300013102 Bacteria 4442
422 Ga0157371_10025585 3300013102 Bacteria 4298
423 Ga0157370_10020489 3300013104 Bacteria 6604
424 Ga0157370_10022671 3300013104 Bacteria 6248
425 Ga0157370_10890326 3300013104 Bacteria 808
426 Ga0157370_11340582 3300013104 Bacteria 644
427 Ga0157369_10018315 3300013105 Bacteria 7853
428 Ga0157369_10097245 3300013105 Bacteria 3141
429 Ga0157369_10665926 3300013105 Bacteria 1073
430 Ga0157374_10302289 3300013296 Bacteria 1583
431 Ga0157374_10400952 3300013296 Bacteria 1368
432 Ga0157374_10473969 3300013296 Bacteria 1254
433 Ga0157374_10822569 3300013296 Bacteria 945
434 Ga0157374_11788153 3300013296 Bacteria 640
435 Ga0157378_10021079 3300013297 Bacteria 5733
436 Ga0157378_10025041 3300013297 Bacteria 5257
437 Ga0157378_10088855 3300013297 Bacteria 2805
438 Ga0157378_10213504 3300013297 Bacteria 1831
439 Ga0157378_10390695 3300013297 Bacteria 1368
440 Ga0157378_10711455 3300013297 Bacteria 1024
441 Ga0157378_11042012 3300013297 Bacteria 854
442 Ga0163162_10111590 3300013306 Bacteria 2832
443 Ga0163162_10118185 3300013306 Bacteria 2753
444 Ga0163162_10223470 3300013306 Bacteria 2013
445 Ga0163162_10432190 3300013306 Bacteria 1449
446 Ga0163162_10596522 3300013306 Bacteria 1231
447 Ga0163162_11139172 3300013306 Bacteria 884
448 Ga0157372_10223514 3300013307 Bacteria 2183
449 Ga0157372_10872783 3300013307 Bacteria 1044
450 Ga0157372_11856724 3300013307 Bacteria 693
451 Ga0157375_10468495 3300013308 Bacteria 1425
452 Ga0157375_10573180 3300013308 Bacteria 1289
453 Ga0157375_11660300 3300013308 Bacteria 756
454 Ga0157375_12230252 3300013308 Bacteria 652
455 Ga0157375_12366843 3300013308 Bacteria 634
456 Ga0163163_10006685 3300014325 Bacteria 10104
457 Ga0163163_10380839 3300014325 Bacteria 1468
458 Ga0163163_10386778 3300014325 Bacteria 1457
459 Ga0163163_10405396 3300014325 Bacteria 1422
460 Ga0163163_10694372 3300014325 Bacteria 1081
461 Ga0163163_10729973 3300014325 Bacteria 1054
462 Ga0163163_10910239 3300014325 Bacteria 943
463 Ga0157380_10236356 3300014326 Bacteria 1645
464 Ga0157380_10240595 3300014326 Bacteria 1632
465 Ga0157380_10244865 3300014326 Bacteria 1619
466 Ga0157380_10277066 3300014326 Bacteria 1532
467 Ga0157380_10508652 3300014326 Bacteria 1172
468 Ga0182008_10089559 3300014497 Bacteria 1517
469 Ga0157377_10034285 3300014745 Bacteria 2777
470 Ga0157377_10162679 3300014745 Bacteria 1389
471 Ga0157379_10009879 3300014968 Bacteria 8312
472 Ga0157379_10009954 3300014968 Bacteria 8282
473 Ga0157379_10013956 3300014968 Bacteria 7041
474 Ga0157379_10082142 3300014968 Bacteria 2887
475 Ga0157379_10534820 3300014968 Bacteria 1089
476 Ga0157379_10582762 3300014968 Bacteria 1043
477 Ga0157379_11856841 3300014968 Bacteria 593
478 Ga0157376_10020266 3300014969 Bacteria 5141
479 Ga0157376_10086464 3300014969 Bacteria 2703
480 Ga0157376_10190886 3300014969 Bacteria 1878
481 Ga0157376_10359201 3300014969 Bacteria 1396
482 Ga0157376_11041539 3300014969 Bacteria 842
483 Ga0157376_11219506 3300014969 Bacteria 781
484 Ga0163161_10009195 3300017792 Bacteria 6830
485 Ga0163161_10104109 3300017792 Bacteria 2115
486 Ga0163161_10126258 3300017792 Bacteria 1926
487 Ga0163161_10322599 3300017792 Bacteria 1221
488 Ga0197907_11163269 3300020069 Bacteria 685
489 Ga0206356_11120293 3300020070 Bacteria 911
490 Ga0206349_1655200 3300020075 Bacteria 2971
491 Ga0206351_10841747 3300020077 Bacteria 1144
492 Ga0206352_10228094 3300020078 Bacteria 2898
493 Ga0206352_10464821 3300020078 Bacteria 752
494 Ga0206352_10771567 3300020078 Bacteria 609
495 Ga0206350_10327598 3300020080 Bacteria 1141
496 Ga0206354_10614689 3300020081 Bacteria 926
497 Ga0206353_11006368 3300020082 Bacteria 1563
498 Ga0213872_10135356 3300021361 Bacteria 1083
499 Ga0213876_10000244 3300021384 Bacteria 51875
500 Ga0213876_10084053 3300021384 Bacteria 1684
501 Ga0213876_10085106 3300021384 Bacteria 1673
502 Ga0213875_10290337 3300021388 Bacteria 773
503 Ga0224712_10044016 3300022467 Bacteria 1700
504 Ga0256744_124951 3300023309 Bacteria 725
505 Ga0256720_139426 3300023438 Bacteria 1142
506 Ga0209026_1003882 3300025250 Bacteria 4706
507 Ga0209565_1000925 3300025263 Bacteria 15538
508 Ga0209455_1018403 3300025272 Bacteria 1436
509 Ga0209673_1002524 3300025273 Bacteria 12545
510 Ga0207673_1001242 3300025290 Bacteria 2750
511 Ga0209675_1002569 3300025291 Bacteria 9211
512 Ga0209676_1004317 3300025292 Bacteria 7996
513 Ga0209676_1005649 3300025292 Bacteria 6445
514 Ga0209676_1005783 3300025292 Bacteria 6325
515 Ga0209676_1036267 3300025292 Bacteria 1437
516 Ga0209564_1023073 3300025295 Bacteria 2175
517 Ga0209564_1035258 3300025295 Bacteria 1452
518 Ga0209564_1067311 3300025295 Bacteria 764
519 Ga0209758_1002168 3300025297 Bacteria 20636
520 Ga0209758_1021887 3300025297 Bacteria 2958
521 Ga0209050_1000161 3300025298 Bacteria 155713
522 Ga0209050_1033197 3300025298 Bacteria 1569
523 Ga0209256_1003893 3300025299 Bacteria 9891
524 Ga0209051_1000877 3300025303 Bacteria 30359
525 Ga0209257_1000252 3300025304 Bacteria 123718
526 Ga0209257_1000284 3300025304 Bacteria 112773
527 Ga0209257_1000976 3300025304 Bacteria 38920
528 Ga0209257_1001464 3300025304 Bacteria 27851
529 Ga0209257_1117875 3300025304 Bacteria 624
530 Ga0207697_10002965 3300025315 Bacteria 8568
531 Ga0207696_1011543 3300025711 Bacteria 3172
532 Ga0207655_1002359 3300025728 Bacteria 15416
533 Ga0207713_1017717 3300025735 Bacteria 3556
534 Ga0207713_1044888 3300025735 Bacteria 1810
535 Ga0207653_10000045 3300025885 Bacteria 94691
536 Ga0207653_10005900 3300025885 Bacteria 3822
537 Ga0207682_10002609 3300025893 Bacteria 8043
538 Ga0207682_10051856 3300025893 Bacteria 1700
539 Ga0207692_10051672 3300025898 Bacteria 2085
540 Ga0207692_10056267 3300025898 Bacteria 2017
541 Ga0207642_10002348 3300025899 Bacteria 5901
542 Ga0207642_10015447 3300025899 Bacteria 2845
543 Ga0207642_10045839 3300025899 Bacteria 1944
544 Ga0207710_10165577 3300025900 Bacteria 1079
545 Ga0207688_10024145 3300025901 Bacteria 3333
546 Ga0207688_10041983 3300025901 Bacteria 2545
547 Ga0207688_10056434 3300025901 Bacteria 2206
548 Ga0207688_10191431 3300025901 Bacteria 1223
549 Ga0207688_10273874 3300025901 Bacteria 1027
550 Ga0207680_10152858 3300025903 Bacteria 1540
551 Ga0207685_10045074 3300025905 Bacteria 1671
552 Ga0207645_10022520 3300025907 Bacteria 4097
553 Ga0207645_10073745 3300025907 Bacteria 2185
554 Ga0207645_10268329 3300025907 Bacteria 1131
555 Ga0207643_10000118 3300025908 Bacteria 53785
556 Ga0207643_10298463 3300025908 Bacteria 1002
557 Ga0207705_10011901 3300025909 Bacteria 6285
558 Ga0207705_10152929 3300025909 Bacteria 1729
559 Ga0207705_10252453 3300025909 Bacteria 1345
560 Ga0207705_10401469 3300025909 Bacteria 1060
561 Ga0207705_10402723 3300025909 Bacteria 1058
562 Ga0207705_10693439 3300025909 Bacteria 792
563 Ga0207705_11194253 3300025909 Bacteria 584
564 Ga0207684_10128030 3300025910 Bacteria 2179
565 Ga0207654_10116974 3300025911 Bacteria 1668
566 Ga0207654_10139882 3300025911 Bacteria 1542
567 Ga0207707_10089543 3300025912 Bacteria 2690
568 Ga0207707_10303574 3300025912 Bacteria 1380
569 Ga0207707_10427272 3300025912 Bacteria 1135
570 Ga0207707_10896025 3300025912 Bacteria 734
571 Ga0207695_10000575 3300025913 Bacteria 74997
572 Ga0207695_10002926 3300025913 Bacteria 24665
573 Ga0207695_10146421 3300025913 Bacteria 2306
574 Ga0207695_10350482 3300025913 Bacteria 1364
575 Ga0207695_10463321 3300025913 Bacteria 1150
576 Ga0207695_10507987 3300025913 Bacteria 1087
577 Ga0207671_10192724 3300025914 Bacteria 1590
578 Ga0207693_10009311 3300025915 Bacteria 8011
579 Ga0207693_10135989 3300025915 Bacteria 1932
580 Ga0207693_10146710 3300025915 Bacteria 1855
581 Ga0207693_10654012 3300025915 Bacteria 816
582 Ga0207663_10008581 3300025916 Bacteria 5356
583 Ga0207660_10000537 3300025917 Bacteria 25426
584 Ga0207660_10020945 3300025917 Bacteria 4393
585 Ga0207660_10243208 3300025917 Bacteria 1418
586 Ga0207660_10274069 3300025917 Bacteria 1337
587 Ga0207662_10009419 3300025918 Bacteria 5374
588 Ga0207662_10686070 3300025918 Bacteria 717
589 Ga0207657_10020254 3300025919 Bacteria 6292
590 Ga0207657_10136762 3300025919 Bacteria 2004
591 Ga0207657_10314964 3300025919 Bacteria 1238
592 Ga0207649_10079383 3300025920 Bacteria 2120
593 Ga0207649_10605728 3300025920 Bacteria 843
594 Ga0207652_10002134 3300025921 Bacteria 16964
595 Ga0207652_10729628 3300025921 Bacteria 883
596 Ga0207652_10753376 3300025921 Bacteria 867
597 Ga0207652_11239759 3300025921 Bacteria 648
598 Ga0207646_10007412 3300025922 Bacteria 11152
599 Ga0207646_10559819 3300025922 Bacteria 1027
600 Ga0207681_10008339 3300025923 Bacteria 6336
601 Ga0207681_10008696 3300025923 Bacteria 6200
602 Ga0207681_10496989 3300025923 Bacteria 998
603 Ga0207681_10748247 3300025923 Bacteria 815
604 Ga0207694_10078132 3300025924 Bacteria 2594
605 Ga0207694_10104409 3300025924 Bacteria 2248
606 Ga0207694_10147033 3300025924 Bacteria 1897
607 Ga0207694_10172335 3300025924 Bacteria 1753
608 Ga0207694_10427961 3300025924 Bacteria 1103
609 Ga0207694_10979407 3300025924 Bacteria 715
610 Ga0207694_11155173 3300025924 Bacteria 655
611 Ga0207650_10000883 3300025925 Bacteria 22684
612 Ga0207650_10002395 3300025925 Bacteria 13056
613 Ga0207650_10005005 3300025925 Bacteria 9053
614 Ga0207650_10499802 3300025925 Bacteria 1016
615 Ga0207659_10011510 3300025926 Bacteria 5590
616 Ga0207659_10133918 3300025926 Bacteria 1916
617 Ga0207659_10286174 3300025926 Bacteria 1349
618 Ga0207659_10294806 3300025926 Bacteria 1330
619 Ga0207659_10515480 3300025926 Bacteria 1013
620 Ga0207687_10009078 3300025927 Bacteria 6502
621 Ga0207687_10065082 3300025927 Bacteria 2588
622 Ga0207687_10356241 3300025927 Bacteria 1193
623 Ga0207687_11026906 3300025927 Bacteria 707
624 Ga0207687_11103028 3300025927 Bacteria 681
625 Ga0207700_10438719 3300025928 Bacteria 1149
626 Ga0207664_11150883 3300025929 Bacteria 693
627 Ga0207644_10006669 3300025931 Bacteria 7523
628 Ga0207644_10040202 3300025931 Bacteria 3304
629 Ga0207644_10053826 3300025931 Bacteria 2897
630 Ga0207690_10214872 3300025932 Bacteria 1468
631 Ga0207706_10004872 3300025933 Bacteria 12567
632 Ga0207706_10042383 3300025933 Bacteria 4034
633 Ga0207706_10298098 3300025933 Bacteria 1405
634 Ga0207686_10012281 3300025934 Bacteria 4706
635 Ga0207686_10023271 3300025934 Bacteria 3576
636 Ga0207686_10037323 3300025934 Bacteria 2931
637 Ga0207686_10046905 3300025934 Bacteria 2668
638 Ga0207686_10051931 3300025934 Bacteria 2556
639 Ga0207686_10093561 3300025934 Bacteria 1990
640 Ga0207686_10242708 3300025934 Bacteria 1312
641 Ga0207686_10307097 3300025934 Bacteria 1180
642 Ga0207709_10016640 3300025935 Bacteria 4091
643 Ga0207709_10025729 3300025935 Bacteria 3372
644 Ga0207709_10049670 3300025935 Bacteria 2562
645 Ga0207709_10083763 3300025935 Bacteria 2063
646 Ga0207709_11067389 3300025935 Bacteria 662
647 Ga0207669_10014704 3300025937 Bacteria 3929
648 Ga0207669_10016767 3300025937 Bacteria 3735
649 Ga0207704_10073496 3300025938 Bacteria 2178
650 Ga0207704_10192726 3300025938 Bacteria 1484
651 Ga0207704_10224450 3300025938 Bacteria 1392
652 Ga0207704_10307479 3300025938 Bacteria 1217
653 Ga0207691_10002209 3300025940 Bacteria 19049
654 Ga0207691_10110769 3300025940 Bacteria 2441
655 Ga0207691_10286363 3300025940 Bacteria 1417
656 Ga0207711_10001469 3300025941 Bacteria 21980
657 Ga0207711_10023017 3300025941 Bacteria 5215
658 Ga0207711_10029957 3300025941 Bacteria 4591
659 Ga0207711_10047912 3300025941 Bacteria 3655
660 Ga0207711_10055511 3300025941 Bacteria 3401
661 Ga0207711_10203685 3300025941 Bacteria 1806
662 Ga0207711_10220646 3300025941 Bacteria 1734
663 Ga0207711_10837575 3300025941 Bacteria 856
664 Ga0207689_10137435 3300025942 Bacteria 2012
665 Ga0207689_10172806 3300025942 Bacteria 1781
666 Ga0207689_10244565 3300025942 Bacteria 1483
667 Ga0207689_10294206 3300025942 Bacteria 1345
668 Ga0207689_10750222 3300025942 Bacteria 824
669 Ga0207661_10013726 3300025944 Bacteria 5916
670 Ga0207661_10115948 3300025944 Bacteria 2273
671 Ga0207679_10003258 3300025945 Bacteria 10029
672 Ga0207679_10136908 3300025945 Bacteria 1973
673 Ga0207679_10543970 3300025945 Bacteria 1041
674 Ga0207679_10720696 3300025945 Bacteria 906
675 Ga0207679_10762319 3300025945 Bacteria 880
676 Ga0207667_10015066 3300025949 Bacteria 8794
677 Ga0207667_10027885 3300025949 Bacteria 6139
678 Ga0207667_10166617 3300025949 Bacteria 2265
679 Ga0207667_10310503 3300025949 Bacteria 1611
680 Ga0207667_10334516 3300025949 Bacteria 1546
681 Ga0207667_10676319 3300025949 Bacteria 1036
682 Ga0207651_10011007 3300025960 Bacteria 5041
683 Ga0207651_10798293 3300025960 Bacteria 837
684 Ga0207712_10002131 3300025961 Bacteria 12933
685 Ga0207712_10013482 3300025961 Bacteria 5242
686 Ga0207712_10050038 3300025961 Bacteria 2916
687 Ga0207712_10357824 3300025961 Bacteria 1215
688 Ga0207712_10441312 3300025961 Bacteria 1102
689 Ga0207712_10492863 3300025961 Bacteria 1046
690 Ga0207668_10000363 3300025972 Bacteria 28976
691 Ga0207668_10000571 3300025972 Bacteria 23129
692 Ga0207668_10007456 3300025972 Bacteria 6507
693 Ga0207668_10009414 3300025972 Bacteria 5854
694 Ga0207668_10024762 3300025972 Bacteria 3877
695 Ga0207668_10159369 3300025972 Bacteria 1756
696 Ga0207668_10216512 3300025972 Bacteria 1535
697 Ga0207640_10155026 3300025981 Bacteria 1687
698 Ga0207640_10188781 3300025981 Bacteria 1552
699 Ga0207640_10249687 3300025981 Bacteria 1376
700 Ga0207658_10001253 3300025986 Bacteria 20099
701 Ga0207658_10010638 3300025986 Bacteria 6254
702 Ga0207658_10047256 3300025986 Bacteria 3149
703 Ga0207658_10048296 3300025986 Bacteria 3120
704 Ga0207658_10054635 3300025986 Bacteria 2955
705 Ga0207658_10662815 3300025986 Bacteria 941
706 Ga0207677_10006799 3300026023 Bacteria 6279
707 Ga0207677_10065723 3300026023 Bacteria 2532
708 Ga0207677_10482735 3300026023 Bacteria 1068
709 Ga0207677_10830616 3300026023 Bacteria 829
710 Ga0207677_10946695 3300026023 Bacteria 779
711 Ga0207703_10000133 3300026035 Bacteria 90055
712 Ga0207703_10010843 3300026035 Bacteria 7108
713 Ga0207703_10146296 3300026035 Bacteria 2055
714 Ga0207703_10169581 3300026035 Bacteria 1919
715 Ga0207703_10456155 3300026035 Bacteria 1195
716 Ga0207639_10158964 3300026041 Bacteria 1902
717 Ga0207639_10994057 3300026041 Bacteria 786
718 Ga0207678_10008107 3300026067 Bacteria 9264
719 Ga0207678_10020090 3300026067 Bacteria 5867
720 Ga0207678_10127526 3300026067 Bacteria 2170
721 Ga0207708_10006675 3300026075 Bacteria 8536
722 Ga0207708_10015459 3300026075 Bacteria 5724
723 Ga0207708_10030576 3300026075 Bacteria 4083
724 Ga0207708_10076955 3300026075 Bacteria 2560
725 Ga0207708_10716480 3300026075 Bacteria 856
726 Ga0207708_10873556 3300026075 Bacteria 777
727 Ga0207702_10344675 3300026078 Bacteria 1424
728 Ga0207702_10409077 3300026078 Bacteria 1310
729 Ga0207641_10000168 3300026088 Bacteria 92126
730 Ga0207641_10005884 3300026088 Bacteria 10409
731 Ga0207641_10007468 3300026088 Bacteria 9094
732 Ga0207641_10085368 3300026088 Bacteria 2750
733 Ga0207641_10994020 3300026088 Bacteria 835
734 Ga0207648_10007348 3300026089 Bacteria 10849
735 Ga0207648_10008491 3300026089 Bacteria 9939
736 Ga0207648_10048425 3300026089 Bacteria 3720
737 Ga0207648_10048888 3300026089 Bacteria 3702
738 Ga0207676_10000247 3300026095 Bacteria 47010
739 Ga0207676_10000647 3300026095 Bacteria 27890
740 Ga0207676_10005933 3300026095 Bacteria 8622
741 Ga0207676_10666251 3300026095 Bacteria 1005
742 Ga0207674_10011658 3300026116 Bacteria 9870
743 Ga0207674_10019413 3300026116 Bacteria 7361
744 Ga0207675_100005964 3300026118 Bacteria 11609
745 Ga0207675_100014683 3300026118 Bacteria 7303
746 Ga0207675_100602256 3300026118 Bacteria 1102
747 Ga0207675_101105711 3300026118 Bacteria 812
748 Ga0207683_10000603 3300026121 Bacteria 33155
749 Ga0207683_10000991 3300026121 Bacteria 26020
750 Ga0207683_10038015 3300026121 Bacteria 4192
751 Ga0207683_10108188 3300026121 Bacteria 2488
752 Ga0207683_10181530 3300026121 Bacteria 1908
753 Ga0207683_10840083 3300026121 Bacteria 853
754 Ga0207698_10044888 3300026142 Bacteria 3325
755 Ga0207698_10195700 3300026142 Bacteria 1805
756 Ga0207698_10675599 3300026142 Bacteria 1025
757 Ga0207698_11053008 3300026142 Bacteria 825
758 Ga0207698_11347759 3300026142 Bacteria 728
759 Ga0209999_1009868 3300027543 Bacteria 1724
760 Ga0209983_1007723 3300027665 Bacteria 2202
761 Ga0209974_10014633 3300027876 Bacteria 2608
762 Ga0207428_10002487 3300027907 Bacteria 18400
763 Ga0207428_10013220 3300027907 Bacteria 7223
764 Ga0207428_10023327 3300027907 Bacteria 5205
765 Ga0207428_10083638 3300027907 Bacteria 2489
766 Ga0268266_10000106 3300028379 Bacteria 175109
767 Ga0268266_10001264 3300028379 Bacteria 30909
768 Ga0268266_10045074 3300028379 Bacteria 3771
769 Ga0268266_10106712 3300028379 Bacteria 2476
770 Ga0268266_10138455 3300028379 Bacteria 2182
771 Ga0268266_10250079 3300028379 Bacteria 1639
772 Ga0268266_11316336 3300028379 Bacteria 698
773 Ga0268265_10004922 3300028380 Bacteria 9184
774 Ga0268265_10071252 3300028380 Bacteria 2706
775 Ga0268265_10100736 3300028380 Bacteria 2332
776 Ga0268265_10124370 3300028380 Bacteria 2131
777 Ga0268265_10223652 3300028380 Bacteria 1649
778 Ga0268265_10245853 3300028380 Bacteria 1581
779 Ga0268265_10247143 3300028380 Bacteria 1578
780 Ga0268264_10000383 3300028381 Bacteria 63883
781 Ga0268264_10002325 3300028381 Bacteria 16817
782 Ga0268264_10028639 3300028381 Bacteria 4558
783 Ga0268264_10036966 3300028381 Bacteria 4024
784 Ga0265326_10000442 3300028558 Bacteria 16319
785 Ga0265319_1021178 3300028563 Bacteria 2392
786 Ga0265334_10045332 3300028573 Bacteria 1703
787 Ga0265318_10012644 3300028577 Bacteria 3585
788 Ga0265336_10030678 3300028666 Bacteria 1674
789 Ga0307517_10326725 3300028786 Bacteria 845
790 Ga0307515_10273927 3300028794 Bacteria 1404
791 Ga0265338_10014341 3300028800 Bacteria 8827
792 Ga0265338_10069087 3300028800 Bacteria 3038
793 Ga0265338_10087400 3300028800 Bacteria 2590
794 Ga0265338_10129548 3300028800 Bacteria 1995
795 Ga0265338_10183773 3300028800 Bacteria 1591
796 Ga0265338_10423197 3300028800 Bacteria 946
797 Ga0311001_1093307 3300029277 Bacteria 1619
798 Ga0310981_1013259 3300029285 Bacteria 583
799 Ga0310981_1079615 3300029285 Bacteria 2555
800 Ga0307511_10006537 3300030521 Bacteria 11736
801 Ga0316181_1063037 3300030744 Bacteria 1769
802 Ga0265760_10049218 3300031090 Bacteria 1267
803 Ga0265330_10003732 3300031235 Bacteria 7879
804 Ga0265320_10039508 3300031240 Bacteria 2359
805 Ga0265320_10107131 3300031240 Bacteria 1283
806 Ga0265339_10273637 3300031249 Bacteria 811
807 Ga0265327_10000381 3300031251 Bacteria 83617
808 Ga0265327_10005226 3300031251 Bacteria 10946
809 Ga0265327_10007046 3300031251 Bacteria 8808
810 Ga0265327_10014580 3300031251 Bacteria 5131
811 Ga0265316_10008770 3300031344 Bacteria 9346
812 Ga0265316_10580659 3300031344 Bacteria 796
813 Ga0307513_10002446 3300031456 Bacteria 25748
814 Ga0307513_10010515 3300031456 Bacteria 11583
815 Ga0307513_10133255 3300031456 Bacteria 2425
816 Ga0307513_10236173 3300031456 Bacteria 1637
817 Ga0307513_10248379 3300031456 Bacteria 1578
818 Ga0307513_10324480 3300031456 Bacteria 1296
819 Ga0307408_100080190 3300031548 Bacteria 2437
820 Ga0307408_100207056 3300031548 Bacteria 1591
821 Ga0307408_100401965 3300031548 Bacteria 1176
822 Ga0307508_10257921 3300031616 Bacteria 1339
823 Ga0307514_10006548 3300031649 Bacteria 10128
824 Ga0307514_10045338 3300031649 Bacteria 3441
825 Ga0316575_10005334 3300031665 Bacteria 4582
826 Ga0316579_10004029 3300031691 Bacteria 5793
827 Ga0265314_10032344 3300031711 Bacteria 3849
828 Ga0265342_10001795 3300031712 Bacteria 19520
829 Ga0265342_10231167 3300031712 Bacteria 993
830 Ga0316576_10002066 3300031727 Bacteria 11270
831 Ga0316576_10002234 3300031727 Bacteria 10948
832 Ga0316576_10124201 3300031727 Bacteria 1939
833 Ga0316576_10374564 3300031727 Bacteria 1057
834 Ga0316576_10852362 3300031727 Bacteria 654
835 Ga0316578_10003703 3300031728 Bacteria 7056
836 Ga0316578_10004884 3300031728 Bacteria 6409
837 Ga0316578_10005682 3300031728 Bacteria 6073
838 Ga0316578_10157286 3300031728 Bacteria 1369
839 Ga0316578_10366217 3300031728 Bacteria 857
840 Ga0307516_10001565 3300031730 Bacteria 31484
841 Ga0307405_10002818 3300031731 Bacteria 7808
842 Ga0307405_10040438 3300031731 Bacteria 2824
843 Ga0316577_10015885 3300031733 Bacteria 4144
844 Ga0316577_10028995 3300031733 Bacteria 3089
845 Ga0316577_10065100 3300031733 Bacteria 2035
846 Ga0307413_10003502 3300031824 Bacteria 6617
847 Ga0307413_10031850 3300031824 Bacteria 2981
848 Ga0307413_10072160 3300031824 Bacteria 2178
849 Ga0307413_10101849 3300031824 Bacteria 1899
850 Ga0307413_10276942 3300031824 Bacteria 1259
851 Ga0307410_10004470 3300031852 Bacteria 7237
852 Ga0307410_10009398 3300031852 Bacteria 5482
853 Ga0307410_10033428 3300031852 Bacteria 3320
854 Ga0307410_10260935 3300031852 Bacteria 1351
855 Ga0307406_10005941 3300031901 Bacteria 6699
856 Ga0307406_10008849 3300031901 Bacteria 5627
857 Ga0307406_10082192 3300031901 Bacteria 2144
858 Ga0307407_10015861 3300031903 Bacteria 3737
859 Ga0307407_10109716 3300031903 Bacteria 1730
860 Ga0307407_10630526 3300031903 Bacteria 801
861 Ga0307412_10009022 3300031911 Bacteria 5714
862 Ga0307412_10018937 3300031911 Bacteria 4156
863 Ga0307412_10038714 3300031911 Bacteria 3073
864 Ga0307409_100012260 3300031995 Bacteria 5453
865 Ga0307409_100055380 3300031995 Bacteria 3061
866 Ga0307409_100149941 3300031995 Bacteria 2023
867 Ga0307409_100233006 3300031995 Bacteria 1670
868 Ga0307409_100427179 3300031995 Bacteria 1272
869 Ga0307416_100006615 3300032002 Bacteria 7273
870 Ga0307416_100011043 3300032002 Bacteria 6001
871 Ga0307416_100019290 3300032002 Bacteria 4830
872 Ga0307416_100231190 3300032002 Bacteria 1783
873 Ga0307416_100378318 3300032002 Bacteria 1445
874 Ga0307416_100923545 3300032002 Bacteria 974
875 Ga0307414_10041874 3300032004 Bacteria 3106
876 Ga0307414_10108448 3300032004 Bacteria 2106
877 Ga0307414_10236130 3300032004 Bacteria 1510
878 Ga0307414_10517633 3300032004 Bacteria 1058
879 Ga0307411_10049694 3300032005 Bacteria 2727
880 Ga0307411_10050011 3300032005 Bacteria 2720
881 Ga0307411_10329258 3300032005 Bacteria 1237
882 Ga0307411_11040215 3300032005 Bacteria 735
883 Ga0307415_100000047 3300032126 Bacteria 51706
884 Ga0307415_100128118 3300032126 Bacteria 1916
885 Ga0307415_100351122 3300032126 Bacteria 1241
886 Ga0307415_101219423 3300032126 Bacteria 709
887 Ga0307415_101228604 3300032126 Bacteria 707
888 Ga0316585_10018757 3300032137 Bacteria 2102
889 Ga0316585_10137148 3300032137 Bacteria 807
890 Ga0316580_10003748 3300032139 Bacteria 4355
891 Ga0316580_10006478 3300032139 Bacteria 3460
892 Ga0316580_10007750 3300032139 Bacteria 3204
893 Ga0316593_10003756 3300032168 Bacteria 3814
894 Ga0316593_10011313 3300032168 Bacteria 2590
895 Ga0316593_10014263 3300032168 Bacteria 2366
896 Ga0316593_10037011 3300032168 Bacteria 1611
897 Ga0316593_10227609 3300032168 Bacteria 694
898 Ga0307510_10178406 3300033180 Bacteria 1691
899 Ga0316592_1008584 3300033524 Bacteria 2025
900 Ga0316586_1010333 3300033527 Bacteria 1413
901 Ga0316588_1001948 3300033528 Bacteria 3515
902 Ga0316596_1143210 3300033541 Unclassified 655
903 Ga0373959_0056514 3300034820 Bacteria 859
904 Ga0373938_0117165 3300034957 Bacteria 683
905 Ga0373938_0180536 3300034957 Bacteria 576
906 Ga0373926_0000779 3300035083 Bacteria 8955
907 Ga0373940_0110434 3300035088 Bacteria 844
908 Ga0373944_0001205 3300035089 Bacteria 6472
909 Ga0373949_0011265 3300035090 Bacteria 1968
910 Ga0373949_0074695 3300035090 Bacteria 894
911 Ga0373951_0096161 3300035091 Bacteria 782
912 Ga0373923_0003280 3300035111 Bacteria 5159
913 Ga0373932_0119512 3300035112 Bacteria 877
914 Ga0373936_0004112 3300035113 Bacteria 5483
915 Ga0373936_0008117 3300035113 Bacteria 3948
916 Ga0373939_0010335 3300035114 Bacteria 2332
917 Ga0373939_0114132 3300035114 Bacteria 945
918 Ga0373941_0194168 3300035115 Bacteria 768
919 Ga0373956_0002191 3300035119 Bacteria 8054
920 Ga0373960_0083547 3300035121 Bacteria 1010
921 Ga0373943_0058166 3300035170 Bacteria 1923
922 Ga0373943_0123357 3300035170 Bacteria 1379
923 Ga0373946_0001819 3300035171 Bacteria 7448
924 Ga0373946_0157615 3300035171 Bacteria 1063
925 Ga0373955_0022416 3300035172 Bacteria 3204
926 Ga0373942_0084888 3300035207 Bacteria 946
927 Ga0373962_0049998 3300035242 Bacteria 1203
928 Ga0316574_0003943 3300035398 Bacteria 7721
929 Ga0316574_0007642 3300035398 Bacteria 5938
930 Ga0316574_0014627 3300035398 Bacteria 4537
931 Ga0316574_0025544 3300035398 Bacteria 3546
932 Ga0316574_0062602 3300035398 Bacteria 2338
933 Ga0316574_0314325 3300035398 Bacteria 995
934 Ga0373924_0007751 3300035410 Bacteria 3881
935 Ga0373931_0036427 3300035691 Bacteria 2565
936 Ga0373931_0042427 3300035691 Bacteria 2392
937 Ga0373935_0001471 3300035692 Bacteria 13067
938 Ga0373935_0327465 3300035692 Bacteria 1088
939 Ga0373927_0010402 3300035695 Bacteria 6206
940 Ga0373947_0006076 3300035725 Bacteria 7037
941 Ga0373947_0022680 3300035725 Bacteria 3643
942 Ga0373947_0027756 3300035725 Bacteria 3314
943 Ga0316582_0027404 3300036647 Bacteria 3440
944 Ga0316582_0042815 3300036647 Bacteria 2838
945 Ga0316582_0452668 3300036647 Bacteria 885
946 Ga0316584_0002452 3300036712 Bacteria 11732
947 Ga0316584_0003844 3300036712 Bacteria 9844
948 Ga0316584_0017224 3300036712 Bacteria 5190
949 Ga0316584_0054632 3300036712 Bacteria 2989
950 Ga0316584_0078955 3300036712 Bacteria 2465
951 Ga0373925_0079947 3300037068 Bacteria 2485
952 Ga0373925_0148269 3300037068 Bacteria 1840
953 Ga0395899_0000105 3300037312 Bacteria 146163
954 Ga0395899_0014432 3300037312 Bacteria 6031
955 Ga0395899_0047414 3300037312 Bacteria 3199
956 Ga0395899_0077090 3300037312 Bacteria 2432
957 Ga0395899_0082934 3300037312 Bacteria 2331
958 Ga0395899_0101686 3300037312 Bacteria 2074
959 Ga0395899_0124107 3300037312 Bacteria 1847
960 Ga0395899_0125985 3300037312 Bacteria 1832
961 Ga0395899_0132514 3300037312 Bacteria 1779
962 Ga0395899_0136160 3300037312 Bacteria 1751
963 Ga0395899_0152780 3300037312 Bacteria 1635
964 Ga0395899_0292822 3300037312 Bacteria 1104
965 Ga0395899_0479586 3300037312 Bacteria 810
966 Ga0395900_0002517 3300037418 Bacteria 20108
967 Ga0395900_0004844 3300037418 Bacteria 14179
968 Ga0395900_0006085 3300037418 Bacteria 12582
969 Ga0395900_0026851 3300037418 Bacteria 5892
970 Ga0395900_0034696 3300037418 Bacteria 5196
971 Ga0395900_0058480 3300037418 Bacteria 3968
972 Ga0395900_0098179 3300037418 Bacteria 3009
973 Ga0395900_0190675 3300037418 Bacteria 2079
974 Ga0395900_0209885 3300037418 Bacteria 1967
975 Ga0395900_0214770 3300037418 Bacteria 1941
976 Ga0395900_0303429 3300037418 Bacteria 1582
977 Ga0395900_0374261 3300037418 Bacteria 1393
978 Ga0395900_0385825 3300037418 Bacteria 1368
979 Ga0395900_0426275 3300037418 Bacteria 1286
980 Ga0395900_0570478 3300037418 Bacteria 1074
981 Ga0395900_0580199 3300037418 Bacteria 1063
982 Ga0395900_0788035 3300037418 Bacteria 879
983 Ga0395900_1316031 3300037418 Bacteria 636
984 Ga0395898_0004658 3300037466 Bacteria 14954
985 Ga0395898_0036716 3300037466 Bacteria 4864
986 Ga0395898_0037450 3300037466 Bacteria 4811
987 Ga0395898_0089097 3300037466 Bacteria 2970
988 Ga0395898_0096111 3300037466 Bacteria 2846
989 Ga0395898_0118890 3300037466 Bacteria 2531
990 Ga0395898_0125346 3300037466 Bacteria 2460
991 Ga0395898_0134065 3300037466 Bacteria 2371
992 Ga0395898_0139498 3300037466 Bacteria 2321
993 Ga0395898_0169480 3300037466 Bacteria 2087
994 Ga0395898_0199525 3300037466 Bacteria 1910
995 Ga0395898_0616216 3300037466 Bacteria 1028
996 Ga0395898_0901510 3300037466 Bacteria 822
997 Ga0395898_1075316 3300037466 Bacteria 738
998 Ga0395905_0025006 3300037471 Bacteria 5632
999 Ga0395905_0114143 3300037471 Bacteria 2538
1000 Ga0395905_0119007 3300037471 Bacteria 2482
1001 Ga0395905_0360486 3300037471 Bacteria 1346
1002 Ga0395905_0375965 3300037471 Bacteria 1314
1003 Ga0395905_0396756 3300037471 Bacteria 1274
1004 Ga0395905_0433622 3300037471 Bacteria 1211
1005 Ga0395905_0463395 3300037471 Bacteria 1166
1006 Ga0395905_1125155 3300037471 Bacteria 688
1007 Ga0436364_0130730 3300037853 Bacteria 3486
1008 Ga0436364_0624330 3300037853 Bacteria 1786
1009 Ga0436364_1483493 3300037853 Bacteria 5443
1010 Ga0395901_0011915 3300038443 Bacteria 8817
1011 Ga0395901_0022368 3300038443 Bacteria 6478
1012 Ga0395901_0033719 3300038443 Bacteria 5286
1013 Ga0395901_0051913 3300038443 Bacteria 4262
1014 Ga0395901_0053587 3300038443 Bacteria 4191
1015 Ga0395901_0057679 3300038443 Bacteria 4038
1016 Ga0395901_0098100 3300038443 Bacteria 3072
1017 Ga0395901_0104024 3300038443 Bacteria 2979
1018 Ga0395901_0146305 3300038443 Bacteria 2483
1019 Ga0395901_0148822 3300038443 Bacteria 2460
1020 Ga0395901_0150685 3300038443 Bacteria 2444
1021 Ga0395901_0266522 3300038443 Bacteria 1782
1022 Ga0395901_0374484 3300038443 Bacteria 1466
1023 Ga0395901_0453379 3300038443 Bacteria 1311
1024 Ga0395901_0551179 3300038443 Bacteria 1168
1025 Ga0395901_0717817 3300038443 Bacteria 995
1026 Ga0395901_0907470 3300038443 Bacteria 862
1027 Ga0395901_1351428 3300038443 Bacteria 673
1028 Ga0400485_00886 3300038735 Bacteria 7657
1029 Ga0436365_0376847 3300039437 Bacteria 89580
1030 Ga0436365_1158188 3300039437 Bacteria 1851
1031 Ga0436365_1322648 3300039437 Bacteria 3198
1032 Ga0436365_1869888 3300039437 Bacteria 785
1033 Ga0436360_0795636 3300039438 Bacteria 786
1034 Ga0436361_0376133 3300039447 Bacteria 931
1035 Ga0436361_0446519 3300039447 Bacteria 1105
1036 Ga0436361_0953537 3300039447 Bacteria 44604
1037 Ga0436362_0949831 3300039453 Bacteria 876
1038 Ga0439436_0020680 3300041404 Bacteria 1959
1039 Ga0439438_030759 3300041405 Bacteria 1429
1040 Ga0439438_098410 3300041405 Bacteria 710
1041 Ga0439461_0035394 3300041410 Bacteria 1059
1042 Ga0439466_0024167 3300041411 Bacteria 2133
1043 Ga0439466_0062696 3300041411 Bacteria 1194
1044 Ga0439465_0018730 3300041413 Bacteria 2163
1045 Ga0451789_0366743 3300041443 Bacteria 852
1046 Ga0451794_20570 3300041446 Bacteria 1046
1047 Ga0451794_41478 3300041446 Bacteria 705
1048 Ga0451791_1010988 3300041451 Bacteria 1915
1049 Ga0451793_0361512 3300041452 Bacteria 927
1050 Ga0451797_1023958 3300041453 Bacteria 1120
1051 Ga0451797_1549316 3300041453 Bacteria 1124
1052 Ga0451798_0506741 3300041458 Bacteria 776
1053 Ga0451807_0277899 3300041486 Bacteria 790
1054 Ga0451807_1705608 3300041486 Bacteria 599
1055 Ga0451807_1809595 3300041486 Bacteria 577
1056 Ga0451835_0399605 3300041492 Bacteria 737
1057 Ga0451837_0248662 3300041494 Bacteria 1534
1058 Ga0451841_1058791 3300041498 Bacteria 943
1059 Ga0451849_0786616 3300041505 Bacteria 1367
1060 Ga0451855_0152540 3300041511 Bacteria 1762
1061 Ga0451855_1498768 3300041511 Bacteria 991
1062 Ga0451853_0259300 3300041512 Bacteria 777
1063 Ga0451853_1639627 3300041512 Bacteria 853
1064 Ga0439431_0038684 3300041997 Bacteria 1208
1065 Ga0439431_0076865 3300041997 Bacteria 896
1066 Ga0439431_0156020 3300041997 Bacteria 650
1067 Ga0439433_0005951 3300041999 Bacteria 2620
1068 Ga0439442_000004 3300042002 Bacteria 67479
1069 Ga0439443_062105 3300042003 Bacteria 670
1070 Ga0439445_0082482 3300042004 Bacteria 899
1071 Ga0439448_0056999 3300042005 Bacteria 1287
1072 Ga0439432_099743 3300042006 Bacteria 869
1073 Ga0439432_109368 3300042006 Bacteria 823
1074 Ga0439449_0006377 3300042007 Bacteria 4510
1075 Ga0439449_0026523 3300042007 Bacteria 2162
1076 Ga0439449_0126629 3300042007 Bacteria 949
1077 Ga0439452_043370 3300042010 Bacteria 1052
1078 Ga0439455_0005999 3300042012 Bacteria 2499
1079 Ga0439457_005183 3300042014 Bacteria 3309
1080 Ga0439462_0018668 3300042015 Bacteria 1801
1081 Ga0450919_011883 3300042121 Bacteria 988
1082 Ga0450923_059451 3300042125 Bacteria 832
1083 Ga0450923_111802 3300042125 Bacteria 638
1084 Ga0450897_002107 3300042128 Bacteria 1452
1085 Ga0450906_005765 3300042145 Bacteria 2527
1086 Ga0450907_000666 3300042146 Bacteria 8981
1087 Ga0439446_0038799 3300042156 Bacteria 1397
1088 Ga0450908_009279 3300042184 Bacteria 1829
1089 Ga0439434_0000752 3300042435 Bacteria 9302
1090 Ga0439434_0027903 3300042435 Bacteria 1708
1091 Ga0439434_0169683 3300042435 Bacteria 727
1092 Ga0439459_0000384 3300042438 Bacteria 5522
1093 Ga0439464_0010468 3300042439 Bacteria 2449
1094 Ga0439464_0214024 3300042439 Bacteria 617
1095 Ga0439460_0165993 3300042461 Bacteria 742
1096 Ga0439460_0236360 3300042461 Bacteria 629
1097 Ga0450918_006155 3300042531 Bacteria 2141
1098 Ga0451577_0000006 3300042876 Bacteria 709265
1099 Ga0451577_0301573 3300042876 Bacteria 1452
1100 Ga0451577_0382641 3300042876 Bacteria 1277
1101 Ga0451577_0969230 3300042876 Bacteria 764
1102 Ga0466969_0002862 3300044656 Bacteria 9217
1103 Ga0466969_0119995 3300044656 Bacteria 1225
1104 Ga0466972_0056469 3300044658 Bacteria 1888
1105 Ga0466972_0164282 3300044658 Bacteria 1043
1106 Ga0453683_0000088 3300044673 Bacteria 138620
1107 Ga0466965_0113070 3300044683 Bacteria 1397
1108 Ga0466966_0001452 3300044684 Bacteria 15233
1109 Ga0466961_0000659 3300044693 Bacteria 21720
1110 Ga0466961_0272072 3300044693 Bacteria 1038
1111 Ga0466963_0167988 3300044694 Bacteria 1528
1112 Ga0453684_0000037 3300044712 Bacteria 709327
1113 Ga0453684_0001588 3300044712 Bacteria 62596
1114 Ga0453684_0130862 3300044712 Bacteria 3011
1115 Ga0453684_0716670 3300044712 Bacteria 1086
1116 Ga0466971_0000901 3300044719 Bacteria 12185
1117 Ga0466971_0279206 3300044719 Bacteria 799
1118 Ga0466968_0100908 3300044735 Bacteria 1288
1119 Ga0466970_0004965 3300044765 Bacteria 6573
1120 Ga0466970_0213492 3300044765 Bacteria 1076
1121 Ga0466957_0012919 3300044842 Bacteria 4839
1122 Ga0466957_0304632 3300044842 Bacteria 1071
1123 Ga0466957_0314944 3300044842 Bacteria 1054
1124 Ga0466959_0000162 3300045049 Bacteria 44052
1125 Ga0466959_0036896 3300045049 Bacteria 3611
1126 Ga0451576_0022970 3300045051 Bacteria 6759
1127 Ga0466958_0000155 3300045836 Bacteria 24034
1128 Ga0466958_0490304 3300045836 Bacteria 797
1129 Ga0466967_1112395 3300045976 Bacteria 787
1130 Ga0495627_000399 3300046453 Bacteria 38947
1131 Ga0495592_0434713 3300046454 Bacteria 825
1132 Ga0495603_0025742 3300046455 Bacteria 3557
1133 Ga0495603_0030908 3300046455 Bacteria 3225
1134 Ga0495603_0048789 3300046455 Bacteria 2521
1135 Ga0495603_0075258 3300046455 Bacteria 1982
1136 Ga0495603_0115060 3300046455 Bacteria 1568
1137 Ga0495603_0655579 3300046455 Bacteria 601
1138 Ga0495590_0003932 3300046457 Bacteria 6042
1139 Ga0495629_0010441 3300046459 Bacteria 6755
1140 Ga0495629_0011151 3300046459 Bacteria 6530
1141 Ga0495629_0047780 3300046459 Bacteria 3001
1142 Ga0495629_0131561 3300046459 Bacteria 1743
1143 Ga0495638_0038595 3300046460 Bacteria 3033
1144 Ga0495638_0102148 3300046460 Bacteria 1713
1145 Ga0495638_0159678 3300046460 Bacteria 1301
1146 Ga0495638_0293000 3300046460 Bacteria 879
1147 Ga0495641_0001712 3300046461 Bacteria 18335
1148 Ga0495653_0157318 3300046463 Bacteria 1581
1149 Ga0495650_0000269 3300046471 Bacteria 99675
1150 Ga0495650_0002639 3300046471 Bacteria 14025
1151 Ga0495650_0096644 3300046471 Bacteria 1114
1152 Ga0495650_0114351 3300046471 Bacteria 999
1153 Ga0495580_0271136 3300046472 Bacteria 1159
1154 Ga0495582_0000026 3300046473 Bacteria 81238
1155 Ga0495582_0005324 3300046473 Bacteria 7184
1156 Ga0495582_0034380 3300046473 Bacteria 2786
1157 Ga0495605_0119117 3300046474 Bacteria 1198
1158 Ga0495605_0123228 3300046474 Bacteria 1174
1159 Ga0495605_0247733 3300046474 Bacteria 763
1160 Ga0495639_0047249 3300046475 Bacteria 1949
1161 Ga0495639_0201544 3300046475 Bacteria 974
1162 Ga0495662_0003638 3300046476 Bacteria 7771
1163 Ga0495584_0055795 3300046491 Bacteria 1988
1164 Ga0495584_0094537 3300046491 Bacteria 1509
1165 Ga0495584_0267224 3300046491 Bacteria 869
1166 Ga0495584_0411060 3300046491 Bacteria 688
1167 Ga0495584_0456963 3300046491 Bacteria 650
1168 Ga0495585_0023597 3300046492 Bacteria 3530
1169 Ga0495585_0047175 3300046492 Bacteria 2400
1170 Ga0495585_0048221 3300046492 Bacteria 2369
1171 Ga0495594_0042303 3300046499 Bacteria 2495
1172 Ga0495594_0467805 3300046499 Bacteria 717
1173 Ga0495596_0023223 3300046500 Bacteria 2518
1174 Ga0495596_0248560 3300046500 Bacteria 690
1175 Ga0495607_0021661 3300046501 Bacteria 4042
1176 Ga0495607_0021701 3300046501 Bacteria 4038
1177 Ga0495607_0050892 3300046501 Bacteria 2409
1178 Ga0495583_0000650 3300046506 Bacteria 45814
1179 Ga0495583_0044333 3300046506 Bacteria 2064
1180 Ga0495583_0152012 3300046506 Bacteria 959
1181 Ga0495583_0283746 3300046506 Bacteria 660
1182 Ga0495606_0036953 3300046507 Bacteria 3321
1183 Ga0495606_0041810 3300046507 Bacteria 3071
1184 Ga0495606_0082018 3300046507 Bacteria 2003
1185 Ga0495606_0228192 3300046507 Bacteria 1045
1186 Ga0495610_0017211 3300046512 Bacteria 4126
1187 Ga0495610_0029296 3300046512 Bacteria 2901
1188 Ga0495610_0036158 3300046512 Bacteria 2527
1189 Ga0495610_0062120 3300046512 Bacteria 1772
1190 Ga0495620_0053397 3300046515 Bacteria 1711
1191 Ga0495620_0090280 3300046515 Bacteria 1230
1192 Ga0495628_0180042 3300046516 Bacteria 1599
1193 Ga0495630_0394172 3300046517 Bacteria 1061
1194 Ga0495631_0143450 3300046518 Bacteria 1025
1195 Ga0495632_0041761 3300046519 Bacteria 2302
1196 Ga0495632_0189773 3300046519 Bacteria 939
1197 Ga0495637_0015304 3300046520 Bacteria 3598
1198 Ga0495637_0057106 3300046520 Bacteria 1613
1199 Ga0495637_0089253 3300046520 Bacteria 1218
1200 Ga0495643_0002864 3300046522 Bacteria 13105
1201 Ga0495643_0004644 3300046522 Bacteria 9552
1202 Ga0495643_0124706 3300046522 Bacteria 1298
1203 Ga0495643_0302479 3300046522 Bacteria 728
1204 Ga0495644_0056910 3300046523 Bacteria 1469
1205 Ga0495644_0057300 3300046523 Bacteria 1464
1206 Ga0495644_0140726 3300046523 Bacteria 921
1207 Ga0495648_0014211 3300046524 Bacteria 5839
1208 Ga0495648_0070299 3300046524 Bacteria 2034
1209 Ga0495648_0160454 3300046524 Bacteria 1163
1210 Ga0495663_0008611 3300046525 Bacteria 2830
1211 Ga0495663_0010458 3300046525 Bacteria 2581
1212 Ga0495663_0020482 3300046525 Bacteria 1898
1213 Ga0495663_0041507 3300046525 Bacteria 1399
1214 Ga0495663_0091788 3300046525 Bacteria 990
1215 Ga0495666_0006954 3300046526 Bacteria 5685
1216 Ga0495642_0008396 3300046528 Bacteria 3952
1217 Ga0495642_0028275 3300046528 Bacteria 2233
1218 Ga0495642_0039600 3300046528 Bacteria 1913
1219 Ga0495642_0081293 3300046528 Bacteria 1365
1220 Ga0495642_0165305 3300046528 Bacteria 960
1221 Ga0495652_0522347 3300046529 Bacteria 820
1222 Ga0495652_0586238 3300046529 Bacteria 762
1223 Ga0495665_0008026 3300046531 Bacteria 5725
1224 Ga0495665_0030104 3300046531 Bacteria 2905
1225 Ga0495665_0039621 3300046531 Bacteria 2509
1226 Ga0495640_0011449 3300046533 Bacteria 6826
1227 Ga0495640_0509516 3300046533 Bacteria 732
1228 Ga0495586_0006998 3300046535 Bacteria 6011
1229 Ga0495586_0066751 3300046535 Bacteria 1961
1230 Ga0495587_0162159 3300046536 Bacteria 1272
1231 Ga0495598_0003658 3300046537 Bacteria 3283
1232 Ga0495598_0010163 3300046537 Bacteria 2248
1233 Ga0495598_0036334 3300046537 Bacteria 1415
1234 Ga0495609_0011725 3300046538 Bacteria 4168
1235 Ga0495609_0219665 3300046538 Bacteria 789
1236 Ga0495609_0283261 3300046538 Bacteria 677
1237 Ga0495621_0075144 3300046539 Bacteria 1251
1238 Ga0495597_0001666 3300046542 Bacteria 15467
1239 Ga0495597_0020495 3300046542 Bacteria 3078
1240 Ga0495597_0135910 3300046542 Bacteria 1017
1241 Ga0495597_0187444 3300046542 Bacteria 833
1242 Ga0495645_0011297 3300046543 Bacteria 6280
1243 Ga0495645_0188009 3300046543 Bacteria 1410
1244 Ga0495622_0002985 3300046557 Bacteria 8042
1245 Ga0495622_0015094 3300046557 Bacteria 3591
1246 Ga0495633_0008831 3300046558 Bacteria 5627
1247 Ga0495633_0029769 3300046558 Bacteria 2655
1248 Ga0495633_0066972 3300046558 Bacteria 1677
1249 Ga0495633_0071310 3300046558 Bacteria 1620
1250 Ga0495656_0001111 3300046615 Bacteria 8749
1251 Ga0495656_0021465 3300046615 Bacteria 2514
1252 Ga0495656_0022203 3300046615 Bacteria 2482
1253 Ga0495656_0037265 3300046615 Bacteria 2007
1254 Ga0495656_0064313 3300046615 Bacteria 1610
1255 Ga0495668_0001504 3300046616 Bacteria 22287
1256 Ga0495668_0010366 3300046616 Bacteria 5641
1257 Ga0495668_0010401 3300046616 Bacteria 5629
1258 Ga0495668_0015955 3300046616 Bacteria 4375
1259 Ga0495668_0064267 3300046616 Bacteria 2020
1260 Ga0495668_0097894 3300046616 Bacteria 1605
1261 Ga0495668_0326583 3300046616 Bacteria 841
1262 Ga0495634_0013309 3300046642 Bacteria 5946
1263 Ga0495634_0082548 3300046642 Bacteria 2100
1264 Ga0495634_0213993 3300046642 Bacteria 1192
1265 Ga0495611_0005291 3300046648 Bacteria 5527
1266 Ga0495611_0087038 3300046648 Bacteria 1442
1267 Ga0495625_0001925 3300046660 Bacteria 23466
1268 Ga0495625_0029168 3300046660 Bacteria 4129
1269 Ga0495625_0049607 3300046660 Bacteria 3016
1270 Ga0495625_0092672 3300046660 Bacteria 2087
1271 Ga0495625_0255297 3300046660 Bacteria 1136
1272 Ga0495635_0002654 3300046663 Bacteria 12233
1273 Ga0495659_0022021 3300046664 Bacteria 2151
1274 Ga0495659_0034130 3300046664 Bacteria 1788
1275 Ga0495659_0043364 3300046664 Bacteria 1613
1276 Ga0495659_0195772 3300046664 Bacteria 827
1277 Ga0495659_0199604 3300046664 Bacteria 820
1278 Ga0495661_0039834 3300046665 Bacteria 2917
1279 Ga0495661_0433430 3300046665 Bacteria 635
1280 Ga0495588_0033500 3300046674 Bacteria 2594
1281 Ga0495588_0046907 3300046674 Bacteria 2217
1282 Ga0495588_0134261 3300046674 Bacteria 1306
1283 Ga0495588_0289756 3300046674 Bacteria 862
1284 Ga0495657_0177544 3300046675 Bacteria 1309
1285 Ga0495647_0002256 3300046681 Bacteria 6046
1286 Ga0495647_0005065 3300046681 Bacteria 4314
1287 Ga0495647_0119007 3300046681 Bacteria 1109
1288 Ga0495647_0194474 3300046681 Bacteria 887
1289 Ga0495658_0000984 3300046683 Bacteria 15108
1290 Ga0495658_0008704 3300046683 Bacteria 5039
1291 Ga0495658_0066307 3300046683 Bacteria 2085
1292 Ga0495658_0661585 3300046683 Bacteria 669
1293 Ga0495669_0000044 3300046684 Bacteria 85633
1294 Ga0495669_0004323 3300046684 Bacteria 5862
1295 Ga0495669_0050594 3300046684 Bacteria 1863
1296 Ga0495669_0054174 3300046684 Bacteria 1805
1297 Ga0495613_0000576 3300046689 Bacteria 29823
1298 Ga0495613_0001744 3300046689 Bacteria 16553
1299 Ga0495613_0120378 3300046689 Bacteria 1885
1300 Ga0495613_0179718 3300046689 Bacteria 1498
1301 Ga0495624_0005555 3300046690 Bacteria 9074
1302 Ga0495670_0003300 3300046691 Bacteria 7951
1303 Ga0495670_0150002 3300046691 Bacteria 1222
1304 Ga0495670_0164097 3300046691 Bacteria 1168
1305 Ga0495670_0226093 3300046691 Bacteria 994
1306 Ga0495671_0051516 3300046692 Bacteria 2047
1307 Ga0495671_0106856 3300046692 Bacteria 1367
1308 Ga0495671_0214401 3300046692 Bacteria 933
1309 Ga0495649_0000981 3300046694 Bacteria 22495
1310 Ga0495589_0096703 3300046794 Bacteria 1431
1311 Ga0495589_0175592 3300046794 Bacteria 1017
1312 Ga0495600_0592892 3300046809 Bacteria 674
1313 Ga0495660_0035609 3300046810 Bacteria 2780
1314 Ga0495660_0259253 3300046810 Bacteria 803
1315 Ga0495581_0001983 3300047315 Bacteria 11488
1316 Ga0495581_0021863 3300047315 Bacteria 3708
1317 Ga0495581_0127218 3300047315 Bacteria 1484
1318 Ga0495636_0006624 3300047318 Bacteria 4554
1319 Ga0495636_0007362 3300047318 Bacteria 4332
1320 Ga0495636_0038495 3300047318 Bacteria 1979
1321 Ga0495636_0060395 3300047318 Bacteria 1601
1322 Ga0495636_0084264 3300047318 Bacteria 1372
1323 Ga0495636_0355838 3300047318 Bacteria 692
1324 Ga0495636_0440568 3300047318 Bacteria 625
1325 Ga0495674_0014139 3300047319 Bacteria 7477
1326 Ga0495674_0106128 3300047319 Bacteria 2386
1327 Ga0495674_0855791 3300047319 Bacteria 704
1328 Ga0495672_0000439 3300047320 Bacteria 49666
1329 Ga0495672_0074113 3300047320 Bacteria 1918
1330 Ga0495672_0258142 3300047320 Bacteria 842
1331 Ga0495676_0028538 3300047321 Bacteria 4762
1332 Ga0495676_0055381 3300047321 Bacteria 3145
1333 Ga0495676_0121422 3300047321 Bacteria 1900
1334 Ga0495676_0212240 3300047321 Bacteria 1339
1335 Ga0495676_0246773 3300047321 Bacteria 1220
1336 Ga0495676_0364589 3300047321 Bacteria 964
1337 Ga0495680_0012777 3300047322 Bacteria 7364
1338 Ga0495680_0261175 3300047322 Bacteria 1225
1339 Ga0495680_0356648 3300047322 Bacteria 1017
1340 Ga0495683_0003613 3300047323 Bacteria 8973
1341 Ga0495683_0100151 3300047323 Bacteria 1394
1342 Ga0495683_0149520 3300047323 Bacteria 1088
1343 Ga0495687_008468 3300047443 Bacteria 5884
1344 Ga0495677_0011535 3300047445 Bacteria 3232
1345 Ga0495677_0013232 3300047445 Bacteria 3002
1346 Ga0495677_0201361 3300047445 Bacteria 774
1347 Ga0495679_137661 3300047446 Bacteria 660
1348 Ga0495673_0000189 3300047469 Bacteria 99018
1349 Ga0495673_0006882 3300047469 Bacteria 6626
1350 Ga0495673_0118202 3300047469 Bacteria 1052
1351 Ga0495673_0184274 3300047469 Bacteria 789
1352 Ga0495681_0234152 3300047470 Bacteria 731
1353 Ga0495684_0451647 3300047471 Bacteria 893
1354 Ga0495684_0820251 3300047471 Bacteria 606
1355 Ga0495686_0000007 3300047472 Bacteria 732622
1356 Ga0495686_0015147 3300047472 Bacteria 5280
1357 Ga0495686_0029450 3300047472 Bacteria 3571
1358 Ga0495686_0063073 3300047472 Bacteria 2297
1359 Ga0495686_0172695 3300047472 Bacteria 1256
1360 Ga0495686_0182733 3300047472 Bacteria 1214
1361 Ga0495686_0251901 3300047472 Bacteria 992
1362 Ga0495593_0008408 3300047673 Bacteria 6002
1363 Ga0495602_0204492 3300048088 Bacteria 1504
1364 Ga0495614_0007394 3300048089 Bacteria 4891
1365 Ga0495614_0014788 3300048089 Bacteria 3414
1366 Ga0495614_0079716 3300048089 Bacteria 1418
1367 Ga0495615_0002803 3300048090 Bacteria 2838
1368 Ga0495615_0036383 3300048090 Bacteria 1208
1369 Ga0496100_0027948 3300048903 Bacteria 3474
1370 Ga0496100_0028774 3300048903 Bacteria 3430
1371 Ga0496100_0051293 3300048903 Bacteria 2677
1372 Ga0496100_0210999 3300048903 Bacteria 1420
1373 Ga0496100_0241720 3300048903 Bacteria 1332
1374 Ga0496100_0330019 3300048903 Bacteria 1148
1375 Ga0496100_0491453 3300048903 Bacteria 945
1376 Ga0496100_0743659 3300048903 Bacteria 767
1377 Ga0496101_0008514 3300048904 Bacteria 6704
1378 Ga0496101_0017813 3300048904 Bacteria 4821
1379 Ga0496101_0023677 3300048904 Bacteria 4244
1380 Ga0496101_0073312 3300048904 Bacteria 2515
1381 Ga0496101_0132976 3300048904 Bacteria 1890
1382 Ga0496101_0289904 3300048904 Bacteria 1280
1383 Ga0496101_0912715 3300048904 Bacteria 691
1384 Ga0496102_0003818 3300048905 Bacteria 12741
1385 Ga0496102_0018082 3300048905 Bacteria 6187
1386 Ga0496102_0032510 3300048905 Bacteria 4686
1387 Ga0496102_0033599 3300048905 Bacteria 4610
1388 Ga0496102_0090282 3300048905 Bacteria 2835
1389 Ga0496102_0148457 3300048905 Bacteria 2201
1390 Ga0496102_0376843 3300048905 Bacteria 1335
1391 Ga0496102_0526090 3300048905 Bacteria 1105
1392 Ga0496102_0734169 3300048905 Bacteria 910
1393 Ga0496102_1441352 3300048905 Bacteria 607
1394 Ga0496103_0007277 3300048906 Bacteria 6596
1395 Ga0496103_0053056 3300048906 Bacteria 2512
1396 Ga0496103_0107100 3300048906 Bacteria 1773
1397 Ga0496103_0121911 3300048906 Bacteria 1661
1398 Ga0496103_0209555 3300048906 Bacteria 1253
1399 Ga0496103_0264219 3300048906 Bacteria 1107
1400 Ga0496103_0265804 3300048906 Bacteria 1103
1401 Ga0496103_0373127 3300048906 Bacteria 917
1402 Ga0496104_0014856 3300048907 Bacteria 7039
1403 Ga0496104_0039107 3300048907 Bacteria 4440
1404 Ga0496104_0219344 3300048907 Bacteria 1814
1405 Ga0496104_0382441 3300048907 Bacteria 1320
1406 Ga0496104_0553724 3300048907 Bacteria 1061
1407 Ga0496104_0798815 3300048907 Bacteria 850
1408 Ga0496104_1054389 3300048907 Bacteria 717
1409 Ga0496105_0016058 3300048908 Bacteria 5973
1410 Ga0496105_0115382 3300048908 Bacteria 2215
1411 Ga0496105_0153231 3300048908 Bacteria 1894
1412 Ga0496105_0248745 3300048908 Bacteria 1441
1413 Ga0496105_0294063 3300048908 Bacteria 1307
1414 Ga0496106_0002470 3300048909 Bacteria 13780
1415 Ga0496106_0008171 3300048909 Bacteria 7732
1416 Ga0496106_0014990 3300048909 Bacteria 5735
1417 Ga0496106_0037041 3300048909 Bacteria 3648
1418 Ga0496106_0175665 3300048909 Bacteria 1699
1419 Ga0496106_0313037 3300048909 Bacteria 1260
1420 Ga0496107_0000073 3300048910 Bacteria 48489
1421 Ga0496107_0006852 3300048910 Bacteria 7848
1422 Ga0496107_0007516 3300048910 Bacteria 7517
1423 Ga0496107_0020868 3300048910 Bacteria 4631
1424 Ga0496107_0044904 3300048910 Bacteria 3177
1425 Ga0496107_0055567 3300048910 Bacteria 2859
1426 Ga0496107_0083885 3300048910 Bacteria 2324
1427 Ga0496107_0097119 3300048910 Bacteria 2157
1428 Ga0496107_0201518 3300048910 Bacteria 1479
1429 Ga0496108_0009206 3300048911 Bacteria 7994
1430 Ga0496108_0015179 3300048911 Bacteria 6283
1431 Ga0496108_0058890 3300048911 Bacteria 3230
1432 Ga0496108_0083893 3300048911 Bacteria 2703
1433 Ga0496108_0127109 3300048911 Bacteria 2189
1434 Ga0496108_0157383 3300048911 Bacteria 1962
1435 Ga0496108_0368561 3300048911 Bacteria 1254
1436 Ga0496108_0381477 3300048911 Bacteria 1231
1437 Ga0496108_0968083 3300048911 Bacteria 728
1438 Ga0496109_0002583 3300048912 Bacteria 15165
1439 Ga0496109_0010105 3300048912 Bacteria 8051
1440 Ga0496109_0049180 3300048912 Bacteria 3837
1441 Ga0496109_0056408 3300048912 Bacteria 3584
1442 Ga0496109_0162984 3300048912 Bacteria 2089
1443 Ga0496109_0226770 3300048912 Bacteria 1757
1444 Ga0496109_0253905 3300048912 Bacteria 1656
1445 Ga0496109_0314953 3300048912 Bacteria 1476
1446 Ga0496109_0580958 3300048912 Bacteria 1056
1447 Ga0496109_0690016 3300048912 Bacteria 958
1448 Ga0496110_0001862 3300048913 Bacteria 15584
1449 Ga0496110_0016596 3300048913 Bacteria 6149
1450 Ga0496110_0026567 3300048913 Bacteria 4956
1451 Ga0496110_0038216 3300048913 Bacteria 4175
1452 Ga0496110_0110944 3300048913 Bacteria 2465
1453 Ga0496110_0430196 3300048913 Bacteria 1203
1454 Ga0496110_1440191 3300048913 Bacteria 598
1455 Ga0496111_0003250 3300048914 Bacteria 10036
1456 Ga0496111_0024086 3300048914 Bacteria 4281
1457 Ga0496111_0048130 3300048914 Bacteria 3072
1458 Ga0496111_0156346 3300048914 Bacteria 1692
1459 Ga0496112_0010568 3300048915 Bacteria 8383
1460 Ga0496112_0033003 3300048915 Bacteria 5027
1461 Ga0496112_0146086 3300048915 Bacteria 2333
1462 Ga0496112_0175570 3300048915 Bacteria 2107
1463 Ga0496112_0242128 3300048915 Bacteria 1756
1464 Ga0496112_0421211 3300048915 Bacteria 1274
1465 Ga0496113_0035256 3300048916 Bacteria 3658
1466 Ga0496113_0039497 3300048916 Bacteria 3473
1467 Ga0496113_0061435 3300048916 Bacteria 2835
1468 Ga0496114_0001853 3300048917 Bacteria 16012
1469 Ga0496114_0015605 3300048917 Bacteria 6108
1470 Ga0496114_0046931 3300048917 Bacteria 3590
1471 Ga0496114_0099854 3300048917 Bacteria 2476
1472 Ga0496115_0003309 3300048918 Bacteria 11572
1473 Ga0496115_0037796 3300048918 Bacteria 3827
1474 Ga0496115_0047273 3300048918 Bacteria 3441
1475 Ga0496115_0066390 3300048918 Bacteria 2915
1476 Ga0496115_0085120 3300048918 Bacteria 2578
1477 Ga0496115_0348888 3300048918 Bacteria 1207
1478 Ga0496115_0608510 3300048918 Bacteria 868
1479 Ga0496115_0942206 3300048918 Bacteria 663
1480 Ga0496116_0030264 3300048919 Bacteria 3892
1481 Ga0496116_0321775 3300048919 Bacteria 724
1482 Ga0496117_0004445 3300048920 Bacteria 15459
1483 Ga0496117_0006530 3300048920 Bacteria 11750
1484 Ga0496117_0031402 3300048920 Bacteria 4055
1485 Ga0496117_0046658 3300048920 Bacteria 3114
1486 Ga0496117_0193004 3300048920 Bacteria 1158
1487 Ga0496117_0305048 3300048920 Bacteria 841
1488 Ga0496118_0000116 3300048921 Bacteria 145054
1489 Ga0496118_0008749 3300048921 Bacteria 10383
1490 Ga0496118_0018740 3300048921 Bacteria 6219
1491 Ga0496119_0003034 3300048922 Bacteria 17774
1492 Ga0496119_0009462 3300048922 Bacteria 8359
1493 Ga0496119_0023935 3300048922 Bacteria 4313
1494 Ga0496119_0043692 3300048922 Bacteria 2829
1495 Ga0496120_0127975 3300048923 Bacteria 1304
1496 Ga0496120_0173658 3300048923 Bacteria 1064
1497 Ga0496121_0000946 3300048924 Bacteria 52586
1498 Ga0496121_0023808 3300048924 Bacteria 5879
1499 Ga0496121_0027894 3300048924 Bacteria 5273
1500 Ga0496121_0231337 3300048924 Bacteria 1294
1501 Ga0496121_0320914 3300048924 Bacteria 1043
1502 Ga0496121_0336102 3300048924 Bacteria 1011
1503 Ga0496121_0437934 3300048924 Bacteria 846
1504 Ga0496121_0478811 3300048924 Bacteria 795
1505 Ga0496121_0542480 3300048924 Bacteria 729
1506 Ga0496122_0000799 3300048925 Bacteria 60347
1507 Ga0496122_0010341 3300048925 Bacteria 9645
1508 Ga0496122_0011257 3300048925 Bacteria 9089
1509 Ga0496122_0341188 3300048925 Bacteria 787
1510 Ga0496123_0000009 3300048926 Bacteria 509486
1511 Ga0496123_0003905 3300048926 Bacteria 16202
1512 Ga0496123_0130096 3300048926 Bacteria 1396
1513 Ga0496124_0000135 3300048927 Bacteria 152458
1514 Ga0496124_0006965 3300048927 Bacteria 12143
1515 Ga0496124_0008978 3300048927 Bacteria 10348
1516 Ga0496124_0022787 3300048927 Bacteria 5733
1517 Ga0496124_0029307 3300048927 Bacteria 4907
1518 Ga0496124_0158183 3300048927 Bacteria 1769
1519 Ga0496124_0254080 3300048927 Bacteria 1298
1520 Ga0496125_0005322 3300048928 Bacteria 14385
1521 Ga0496125_0067302 3300048928 Bacteria 2823
1522 Ga0496125_0104534 3300048928 Bacteria 2074
1523 Ga0496125_0112323 3300048928 Bacteria 1969
1524 Ga0496126_0007225 3300048929 Bacteria 12216
1525 Ga0496126_0052186 3300048929 Bacteria 3717
1526 Ga0496126_0067161 3300048929 Bacteria 3204
1527 Ga0496126_0373200 3300048929 Bacteria 1163
1528 Ga0496126_0498105 3300048929 Bacteria 974
1529 Ga0501306_010493 3300049127 Bacteria 1167
1530 Ga0501308_000762 3300049128 Bacteria 2287
1531 Ga0501309_000992 3300049129 Bacteria 2589
1532 Ga0501309_019776 3300049129 Bacteria 939
1533 Ga0501309_061009 3300049129 Bacteria 607
1534 Ga0501310_008380 3300049130 Bacteria 1121
1535 Ga0501341_01086 3300049131 Bacteria 1306
1536 Ga0501343_007103 3300049132 Bacteria 882
1537 Ga0501345_03341 3300049134 Bacteria 691
1538 Ga0501304_004692 3300049160 Bacteria 1045
1539 Ga0501305_026696 3300049161 Bacteria 882
1540 Ga0501307_009147 3300049162 Bacteria 1128
1541 Ga0501307_018822 3300049162 Bacteria 881
1542 Ga0495678_005077 3300049459 Bacteria 7394
1543 Ga0501311_001352 3300049527 Bacteria 2099
1544 Ga0501311_005112 3300049527 Bacteria 1424
1545 Ga0501311_020409 3300049527 Bacteria 896
1546 Ga0501311_021938 3300049527 Bacteria 874
1547 Ga0501313_001839 3300049529 Bacteria 1928
1548 Ga0501313_002169 3300049529 Bacteria 1831
1549 Ga0501314_001352 3300049530 Bacteria 1760
1550 Ga0501314_001694 3300049530 Bacteria 1630
1551 Ga0501314_021266 3300049530 Bacteria 676
1552 Ga0501314_027782 3300049530 Bacteria 617
1553 Ga0501315_000692 3300049531 Bacteria 2487
1554 Ga0501315_001500 3300049531 Bacteria 2020
1555 Ga0501315_052691 3300049531 Bacteria 642
1556 Ga0501316_026875 3300049532 Bacteria 755
1557 Ga0501317_000360 3300049533 Bacteria 3067
1558 Ga0501317_002781 3300049533 Bacteria 1687
1559 Ga0501317_006725 3300049533 Bacteria 1275
1560 Ga0501317_010725 3300049533 Bacteria 1101
1561 Ga0501317_013065 3300049533 Bacteria 1033
1562 Ga0501318_000828 3300049534 Bacteria 2170
1563 Ga0501318_001073 3300049534 Bacteria 2023
1564 Ga0501318_009581 3300049534 Bacteria 1059
1565 Ga0501318_025451 3300049534 Bacteria 776
1566 Ga0501319_000008 3300049535 Bacteria 8166
1567 Ga0501319_008189 3300049535 Bacteria 801
1568 Ga0501319_023326 3300049535 Bacteria 566
1569 Ga0501320_009247 3300049536 Bacteria 984
1570 Ga0501321_001497 3300049537 Bacteria 1874
1571 Ga0501321_028545 3300049537 Bacteria 734
1572 Ga0501321_043824 3300049537 Bacteria 637
1573 Ga0501323_002862 3300049539 Bacteria 1715
1574 Ga0501323_010191 3300049539 Bacteria 1118
1575 Ga0501323_029854 3300049539 Bacteria 761
1576 Ga0501323_047648 3300049539 Bacteria 643
1577 Ga0501325_000439 3300049541 Bacteria 1973
1578 Ga0501325_011999 3300049541 Bacteria 809
1579 Ga0501327_00546 3300049543 Bacteria 1553
1580 Ga0501329_01600 3300049545 Bacteria 1013
1581 Ga0501330_003158 3300049546 Bacteria 969
1582 Ga0501330_010360 3300049546 Bacteria 661
1583 Ga0501333_000524 3300049549 Bacteria 1798
1584 Ga0501335_000127 3300049551 Bacteria 3748
1585 Ga0501335_003740 3300049551 Bacteria 1302
1586 Ga0501031_0108493 3300049568 Bacteria 1812
1587 Ga0501031_0337677 3300049568 Bacteria 975
1588 Ga0501031_0471720 3300049568 Bacteria 810
1589 Ga0501032_0001915 3300049569 Bacteria 16407
1590 Ga0501032_0011961 3300049569 Bacteria 6215
1591 Ga0501032_0376622 3300049569 Bacteria 913
1592 Ga0501032_0402229 3300049569 Bacteria 879
1593 Ga0501032_0403667 3300049569 Bacteria 878
1594 Ga0501033_0065847 3300049570 Bacteria 2665
1595 Ga0501033_0071404 3300049570 Bacteria 2550
1596 Ga0501033_0100089 3300049570 Bacteria 2116
1597 Ga0501033_0114091 3300049570 Bacteria 1964
1598 Ga0501033_0179594 3300049570 Bacteria 1518
1599 Ga0501033_0306091 3300049570 Bacteria 1118
1600 Ga0501034_0022444 3300049571 Bacteria 6431
1601 Ga0501034_0070754 3300049571 Bacteria 3499
1602 Ga0501034_0098967 3300049571 Bacteria 2911
1603 Ga0501034_0182168 3300049571 Bacteria 2065
1604 Ga0501034_0204731 3300049571 Bacteria 1930
1605 Ga0501034_0490026 3300049571 Bacteria 1144
1606 Ga0501036_0011903 3300049572 Bacteria 7213
1607 Ga0501036_0044244 3300049572 Bacteria 3771
1608 Ga0501036_0152380 3300049572 Bacteria 1950
1609 Ga0501036_0208859 3300049572 Bacteria 1641
1610 Ga0501036_0243639 3300049572 Bacteria 1507
1611 Ga0501036_0307394 3300049572 Bacteria 1326
1612 Ga0501036_0313477 3300049572 Bacteria 1311
1613 Ga0501036_0523908 3300049572 Bacteria 986
1614 Ga0501036_0544378 3300049572 Bacteria 965
1615 Ga0501036_0937600 3300049572 Bacteria 710
1616 Ga0501037_0011203 3300049573 Bacteria 6600
1617 Ga0501037_0017799 3300049573 Bacteria 5231
1618 Ga0501037_0048505 3300049573 Bacteria 3111
1619 Ga0501037_0522871 3300049573 Bacteria 803
1620 Ga0501038_0007256 3300049574 Bacteria 10233
1621 Ga0501038_0018247 3300049574 Bacteria 6334
1622 Ga0501038_0030826 3300049574 Bacteria 4740
1623 Ga0501038_0102586 3300049574 Bacteria 2380
1624 Ga0501038_0124043 3300049574 Bacteria 2127
1625 Ga0501038_0207166 3300049574 Bacteria 1571
1626 Ga0501038_0623870 3300049574 Bacteria 814
1627 Ga0501039_0013552 3300049575 Bacteria 6235
1628 Ga0501039_0020848 3300049575 Bacteria 5024
1629 Ga0501039_0070692 3300049575 Bacteria 2711
1630 Ga0501039_0088308 3300049575 Bacteria 2415
1631 Ga0501039_0099046 3300049575 Bacteria 2275
1632 Ga0501039_0183875 3300049575 Bacteria 1643
1633 Ga0501039_0366474 3300049575 Bacteria 1132
1634 Ga0501040_0011876 3300049576 Bacteria 5697
1635 Ga0501040_0013956 3300049576 Bacteria 5290
1636 Ga0501040_0030850 3300049576 Bacteria 3622
1637 Ga0501040_0072778 3300049576 Bacteria 2374
1638 Ga0501040_0218554 3300049576 Bacteria 1356
1639 Ga0501040_0235015 3300049576 Bacteria 1305
1640 Ga0501040_0241135 3300049576 Bacteria 1289
1641 Ga0501040_0345860 3300049576 Bacteria 1065
1642 Ga0501041_0009630 3300049577 Bacteria 5696
1643 Ga0501041_0022523 3300049577 Bacteria 3772
1644 Ga0501041_0064655 3300049577 Bacteria 2240
1645 Ga0501041_0067285 3300049577 Bacteria 2196
1646 Ga0501041_0215027 3300049577 Bacteria 1206
1647 Ga0501041_0525725 3300049577 Bacteria 753
1648 Ga0501041_0539023 3300049577 Bacteria 743
1649 Ga0501041_0545089 3300049577 Bacteria 739
1650 Ga0501042_0004476 3300049578 Bacteria 8913
1651 Ga0501042_0103379 3300049578 Bacteria 2049
1652 Ga0501042_0123514 3300049578 Bacteria 1864
1653 Ga0501042_0159447 3300049578 Bacteria 1627
1654 Ga0501042_0161685 3300049578 Bacteria 1616
1655 Ga0501042_0168875 3300049578 Bacteria 1579
1656 Ga0501042_0178051 3300049578 Bacteria 1534
1657 Ga0501042_0271189 3300049578 Bacteria 1225
1658 Ga0501043_0005548 3300049579 Bacteria 10173
1659 Ga0501043_0007625 3300049579 Bacteria 8575
1660 Ga0501043_0038750 3300049579 Bacteria 3748
1661 Ga0501043_0046549 3300049579 Bacteria 3411
1662 Ga0501043_0260557 3300049579 Bacteria 1334
1663 Ga0501043_0262212 3300049579 Bacteria 1328
1664 Ga0501043_0333158 3300049579 Bacteria 1155
1665 Ga0501043_0337664 3300049579 Bacteria 1146
1666 Ga0501046_0028648 3300049580 Bacteria 4534
1667 Ga0501046_0133876 3300049580 Bacteria 1878
1668 Ga0501046_0134060 3300049580 Bacteria 1877
1669 Ga0501047_0000278 3300049581 Bacteria 59271
1670 Ga0501047_0034449 3300049581 Bacteria 4889
1671 Ga0501047_0067110 3300049581 Bacteria 3457
1672 Ga0501047_0071357 3300049581 Bacteria 3343
1673 Ga0501047_0135577 3300049581 Bacteria 2342
1674 Ga0501047_0141054 3300049581 Bacteria 2288
1675 Ga0501047_0162817 3300049581 Bacteria 2102
1676 Ga0501047_0370072 3300049581 Bacteria 1268
1677 Ga0501047_0566768 3300049581 Bacteria 959
1678 Ga0501048_0007798 3300049582 Bacteria 8118
1679 Ga0501048_0163054 3300049582 Bacteria 1578
1680 Ga0501048_0173386 3300049582 Bacteria 1528
1681 Ga0501048_0265626 3300049582 Bacteria 1219
1682 Ga0501067_0007685 3300049583 Bacteria 5996
1683 Ga0501067_0009378 3300049583 Bacteria 5422
1684 Ga0501067_0104720 3300049583 Bacteria 1572
1685 Ga0501068_0002132 3300049584 Bacteria 10536
1686 Ga0501068_0010558 3300049584 Bacteria 5191
1687 Ga0501068_0047975 3300049584 Bacteria 2577
1688 Ga0501068_0053272 3300049584 Bacteria 2449
1689 Ga0501068_0228161 3300049584 Bacteria 1184
1690 Ga0501069_0262350 3300049585 Bacteria 1009
1691 Ga0501069_0384253 3300049585 Bacteria 829
1692 Ga0501069_0422584 3300049585 Bacteria 790
1693 Ga0501069_0481799 3300049585 Bacteria 739
1694 Ga0501070_0003383 3300049586 Bacteria 13839
1695 Ga0501070_0032293 3300049586 Bacteria 4381
1696 Ga0501070_0060195 3300049586 Bacteria 3148
1697 Ga0501070_0168040 3300049586 Bacteria 1807
1698 Ga0501071_0000119 3300049587 Bacteria 31338
1699 Ga0501071_0018369 3300049587 Bacteria 4840
1700 Ga0501071_0085300 3300049587 Bacteria 2315
1701 Ga0501071_0118385 3300049587 Bacteria 1962
1702 Ga0501071_0140578 3300049587 Bacteria 1797
1703 Ga0501071_0288153 3300049587 Bacteria 1243
1704 Ga0501071_0323264 3300049587 Bacteria 1172
1705 Ga0501071_0595865 3300049587 Bacteria 850
1706 Ga0501071_0661802 3300049587 Bacteria 804
1707 Ga0501072_0015537 3300049588 Bacteria 5832
1708 Ga0501072_0063412 3300049588 Bacteria 2915
1709 Ga0501072_0080713 3300049588 Bacteria 2577
1710 Ga0501072_0153545 3300049588 Bacteria 1836
1711 Ga0501072_0176454 3300049588 Bacteria 1704
1712 Ga0501072_0204030 3300049588 Bacteria 1576
1713 Ga0501072_0261631 3300049588 Bacteria 1377
1714 Ga0501072_0686562 3300049588 Bacteria 805
1715 Ga0501072_0816256 3300049588 Bacteria 730
1716 Ga0501073_0000083 3300049589 Bacteria 59733
1717 Ga0501073_0012875 3300049589 Bacteria 6097
1718 Ga0501073_0026724 3300049589 Bacteria 4133
1719 Ga0501073_0030425 3300049589 Bacteria 3855
1720 Ga0501074_0069698 3300049590 Bacteria 2528
1721 Ga0501074_0160383 3300049590 Bacteria 1606
1722 Ga0501074_0181543 3300049590 Bacteria 1501
1723 Ga0501074_0233789 3300049590 Bacteria 1308
1724 Ga0501074_0242265 3300049590 Bacteria 1282
1725 Ga0501074_0806648 3300049590 Bacteria 661
1726 Ga0501075_0002249 3300049591 Bacteria 12793
1727 Ga0501075_0035289 3300049591 Bacteria 3728
1728 Ga0501075_0144877 3300049591 Bacteria 1810
1729 Ga0501075_0393131 3300049591 Bacteria 1057
1730 Ga0501075_0408013 3300049591 Bacteria 1036
1731 Ga0501075_0415515 3300049591 Bacteria 1026
1732 Ga0501075_0486014 3300049591 Bacteria 942
1733 Ga0501075_0580310 3300049591 Bacteria 855
1734 Ga0501075_0662922 3300049591 Bacteria 795
1735 Ga0501076_0012269 3300049592 Bacteria 6408
1736 Ga0501076_0040602 3300049592 Bacteria 3657
1737 Ga0501076_0157759 3300049592 Bacteria 1848
1738 Ga0501076_0209858 3300049592 Bacteria 1591
1739 Ga0501076_0268317 3300049592 Bacteria 1397
1740 Ga0501076_0274317 3300049592 Bacteria 1381
1741 Ga0501076_0295747 3300049592 Bacteria 1327
1742 Ga0501076_0941435 3300049592 Bacteria 712
1743 Ga0501076_1103686 3300049592 Bacteria 653
1744 Ga0501077_0000088 3300049593 Bacteria 46551
1745 Ga0501077_0027673 3300049593 Bacteria 3599
1746 Ga0501077_0064481 3300049593 Bacteria 2324
1747 Ga0501077_0077464 3300049593 Bacteria 2106
1748 Ga0501077_0117509 3300049593 Bacteria 1685
1749 Ga0501077_0144574 3300049593 Bacteria 1509
1750 Ga0501238_000438 3300049671 Bacteria 4864
1751 Ga0501257_005035 3300049686 Bacteria 2899
1752 Ga0501079_0016993 3300049741 Bacteria 5557
1753 Ga0501079_0046905 3300049741 Bacteria 3334
1754 Ga0501079_0079813 3300049741 Bacteria 2530
1755 Ga0501079_0082541 3300049741 Bacteria 2485
1756 Ga0501079_0136256 3300049741 Bacteria 1911
1757 Ga0501079_0179356 3300049741 Bacteria 1652
1758 Ga0501079_0300557 3300049741 Bacteria 1256
1759 Ga0501079_0514654 3300049741 Bacteria 941
1760 Ga0501079_0632423 3300049741 Bacteria 842
1761 Ga0501080_0003162 3300049742 Bacteria 14508
1762 Ga0501080_0004733 3300049742 Bacteria 12134
1763 Ga0501080_0101916 3300049742 Bacteria 2663
1764 Ga0501080_0662198 3300049742 Bacteria 923
1765 Ga0501081_0065372 3300049743 Bacteria 2528
1766 Ga0501081_0147367 3300049743 Bacteria 1689
1767 Ga0501081_0303982 3300049743 Bacteria 1170
1768 Ga0501081_0362931 3300049743 Bacteria 1069
1769 Ga0501083_0007861 3300049744 Bacteria 7555
1770 Ga0501083_0179333 3300049744 Bacteria 1383
1771 Ga0501083_0212775 3300049744 Bacteria 1260
1772 Ga0501263_014075 3300049760 Bacteria 1021
1773 Ga0501035_0006382 3300049822 Bacteria 11088
1774 Ga0501035_0033582 3300049822 Bacteria 4665
1775 Ga0501035_0083246 3300049822 Bacteria 2823
1776 Ga0501035_0085396 3300049822 Bacteria 2782
1777 Ga0501035_0881853 3300049822 Bacteria 710
1778 Ga0501044_0002166 3300049823 Bacteria 22521
1779 Ga0501044_0012437 3300049823 Bacteria 9216
1780 Ga0501044_0015806 3300049823 Bacteria 8125
1781 Ga0501044_0210123 3300049823 Bacteria 1901
1782 Ga0501044_0223450 3300049823 Bacteria 1833
1783 Ga0501044_0404179 3300049823 Bacteria 1278
1784 Ga0501044_0664164 3300049823 Bacteria 930
1785 Ga0501044_1133459 3300049823 Bacteria 651
1786 Ga0501045_0026884 3300049824 Bacteria 4141
1787 Ga0501045_0055099 3300049824 Bacteria 2908
1788 Ga0501045_0079358 3300049824 Bacteria 2420
1789 Ga0501045_0160621 3300049824 Bacteria 1672
1790 Ga0501045_0239404 3300049824 Bacteria 1351
1791 Ga0501045_0246640 3300049824 Bacteria 1329
1792 Ga0501045_0467885 3300049824 Bacteria 937
1793 nmdc:mga03683_100605_c2 3300050489 Bacteria 977
1794 nmdc:mga03683_179271_c1 3300050489 Bacteria 966
1795 nmdc:mga03n38_34767_c1 3300050490 Bacteria 2154
1796 nmdc:mga03n38_43058_c1 3300050490 Bacteria 1977
1797 nmdc:mga03n38_43132_c1 3300050490 Bacteria 1976
1798 nmdc:mga0yw44_117405_c1 3300050492 Bacteria 1711
1799 nmdc:mga0yw44_61628_c1 3300050492 Bacteria 2302
1800 nmdc:mga0yw44_69406_c1 3300050492 Bacteria 2183
1801 nmdc:mga0k408_11918_c1 3300050493 Bacteria 4743
1802 nmdc:mga0k408_16271_c1 3300050493 Bacteria 4125
1803 nmdc:mga0k408_3470_c1 3300050493 Bacteria 8345
1804 nmdc:mga06z11_4918_c1 3300050494 Bacteria 5305
1805 nmdc:mga07m45_186267_c1 3300050496 Bacteria 1207
1806 nmdc:mga07m45_221564_c1 3300050496 Bacteria 1100
1807 nmdc:mga07m45_31868_c1 3300050496 Bacteria 2922
1808 nmdc:mga07m45_44026_c1 3300050496 Bacteria 2504
1809 nmdc:mga07m45_495427_c1 3300050496 Bacteria 708
1810 nmdc:mga05p37_10502_c1 3300050507 Bacteria 10983
1811 nmdc:mga05p37_1689242_c1 3300050507 Bacteria 618
1812 nmdc:mga05p37_17560_c2 3300050507 Bacteria 7255
1813 nmdc:mga05p37_267849_c1 3300050507 Bacteria 2042
1814 nmdc:mga05p37_33504_c1 3300050507 Bacteria 6292
1815 nmdc:mga05p37_406737_c1 3300050507 Bacteria 1588
1816 nmdc:mga05p37_41972_c1 3300050507 Bacteria 5619
1817 nmdc:mga05p37_51408_c1 3300050507 Bacteria 5068
1818 nmdc:mga05p37_89093_c1 3300050507 Bacteria 3802
1819 nmdc:mga09592_13664_c1 3300050508 Bacteria 6635
1820 nmdc:mga09592_227751_c1 3300050508 Bacteria 1615
1821 nmdc:mga09592_36262_c1 3300050508 Bacteria 4130
1822 nmdc:mga0qj67_15087_c1 3300050509 Bacteria 5847
1823 nmdc:mga0qj67_173810_c1 3300050509 Bacteria 1749
1824 nmdc:mga0qj67_371991_c1 3300050509 Bacteria 1154
1825 nmdc:mga0qj67_52086_c1 3300050509 Bacteria 3238
1826 nmdc:mga06r32_207130_c1 3300050510 Bacteria 1949
1827 nmdc:mga06r32_53547_c1 3300050510 Bacteria 3866
1828 nmdc:mga08y16_129080_c1 3300050511 Bacteria 2630
1829 nmdc:mga08y16_185182_c1 3300050511 Bacteria 2161
1830 nmdc:mga08y16_262435_c1 3300050511 Bacteria 1784
1831 nmdc:mga08y16_287696_c1 3300050511 Bacteria 1695
1832 nmdc:mga08y16_583372_c1 3300050511 Bacteria 1128
1833 nmdc:mga08y16_720301_c1 3300050511 Bacteria 996
1834 nmdc:mga0n895_1534_c1 3300050512 Bacteria 17352
1835 nmdc:mga0n895_204400_c1 3300050512 Bacteria 2006
1836 nmdc:mga0n895_277446_c1 3300050512 Bacteria 1700
1837 nmdc:mga0rr50_582791_c1 3300050513 Bacteria 953
1838 nmdc:mga0rr50_7611_c1 3300050513 Bacteria 6697
1839 nmdc:mga08x19_63444_c1 3300050514 Bacteria 2397
1840 nmdc:mga0a205_1011_c1 3300050515 Bacteria 23356
1841 nmdc:mga0a205_357385_c1 3300050515 Bacteria 1327
1842 nmdc:mga0a205_3780_c1 3300050515 Bacteria 13551
1843 nmdc:mga0a205_890_c1 3300050515 Bacteria 24549
1844 nmdc:mga0sz30_17058_c1 3300050516 Bacteria 2892
1845 Ga0495601_0532531 3300053077 Bacteria 757
1846 Ga0500635_0000205 3300053080 Bacteria 29287
1847 Ga0500635_0152709 3300053080 Bacteria 882
1848 Ga0495655_0025363 3300053083 Bacteria 1386
1849 Ga0495655_0119097 3300053083 Bacteria 802
1850 Ga0495619_0011120 3300053085 Bacteria 5661
1851 Ga0495619_0741693 3300053085 Bacteria 666
1852 Ga0500578_0000459 3300053086 Bacteria 49572
1853 Ga0500643_001398 3300053087 Bacteria 13944
1854 Ga0500643_045106 3300053087 Bacteria 1278
1855 Ga0500644_0000193 3300053088 Bacteria 37831
1856 Ga0500644_0004906 3300053088 Bacteria 3364
1857 Ga0500646_0273895 3300053090 Bacteria 599
1858 Ga0500647_0003466 3300053091 Bacteria 6142
1859 Ga0500583_0043876 3300053092 Bacteria 2044
1860 Ga0500651_0003210 3300053093 Bacteria 8883
1861 Ga0500651_0066265 3300053093 Bacteria 2249
1862 Ga0500651_0151229 3300053093 Bacteria 1394
1863 Ga0500566_0306669 3300053094 Bacteria 745
1864 Ga0500641_0000731 3300053096 Bacteria 11909
1865 Ga0500641_0010127 3300053096 Bacteria 3400
1866 Ga0500641_0010509 3300053096 Bacteria 3346
1867 Ga0500554_048927 3300053102 Bacteria 1324
1868 Ga0500555_000830 3300053103 Bacteria 11035
1869 Ga0500555_049020 3300053103 Bacteria 1159
1870 Ga0500556_0000151 3300053104 Bacteria 57882
1871 Ga0500556_0001077 3300053104 Bacteria 13785
1872 Ga0500556_0065074 3300053104 Bacteria 1351
1873 Ga0500562_000644 3300053108 Bacteria 8433
1874 Ga0500562_004235 3300053108 Bacteria 3627
1875 Ga0500562_026039 3300053108 Bacteria 1532
1876 Ga0500572_000706 3300053111 Bacteria 10831
1877 Ga0500572_151849 3300053111 Bacteria 756
1878 Ga0500593_000419 3300053117 Bacteria 16785
1879 Ga0500594_0004036 3300053118 Bacteria 3230
1880 Ga0500594_0215828 3300053118 Bacteria 633
1881 Ga0500595_001651 3300053119 Bacteria 11721
1882 Ga0500595_026433 3300053119 Bacteria 2000
1883 Ga0500595_038381 3300053119 Bacteria 1557
1884 Ga0500608_000222 3300053122 Bacteria 22331
1885 Ga0500608_001997 3300053122 Bacteria 7304
1886 Ga0500614_000617 3300053123 Bacteria 9057
1887 Ga0500618_000703 3300053125 Bacteria 19670
1888 Ga0500642_0153818 3300053130 Bacteria 1079
1889 Ga0500642_0312929 3300053130 Bacteria 706
1890 Ga0500655_001124 3300053133 Bacteria 5107
1891 Ga0500658_0000930 3300053134 Bacteria 11933
1892 Ga0500658_0116458 3300053134 Bacteria 1181
1893 Ga0500559_0000050 3300053136 Bacteria 93262
1894 Ga0500559_0000164 3300053136 Bacteria 52626
1895 Ga0500559_0001398 3300053136 Bacteria 13721
1896 Ga0500559_0011392 3300053136 Bacteria 3799
1897 Ga0500559_0021969 3300053136 Bacteria 2706
1898 Ga0500559_0132725 3300053136 Bacteria 1163
1899 Ga0500559_0151466 3300053136 Bacteria 1089
1900 Ga0500559_0246886 3300053136 Bacteria 841
1901 Ga0500564_031554 3300053138 Bacteria 2441
1902 Ga0500573_0006750 3300053140 Bacteria 6226
1903 Ga0500573_0016494 3300053140 Bacteria 4192
1904 Ga0500573_0201910 3300053140 Bacteria 1054
1905 Ga0500573_0230252 3300053140 Bacteria 966
1906 Ga0500573_0279000 3300053140 Bacteria 846
1907 Ga0500573_0449444 3300053140 Bacteria 596
1908 Ga0500577_0308540 3300053142 Bacteria 691
1909 Ga0500577_0314041 3300053142 Bacteria 684
1910 Ga0500590_004741 3300053148 Bacteria 6459
1911 Ga0500590_178526 3300053148 Bacteria 925
1912 Ga0500616_0000947 3300053153 Bacteria 31587
1913 Ga0500616_0024622 3300053153 Bacteria 3342
1914 Ga0500616_0183761 3300053153 Bacteria 939
1915 Ga0500620_051382 3300053155 Bacteria 1383
1916 Ga0500622_0000771 3300053156 Bacteria 27846
1917 Ga0500622_0002771 3300053156 Bacteria 12332
1918 Ga0500622_0040896 3300053156 Bacteria 2413
1919 Ga0500622_0292388 3300053156 Bacteria 697
1920 Ga0500627_0001516 3300053158 Bacteria 6534
1921 Ga0500638_128492 3300053162 Bacteria 1151
1922 Ga0500639_198485 3300053163 Bacteria 865
1923 Ga0500636_0010869 3300053177 Bacteria 5320
1924 Ga0500636_0032046 3300053177 Bacteria 3110
1925 Ga0500636_0306259 3300053177 Bacteria 779
1926 Ga0500576_019330 3300053725 Bacteria 3107
1927 Ga0500625_054205 3300053729 Bacteria 1842
1928 Ga0500645_002894 3300053730 Bacteria 7334
1929 Ga0500609_000093 3300053731 Bacteria 11592
1930 Ga0500596_000363 3300053735 Bacteria 8223
1931 Ga0501084_0009653 3300054114 Bacteria 7984
1932 Ga0501084_0051696 3300054114 Bacteria 3439
1933 Ga0501084_0080694 3300054114 Bacteria 2728
1934 Ga0501084_0237792 3300054114 Bacteria 1537
1935 Ga0590075_006327 3300059424 Bacteria 2809
1936 Ga0590075_036350 3300059424 Bacteria 1255
1937 Ga0587084_002366 3300059477 Bacteria 1944
1938 Ga0587084_039138 3300059477 Bacteria 798
1939 Ga0587093_050884 3300059478 Bacteria 654
1940 Ga0587066_047796 3300059490 Bacteria 831
1941 Ga0587066_088959 3300059490 Bacteria 682
1942 Ga0587070_010066 3300059491 Bacteria 1384
1943 Ga0587070_026479 3300059491 Bacteria 1019
1944 Ga0587070_035675 3300059491 Bacteria 926
1945 Ga0587077_000756 3300059493 Bacteria 3063
1946 Ga0587077_015902 3300059493 Bacteria 1260
1947 Ga0587077_036886 3300059493 Bacteria 962
1948 Ga0587077_043657 3300059493 Bacteria 910
1949 Ga0587077_051251 3300059493 Bacteria 864
1950 Ga0587080_053827 3300059503 Bacteria 767
1951 Ga0587083_0045794 3300059505 Bacteria 935
1952 Ga0587086_012095 3300059507 Bacteria 1068
1953 Ga0587086_040749 3300059507 Bacteria 718
1954 Ga0587088_001655 3300059508 Bacteria 2363
1955 Ga0587088_047967 3300059508 Bacteria 827
1956 Ga0587088_083504 3300059508 Bacteria 688
1957 Ga0587089_013933 3300059509 Bacteria 1045
1958 Ga0587090_000805 3300059510 Bacteria 2877
1959 Ga0587090_000870 3300059510 Bacteria 2810
1960 Ga0587090_012104 3300059510 Bacteria 1225
1961 Ga0587090_014184 3300059510 Bacteria 1162
1962 Ga0587090_097093 3300059510 Bacteria 612
1963 Ga0587091_025641 3300059511 Bacteria 1068
1964 Ga0587091_030410 3300059511 Bacteria 1010
1965 Ga0587092_063402 3300059512 Bacteria 696
1966 Ga0587094_035122 3300059513 Bacteria 794
1967 Ga0587095_000137 3300059514 Bacteria 3032
1968 Ga0587097_02033 3300059603 Bacteria 783
1969 Ga0587098_004890 3300059604 Bacteria 1288
1970 Ga0587098_024447 3300059604 Bacteria 792
1971 Ga0587106_001859 3300059605 Bacteria 1969
1972 Ga0587106_007267 3300059605 Bacteria 1339
1973 Ga0587106_032870 3300059605 Bacteria 842
1974 Ga0587125_000214 3300059607 Bacteria 2903
1975 Ga0587131_000266 3300059609 Bacteria 1910
1976 Ga0587099_011423 3300059622 Bacteria 900
1977 Ga0587099_012233 3300059622 Bacteria 880
1978 Ga0587101_005901 3300059623 Bacteria 1381
1979 Ga0587101_021575 3300059623 Bacteria 932
1980 Ga0587101_048491 3300059623 Bacteria 724
1981 Ga0587101_051013 3300059623 Bacteria 713
1982 Ga0587109_078434 3300059624 Bacteria 726
1983 Ga0587109_105581 3300059624 Bacteria 652
1984 Ga0587109_114759 3300059624 Bacteria 633
1985 Ga0587113_002263 3300059625 Bacteria 1365
1986 Ga0587115_000438 3300059626 Bacteria 3053
1987 Ga0587117_040625 3300059627 Bacteria 739
1988 Ga0587122_007483 3300059628 Bacteria 970
1989 Ga0587122_014505 3300059628 Bacteria 795
1990 Ga0587128_018969 3300059630 Bacteria 1036
1991 Ga0587128_052364 3300059630 Bacteria 749
1992 Ga0587062_006597 3300059639 Bacteria 1325
1993 Ga0587062_055529 3300059639 Bacteria 682
1994 Ga0587067_026656 3300059640 Bacteria 1037
1995 Ga0587068_014409 3300059641 Bacteria 1232
1996 Ga0587068_021381 3300059641 Bacteria 1065
1997 Ga0587068_028286 3300059641 Bacteria 958
1998 Ga0587069_001327 3300059642 Bacteria 2234
1999 Ga0587069_046351 3300059642 Bacteria 759
2000 Ga0587069_053340 3300059642 Bacteria 726
2001 Ga0587069_055484 3300059642 Bacteria 717
2002 Ga0587072_012807 3300059643 Bacteria 1391
2003 Ga0587072_021197 3300059643 Bacteria 1151
2004 Ga0587072_036526 3300059643 Bacteria 939
2005 Ga0587072_040187 3300059643 Bacteria 906
2006 Ga0587075_032057 3300059644 Bacteria 842
2007 Ga0587075_032730 3300059644 Bacteria 836
2008 Ga0587075_052454 3300059644 Bacteria 715
2009 Ga0587076_006682 3300059645 Bacteria 1547
2010 Ga0587076_011237 3300059645 Bacteria 1311
2011 Ga0587076_019780 3300059645 Bacteria 1098
2012 Ga0587076_023453 3300059645 Bacteria 1040
2013 Ga0587078_039606 3300059646 Bacteria 662
2014 Ga0587078_040986 3300059646 Bacteria 654
2015 Ga0587079_015245 3300059647 Bacteria 1302
2016 Ga0587079_077491 3300059647 Bacteria 754
2017 Ga0587079_080702 3300059647 Bacteria 743
2018 Ga0587100_005861 3300059648 Bacteria 928
2019 Ga0587104_007589 3300059650 Bacteria 755
2020 Ga0587105_003333 3300059651 Bacteria 972
2021 Ga0587105_006622 3300059651 Bacteria 801
2022 Ga0587107_013746 3300059652 Bacteria 1031
2023 Ga0587107_059567 3300059652 Bacteria 670
2024 Ga0587108_010053 3300059653 Bacteria 789
2025 Ga0587114_003562 3300059655 Bacteria 1557
2026 Ga0587118_12068 3300059657 Bacteria 670
2027 Ga0587118_12173 3300059657 Bacteria 668
2028 Ga0587124_000156 3300059660 Bacteria 3038
2029 Ga0587071_002314 3300060344 Bacteria 2569
2030 Ga0587071_004686 3300060344 Bacteria 2055
2031 Ga0587071_010510 3300060344 Bacteria 1546
2032 Ga0587071_024712 3300060344 Bacteria 1123
2033 Ga0587071_030204 3300060344 Bacteria 1040
2034 Ga0587071_057034 3300060344 Bacteria 821
2035 Ga0587111_0038656 3300060346 Bacteria 1008
2036 Ga0587111_0069972 3300060346 Bacteria 817
2037 Ga0587111_0086541 3300060346 Bacteria 758
2038 Ga0501082_0049068 3300060353 Bacteria 3640
2039 Ga0501082_0056952 3300060353 Bacteria 3368
2040 Ga0501082_0067137 3300060353 Bacteria 3088
2041 Ga0501082_0125074 3300060353 Bacteria 2230
2042 Ga0501082_0206605 3300060353 Bacteria 1708
2043 Ga0501082_0319389 3300060353 Bacteria 1353
2044 Ga0501082_0363843 3300060353 Bacteria 1262
2045 Ga0501082_0451649 3300060353 Bacteria 1123
2046 Ga0501082_0573781 3300060353 Bacteria 987
2047 Ga0501082_0828328 3300060353 Bacteria 809
2048 Ga0466962_0003721 3300061719 Bacteria 7277
2049 Ga0530510_0008283 3300061734 Bacteria 7248
2050 Ga0530510_0057241 3300061734 Bacteria 2816
2051 Ga0530510_0119041 3300061734 Bacteria 1938
2052 Ga0530510_0125085 3300061734 Bacteria 1890
2053 Ga0530510_0188773 3300061734 Bacteria 1529
2054 Ga0530510_0189448 3300061734 Bacteria 1527
2055 Ga0530510_0680445 3300061734 Bacteria 784

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0001588 Ga0453684_0001588_370_942 148
2 3300049568 Ga0501031_0471720 Ga0501031_0471720_87_623 151
3 3300049570 Ga0501033_0306091 Ga0501033_0306091_501_1037 151
4 3300049571 Ga0501034_0070754 Ga0501034_0070754_227_763 151
5 3300049573 Ga0501037_0048505 Ga0501037_0048505_131_667 151
6 3300049574 Ga0501038_0007256 Ga0501038_0007256_8070_8606 151
7 3300049575 Ga0501039_0088308 Ga0501039_0088308_981_1517 151
8 3300049579 Ga0501043_0005548 Ga0501043_0005548_634_1170 151
9 3300049581 Ga0501047_0067110 Ga0501047_0067110_1211_1747 151
10 3300049584 Ga0501068_0010558 Ga0501068_0010558_2011_2547 151
11 3300049589 Ga0501073_0012875 Ga0501073_0012875_2412_2948 151
12 3300049590 Ga0501074_0160383 Ga0501074_0160383_279_815 151
13 3300049742 Ga0501080_0004733 Ga0501080_0004733_8923_9459 151
14 3300049744 Ga0501083_0007861 Ga0501083_0007861_795_1331 151
15 3300049822 Ga0501035_0006382 Ga0501035_0006382_6335_6871 151
16 3300060353 Ga0501082_0067137 Ga0501082_0067137_593_1129 151
17 3300049572 Ga0501036_0313477 Ga0501036_0313477_174_710 152
18 3300049592 Ga0501076_0295747 Ga0501076_0295747_246_782 152
19 3300049744 Ga0501083_0212775 Ga0501083_0212775_621_1157 152
20 3300049588 Ga0501072_0816256 Ga0501072_0816256_253_720 154
21 3300048907 Ga0496104_0382441 Ga0496104_0382441_315_836 155
22 3300048908 Ga0496105_0153231 Ga0496105_0153231_1073_1594 155
23 3300048918 Ga0496115_0942206 Ga0496115_0942206_121_642 155
24 3300049823 Ga0501044_0012437 Ga0501044_0012437_8005_8541 155
25 3300014969 Ga0157376_10359201 Ga0157376_103592012 156
26 3300006237 Ga0097621_100367617 Ga0097621_1003676171 157
27 3300010375 Ga0105239_11414849 Ga0105239_114148492 157
28 3300059424 Ga0590075_036350 Ga0590075_036350_148_696 158
29 3300005329 Ga0070683_100081513 Ga0070683_1000815136 159
30 3300006846 Ga0075430_100147527 Ga0075430_1001475274 159
31 3300025944 Ga0207661_10115948 Ga0207661_101159485 159
32 3300048907 Ga0496104_0798815 Ga0496104_0798815_170_703 159
33 3300048911 Ga0496108_0368561 Ga0496108_0368561_149_682 159
34 3300050509 nmdc:mga0qj67_371991_c1 nmdc:mga0qj67_371991_c1_302_838 159
35 3300005466 Ga0070685_10018528 Ga0070685_100185285 160
36 3300045836 Ga0466958_0490304 Ga0466958_0490304_303_785 160
37 3300047472 Ga0495686_0063073 Ga0495686_0063073_1184_1720 160
38 3300048905 Ga0496102_0526090 Ga0496102_0526090_47_529 160
39 3300025909 Ga0207705_11194253 Ga0207705_111942531 161
40 3300026142 Ga0207698_10675599 Ga0207698_106755992 161
41 3300026142 Ga0207698_11053008 Ga0207698_110530082 161
42 3300047446 Ga0495679_137661 Ga0495679_137661_59_592 161
43 3300049532 Ga0501316_026875 Ga0501316_026875_15_500 161
44 3300005546 Ga0070696_100004194 Ga0070696_10000419410 162
45 3300005719 Ga0068861_101473182 Ga0068861_1014731822 162
46 3300009176 Ga0105242_10410072 Ga0105242_104100723 162
47 3300025907 Ga0207645_10268329 Ga0207645_102683292 162
48 3300025934 Ga0207686_10051931 Ga0207686_100519315 162
49 3300025935 Ga0207709_10016640 Ga0207709_100166406 162
50 3300037312 Ga0395899_0479586 Ga0395899_0479586_68_619 162
51 3300037418 Ga0395900_0190675 Ga0395900_0190675_503_1054 162
52 3300037466 Ga0395898_0901510 Ga0395898_0901510_85_636 162
53 3300037471 Ga0395905_0114143 Ga0395905_0114143_1766_2317 162
54 3300038443 Ga0395901_0146305 Ga0395901_0146305_830_1381 162
55 3300046454 Ga0495592_0434713 Ga0495592_0434713_241_774 162
56 3300046516 Ga0495628_0180042 Ga0495628_0180042_755_1288 162
57 3300046517 Ga0495630_0394172 Ga0495630_0394172_474_1007 162
58 3300046529 Ga0495652_0522347 Ga0495652_0522347_180_713 162
59 3300046543 Ga0495645_0011297 Ga0495645_0011297_5344_5877 162
60 3300047319 Ga0495674_0106128 Ga0495674_0106128_535_1068 162
61 3300047471 Ga0495684_0451647 Ga0495684_0451647_13_546 162
62 3300048915 Ga0496112_0175570 Ga0496112_0175570_750_1283 162
63 3300049569 Ga0501032_0001915 Ga0501032_0001915_3862_4398 162
64 3300049572 Ga0501036_0044244 Ga0501036_0044244_2726_3262 162
65 3300049573 Ga0501037_0017799 Ga0501037_0017799_2552_3088 162
66 3300049579 Ga0501043_0046549 Ga0501043_0046549_2577_3113 162
67 3300049583 Ga0501067_0009378 Ga0501067_0009378_2042_2578 162
68 3300049584 Ga0501068_0002132 Ga0501068_0002132_745_1281 162
69 3300049589 Ga0501073_0000083 Ga0501073_0000083_40912_41448 162
70 3300049593 Ga0501077_0000088 Ga0501077_0000088_17554_18090 162
71 3300049742 Ga0501080_0003162 Ga0501080_0003162_10542_11078 162
72 3300049823 Ga0501044_0002166 Ga0501044_0002166_323_859 162
73 3300012480 Ga0157346_1005968 Ga0157346_10059682 163
74 3300031995 Ga0307409_100149941 Ga0307409_1001499413 163
75 3300044842 Ga0466957_0304632 Ga0466957_0304632_41_532 163
76 3300046664 Ga0495659_0199604 Ga0495659_0199604_307_798 163
77 3300046809 Ga0495600_0592892 Ga0495600_0592892_169_660 163
78 3300047321 Ga0495676_0212240 Ga0495676_0212240_239_772 163
79 3300047470 Ga0495681_0234152 Ga0495681_0234152_217_708 163
80 3300049582 Ga0501048_0163054 Ga0501048_0163054_460_954 163
81 3300049590 Ga0501074_0806648 Ga0501074_0806648_150_641 163
82 3300049591 Ga0501075_0415515 Ga0501075_0415515_31_564 163
83 3300050496 nmdc:mga07m45_31868_c1 nmdc:mga07m45_31868_c1_11_502 163
84 3300053090 Ga0500646_0273895 Ga0500646_0273895_30_521 163
85 3300005356 Ga0070674_100109721 Ga0070674_1001097214 164
86 3300005436 Ga0070713_101714653 Ga0070713_1017146531 164
87 3300005440 Ga0070705_100044587 Ga0070705_1000445876 164
88 3300005546 Ga0070696_100050957 Ga0070696_1000509572 164
89 3300005549 Ga0070704_100578514 Ga0070704_1005785142 164
90 3300006175 Ga0070712_100218724 Ga0070712_1002187242 164
91 3300009098 Ga0105245_10999553 Ga0105245_109995532 164
92 3300009148 Ga0105243_10003350 Ga0105243_1000335018 164
93 3300009176 Ga0105242_10003352 Ga0105242_1000335218 164
94 3300013297 Ga0157378_10025041 Ga0157378_100250419 164
95 3300013306 Ga0163162_10118185 Ga0163162_101181857 164
96 3300025899 Ga0207642_10002348 Ga0207642_100023484 164
97 3300025915 Ga0207693_10135989 Ga0207693_101359892 164
98 3300025934 Ga0207686_10093561 Ga0207686_100935614 164
99 3300025935 Ga0207709_10049670 Ga0207709_100496703 164
100 3300025942 Ga0207689_10244565 Ga0207689_102445653 164
101 3300025961 Ga0207712_10050038 Ga0207712_100500384 164
102 3300046455 Ga0495603_0025742 Ga0495603_0025742_2538_3089 164
103 3300046491 Ga0495584_0055795 Ga0495584_0055795_477_1028 164
104 3300046528 Ga0495642_0081293 Ga0495642_0081293_659_1210 164
105 3300048903 Ga0496100_0330019 Ga0496100_0330019_471_1022 164
106 3300048905 Ga0496102_0376843 Ga0496102_0376843_493_1044 164
107 3300049572 Ga0501036_0523908 Ga0501036_0523908_119_655 164
108 3300049686 Ga0501257_005035 Ga0501257_005035_2211_2744 164
109 3300053083 Ga0495655_0119097 Ga0495655_0119097_112_663 164
110 3300053087 Ga0500643_001398 Ga0500643_001398_4795_5328 164
111 3300060353 Ga0501082_0363843 Ga0501082_0363843_349_885 164
112 3300060353 Ga0501082_0451649 Ga0501082_0451649_317_853 164
113 3300037312 Ga0395899_0077090 Ga0395899_0077090_986_1537 165
114 3300037418 Ga0395900_0034696 Ga0395900_0034696_3775_4326 165
115 3300037466 Ga0395898_0139498 Ga0395898_0139498_135_686 165
116 3300038443 Ga0395901_0011915 Ga0395901_0011915_3833_4384 165
117 3300038443 Ga0395901_0033719 Ga0395901_0033719_2849_3400 165
118 3300047318 Ga0495636_0355838 Ga0495636_0355838_67_600 165
119 3300047318 Ga0495636_0440568 Ga0495636_0440568_13_564 165
120 3300041486 Ga0451807_1705608 Ga0451807_1705608_42_578 166
121 3300048915 Ga0496112_0242128 Ga0496112_0242128_1038_1571 166
122 3300049587 Ga0501071_0595865 Ga0501071_0595865_65_598 166
123 3300026142 Ga0207698_11347759 Ga0207698_113477592 167
124 3300037312 Ga0395899_0136160 Ga0395899_0136160_78_611 167
125 3300037418 Ga0395900_0209885 Ga0395900_0209885_64_597 167
126 3300038443 Ga0395901_0266522 Ga0395901_0266522_294_827 167
127 3300005937 Ga0081455_10331245 Ga0081455_103312453 168
128 3300013308 Ga0157375_12230252 Ga0157375_122302521 168
129 3300026121 Ga0207683_10181530 Ga0207683_101815303 168
130 3300048918 Ga0496115_0047273 Ga0496115_0047273_1948_2496 168
131 3300005336 Ga0070680_100071832 Ga0070680_1000718322 169
132 3300005341 Ga0070691_10035939 Ga0070691_100359393 169
133 3300005458 Ga0070681_10040928 Ga0070681_1004092810 169
134 3300005530 Ga0070679_100226119 Ga0070679_1002261194 169
135 3300005548 Ga0070665_100088661 Ga0070665_1000886615 169
136 3300005548 Ga0070665_100166338 Ga0070665_1001663382 169
137 3300005563 Ga0068855_100018024 Ga0068855_10001802413 169
138 3300005578 Ga0068854_100912852 Ga0068854_1009128522 169
139 3300009093 Ga0105240_10207291 Ga0105240_102072914 169
140 3300013105 Ga0157369_10665926 Ga0157369_106659263 169
141 3300025912 Ga0207707_10303574 Ga0207707_103035743 169
142 3300025913 Ga0207695_10000575 Ga0207695_1000057520 169
143 3300025917 Ga0207660_10274069 Ga0207660_102740693 169
144 3300025949 Ga0207667_10166617 Ga0207667_101666174 169
145 3300025949 Ga0207667_10676319 Ga0207667_106763192 169
146 3300025981 Ga0207640_10155026 Ga0207640_101550263 169
147 3300028379 Ga0268266_10138455 Ga0268266_101384555 169
148 3300031548 Ga0307408_100401965 Ga0307408_1004019652 169
149 3300031824 Ga0307413_10101849 Ga0307413_101018491 169
150 3300032004 Ga0307414_10041874 Ga0307414_100418746 169
151 3300032005 Ga0307411_10049694 Ga0307411_100496943 169
152 3300037312 Ga0395899_0125985 Ga0395899_0125985_599_1132 169
153 3300037418 Ga0395900_0303429 Ga0395900_0303429_1030_1563 169
154 3300046535 Ga0495586_0066751 Ga0495586_0066751_444_992 169
155 3300046642 Ga0495634_0213993 Ga0495634_0213993_232_780 169
156 3300049127 Ga0501306_010493 Ga0501306_010493_520_1053 169
157 3300049536 Ga0501320_009247 Ga0501320_009247_200_733 169
158 3300059510 Ga0587090_012104 Ga0587090_012104_174_707 169
159 3300059604 Ga0587098_004890 Ga0587098_004890_196_729 169
160 3300059639 Ga0587062_006597 Ga0587062_006597_593_1126 169
161 3300059641 Ga0587068_014409 Ga0587068_014409_538_1071 169
162 3300059642 Ga0587069_001327 Ga0587069_001327_1244_1777 169
163 3300059645 Ga0587076_011237 Ga0587076_011237_205_738 169
164 3300003215 JGI25153J46596_10043753 JGI25153J46596_100437532 170
165 3300003791 Ga0055530_10006621 Ga0055530_100066212 170
166 3300005262 Ga0065165_1027151 Ga0065165_10271514 170
167 3300005535 Ga0070684_100841607 Ga0070684_1008416072 170
168 3300006881 Ga0068865_100031091 Ga0068865_1000310914 170
169 3300009553 Ga0105249_11446201 Ga0105249_114462012 170
170 3300013102 Ga0157371_10024138 Ga0157371_100241384 170
171 3300013306 Ga0163162_11139172 Ga0163162_111391722 170
172 3300014325 Ga0163163_10910239 Ga0163163_109102392 170
173 3300025297 Ga0209758_1002168 Ga0209758_100216820 170
174 3300025298 Ga0209050_1000161 Ga0209050_1000161102 170
175 3300025304 Ga0209257_1000252 Ga0209257_100025274 170
176 3300025911 Ga0207654_10139882 Ga0207654_101398824 170
177 3300025938 Ga0207704_10192726 Ga0207704_101927263 170
178 3300047320 Ga0495672_0074113 Ga0495672_0074113_1215_1748 170
179 3300048903 Ga0496100_0491453 Ga0496100_0491453_324_857 170
180 3300053087 Ga0500643_045106 Ga0500643_045106_734_1267 170
181 3300059643 Ga0587072_012807 Ga0587072_012807_553_1089 170
182 3300005331 Ga0070670_100879486 Ga0070670_1008794862 171
183 3300005459 Ga0068867_101019187 Ga0068867_1010191872 171
184 3300009553 Ga0105249_10200258 Ga0105249_102002581 171
185 3300014325 Ga0163163_10386778 Ga0163163_103867782 171
186 3300026088 Ga0207641_10994020 Ga0207641_109940202 171
187 3300037312 Ga0395899_0152780 Ga0395899_0152780_548_1081 171
188 3300038443 Ga0395901_0098100 Ga0395901_0098100_1388_1921 171
189 3300042005 Ga0439448_0056999 Ga0439448_0056999_101_634 171
190 3300005327 Ga0070658_10343132 Ga0070658_103431321 172
191 3300013308 Ga0157375_12366843 Ga0157375_123668431 172
192 3300031649 Ga0307514_10045338 Ga0307514_100453385 172
193 3300035088 Ga0373940_0110434 Ga0373940_0110434_72_590 172
194 3300036647 Ga0316582_0452668 Ga0316582_0452668_55_618 172
195 3300046471 Ga0495650_0002639 Ga0495650_0002639_9752_10270 172
196 3300053080 Ga0500635_0152709 Ga0500635_0152709_91_609 172
197 3300032005 Ga0307411_11040215 Ga0307411_110402151 173
198 3300046615 Ga0495656_0001111 Ga0495656_0001111_5359_5880 173
199 iso_pu_bacteria 2510917020 2511120796 173
200 iso_pu_bacteria 2582581279 2585150064 173
201 iso_pu_bacteria 2582581280 2585155413 173
202 iso_pu_bacteria 2582581293 2585199197 173
203 iso_pu_bacteria 2585428106 2587919519 173
204 iso_pu_bacteria 2643221545 2643747981 173
205 iso_pu_bacteria 2643221552 2643781694 173
206 iso_pu_bacteria 2643221574 2643884718 173
207 iso_pu_bacteria 2643221583 2643926343 173
208 iso_pu_bacteria 2643221584 2643931634 173
209 iso_pu_bacteria 2643221598 2643997898 173
210 iso_pu_bacteria 2643221614 2644088892 173
211 iso_pu_bacteria 2643221640 2644226550 173
212 iso_pu_bacteria 2643221642 2644236038 173
213 iso_pu_bacteria 2643221661 2644342254 173
214 iso_pu_bacteria 2643221663 2644352437 173
215 iso_pu_bacteria 2643221666 2644369637 173
216 iso_pu_bacteria 2643221691 2644507916 173
217 iso_pu_bacteria 2643221699 2644548378 173
218 iso_pu_bacteria 2739367756 2739792111 173
219 iso_pu_bacteria 2791355048 2792463725 173
220 iso_pu_bacteria 2818991435 2819536850 173
221 iso_pu_bacteria 2818991454 2819646011 173
222 iso_pu_bacteria 2843744320 2843747099 173
223 iso_pu_bacteria 2849560528 2849560638 173
224 iso_pu_bacteria 2849573788 2849578479 173
225 iso_pu_bacteria 2851153111 2851154278 173
226 iso_pu_bacteria 2857504554 2857509531 173
227 iso_pu_bacteria 2884960567 2884961081 173
228 iso_pu_bacteria 2898329390 2898331318 173
229 iso_pu_bacteria 2928531327 2928535740 173
230 iso_pu_bacteria 2928972540 2928974667 173
231 iso_pu_bacteria 2941485952 2941486950 173
232 iso_pu_bacteria 2977240413 2977242293 173
233 3300046536 Ga0495587_0162159 Ga0495587_0162159_315_839 174
234 iso_pu_bacteria 2554235227 2555228813 174
235 iso_pu_bacteria 2654587600 2655033277 174
236 iso_pu_bacteria 2690315906 2691514810 174
237 iso_pu_bacteria 2721755702 2723643141 174
238 iso_pu_bacteria 2751185788 2753303684 174
239 iso_pu_bacteria 2775506735 2775654849 174
240 iso_pu_bacteria 2808606357 2808827920 174
241 iso_pu_bacteria 2808606360 2808853277 174
242 iso_pu_bacteria 2808606366 2808878225 174
243 iso_pu_bacteria 2808606370 2808892173 174
244 iso_pu_bacteria 2808606371 2808897272 174
245 iso_pu_bacteria 2808606700 2810364444 174
246 iso_pu_bacteria 2811994871 2812320313 174
247 iso_pu_bacteria 2844841374 2844843361 174
248 iso_pu_bacteria 2844849076 2844849794 174
249 iso_pu_bacteria 2852643534 2852644357 174
250 iso_pu_bacteria 2857740372 2857741101 174
251 iso_pu_bacteria 2904430863 2904432391 174
252 iso_pu_bacteria 2904497146 2904500335 174
253 iso_pu_bacteria 2904776348 2904776870 174
254 iso_pu_bacteria 2905926851 2905928028 174
255 iso_pu_bacteria 2910809715 2910811886 174
256 iso_pu_bacteria 2919034639 2919036408 174
257 iso_pu_bacteria 2919051321 2919052519 174
258 iso_pu_bacteria 2919055335 2919055339 174
259 iso_pu_bacteria 2919059106 2919059578 174
260 iso_pu_bacteria 2919391150 2919392845 174
261 iso_pu_bacteria 2919538618 2919540867 174
262 iso_pu_bacteria 2928153084 2928153498 174
263 iso_pu_bacteria 2932426870 2932427002 174
264 iso_pu_bacteria 2933418574 2933419631 174
265 iso_pu_bacteria 2935409751 2935412129 174
266 iso_pu_bacteria 2939598168 2939598892 174
267 iso_pu_bacteria 2939647034 2939649968 174
268 iso_pu_bacteria 2939660829 2939662738 174
269 iso_pu_bacteria 2939674588 2939677418 174
270 iso_pu_bacteria 2945916053 2945918061 174
271 iso_pu_bacteria 2945920336 2945921652 174
272 iso_pu_bacteria 2945941187 2945942132 174
273 iso_pu_bacteria 2945956166 2945960084 174
274 iso_pu_bacteria 2946024296 2946026675 174
275 iso_pu_bacteria 2946037020 2946038114 174
276 iso_pu_bacteria 2946059875 2946061902 174
277 iso_pu_bacteria 2953998280 2953999390 174
278 iso_pu_bacteria 2964326757 2964328463 174
279 iso_pu_bacteria 2974302888 2974306100 174
280 iso_pu_bacteria 2984551494 2984551980 174
281 iso_pu_bacteria 8004021418 8004021552 174
282 iso_pu_bacteria 8054107350 8054108519 174
283 iso_pu_bacteria 2643221692 2644515355 175
284 iso_pu_bacteria 2863067949 2863070305 175
285 iso_pu_bacteria 2919713450 2919718291 175
286 3300033180 Ga0307510_10178406 Ga0307510_101784062 176
287 3300053156 Ga0500622_0002771 Ga0500622_0002771_10930_11460 176
288 3300003578 Ga0006562J51391_1097499 Ga0006562J51391_10974992 177
289 3300003771 Ga0055526_1009783 Ga0055526_10097832 177
290 3300003773 Ga0055537_1001243 Ga0055537_100124313 177
291 3300003784 Ga0055534_1014923 Ga0055534_10149233 177
292 3300003790 Ga0055528_1008934 Ga0055528_10089345 177
293 3300003794 Ga0055531_10004281 Ga0055531_1000428112 177
294 3300003794 Ga0055531_10016789 Ga0055531_100167893 177
295 3300005262 Ga0065165_1002762 Ga0065165_100276221 177
296 3300005327 Ga0070658_10067818 Ga0070658_100678182 177
297 3300005327 Ga0070658_10584380 Ga0070658_105843802 177
298 3300005330 Ga0070690_100023918 Ga0070690_1000239186 177
299 3300005331 Ga0070670_100000958 Ga0070670_10000095818 177
300 3300005331 Ga0070670_100770170 Ga0070670_1007701701 177
301 3300005335 Ga0070666_10143334 Ga0070666_101433343 177
302 3300005335 Ga0070666_10206799 Ga0070666_102067992 177
303 3300005336 Ga0070680_100006095 Ga0070680_1000060959 177
304 3300005338 Ga0068868_100039367 Ga0068868_1000393676 177
305 3300005338 Ga0068868_100476488 Ga0068868_1004764882 177
306 3300005340 Ga0070689_100182830 Ga0070689_1001828303 177
307 3300005345 Ga0070692_10141576 Ga0070692_101415761 177
308 3300005347 Ga0070668_100002473 Ga0070668_1000024738 177
309 3300005347 Ga0070668_100005674 Ga0070668_1000056745 177
310 3300005347 Ga0070668_100023377 Ga0070668_1000233772 177
311 3300005347 Ga0070668_100104434 Ga0070668_1001044344 177
312 3300005347 Ga0070668_100114247 Ga0070668_1001142475 177
313 3300005347 Ga0070668_100128011 Ga0070668_1001280113 177
314 3300005354 Ga0070675_100761997 Ga0070675_1007619972 177
315 3300005355 Ga0070671_100006755 Ga0070671_1000067559 177
316 3300005355 Ga0070671_100235904 Ga0070671_1002359043 177
317 3300005364 Ga0070673_100714822 Ga0070673_1007148221 177
318 3300005366 Ga0070659_100022607 Ga0070659_1000226073 177
319 3300005367 Ga0070667_100006266 Ga0070667_1000062667 177
320 3300005367 Ga0070667_100013914 Ga0070667_1000139142 177
321 3300005367 Ga0070667_100081570 Ga0070667_1000815704 177
322 3300005367 Ga0070667_100357303 Ga0070667_1003573032 177
323 3300005435 Ga0070714_100409185 Ga0070714_1004091853 177
324 3300005440 Ga0070705_100174325 Ga0070705_1001743253 177
325 3300005440 Ga0070705_100206927 Ga0070705_1002069272 177
326 3300005440 Ga0070705_100304553 Ga0070705_1003045532 177
327 3300005456 Ga0070678_100005141 Ga0070678_1000051416 177
328 3300005456 Ga0070678_100120082 Ga0070678_1001200825 177
329 3300005457 Ga0070662_100014250 Ga0070662_1000142509 177
330 3300005457 Ga0070662_100076756 Ga0070662_1000767564 177
331 3300005457 Ga0070662_100275605 Ga0070662_1002756052 177
332 3300005458 Ga0070681_10042882 Ga0070681_100428825 177
333 3300005458 Ga0070681_10114267 Ga0070681_101142675 177
334 3300005458 Ga0070681_10985059 Ga0070681_109850592 177
335 3300005471 Ga0070698_100014515 Ga0070698_1000145152 177
336 3300005530 Ga0070679_100042115 Ga0070679_10004211510 177
337 3300005530 Ga0070679_101195285 Ga0070679_1011952852 177
338 3300005530 Ga0070679_101400156 Ga0070679_1014001561 177
339 3300005535 Ga0070684_100199462 Ga0070684_1001994623 177
340 3300005539 Ga0068853_100541991 Ga0068853_1005419912 177
341 3300005546 Ga0070696_100076045 Ga0070696_1000760455 177
342 3300005546 Ga0070696_100707729 Ga0070696_1007077292 177
343 3300005548 Ga0070665_100000121 Ga0070665_100000121154 177
344 3300005548 Ga0070665_100006341 Ga0070665_10000634110 177
345 3300005548 Ga0070665_100029959 Ga0070665_1000299595 177
346 3300005548 Ga0070665_100071556 Ga0070665_1000715564 177
347 3300005549 Ga0070704_100103646 Ga0070704_1001036463 177
348 3300005563 Ga0068855_100067956 Ga0068855_1000679562 177
349 3300005563 Ga0068855_100074983 Ga0068855_10007498310 177
350 3300005563 Ga0068855_101027957 Ga0068855_1010279572 177
351 3300005564 Ga0070664_100445214 Ga0070664_1004452142 177
352 3300005564 Ga0070664_100492882 Ga0070664_1004928822 177
353 3300005564 Ga0070664_100499798 Ga0070664_1004997982 177
354 3300005578 Ga0068854_100195338 Ga0068854_1001953383 177
355 3300005614 Ga0068856_100043556 Ga0068856_1000435565 177
356 3300005614 Ga0068856_100384103 Ga0068856_1003841032 177
357 3300005614 Ga0068856_100391407 Ga0068856_1003914073 177
358 3300005614 Ga0068856_100602406 Ga0068856_1006024061 177
359 3300005615 Ga0070702_100003273 Ga0070702_1000032736 177
360 3300005616 Ga0068852_100109130 Ga0068852_1001091302 177
361 3300005617 Ga0068859_100001281 Ga0068859_10000128127 177
362 3300005617 Ga0068859_100429757 Ga0068859_1004297573 177
363 3300005618 Ga0068864_100000263 Ga0068864_10000026351 177
364 3300005618 Ga0068864_100008221 Ga0068864_1000082218 177
365 3300005618 Ga0068864_100274288 Ga0068864_1002742882 177
366 3300005718 Ga0068866_10013084 Ga0068866_100130845 177
367 3300005718 Ga0068866_10316892 Ga0068866_103168922 177
368 3300005719 Ga0068861_100116966 Ga0068861_1001169664 177
369 3300005719 Ga0068861_101451468 Ga0068861_1014514681 177
370 3300005841 Ga0068863_100000694 Ga0068863_10000069410 177
371 3300005841 Ga0068863_100004023 Ga0068863_10000402311 177
372 3300005841 Ga0068863_100058583 Ga0068863_1000585835 177
373 3300005841 Ga0068863_100088718 Ga0068863_1000887184 177
374 3300005842 Ga0068858_100000270 Ga0068858_10000027054 177
375 3300005842 Ga0068858_100007271 Ga0068858_10000727111 177
376 3300005842 Ga0068858_100196267 Ga0068858_1001962673 177
377 3300005843 Ga0068860_100001684 Ga0068860_10000168415 177
378 3300005843 Ga0068860_100010284 Ga0068860_1000102846 177
379 3300005843 Ga0068860_100055504 Ga0068860_1000555047 177
380 3300005843 Ga0068860_100373448 Ga0068860_1003734482 177
381 3300005844 Ga0068862_100007110 Ga0068862_10000711011 177
382 3300005844 Ga0068862_100094860 Ga0068862_1000948605 177
383 3300005844 Ga0068862_100334272 Ga0068862_1003342722 177
384 3300005844 Ga0068862_100381530 Ga0068862_1003815302 177
385 3300005937 Ga0081455_10014194 Ga0081455_1001419413 177
386 3300005937 Ga0081455_10048479 Ga0081455_100484798 177
387 3300005983 Ga0081540_1007820 Ga0081540_100782011 177
388 3300006038 Ga0075365_10006324 Ga0075365_100063246 177
389 3300006051 Ga0075364_10001038 Ga0075364_100010388 177
390 3300006173 Ga0070716_100369409 Ga0070716_1003694092 177
391 3300006175 Ga0070712_100830163 Ga0070712_1008301632 177
392 3300006177 Ga0075362_10006228 Ga0075362_100062284 177
393 3300006177 Ga0075362_10237312 Ga0075362_102373122 177
394 3300006178 Ga0075367_10001012 Ga0075367_1000101218 177
395 3300006178 Ga0075367_10064400 Ga0075367_100644004 177
396 3300006186 Ga0075369_10020903 Ga0075369_100209033 177
397 3300006195 Ga0075366_10007868 Ga0075366_1000786810 177
398 3300006195 Ga0075366_10060203 Ga0075366_100602033 177
399 3300006195 Ga0075366_10065097 Ga0075366_100650974 177
400 3300006195 Ga0075366_10287405 Ga0075366_102874052 177
401 3300006237 Ga0097621_100818543 Ga0097621_1008185432 177
402 3300006353 Ga0075370_10019956 Ga0075370_100199566 177
403 3300006353 Ga0075370_10087766 Ga0075370_100877662 177
404 3300006353 Ga0075370_10306181 Ga0075370_103061811 177
405 3300006353 Ga0075370_10727877 Ga0075370_107278771 177
406 3300006358 Ga0068871_100031253 Ga0068871_1000312535 177
407 3300006846 Ga0075430_100112480 Ga0075430_1001124804 177
408 3300006847 Ga0075431_100124871 Ga0075431_1001248715 177
409 3300006852 Ga0075433_10006179 Ga0075433_1000617918 177
410 3300006880 Ga0075429_100376674 Ga0075429_1003766743 177
411 3300006881 Ga0068865_100292920 Ga0068865_1002929202 177
412 3300006914 Ga0075436_100090350 Ga0075436_1000903504 177
413 3300006931 Ga0097620_100001281 Ga0097620_10000128127 177
414 3300006931 Ga0097620_100429721 Ga0097620_1004297213 177
415 3300006946 Ga0079104_1007846 Ga0079104_10078464 177
416 3300007076 Ga0075435_100010943 Ga0075435_10001094310 177
417 3300009092 Ga0105250_10003109 Ga0105250_100031094 177
418 3300009093 Ga0105240_10013835 Ga0105240_100138356 177
419 3300009093 Ga0105240_10162906 Ga0105240_101629066 177
420 3300009093 Ga0105240_10369970 Ga0105240_103699702 177
421 3300009093 Ga0105240_10646104 Ga0105240_106461043 177
422 3300009093 Ga0105240_10718939 Ga0105240_107189392 177
423 3300009098 Ga0105245_10049066 Ga0105245_100490666 177
424 3300009098 Ga0105245_10156777 Ga0105245_101567775 177
425 3300009101 Ga0105247_10293539 Ga0105247_102935392 177
426 3300009147 Ga0114129_10201453 Ga0114129_102014533 177
427 3300009147 Ga0114129_10289259 Ga0114129_102892594 177
428 3300009148 Ga0105243_10018421 Ga0105243_100184214 177
429 3300009148 Ga0105243_10671510 Ga0105243_106715102 177
430 3300009148 Ga0105243_11071468 Ga0105243_110714682 177
431 3300009174 Ga0105241_10096984 Ga0105241_100969844 177
432 3300009174 Ga0105241_10166634 Ga0105241_101666342 177
433 3300009176 Ga0105242_10047469 Ga0105242_100474697 177
434 3300009176 Ga0105242_10205316 Ga0105242_102053164 177
435 3300009176 Ga0105242_10516396 Ga0105242_105163962 177
436 3300009177 Ga0105248_10086390 Ga0105248_100863905 177
437 3300009177 Ga0105248_10089402 Ga0105248_100894024 177
438 3300009177 Ga0105248_10168671 Ga0105248_101686712 177
439 3300009177 Ga0105248_10178500 Ga0105248_101785004 177
440 3300009177 Ga0105248_10180513 Ga0105248_101805134 177
441 3300009177 Ga0105248_10222577 Ga0105248_102225773 177
442 3300009177 Ga0105248_10563249 Ga0105248_105632493 177
443 3300009177 Ga0105248_10619254 Ga0105248_106192542 177
444 3300009177 Ga0105248_10678976 Ga0105248_106789763 177
445 3300009545 Ga0105237_10362248 Ga0105237_103622483 177
446 3300009545 Ga0105237_10769858 Ga0105237_107698582 177
447 3300009551 Ga0105238_10228969 Ga0105238_102289693 177
448 3300009551 Ga0105238_10295500 Ga0105238_102955003 177
449 3300009551 Ga0105238_10377821 Ga0105238_103778213 177
450 3300009551 Ga0105238_10566717 Ga0105238_105667172 177
451 3300009551 Ga0105238_10658009 Ga0105238_106580092 177
452 3300009551 Ga0105238_11474645 Ga0105238_114746452 177
453 3300009551 Ga0105238_11704200 Ga0105238_117042001 177
454 3300009553 Ga0105249_10010200 Ga0105249_100102003 177
455 3300009553 Ga0105249_10338536 Ga0105249_103385362 177
456 3300009553 Ga0105249_10463175 Ga0105249_104631752 177
457 3300010159 Ga0099796_10268884 Ga0099796_102688842 177
458 3300010375 Ga0105239_10247557 Ga0105239_102475573 177
459 3300010375 Ga0105239_10548759 Ga0105239_105487593 177
460 3300010375 Ga0105239_10604321 Ga0105239_106043212 177
461 3300010375 Ga0105239_11048261 Ga0105239_110482612 177
462 3300011119 Ga0105246_10042888 Ga0105246_100428885 177
463 3300012500 Ga0157314_1011798 Ga0157314_10117982 177
464 3300013102 Ga0157371_10025585 Ga0157371_100255859 177
465 3300013104 Ga0157370_10020489 Ga0157370_1002048913 177
466 3300013104 Ga0157370_10022671 Ga0157370_100226716 177
467 3300013105 Ga0157369_10018315 Ga0157369_1001831516 177
468 3300013296 Ga0157374_10302289 Ga0157374_103022893 177
469 3300013296 Ga0157374_10473969 Ga0157374_104739693 177
470 3300013297 Ga0157378_10711455 Ga0157378_107114552 177
471 3300013306 Ga0163162_10223470 Ga0163162_102234704 177
472 3300013306 Ga0163162_10432190 Ga0163162_104321901 177
473 3300013306 Ga0163162_10596522 Ga0163162_105965223 177
474 3300013307 Ga0157372_10223514 Ga0157372_102235143 177
475 3300013307 Ga0157372_11856724 Ga0157372_118567242 177
476 3300013308 Ga0157375_10573180 Ga0157375_105731802 177
477 3300013308 Ga0157375_11660300 Ga0157375_116603002 177
478 3300014325 Ga0163163_10380839 Ga0163163_103808393 177
479 3300014325 Ga0163163_10405396 Ga0163163_104053962 177
480 3300014325 Ga0163163_10729973 Ga0163163_107299732 177
481 3300014326 Ga0157380_10236356 Ga0157380_102363562 177
482 3300014326 Ga0157380_10277066 Ga0157380_102770664 177
483 3300014326 Ga0157380_10508652 Ga0157380_105086522 177
484 3300014745 Ga0157377_10034285 Ga0157377_100342855 177
485 3300014968 Ga0157379_10009879 Ga0157379_100098793 177
486 3300014968 Ga0157379_10009954 Ga0157379_1000995410 177
487 3300014968 Ga0157379_10082142 Ga0157379_100821425 177
488 3300014968 Ga0157379_10534820 Ga0157379_105348202 177
489 3300014968 Ga0157379_11856841 Ga0157379_118568411 177
490 3300014969 Ga0157376_10020266 Ga0157376_100202663 177
491 3300014969 Ga0157376_10086464 Ga0157376_100864642 177
492 3300014969 Ga0157376_11041539 Ga0157376_110415392 177
493 3300014969 Ga0157376_11219506 Ga0157376_112195061 177
494 3300017792 Ga0163161_10104109 Ga0163161_101041094 177
495 3300017792 Ga0163161_10322599 Ga0163161_103225993 177
496 3300021361 Ga0213872_10135356 Ga0213872_101353563 177
497 3300021384 Ga0213876_10000244 Ga0213876_1000024412 177
498 3300021384 Ga0213876_10084053 Ga0213876_100840532 177
499 3300021384 Ga0213876_10085106 Ga0213876_100851063 177
500 3300021388 Ga0213875_10290337 Ga0213875_102903372 177
501 3300025250 Ga0209026_1003882 Ga0209026_10038825 177
502 3300025263 Ga0209565_1000925 Ga0209565_100092515 177
503 3300025272 Ga0209455_1018403 Ga0209455_10184032 177
504 3300025273 Ga0209673_1002524 Ga0209673_100252414 177
505 3300025291 Ga0209675_1002569 Ga0209675_100256911 177
506 3300025292 Ga0209676_1004317 Ga0209676_10043172 177
507 3300025292 Ga0209676_1005649 Ga0209676_10056495 177
508 3300025292 Ga0209676_1005783 Ga0209676_10057835 177
509 3300025292 Ga0209676_1036267 Ga0209676_10362673 177
510 3300025295 Ga0209564_1023073 Ga0209564_10230735 177
511 3300025295 Ga0209564_1035258 Ga0209564_10352582 177
512 3300025295 Ga0209564_1067311 Ga0209564_10673112 177
513 3300025297 Ga0209758_1021887 Ga0209758_10218875 177
514 3300025298 Ga0209050_1033197 Ga0209050_10331973 177
515 3300025299 Ga0209256_1003893 Ga0209256_100389318 177
516 3300025303 Ga0209051_1000877 Ga0209051_100087710 177
517 3300025304 Ga0209257_1000284 Ga0209257_1000284115 177
518 3300025304 Ga0209257_1000976 Ga0209257_100097636 177
519 3300025304 Ga0209257_1001464 Ga0209257_100146435 177
520 3300025304 Ga0209257_1117875 Ga0209257_11178751 177
521 3300025711 Ga0207696_1011543 Ga0207696_10115436 177
522 3300025893 Ga0207682_10051856 Ga0207682_100518564 177
523 3300025899 Ga0207642_10015447 Ga0207642_100154474 177
524 3300025901 Ga0207688_10056434 Ga0207688_100564343 177
525 3300025903 Ga0207680_10152858 Ga0207680_101528583 177
526 3300025909 Ga0207705_10011901 Ga0207705_1001190113 177
527 3300025909 Ga0207705_10152929 Ga0207705_101529294 177
528 3300025909 Ga0207705_10401469 Ga0207705_104014692 177
529 3300025909 Ga0207705_10402723 Ga0207705_104027232 177
530 3300025909 Ga0207705_10693439 Ga0207705_106934391 177
531 3300025911 Ga0207654_10116974 Ga0207654_101169742 177
532 3300025912 Ga0207707_10089543 Ga0207707_100895435 177
533 3300025912 Ga0207707_10427272 Ga0207707_104272722 177
534 3300025912 Ga0207707_10896025 Ga0207707_108960252 177
535 3300025913 Ga0207695_10002926 Ga0207695_1000292621 177
536 3300025913 Ga0207695_10146421 Ga0207695_101464212 177
537 3300025913 Ga0207695_10350482 Ga0207695_103504823 177
538 3300025913 Ga0207695_10463321 Ga0207695_104633212 177
539 3300025913 Ga0207695_10507987 Ga0207695_105079872 177
540 3300025914 Ga0207671_10192724 Ga0207671_101927243 177
541 3300025915 Ga0207693_10654012 Ga0207693_106540122 177
542 3300025917 Ga0207660_10000537 Ga0207660_1000053720 177
543 3300025917 Ga0207660_10020945 Ga0207660_100209459 177
544 3300025919 Ga0207657_10314964 Ga0207657_103149642 177
545 3300025920 Ga0207649_10605728 Ga0207649_106057282 177
546 3300025921 Ga0207652_10002134 Ga0207652_1000213411 177
547 3300025921 Ga0207652_10729628 Ga0207652_107296282 177
548 3300025921 Ga0207652_10753376 Ga0207652_107533761 177
549 3300025921 Ga0207652_11239759 Ga0207652_112397592 177
550 3300025923 Ga0207681_10008339 Ga0207681_100083396 177
551 3300025923 Ga0207681_10748247 Ga0207681_107482471 177
552 3300025924 Ga0207694_10078132 Ga0207694_100781325 177
553 3300025924 Ga0207694_10147033 Ga0207694_101470334 177
554 3300025924 Ga0207694_10979407 Ga0207694_109794072 177
555 3300025924 Ga0207694_11155173 Ga0207694_111551732 177
556 3300025925 Ga0207650_10000883 Ga0207650_1000088320 177
557 3300025925 Ga0207650_10499802 Ga0207650_104998022 177
558 3300025926 Ga0207659_10286174 Ga0207659_102861742 177
559 3300025926 Ga0207659_10515480 Ga0207659_105154802 177
560 3300025927 Ga0207687_11103028 Ga0207687_111030282 177
561 3300025931 Ga0207644_10006669 Ga0207644_1000666910 177
562 3300025933 Ga0207706_10042383 Ga0207706_100423834 177
563 3300025933 Ga0207706_10298098 Ga0207706_102980983 177
564 3300025934 Ga0207686_10012281 Ga0207686_100122816 177
565 3300025934 Ga0207686_10242708 Ga0207686_102427082 177
566 3300025935 Ga0207709_10083763 Ga0207709_100837633 177
567 3300025935 Ga0207709_11067389 Ga0207709_110673891 177
568 3300025937 Ga0207669_10016767 Ga0207669_100167675 177
569 3300025938 Ga0207704_10224450 Ga0207704_102244502 177
570 3300025940 Ga0207691_10286363 Ga0207691_102863631 177
571 3300025941 Ga0207711_10001469 Ga0207711_1000146921 177
572 3300025941 Ga0207711_10029957 Ga0207711_100299576 177
573 3300025941 Ga0207711_10047912 Ga0207711_100479127 177
574 3300025941 Ga0207711_10203685 Ga0207711_102036852 177
575 3300025941 Ga0207711_10220646 Ga0207711_102206462 177
576 3300025941 Ga0207711_10837575 Ga0207711_108375752 177
577 3300025942 Ga0207689_10137435 Ga0207689_101374354 177
578 3300025942 Ga0207689_10294206 Ga0207689_102942063 177
579 3300025944 Ga0207661_10013726 Ga0207661_100137263 177
580 3300025945 Ga0207679_10136908 Ga0207679_101369084 177
581 3300025945 Ga0207679_10543970 Ga0207679_105439701 177
582 3300025945 Ga0207679_10720696 Ga0207679_107206961 177
583 3300025945 Ga0207679_10762319 Ga0207679_107623191 177
584 3300025949 Ga0207667_10015066 Ga0207667_1001506610 177
585 3300025949 Ga0207667_10027885 Ga0207667_1002788510 177
586 3300025949 Ga0207667_10310503 Ga0207667_103105033 177
587 3300025949 Ga0207667_10334516 Ga0207667_103345163 177
588 3300025960 Ga0207651_10798293 Ga0207651_107982932 177
589 3300025961 Ga0207712_10002131 Ga0207712_100021316 177
590 3300025961 Ga0207712_10357824 Ga0207712_103578243 177
591 3300025961 Ga0207712_10441312 Ga0207712_104413122 177
592 3300025972 Ga0207668_10000363 Ga0207668_1000036317 177
593 3300025972 Ga0207668_10000571 Ga0207668_1000057118 177
594 3300025972 Ga0207668_10007456 Ga0207668_100074563 177
595 3300025972 Ga0207668_10009414 Ga0207668_100094143 177
596 3300025972 Ga0207668_10159369 Ga0207668_101593694 177
597 3300025972 Ga0207668_10216512 Ga0207668_102165121 177
598 3300025981 Ga0207640_10188781 Ga0207640_101887812 177
599 3300025986 Ga0207658_10001253 Ga0207658_1000125318 177
600 3300025986 Ga0207658_10010638 Ga0207658_100106385 177
601 3300025986 Ga0207658_10047256 Ga0207658_100472562 177
602 3300026023 Ga0207677_10065723 Ga0207677_100657234 177
603 3300026023 Ga0207677_10482735 Ga0207677_104827352 177
604 3300026023 Ga0207677_10830616 Ga0207677_108306161 177
605 3300026035 Ga0207703_10000133 Ga0207703_1000013386 177
606 3300026035 Ga0207703_10010843 Ga0207703_1001084311 177
607 3300026035 Ga0207703_10169581 Ga0207703_101695813 177
608 3300026035 Ga0207703_10456155 Ga0207703_104561551 177
609 3300026041 Ga0207639_10158964 Ga0207639_101589643 177
610 3300026041 Ga0207639_10994057 Ga0207639_109940572 177
611 3300026067 Ga0207678_10020090 Ga0207678_100200907 177
612 3300026067 Ga0207678_10127526 Ga0207678_101275263 177
613 3300026075 Ga0207708_10716480 Ga0207708_107164802 177
614 3300026078 Ga0207702_10344675 Ga0207702_103446752 177
615 3300026078 Ga0207702_10409077 Ga0207702_104090772 177
616 3300026088 Ga0207641_10000168 Ga0207641_1000016882 177
617 3300026088 Ga0207641_10005884 Ga0207641_1000588412 177
618 3300026088 Ga0207641_10007468 Ga0207641_100074682 177
619 3300026089 Ga0207648_10048425 Ga0207648_100484253 177
620 3300026095 Ga0207676_10000247 Ga0207676_1000024751 177
621 3300026095 Ga0207676_10005933 Ga0207676_100059338 177
622 3300026118 Ga0207675_100602256 Ga0207675_1006022562 177
623 3300026121 Ga0207683_10000603 Ga0207683_1000060335 177
624 3300026121 Ga0207683_10038015 Ga0207683_100380156 177
625 3300026142 Ga0207698_10195700 Ga0207698_101957004 177
626 3300027876 Ga0209974_10014633 Ga0209974_100146335 177
627 3300028379 Ga0268266_10000106 Ga0268266_1000010610 177
628 3300028379 Ga0268266_10001264 Ga0268266_100012644 177
629 3300028379 Ga0268266_10045074 Ga0268266_100450747 177
630 3300028379 Ga0268266_10250079 Ga0268266_102500793 177
631 3300028379 Ga0268266_11316336 Ga0268266_113163362 177
632 3300028380 Ga0268265_10004922 Ga0268265_1000492211 177
633 3300028380 Ga0268265_10100736 Ga0268265_101007364 177
634 3300028380 Ga0268265_10223652 Ga0268265_102236523 177
635 3300028380 Ga0268265_10245853 Ga0268265_102458532 177
636 3300028381 Ga0268264_10000383 Ga0268264_1000038317 177
637 3300028381 Ga0268264_10002325 Ga0268264_1000232520 177
638 3300028381 Ga0268264_10028639 Ga0268264_100286395 177
639 3300028381 Ga0268264_10036966 Ga0268264_100369664 177
640 3300028573 Ga0265334_10045332 Ga0265334_100453323 177
641 3300028666 Ga0265336_10030678 Ga0265336_100306782 177
642 3300028786 Ga0307517_10326725 Ga0307517_103267251 177
643 3300028794 Ga0307515_10273927 Ga0307515_102739272 177
644 3300028800 Ga0265338_10014341 Ga0265338_100143415 177
645 3300028800 Ga0265338_10069087 Ga0265338_100690875 177
646 3300028800 Ga0265338_10087400 Ga0265338_100874003 177
647 3300028800 Ga0265338_10129548 Ga0265338_101295484 177
648 3300028800 Ga0265338_10183773 Ga0265338_101837731 177
649 3300028800 Ga0265338_10423197 Ga0265338_104231972 177
650 3300030521 Ga0307511_10006537 Ga0307511_1000653719 177
651 3300031090 Ga0265760_10049218 Ga0265760_100492183 177
652 3300031240 Ga0265320_10039508 Ga0265320_100395084 177
653 3300031251 Ga0265327_10000381 Ga0265327_1000038162 177
654 3300031251 Ga0265327_10005226 Ga0265327_1000522614 177
655 3300031251 Ga0265327_10007046 Ga0265327_1000704618 177
656 3300031251 Ga0265327_10014580 Ga0265327_100145806 177
657 3300031344 Ga0265316_10580659 Ga0265316_105806592 177
658 3300031456 Ga0307513_10002446 Ga0307513_1000244628 177
659 3300031456 Ga0307513_10010515 Ga0307513_1001051518 177
660 3300031456 Ga0307513_10248379 Ga0307513_102483793 177
661 3300031456 Ga0307513_10324480 Ga0307513_103244802 177
662 3300031548 Ga0307408_100080190 Ga0307408_1000801905 177
663 3300031616 Ga0307508_10257921 Ga0307508_102579212 177
664 3300031711 Ga0265314_10032344 Ga0265314_100323447 177
665 3300031712 Ga0265342_10231167 Ga0265342_102311671 177
666 3300031727 Ga0316576_10124201 Ga0316576_101242013 177
667 3300031728 Ga0316578_10366217 Ga0316578_103662172 177
668 3300031730 Ga0307516_10001565 Ga0307516_1000156528 177
669 3300031731 Ga0307405_10040438 Ga0307405_100404383 177
670 3300031824 Ga0307413_10003502 Ga0307413_1000350210 177
671 3300031824 Ga0307413_10276942 Ga0307413_102769422 177
672 3300031852 Ga0307410_10004470 Ga0307410_100044708 177
673 3300031852 Ga0307410_10260935 Ga0307410_102609352 177
674 3300031901 Ga0307406_10005941 Ga0307406_1000594113 177
675 3300031901 Ga0307406_10082192 Ga0307406_100821925 177
676 3300031903 Ga0307407_10015861 Ga0307407_100158617 177
677 3300031903 Ga0307407_10109716 Ga0307407_101097163 177
678 3300031903 Ga0307407_10630526 Ga0307407_106305262 177
679 3300031911 Ga0307412_10009022 Ga0307412_100090227 177
680 3300031911 Ga0307412_10038714 Ga0307412_100387142 177
681 3300031995 Ga0307409_100055380 Ga0307409_1000553805 177
682 3300032002 Ga0307416_100019290 Ga0307416_1000192907 177
683 3300032002 Ga0307416_100231190 Ga0307416_1002311904 177
684 3300032002 Ga0307416_100923545 Ga0307416_1009235452 177
685 3300032004 Ga0307414_10108448 Ga0307414_101084483 177
686 3300032004 Ga0307414_10517633 Ga0307414_105176332 177
687 3300032005 Ga0307411_10050011 Ga0307411_100500114 177
688 3300032126 Ga0307415_100351122 Ga0307415_1003511223 177
689 3300032126 Ga0307415_101228604 Ga0307415_1012286042 177
690 3300032168 Ga0316593_10003756 Ga0316593_100037566 177
691 3300034957 Ga0373938_0180536 Ga0373938_0180536_28_561 177
692 3300035113 Ga0373936_0004112 Ga0373936_0004112_2218_2751 177
693 3300035114 Ga0373939_0114132 Ga0373939_0114132_236_769 177
694 3300035170 Ga0373943_0123357 Ga0373943_0123357_590_1123 177
695 3300035207 Ga0373942_0084888 Ga0373942_0084888_74_607 177
696 3300035398 Ga0316574_0007642 Ga0316574_0007642_2962_3495 177
697 3300035398 Ga0316574_0025544 Ga0316574_0025544_2843_3376 177
698 3300036712 Ga0316584_0078955 Ga0316584_0078955_803_1336 177
699 3300037312 Ga0395899_0000105 Ga0395899_0000105_136235_136768 177
700 3300037312 Ga0395899_0101686 Ga0395899_0101686_815_1348 177
701 3300037312 Ga0395899_0124107 Ga0395899_0124107_1186_1719 177
702 3300037312 Ga0395899_0292822 Ga0395899_0292822_238_771 177
703 3300037418 Ga0395900_0002517 Ga0395900_0002517_4179_4712 177
704 3300037418 Ga0395900_0004844 Ga0395900_0004844_10221_10754 177
705 3300037418 Ga0395900_0058480 Ga0395900_0058480_2614_3147 177
706 3300037418 Ga0395900_0214770 Ga0395900_0214770_1371_1904 177
707 3300037418 Ga0395900_0374261 Ga0395900_0374261_52_585 177
708 3300037418 Ga0395900_0385825 Ga0395900_0385825_493_1026 177
709 3300037418 Ga0395900_0570478 Ga0395900_0570478_484_1017 177
710 3300037418 Ga0395900_0580199 Ga0395900_0580199_113_646 177
711 3300037418 Ga0395900_0788035 Ga0395900_0788035_272_805 177
712 3300037418 Ga0395900_1316031 Ga0395900_1316031_84_617 177
713 3300037466 Ga0395898_0036716 Ga0395898_0036716_3026_3559 177
714 3300037466 Ga0395898_0089097 Ga0395898_0089097_1891_2424 177
715 3300037466 Ga0395898_0096111 Ga0395898_0096111_2192_2725 177
716 3300037466 Ga0395898_0118890 Ga0395898_0118890_1369_1902 177
717 3300037466 Ga0395898_0134065 Ga0395898_0134065_1483_2016 177
718 3300037466 Ga0395898_0169480 Ga0395898_0169480_675_1208 177
719 3300037466 Ga0395898_0616216 Ga0395898_0616216_462_995 177
720 3300037471 Ga0395905_0119007 Ga0395905_0119007_1198_1731 177
721 3300037471 Ga0395905_0396756 Ga0395905_0396756_182_715 177
722 3300037471 Ga0395905_0433622 Ga0395905_0433622_434_967 177
723 3300037471 Ga0395905_0463395 Ga0395905_0463395_446_979 177
724 3300037471 Ga0395905_1125155 Ga0395905_1125155_52_585 177
725 3300037853 Ga0436364_0130730 Ga0436364_0130730_1769_2302 177
726 3300037853 Ga0436364_0624330 Ga0436364_0624330_492_1025 177
727 3300037853 Ga0436364_1483493 Ga0436364_1483493_4850_5383 177
728 3300038443 Ga0395901_0022368 Ga0395901_0022368_2942_3475 177
729 3300038443 Ga0395901_0053587 Ga0395901_0053587_2798_3331 177
730 3300038443 Ga0395901_0057679 Ga0395901_0057679_2839_3372 177
731 3300038443 Ga0395901_0148822 Ga0395901_0148822_301_834 177
732 3300038443 Ga0395901_0150685 Ga0395901_0150685_1045_1578 177
733 3300038443 Ga0395901_0374484 Ga0395901_0374484_606_1139 177
734 3300038443 Ga0395901_0453379 Ga0395901_0453379_237_770 177
735 3300038443 Ga0395901_0907470 Ga0395901_0907470_232_765 177
736 3300038443 Ga0395901_1351428 Ga0395901_1351428_56_589 177
737 3300039437 Ga0436365_0376847 Ga0436365_0376847_14791_15324 177
738 3300039437 Ga0436365_1158188 Ga0436365_1158188_832_1365 177
739 3300039437 Ga0436365_1322648 Ga0436365_1322648_608_1141 177
740 3300039437 Ga0436365_1869888 Ga0436365_1869888_239_772 177
741 3300039438 Ga0436360_0795636 Ga0436360_0795636_14_547 177
742 3300039447 Ga0436361_0376133 Ga0436361_0376133_309_842 177
743 3300039447 Ga0436361_0446519 Ga0436361_0446519_147_680 177
744 3300039447 Ga0436361_0953537 Ga0436361_0953537_25461_25994 177
745 3300039453 Ga0436362_0949831 Ga0436362_0949831_253_801 177
746 3300041410 Ga0439461_0035394 Ga0439461_0035394_403_936 177
747 3300041413 Ga0439465_0018730 Ga0439465_0018730_539_1072 177
748 3300041446 Ga0451794_20570 Ga0451794_20570_72_605 177
749 3300041486 Ga0451807_0277899 Ga0451807_0277899_113_646 177
750 3300041486 Ga0451807_1809595 Ga0451807_1809595_10_543 177
751 3300041494 Ga0451837_0248662 Ga0451837_0248662_952_1485 177
752 3300041498 Ga0451841_1058791 Ga0451841_1058791_369_902 177
753 3300041512 Ga0451853_0259300 Ga0451853_0259300_229_762 177
754 3300041997 Ga0439431_0076865 Ga0439431_0076865_50_583 177
755 3300042004 Ga0439445_0082482 Ga0439445_0082482_183_716 177
756 3300042007 Ga0439449_0126629 Ga0439449_0126629_176_709 177
757 3300042012 Ga0439455_0005999 Ga0439455_0005999_1259_1792 177
758 3300042125 Ga0450923_059451 Ga0450923_059451_168_701 177
759 3300042156 Ga0439446_0038799 Ga0439446_0038799_296_829 177
760 3300042438 Ga0439459_0000384 Ga0439459_0000384_3745_4278 177
761 3300042439 Ga0439464_0214024 Ga0439464_0214024_46_579 177
762 3300042461 Ga0439460_0165993 Ga0439460_0165993_123_656 177
763 3300044656 Ga0466969_0002862 Ga0466969_0002862_2070_2603 177
764 3300044656 Ga0466969_0119995 Ga0466969_0119995_16_549 177
765 3300044683 Ga0466965_0113070 Ga0466965_0113070_425_958 177
766 3300044684 Ga0466966_0001452 Ga0466966_0001452_10570_11103 177
767 3300044693 Ga0466961_0000659 Ga0466961_0000659_13972_14505 177
768 3300044693 Ga0466961_0272072 Ga0466961_0272072_187_720 177
769 3300044694 Ga0466963_0167988 Ga0466963_0167988_231_764 177
770 3300044719 Ga0466971_0000901 Ga0466971_0000901_11611_12144 177
771 3300044719 Ga0466971_0279206 Ga0466971_0279206_104_637 177
772 3300044765 Ga0466970_0004965 Ga0466970_0004965_3610_4143 177
773 3300044842 Ga0466957_0012919 Ga0466957_0012919_180_713 177
774 3300044842 Ga0466957_0314944 Ga0466957_0314944_241_774 177
775 3300045049 Ga0466959_0000162 Ga0466959_0000162_9115_9648 177
776 3300045049 Ga0466959_0036896 Ga0466959_0036896_1349_1882 177
777 3300045836 Ga0466958_0000155 Ga0466958_0000155_1698_2231 177
778 3300046453 Ga0495627_000399 Ga0495627_000399_9336_9869 177
779 3300046455 Ga0495603_0048789 Ga0495603_0048789_979_1512 177
780 3300046455 Ga0495603_0655579 Ga0495603_0655579_49_582 177
781 3300046457 Ga0495590_0003932 Ga0495590_0003932_4604_5137 177
782 3300046459 Ga0495629_0011151 Ga0495629_0011151_2465_2998 177
783 3300046459 Ga0495629_0131561 Ga0495629_0131561_369_902 177
784 3300046460 Ga0495638_0102148 Ga0495638_0102148_110_643 177
785 3300046460 Ga0495638_0159678 Ga0495638_0159678_636_1169 177
786 3300046460 Ga0495638_0293000 Ga0495638_0293000_134_667 177
787 3300046471 Ga0495650_0000269 Ga0495650_0000269_134_667 177
788 3300046471 Ga0495650_0096644 Ga0495650_0096644_133_666 177
789 3300046471 Ga0495650_0114351 Ga0495650_0114351_410_943 177
790 3300046473 Ga0495582_0034380 Ga0495582_0034380_623_1156 177
791 3300046474 Ga0495605_0119117 Ga0495605_0119117_96_629 177
792 3300046491 Ga0495584_0094537 Ga0495584_0094537_435_968 177
793 3300046491 Ga0495584_0411060 Ga0495584_0411060_120_653 177
794 3300046492 Ga0495585_0047175 Ga0495585_0047175_1359_1892 177
795 3300046501 Ga0495607_0050892 Ga0495607_0050892_578_1111 177
796 3300046506 Ga0495583_0000650 Ga0495583_0000650_18293_18826 177
797 3300046506 Ga0495583_0044333 Ga0495583_0044333_835_1368 177
798 3300046506 Ga0495583_0152012 Ga0495583_0152012_330_863 177
799 3300046507 Ga0495606_0041810 Ga0495606_0041810_1558_2091 177
800 3300046507 Ga0495606_0082018 Ga0495606_0082018_493_1026 177
801 3300046507 Ga0495606_0228192 Ga0495606_0228192_138_671 177
802 3300046512 Ga0495610_0017211 Ga0495610_0017211_3202_3735 177
803 3300046512 Ga0495610_0036158 Ga0495610_0036158_1981_2514 177
804 3300046512 Ga0495610_0062120 Ga0495610_0062120_978_1511 177
805 3300046515 Ga0495620_0053397 Ga0495620_0053397_165_698 177
806 3300046518 Ga0495631_0143450 Ga0495631_0143450_356_889 177
807 3300046519 Ga0495632_0041761 Ga0495632_0041761_1420_1953 177
808 3300046520 Ga0495637_0015304 Ga0495637_0015304_889_1422 177
809 3300046520 Ga0495637_0057106 Ga0495637_0057106_193_726 177
810 3300046520 Ga0495637_0089253 Ga0495637_0089253_662_1195 177
811 3300046522 Ga0495643_0002864 Ga0495643_0002864_2975_3508 177
812 3300046522 Ga0495643_0302479 Ga0495643_0302479_155_688 177
813 3300046524 Ga0495648_0014211 Ga0495648_0014211_4306_4839 177
814 3300046524 Ga0495648_0070299 Ga0495648_0070299_913_1446 177
815 3300046524 Ga0495648_0160454 Ga0495648_0160454_548_1081 177
816 3300046525 Ga0495663_0008611 Ga0495663_0008611_2189_2722 177
817 3300046525 Ga0495663_0020482 Ga0495663_0020482_732_1265 177
818 3300046528 Ga0495642_0008396 Ga0495642_0008396_3338_3871 177
819 3300046528 Ga0495642_0165305 Ga0495642_0165305_414_947 177
820 3300046529 Ga0495652_0586238 Ga0495652_0586238_182_715 177
821 3300046537 Ga0495598_0036334 Ga0495598_0036334_142_675 177
822 3300046538 Ga0495609_0219665 Ga0495609_0219665_71_604 177
823 3300046538 Ga0495609_0283261 Ga0495609_0283261_106_639 177
824 3300046539 Ga0495621_0075144 Ga0495621_0075144_239_772 177
825 3300046542 Ga0495597_0001666 Ga0495597_0001666_10111_10644 177
826 3300046542 Ga0495597_0020495 Ga0495597_0020495_1593_2126 177
827 3300046542 Ga0495597_0135910 Ga0495597_0135910_177_710 177
828 3300046542 Ga0495597_0187444 Ga0495597_0187444_255_788 177
829 3300046557 Ga0495622_0002985 Ga0495622_0002985_873_1406 177
830 3300046558 Ga0495633_0008831 Ga0495633_0008831_3098_3631 177
831 3300046558 Ga0495633_0029769 Ga0495633_0029769_203_736 177
832 3300046616 Ga0495668_0001504 Ga0495668_0001504_3579_4112 177
833 3300046616 Ga0495668_0010366 Ga0495668_0010366_154_687 177
834 3300046616 Ga0495668_0010401 Ga0495668_0010401_5041_5574 177
835 3300046616 Ga0495668_0015955 Ga0495668_0015955_758_1291 177
836 3300046616 Ga0495668_0064267 Ga0495668_0064267_63_596 177
837 3300046616 Ga0495668_0097894 Ga0495668_0097894_219_752 177
838 3300046616 Ga0495668_0326583 Ga0495668_0326583_220_753 177
839 3300046642 Ga0495634_0082548 Ga0495634_0082548_1091_1624 177
840 3300046648 Ga0495611_0005291 Ga0495611_0005291_4866_5399 177
841 3300046660 Ga0495625_0001925 Ga0495625_0001925_4918_5451 177
842 3300046660 Ga0495625_0029168 Ga0495625_0029168_942_1475 177
843 3300046660 Ga0495625_0049607 Ga0495625_0049607_68_601 177
844 3300046660 Ga0495625_0092672 Ga0495625_0092672_636_1169 177
845 3300046660 Ga0495625_0255297 Ga0495625_0255297_507_1040 177
846 3300046674 Ga0495588_0134261 Ga0495588_0134261_691_1224 177
847 3300046681 Ga0495647_0194474 Ga0495647_0194474_25_558 177
848 3300046683 Ga0495658_0066307 Ga0495658_0066307_550_1083 177
849 3300046684 Ga0495669_0000044 Ga0495669_0000044_76624_77157 177
850 3300046684 Ga0495669_0004323 Ga0495669_0004323_2538_3071 177
851 3300046684 Ga0495669_0054174 Ga0495669_0054174_712_1245 177
852 3300046689 Ga0495613_0000576 Ga0495613_0000576_21799_22332 177
853 3300046691 Ga0495670_0150002 Ga0495670_0150002_219_752 177
854 3300046694 Ga0495649_0000981 Ga0495649_0000981_14939_15472 177
855 3300046794 Ga0495589_0175592 Ga0495589_0175592_82_615 177
856 3300046810 Ga0495660_0035609 Ga0495660_0035609_2007_2540 177
857 3300046810 Ga0495660_0259253 Ga0495660_0259253_239_772 177
858 3300047315 Ga0495581_0127218 Ga0495581_0127218_392_925 177
859 3300047318 Ga0495636_0006624 Ga0495636_0006624_798_1331 177
860 3300047320 Ga0495672_0000439 Ga0495672_0000439_38834_39367 177
861 3300047320 Ga0495672_0258142 Ga0495672_0258142_179_712 177
862 3300047321 Ga0495676_0246773 Ga0495676_0246773_362_895 177
863 3300047322 Ga0495680_0356648 Ga0495680_0356648_147_680 177
864 3300047323 Ga0495683_0149520 Ga0495683_0149520_177_710 177
865 3300047443 Ga0495687_008468 Ga0495687_008468_530_1063 177
866 3300047445 Ga0495677_0011535 Ga0495677_0011535_224_757 177
867 3300047469 Ga0495673_0000189 Ga0495673_0000189_92371_92904 177
868 3300047469 Ga0495673_0006882 Ga0495673_0006882_5179_5712 177
869 3300047469 Ga0495673_0118202 Ga0495673_0118202_97_630 177
870 3300047471 Ga0495684_0820251 Ga0495684_0820251_23_556 177
871 3300047472 Ga0495686_0000007 Ga0495686_0000007_327751_328287 177
872 3300047472 Ga0495686_0015147 Ga0495686_0015147_111_644 177
873 3300047472 Ga0495686_0029450 Ga0495686_0029450_56_589 177
874 3300047472 Ga0495686_0172695 Ga0495686_0172695_524_1057 177
875 3300047472 Ga0495686_0182733 Ga0495686_0182733_93_629 177
876 3300047673 Ga0495593_0008408 Ga0495593_0008408_623_1156 177
877 3300048088 Ga0495602_0204492 Ga0495602_0204492_478_1011 177
878 3300048089 Ga0495614_0079716 Ga0495614_0079716_580_1113 177
879 3300048090 Ga0495615_0002803 Ga0495615_0002803_1113_1646 177
880 3300048903 Ga0496100_0027948 Ga0496100_0027948_1365_1898 177
881 3300048903 Ga0496100_0210999 Ga0496100_0210999_678_1211 177
882 3300048903 Ga0496100_0743659 Ga0496100_0743659_86_619 177
883 3300048904 Ga0496101_0008514 Ga0496101_0008514_3658_4191 177
884 3300048904 Ga0496101_0023677 Ga0496101_0023677_1713_2246 177
885 3300048904 Ga0496101_0912715 Ga0496101_0912715_77_610 177
886 3300048905 Ga0496102_0003818 Ga0496102_0003818_11822_12355 177
887 3300048905 Ga0496102_0090282 Ga0496102_0090282_1412_1945 177
888 3300048905 Ga0496102_0734169 Ga0496102_0734169_280_813 177
889 3300048905 Ga0496102_1441352 Ga0496102_1441352_61_594 177
890 3300048906 Ga0496103_0007277 Ga0496103_0007277_2710_3243 177
891 3300048906 Ga0496103_0053056 Ga0496103_0053056_792_1325 177
892 3300048906 Ga0496103_0121911 Ga0496103_0121911_424_957 177
893 3300048907 Ga0496104_0014856 Ga0496104_0014856_2624_3157 177
894 3300048907 Ga0496104_0553724 Ga0496104_0553724_377_910 177
895 3300048907 Ga0496104_1054389 Ga0496104_1054389_162_695 177
896 3300048908 Ga0496105_0016058 Ga0496105_0016058_1398_1931 177
897 3300048908 Ga0496105_0115382 Ga0496105_0115382_1126_1659 177
898 3300048908 Ga0496105_0248745 Ga0496105_0248745_429_962 177
899 3300048909 Ga0496106_0002470 Ga0496106_0002470_10022_10555 177
900 3300048909 Ga0496106_0014990 Ga0496106_0014990_5044_5577 177
901 3300048909 Ga0496106_0175665 Ga0496106_0175665_1028_1561 177
902 3300048909 Ga0496106_0313037 Ga0496106_0313037_23_556 177
903 3300048910 Ga0496107_0000073 Ga0496107_0000073_41777_42310 177
904 3300048910 Ga0496107_0006852 Ga0496107_0006852_6164_6697 177
905 3300048910 Ga0496107_0020868 Ga0496107_0020868_771_1304 177
906 3300048910 Ga0496107_0083885 Ga0496107_0083885_1268_1801 177
907 3300048910 Ga0496107_0097119 Ga0496107_0097119_894_1427 177
908 3300048910 Ga0496107_0201518 Ga0496107_0201518_281_814 177
909 3300048911 Ga0496108_0058890 Ga0496108_0058890_338_871 177
910 3300048911 Ga0496108_0127109 Ga0496108_0127109_1569_2102 177
911 3300048911 Ga0496108_0381477 Ga0496108_0381477_514_1047 177
912 3300048911 Ga0496108_0968083 Ga0496108_0968083_44_577 177
913 3300048912 Ga0496109_0226770 Ga0496109_0226770_665_1198 177
914 3300048912 Ga0496109_0314953 Ga0496109_0314953_106_639 177
915 3300048913 Ga0496110_0038216 Ga0496110_0038216_1774_2307 177
916 3300048913 Ga0496110_0110944 Ga0496110_0110944_800_1333 177
917 3300048913 Ga0496110_0430196 Ga0496110_0430196_379_912 177
918 3300048913 Ga0496110_1440191 Ga0496110_1440191_44_577 177
919 3300048914 Ga0496111_0024086 Ga0496111_0024086_1633_2166 177
920 3300048914 Ga0496111_0048130 Ga0496111_0048130_197_730 177
921 3300048914 Ga0496111_0156346 Ga0496111_0156346_496_1029 177
922 3300048915 Ga0496112_0033003 Ga0496112_0033003_1647_2180 177
923 3300048915 Ga0496112_0421211 Ga0496112_0421211_221_754 177
924 3300048916 Ga0496113_0035256 Ga0496113_0035256_2184_2717 177
925 3300048917 Ga0496114_0001853 Ga0496114_0001853_1142_1675 177
926 3300048918 Ga0496115_0003309 Ga0496115_0003309_10263_10796 177
927 3300048918 Ga0496115_0037796 Ga0496115_0037796_609_1142 177
928 3300048918 Ga0496115_0085120 Ga0496115_0085120_1049_1582 177
929 3300048918 Ga0496115_0348888 Ga0496115_0348888_480_1013 177
930 3300048918 Ga0496115_0608510 Ga0496115_0608510_273_806 177
931 3300048919 Ga0496116_0030264 Ga0496116_0030264_3220_3753 177
932 3300048920 Ga0496117_0046658 Ga0496117_0046658_1626_2159 177
933 3300048921 Ga0496118_0018740 Ga0496118_0018740_903_1436 177
934 3300048922 Ga0496119_0023935 Ga0496119_0023935_2635_3168 177
935 3300048924 Ga0496121_0000946 Ga0496121_0000946_24337_24870 177
936 3300048924 Ga0496121_0023808 Ga0496121_0023808_4367_4900 177
937 3300048924 Ga0496121_0320914 Ga0496121_0320914_186_719 177
938 3300048924 Ga0496121_0437934 Ga0496121_0437934_235_768 177
939 3300048924 Ga0496121_0542480 Ga0496121_0542480_86_619 177
940 3300048925 Ga0496122_0011257 Ga0496122_0011257_4946_5479 177
941 3300048925 Ga0496122_0341188 Ga0496122_0341188_24_557 177
942 3300048926 Ga0496123_0003905 Ga0496123_0003905_806_1339 177
943 3300048927 Ga0496124_0022787 Ga0496124_0022787_931_1464 177
944 3300048927 Ga0496124_0158183 Ga0496124_0158183_101_634 177
945 3300048927 Ga0496124_0254080 Ga0496124_0254080_301_834 177
946 3300048928 Ga0496125_0005322 Ga0496125_0005322_1689_2222 177
947 3300048928 Ga0496125_0104534 Ga0496125_0104534_806_1339 177
948 3300048928 Ga0496125_0112323 Ga0496125_0112323_1159_1692 177
949 3300048929 Ga0496126_0067161 Ga0496126_0067161_1807_2340 177
950 3300049128 Ga0501308_000762 Ga0501308_000762_1107_1640 177
951 3300049131 Ga0501341_01086 Ga0501341_01086_505_1038 177
952 3300049160 Ga0501304_004692 Ga0501304_004692_489_1022 177
953 3300049162 Ga0501307_009147 Ga0501307_009147_136_669 177
954 3300049459 Ga0495678_005077 Ga0495678_005077_3787_4320 177
955 3300049527 Ga0501311_001352 Ga0501311_001352_1075_1608 177
956 3300049527 Ga0501311_005112 Ga0501311_005112_410_943 177
957 3300049530 Ga0501314_021266 Ga0501314_021266_97_630 177
958 3300049533 Ga0501317_006725 Ga0501317_006725_411_944 177
959 3300049535 Ga0501319_000008 Ga0501319_000008_7375_7908 177
960 3300049535 Ga0501319_023326 Ga0501319_023326_11_544 177
961 3300049539 Ga0501323_002862 Ga0501323_002862_140_673 177
962 3300049539 Ga0501323_010191 Ga0501323_010191_460_993 177
963 3300049545 Ga0501329_01600 Ga0501329_01600_356_889 177
964 3300049569 Ga0501032_0376622 Ga0501032_0376622_46_579 177
965 3300049569 Ga0501032_0403667 Ga0501032_0403667_193_726 177
966 3300049570 Ga0501033_0100089 Ga0501033_0100089_555_1088 177
967 3300049570 Ga0501033_0114091 Ga0501033_0114091_399_932 177
968 3300049570 Ga0501033_0179594 Ga0501033_0179594_171_704 177
969 3300049571 Ga0501034_0098967 Ga0501034_0098967_1481_2014 177
970 3300049571 Ga0501034_0182168 Ga0501034_0182168_1091_1624 177
971 3300049571 Ga0501034_0204731 Ga0501034_0204731_253_786 177
972 3300049572 Ga0501036_0152380 Ga0501036_0152380_875_1408 177
973 3300049572 Ga0501036_0208859 Ga0501036_0208859_550_1083 177
974 3300049572 Ga0501036_0307394 Ga0501036_0307394_438_971 177
975 3300049572 Ga0501036_0544378 Ga0501036_0544378_189_722 177
976 3300049574 Ga0501038_0207166 Ga0501038_0207166_14_547 177
977 3300049574 Ga0501038_0623870 Ga0501038_0623870_259_792 177
978 3300049575 Ga0501039_0099046 Ga0501039_0099046_490_1023 177
979 3300049575 Ga0501039_0366474 Ga0501039_0366474_174_707 177
980 3300049576 Ga0501040_0030850 Ga0501040_0030850_1525_2058 177
981 3300049576 Ga0501040_0072778 Ga0501040_0072778_727_1260 177
982 3300049576 Ga0501040_0241135 Ga0501040_0241135_384_917 177
983 3300049577 Ga0501041_0067285 Ga0501041_0067285_685_1218 177
984 3300049577 Ga0501041_0215027 Ga0501041_0215027_213_746 177
985 3300049577 Ga0501041_0525725 Ga0501041_0525725_159_692 177
986 3300049577 Ga0501041_0539023 Ga0501041_0539023_192_725 177
987 3300049577 Ga0501041_0545089 Ga0501041_0545089_144_677 177
988 3300049578 Ga0501042_0123514 Ga0501042_0123514_1300_1833 177
989 3300049578 Ga0501042_0161685 Ga0501042_0161685_924_1457 177
990 3300049578 Ga0501042_0168875 Ga0501042_0168875_50_583 177
991 3300049578 Ga0501042_0178051 Ga0501042_0178051_490_1023 177
992 3300049579 Ga0501043_0038750 Ga0501043_0038750_1201_1734 177
993 3300049579 Ga0501043_0260557 Ga0501043_0260557_42_575 177
994 3300049581 Ga0501047_0034449 Ga0501047_0034449_1964_2497 177
995 3300049581 Ga0501047_0071357 Ga0501047_0071357_1592_2125 177
996 3300049581 Ga0501047_0135577 Ga0501047_0135577_818_1351 177
997 3300049581 Ga0501047_0141054 Ga0501047_0141054_567_1103 177
998 3300049581 Ga0501047_0162817 Ga0501047_0162817_1064_1597 177
999 3300049581 Ga0501047_0370072 Ga0501047_0370072_130_663 177
1000 3300049581 Ga0501047_0566768 Ga0501047_0566768_34_567 177
1001 3300049582 Ga0501048_0265626 Ga0501048_0265626_555_1088 177
1002 3300049583 Ga0501067_0007685 Ga0501067_0007685_703_1236 177
1003 3300049585 Ga0501069_0422584 Ga0501069_0422584_162_695 177
1004 3300049586 Ga0501070_0032293 Ga0501070_0032293_1083_1616 177
1005 3300049586 Ga0501070_0168040 Ga0501070_0168040_235_768 177
1006 3300049587 Ga0501071_0118385 Ga0501071_0118385_819_1352 177
1007 3300049587 Ga0501071_0288153 Ga0501071_0288153_439_972 177
1008 3300049588 Ga0501072_0153545 Ga0501072_0153545_1050_1583 177
1009 3300049588 Ga0501072_0686562 Ga0501072_0686562_255_788 177
1010 3300049589 Ga0501073_0026724 Ga0501073_0026724_994_1602 177
1011 3300049590 Ga0501074_0233789 Ga0501074_0233789_547_1080 177
1012 3300049591 Ga0501075_0393131 Ga0501075_0393131_49_582 177
1013 3300049591 Ga0501075_0580310 Ga0501075_0580310_126_659 177
1014 3300049592 Ga0501076_0274317 Ga0501076_0274317_187_720 177
1015 3300049592 Ga0501076_0941435 Ga0501076_0941435_59_592 177
1016 3300049593 Ga0501077_0064481 Ga0501077_0064481_1436_1969 177
1017 3300049671 Ga0501238_000438 Ga0501238_000438_90_623 177
1018 3300049741 Ga0501079_0079813 Ga0501079_0079813_1627_2160 177
1019 3300049741 Ga0501079_0514654 Ga0501079_0514654_50_583 177
1020 3300049742 Ga0501080_0101916 Ga0501080_0101916_1545_2078 177
1021 3300049743 Ga0501081_0065372 Ga0501081_0065372_1089_1622 177
1022 3300049760 Ga0501263_014075 Ga0501263_014075_399_932 177
1023 3300049822 Ga0501035_0033582 Ga0501035_0033582_1623_2156 177
1024 3300049822 Ga0501035_0881853 Ga0501035_0881853_137_670 177
1025 3300049823 Ga0501044_0210123 Ga0501044_0210123_1109_1642 177
1026 3300049823 Ga0501044_0223450 Ga0501044_0223450_853_1386 177
1027 3300049823 Ga0501044_0404179 Ga0501044_0404179_71_604 177
1028 3300049823 Ga0501044_0664164 Ga0501044_0664164_97_630 177
1029 3300049823 Ga0501044_1133459 Ga0501044_1133459_56_589 177
1030 3300049824 Ga0501045_0079358 Ga0501045_0079358_202_735 177
1031 3300049824 Ga0501045_0246640 Ga0501045_0246640_663_1196 177
1032 3300050489 nmdc:mga03683_100605_c2 nmdc:mga03683_100605_c2_86_619 177
1033 3300050489 nmdc:mga03683_179271_c1 nmdc:mga03683_179271_c1_175_708 177
1034 3300050490 nmdc:mga03n38_34767_c1 nmdc:mga03n38_34767_c1_664_1197 177
1035 3300050490 nmdc:mga03n38_43058_c1 nmdc:mga03n38_43058_c1_124_657 177
1036 3300050490 nmdc:mga03n38_43132_c1 nmdc:mga03n38_43132_c1_910_1443 177
1037 3300050492 nmdc:mga0yw44_117405_c1 nmdc:mga0yw44_117405_c1_967_1500 177
1038 3300050493 nmdc:mga0k408_11918_c1 nmdc:mga0k408_11918_c1_3441_3974 177
1039 3300050493 nmdc:mga0k408_16271_c1 nmdc:mga0k408_16271_c1_1255_1788 177
1040 3300050493 nmdc:mga0k408_3470_c1 nmdc:mga0k408_3470_c1_972_1505 177
1041 3300050494 nmdc:mga06z11_4918_c1 nmdc:mga06z11_4918_c1_2265_2798 177
1042 3300050496 nmdc:mga07m45_44026_c1 nmdc:mga07m45_44026_c1_1792_2325 177
1043 3300050496 nmdc:mga07m45_495427_c1 nmdc:mga07m45_495427_c1_22_555 177
1044 3300050507 nmdc:mga05p37_267849_c1 nmdc:mga05p37_267849_c1_553_1086 177
1045 3300050507 nmdc:mga05p37_89093_c1 nmdc:mga05p37_89093_c1_1660_2193 177
1046 3300050508 nmdc:mga09592_36262_c1 nmdc:mga09592_36262_c1_2932_3465 177
1047 3300050509 nmdc:mga0qj67_52086_c1 nmdc:mga0qj67_52086_c1_941_1474 177
1048 3300050510 nmdc:mga06r32_207130_c1 nmdc:mga06r32_207130_c1_916_1449 177
1049 3300050511 nmdc:mga08y16_583372_c1 nmdc:mga08y16_583372_c1_44_577 177
1050 3300050512 nmdc:mga0n895_1534_c1 nmdc:mga0n895_1534_c1_13207_13740 177
1051 3300050513 nmdc:mga0rr50_7611_c1 nmdc:mga0rr50_7611_c1_3743_4276 177
1052 3300050514 nmdc:mga08x19_63444_c1 nmdc:mga08x19_63444_c1_629_1162 177
1053 3300050515 nmdc:mga0a205_890_c1 nmdc:mga0a205_890_c1_1152_1685 177
1054 3300050516 nmdc:mga0sz30_17058_c1 nmdc:mga0sz30_17058_c1_2285_2818 177
1055 3300053080 Ga0500635_0000205 Ga0500635_0000205_19837_20370 177
1056 3300053085 Ga0495619_0741693 Ga0495619_0741693_119_652 177
1057 3300053086 Ga0500578_0000459 Ga0500578_0000459_29475_30008 177
1058 3300053088 Ga0500644_0000193 Ga0500644_0000193_19365_19898 177
1059 3300053088 Ga0500644_0004906 Ga0500644_0004906_1517_2050 177
1060 3300053091 Ga0500647_0003466 Ga0500647_0003466_4136_4669 177
1061 3300053092 Ga0500583_0043876 Ga0500583_0043876_869_1402 177
1062 3300053093 Ga0500651_0003210 Ga0500651_0003210_6986_7519 177
1063 3300053093 Ga0500651_0066265 Ga0500651_0066265_1627_2160 177
1064 3300053094 Ga0500566_0306669 Ga0500566_0306669_73_606 177
1065 3300053096 Ga0500641_0000731 Ga0500641_0000731_258_791 177
1066 3300053096 Ga0500641_0010127 Ga0500641_0010127_1868_2401 177
1067 3300053096 Ga0500641_0010509 Ga0500641_0010509_763_1296 177
1068 3300053102 Ga0500554_048927 Ga0500554_048927_497_1030 177
1069 3300053103 Ga0500555_000830 Ga0500555_000830_2098_2631 177
1070 3300053103 Ga0500555_049020 Ga0500555_049020_229_762 177
1071 3300053104 Ga0500556_0001077 Ga0500556_0001077_9156_9689 177
1072 3300053104 Ga0500556_0065074 Ga0500556_0065074_804_1337 177
1073 3300053108 Ga0500562_000644 Ga0500562_000644_6463_6996 177
1074 3300053108 Ga0500562_004235 Ga0500562_004235_2292_2825 177
1075 3300053108 Ga0500562_026039 Ga0500562_026039_349_882 177
1076 3300053111 Ga0500572_000706 Ga0500572_000706_5757_6290 177
1077 3300053111 Ga0500572_151849 Ga0500572_151849_52_585 177
1078 3300053118 Ga0500594_0004036 Ga0500594_0004036_1489_2022 177
1079 3300053119 Ga0500595_001651 Ga0500595_001651_2155_2688 177
1080 3300053119 Ga0500595_026433 Ga0500595_026433_907_1440 177
1081 3300053119 Ga0500595_038381 Ga0500595_038381_706_1239 177
1082 3300053122 Ga0500608_000222 Ga0500608_000222_17347_17880 177
1083 3300053122 Ga0500608_001997 Ga0500608_001997_1495_2028 177
1084 3300053123 Ga0500614_000617 Ga0500614_000617_8268_8801 177
1085 3300053125 Ga0500618_000703 Ga0500618_000703_332_865 177
1086 3300053130 Ga0500642_0153818 Ga0500642_0153818_275_808 177
1087 3300053130 Ga0500642_0312929 Ga0500642_0312929_64_597 177
1088 3300053134 Ga0500658_0000930 Ga0500658_0000930_8308_8841 177
1089 3300053134 Ga0500658_0116458 Ga0500658_0116458_199_732 177
1090 3300053136 Ga0500559_0001398 Ga0500559_0001398_7246_7779 177
1091 3300053136 Ga0500559_0011392 Ga0500559_0011392_579_1112 177
1092 3300053136 Ga0500559_0021969 Ga0500559_0021969_1014_1547 177
1093 3300053136 Ga0500559_0151466 Ga0500559_0151466_22_555 177
1094 3300053138 Ga0500564_031554 Ga0500564_031554_1121_1654 177
1095 3300053140 Ga0500573_0230252 Ga0500573_0230252_361_894 177
1096 3300053142 Ga0500577_0308540 Ga0500577_0308540_98_631 177
1097 3300053148 Ga0500590_004741 Ga0500590_004741_5036_5569 177
1098 3300053148 Ga0500590_178526 Ga0500590_178526_269_802 177
1099 3300053153 Ga0500616_0024622 Ga0500616_0024622_1129_1662 177
1100 3300053155 Ga0500620_051382 Ga0500620_051382_619_1152 177
1101 3300053156 Ga0500622_0000771 Ga0500622_0000771_3949_4482 177
1102 3300053156 Ga0500622_0040896 Ga0500622_0040896_972_1505 177
1103 3300053156 Ga0500622_0292388 Ga0500622_0292388_90_623 177
1104 3300053158 Ga0500627_0001516 Ga0500627_0001516_1952_2485 177
1105 3300053162 Ga0500638_128492 Ga0500638_128492_452_985 177
1106 3300053163 Ga0500639_198485 Ga0500639_198485_124_657 177
1107 3300053177 Ga0500636_0010869 Ga0500636_0010869_3143_3676 177
1108 3300053177 Ga0500636_0032046 Ga0500636_0032046_2336_2869 177
1109 3300053177 Ga0500636_0306259 Ga0500636_0306259_217_750 177
1110 3300053725 Ga0500576_019330 Ga0500576_019330_2478_3011 177
1111 3300053729 Ga0500625_054205 Ga0500625_054205_501_1034 177
1112 3300053730 Ga0500645_002894 Ga0500645_002894_1562_2095 177
1113 3300053731 Ga0500609_000093 Ga0500609_000093_9872_10405 177
1114 3300053735 Ga0500596_000363 Ga0500596_000363_1173_1706 177
1115 3300054114 Ga0501084_0237792 Ga0501084_0237792_536_1069 177
1116 3300059491 Ga0587070_010066 Ga0587070_010066_761_1294 177
1117 3300059493 Ga0587077_000756 Ga0587077_000756_2408_2941 177
1118 3300059493 Ga0587077_015902 Ga0587077_015902_76_612 177
1119 3300059493 Ga0587077_051251 Ga0587077_051251_202_735 177
1120 3300059503 Ga0587080_053827 Ga0587080_053827_151_684 177
1121 3300059507 Ga0587086_012095 Ga0587086_012095_154_687 177
1122 3300059605 Ga0587106_007267 Ga0587106_007267_206_739 177
1123 3300059623 Ga0587101_005901 Ga0587101_005901_15_548 177
1124 3300059623 Ga0587101_048491 Ga0587101_048491_69_602 177
1125 3300059645 Ga0587076_006682 Ga0587076_006682_816_1349 177
1126 3300059645 Ga0587076_019780 Ga0587076_019780_124_657 177
1127 3300059657 Ga0587118_12173 Ga0587118_12173_125_658 177
1128 3300060344 Ga0587071_002314 Ga0587071_002314_117_650 177
1129 3300060344 Ga0587071_004686 Ga0587071_004686_1072_1605 177
1130 3300060346 Ga0587111_0069972 Ga0587111_0069972_174_707 177
1131 3300060353 Ga0501082_0049068 Ga0501082_0049068_1143_1676 177
1132 3300060353 Ga0501082_0319389 Ga0501082_0319389_408_941 177
1133 3300060353 Ga0501082_0573781 Ga0501082_0573781_49_582 177
1134 3300061719 Ga0466962_0003721 Ga0466962_0003721_6130_6663 177
1135 3300061734 Ga0530510_0008283 Ga0530510_0008283_5617_6150 177
1136 3300061734 Ga0530510_0125085 Ga0530510_0125085_397_930 177
1137 3300061734 Ga0530510_0189448 Ga0530510_0189448_525_1058 177
1138 3300061734 Ga0530510_0680445 Ga0530510_0680445_38_571 177
1139 3300002076 JGI24749J21850_1006022 JGI24749J21850_10060223 178
1140 3300002126 JGI24035J26624_1000912 JGI24035J26624_10009125 178
1141 3300002155 JGI24033J26618_1000637 JGI24033J26618_10006376 178
1142 3300002155 JGI24033J26618_1000726 JGI24033J26618_10007263 178
1143 3300002244 JGI24742J22300_10018588 JGI24742J22300_100185882 178
1144 3300002459 JGI24751J29686_10000650 JGI24751J29686_100006509 178
1145 3300002459 JGI24751J29686_10016465 JGI24751J29686_100164653 178
1146 3300003163 Ga0006759J45824_1017000 Ga0006759J45824_10170003 178
1147 3300003300 Ga0006758J48902_1026514 Ga0006758J48902_10265141 178
1148 3300003308 Ga0006777J48905_1063427 Ga0006777J48905_10634271 178
1149 3300003322 rootL2_10038024 rootL2_100380243 178
1150 3300003568 Ga0006781J51513_1017202 Ga0006781J51513_10172022 178
1151 3300003575 Ga0007409J51694_1099612 Ga0007409J51694_10996121 178
1152 3300003577 Ga0007416J51690_1018963 Ga0007416J51690_10189632 178
1153 3300003579 Ga0007429J51699_1082617 Ga0007429J51699_10826172 178
1154 3300003693 Ga0032354_1008702 Ga0032354_10087024 178
1155 3300003693 Ga0032354_1059984 Ga0032354_10599841 178
1156 3300003735 Ga0006780_1011098 Ga0006780_10110981 178
1157 3300004798 Ga0058859_10112101 Ga0058859_101121013 178
1158 3300004800 Ga0058861_10162389 Ga0058861_101623892 178
1159 3300004801 Ga0058860_10083617 Ga0058860_100836172 178
1160 3300005288 Ga0065714_10028292 Ga0065714_100282921 178
1161 3300005288 Ga0065714_10039350 Ga0065714_100393501 178
1162 3300005329 Ga0070683_100323389 Ga0070683_1003233894 178
1163 3300005331 Ga0070670_100067478 Ga0070670_1000674783 178
1164 3300005333 Ga0070677_10043737 Ga0070677_100437373 178
1165 3300005334 Ga0068869_100043595 Ga0068869_1000435957 178
1166 3300005334 Ga0068869_100144909 Ga0068869_1001449092 178
1167 3300005338 Ga0068868_100092225 Ga0068868_1000922255 178
1168 3300005338 Ga0068868_100314712 Ga0068868_1003147122 178
1169 3300005341 Ga0070691_10040879 Ga0070691_100408794 178
1170 3300005341 Ga0070691_10101956 Ga0070691_101019563 178
1171 3300005343 Ga0070687_100205728 Ga0070687_1002057283 178
1172 3300005344 Ga0070661_100020772 Ga0070661_1000207729 178
1173 3300005347 Ga0070668_100049055 Ga0070668_1000490556 178
1174 3300005347 Ga0070668_100104823 Ga0070668_1001048234 178
1175 3300005353 Ga0070669_100021730 Ga0070669_1000217304 178
1176 3300005353 Ga0070669_100273788 Ga0070669_1002737882 178
1177 3300005354 Ga0070675_100017277 Ga0070675_1000172779 178
1178 3300005354 Ga0070675_100019885 Ga0070675_1000198856 178
1179 3300005354 Ga0070675_100409703 Ga0070675_1004097033 178
1180 3300005355 Ga0070671_100004934 Ga0070671_1000049347 178
1181 3300005355 Ga0070671_100049752 Ga0070671_1000497528 178
1182 3300005356 Ga0070674_100095404 Ga0070674_1000954042 178
1183 3300005364 Ga0070673_100014103 Ga0070673_1000141033 178
1184 3300005366 Ga0070659_100216613 Ga0070659_1002166133 178
1185 3300005367 Ga0070667_100011523 Ga0070667_1000115236 178
1186 3300005367 Ga0070667_100078188 Ga0070667_1000781882 178
1187 3300005406 Ga0070703_10105878 Ga0070703_101058782 178
1188 3300005439 Ga0070711_100078839 Ga0070711_1000788396 178
1189 3300005440 Ga0070705_100013049 Ga0070705_1000130497 178
1190 3300005440 Ga0070705_100037779 Ga0070705_1000377795 178
1191 3300005441 Ga0070700_100202413 Ga0070700_1002024132 178
1192 3300005441 Ga0070700_100205068 Ga0070700_1002050682 178
1193 3300005441 Ga0070700_100241031 Ga0070700_1002410312 178
1194 3300005441 Ga0070700_100292977 Ga0070700_1002929771 178
1195 3300005445 Ga0070708_100006790 Ga0070708_1000067904 178
1196 3300005445 Ga0070708_100149394 Ga0070708_1001493942 178
1197 3300005455 Ga0070663_100201623 Ga0070663_1002016232 178
1198 3300005456 Ga0070678_100087740 Ga0070678_1000877404 178
1199 3300005456 Ga0070678_100152381 Ga0070678_1001523814 178
1200 3300005457 Ga0070662_100050032 Ga0070662_1000500326 178
1201 3300005458 Ga0070681_10186789 Ga0070681_101867893 178
1202 3300005466 Ga0070685_10118986 Ga0070685_101189863 178
1203 3300005468 Ga0070707_100006906 Ga0070707_10000690611 178
1204 3300005468 Ga0070707_100033729 Ga0070707_1000337296 178
1205 3300005471 Ga0070698_100017647 Ga0070698_1000176476 178
1206 3300005518 Ga0070699_100032426 Ga0070699_1000324268 178
1207 3300005530 Ga0070679_100261840 Ga0070679_1002618404 178
1208 3300005535 Ga0070684_100032950 Ga0070684_1000329501 178
1209 3300005536 Ga0070697_100343238 Ga0070697_1003432382 178
1210 3300005536 Ga0070697_100472740 Ga0070697_1004727401 178
1211 3300005543 Ga0070672_100037907 Ga0070672_1000379073 178
1212 3300005544 Ga0070686_100013633 Ga0070686_1000136334 178
1213 3300005544 Ga0070686_100051189 Ga0070686_1000511895 178
1214 3300005545 Ga0070695_100099797 Ga0070695_1000997973 178
1215 3300005545 Ga0070695_100404583 Ga0070695_1004045832 178
1216 3300005545 Ga0070695_100508680 Ga0070695_1005086802 178
1217 3300005546 Ga0070696_100008489 Ga0070696_1000084897 178
1218 3300005546 Ga0070696_100440169 Ga0070696_1004401691 178
1219 3300005546 Ga0070696_100843543 Ga0070696_1008435432 178
1220 3300005548 Ga0070665_100070803 Ga0070665_1000708036 178
1221 3300005549 Ga0070704_100279897 Ga0070704_1002798973 178
1222 3300005564 Ga0070664_100023793 Ga0070664_1000237931 178
1223 3300005577 Ga0068857_100394244 Ga0068857_1003942443 178
1224 3300005577 Ga0068857_100890587 Ga0068857_1008905872 178
1225 3300005578 Ga0068854_100216989 Ga0068854_1002169893 178
1226 3300005615 Ga0070702_100069906 Ga0070702_1000699064 178
1227 3300005615 Ga0070702_100183485 Ga0070702_1001834852 178
1228 3300005618 Ga0068864_100050052 Ga0068864_1000500527 178
1229 3300005718 Ga0068866_10013518 Ga0068866_100135186 178
1230 3300005718 Ga0068866_10033637 Ga0068866_100336373 178
1231 3300005719 Ga0068861_100019757 Ga0068861_1000197573 178
1232 3300005840 Ga0068870_10000375 Ga0068870_1000037522 178
1233 3300005840 Ga0068870_10051146 Ga0068870_100511464 178
1234 3300005841 Ga0068863_100013521 Ga0068863_10001352114 178
1235 3300005842 Ga0068858_100262915 Ga0068858_1002629153 178
1236 3300005842 Ga0068858_100864333 Ga0068858_1008643332 178
1237 3300005844 Ga0068862_100053766 Ga0068862_1000537666 178
1238 3300005937 Ga0081455_10035927 Ga0081455_1003592710 178
1239 3300005937 Ga0081455_10101402 Ga0081455_101014022 178
1240 3300005981 Ga0081538_10002670 Ga0081538_1000267016 178
1241 3300005981 Ga0081538_10073417 Ga0081538_100734173 178
1242 3300005985 Ga0081539_10008891 Ga0081539_100088917 178
1243 3300005985 Ga0081539_10027263 Ga0081539_100272634 178
1244 3300005985 Ga0081539_10137035 Ga0081539_101370352 178
1245 3300006038 Ga0075365_10374925 Ga0075365_103749252 178
1246 3300006058 Ga0075432_10014356 Ga0075432_100143562 178
1247 3300006058 Ga0075432_10104569 Ga0075432_101045691 178
1248 3300006163 Ga0070715_10014627 Ga0070715_100146272 178
1249 3300006178 Ga0075367_10316816 Ga0075367_103168161 178
1250 3300006358 Ga0068871_100092158 Ga0068871_1000921584 178
1251 3300006844 Ga0075428_100010442 Ga0075428_1000104426 178
1252 3300006844 Ga0075428_100087947 Ga0075428_1000879476 178
1253 3300006844 Ga0075428_100235990 Ga0075428_1002359903 178
1254 3300006844 Ga0075428_100333483 Ga0075428_1003334833 178
1255 3300006846 Ga0075430_100000285 Ga0075430_10000028536 178
1256 3300006846 Ga0075430_100150096 Ga0075430_1001500964 178
1257 3300006846 Ga0075430_100155229 Ga0075430_1001552293 178
1258 3300006847 Ga0075431_100000899 Ga0075431_10000089922 178
1259 3300006847 Ga0075431_100034918 Ga0075431_1000349182 178
1260 3300006852 Ga0075433_10008128 Ga0075433_100081288 178
1261 3300006852 Ga0075433_10018245 Ga0075433_1001824512 178
1262 3300006871 Ga0075434_100005718 Ga0075434_10000571816 178
1263 3300006871 Ga0075434_100025716 Ga0075434_10002571610 178
1264 3300006880 Ga0075429_100000228 Ga0075429_10000022812 178
1265 3300006880 Ga0075429_100127604 Ga0075429_1001276043 178
1266 3300006880 Ga0075429_100132193 Ga0075429_1001321933 178
1267 3300006881 Ga0068865_100042110 Ga0068865_1000421104 178
1268 3300006914 Ga0075436_100088522 Ga0075436_1000885223 178
1269 3300007076 Ga0075435_100005575 Ga0075435_1000055754 178
1270 3300009011 Ga0105251_10011731 Ga0105251_100117313 178
1271 3300009011 Ga0105251_10013458 Ga0105251_100134585 178
1272 3300009011 Ga0105251_10239691 Ga0105251_102396912 178
1273 3300009036 Ga0105244_10007192 Ga0105244_100071928 178
1274 3300009092 Ga0105250_10085986 Ga0105250_100859861 178
1275 3300009093 Ga0105240_10592490 Ga0105240_105924902 178
1276 3300009094 Ga0111539_10036756 Ga0111539_100367568 178
1277 3300009094 Ga0111539_10360723 Ga0111539_103607232 178
1278 3300009094 Ga0111539_10406545 Ga0111539_104065453 178
1279 3300009098 Ga0105245_10022916 Ga0105245_100229167 178
1280 3300009098 Ga0105245_10062833 Ga0105245_100628335 178
1281 3300009098 Ga0105245_10389733 Ga0105245_103897331 178
1282 3300009098 Ga0105245_10602058 Ga0105245_106020582 178
1283 3300009098 Ga0105245_10675311 Ga0105245_106753111 178
1284 3300009101 Ga0105247_10052455 Ga0105247_100524554 178
1285 3300009101 Ga0105247_10094235 Ga0105247_100942353 178
1286 3300009147 Ga0114129_10007341 Ga0114129_1000734122 178
1287 3300009147 Ga0114129_10028692 Ga0114129_100286926 178
1288 3300009147 Ga0114129_10039220 Ga0114129_100392202 178
1289 3300009147 Ga0114129_10079992 Ga0114129_1007999210 178
1290 3300009147 Ga0114129_10157389 Ga0114129_101573892 178
1291 3300009147 Ga0114129_10208861 Ga0114129_102088613 178
1292 3300009147 Ga0114129_10831253 Ga0114129_108312532 178
1293 3300009148 Ga0105243_10004939 Ga0105243_1000493915 178
1294 3300009148 Ga0105243_10029366 Ga0105243_100293666 178
1295 3300009148 Ga0105243_10120876 Ga0105243_101208763 178
1296 3300009148 Ga0105243_10503564 Ga0105243_105035643 178
1297 3300009148 Ga0105243_10752857 Ga0105243_107528572 178
1298 3300009176 Ga0105242_10007115 Ga0105242_100071153 178
1299 3300009176 Ga0105242_10045359 Ga0105242_100453594 178
1300 3300009177 Ga0105248_10026397 Ga0105248_100263972 178
1301 3300009177 Ga0105248_10044644 Ga0105248_1004464410 178
1302 3300009551 Ga0105238_10147975 Ga0105238_101479753 178
1303 3300009551 Ga0105238_10455947 Ga0105238_104559471 178
1304 3300009553 Ga0105249_10014593 Ga0105249_100145938 178
1305 3300009553 Ga0105249_10085350 Ga0105249_100853502 178
1306 3300009553 Ga0105249_10329165 Ga0105249_103291652 178
1307 3300009553 Ga0105249_10914107 Ga0105249_109141072 178
1308 3300010375 Ga0105239_10584854 Ga0105239_105848542 178
1309 3300010375 Ga0105239_10788988 Ga0105239_107889882 178
1310 3300011119 Ga0105246_10045805 Ga0105246_100458052 178
1311 3300011119 Ga0105246_10200648 Ga0105246_102006482 178
1312 3300012507 Ga0157342_1045627 Ga0157342_10456271 178
1313 3300013100 Ga0157373_10072419 Ga0157373_100724192 178
1314 3300013102 Ga0157371_10011651 Ga0157371_100116517 178
1315 3300013104 Ga0157370_10890326 Ga0157370_108903262 178
1316 3300013104 Ga0157370_11340582 Ga0157370_113405822 178
1317 3300013105 Ga0157369_10097245 Ga0157369_100972451 178
1318 3300013296 Ga0157374_10400952 Ga0157374_104009523 178
1319 3300013296 Ga0157374_10822569 Ga0157374_108225692 178
1320 3300013297 Ga0157378_10021079 Ga0157378_100210794 178
1321 3300013297 Ga0157378_10213504 Ga0157378_102135041 178
1322 3300013297 Ga0157378_10390695 Ga0157378_103906951 178
1323 3300013297 Ga0157378_11042012 Ga0157378_110420122 178
1324 3300013306 Ga0163162_10111590 Ga0163162_101115904 178
1325 3300013307 Ga0157372_10872783 Ga0157372_108727831 178
1326 3300013308 Ga0157375_10468495 Ga0157375_104684952 178
1327 3300014325 Ga0163163_10006685 Ga0163163_100066857 178
1328 3300014325 Ga0163163_10694372 Ga0163163_106943722 178
1329 3300014326 Ga0157380_10240595 Ga0157380_102405952 178
1330 3300014326 Ga0157380_10244865 Ga0157380_102448652 178
1331 3300014497 Ga0182008_10089559 Ga0182008_100895591 178
1332 3300014745 Ga0157377_10162679 Ga0157377_101626794 178
1333 3300014968 Ga0157379_10013956 Ga0157379_100139566 178
1334 3300014969 Ga0157376_10190886 Ga0157376_101908862 178
1335 3300017792 Ga0163161_10009195 Ga0163161_100091956 178
1336 3300017792 Ga0163161_10126258 Ga0163161_101262583 178
1337 3300020070 Ga0206356_11120293 Ga0206356_111202932 178
1338 3300020075 Ga0206349_1655200 Ga0206349_16552002 178
1339 3300020077 Ga0206351_10841747 Ga0206351_108417472 178
1340 3300020078 Ga0206352_10771567 Ga0206352_107715671 178
1341 3300020080 Ga0206350_10327598 Ga0206350_103275983 178
1342 3300023309 Ga0256744_124951 Ga0256744_1249511 178
1343 3300023438 Ga0256720_139426 Ga0256720_1394262 178
1344 3300025290 Ga0207673_1001242 Ga0207673_10012422 178
1345 3300025315 Ga0207697_10002965 Ga0207697_100029659 178
1346 3300025728 Ga0207655_1002359 Ga0207655_10023599 178
1347 3300025735 Ga0207713_1017717 Ga0207713_10177176 178
1348 3300025735 Ga0207713_1044888 Ga0207713_10448884 178
1349 3300025885 Ga0207653_10000045 Ga0207653_100000458 178
1350 3300025885 Ga0207653_10005900 Ga0207653_100059009 178
1351 3300025893 Ga0207682_10002609 Ga0207682_100026099 178
1352 3300025898 Ga0207692_10051672 Ga0207692_100516722 178
1353 3300025898 Ga0207692_10056267 Ga0207692_100562671 178
1354 3300025899 Ga0207642_10045839 Ga0207642_100458392 178
1355 3300025900 Ga0207710_10165577 Ga0207710_101655772 178
1356 3300025901 Ga0207688_10024145 Ga0207688_100241454 178
1357 3300025901 Ga0207688_10041983 Ga0207688_100419832 178
1358 3300025905 Ga0207685_10045074 Ga0207685_100450741 178
1359 3300025907 Ga0207645_10022520 Ga0207645_100225208 178
1360 3300025907 Ga0207645_10073745 Ga0207645_100737455 178
1361 3300025908 Ga0207643_10000118 Ga0207643_1000011863 178
1362 3300025908 Ga0207643_10298463 Ga0207643_102984631 178
1363 3300025910 Ga0207684_10128030 Ga0207684_101280302 178
1364 3300025915 Ga0207693_10009311 Ga0207693_1000931117 178
1365 3300025915 Ga0207693_10146710 Ga0207693_101467101 178
1366 3300025916 Ga0207663_10008581 Ga0207663_100085816 178
1367 3300025917 Ga0207660_10243208 Ga0207660_102432081 178
1368 3300025918 Ga0207662_10686070 Ga0207662_106860702 178
1369 3300025919 Ga0207657_10136762 Ga0207657_101367621 178
1370 3300025920 Ga0207649_10079383 Ga0207649_100793834 178
1371 3300025922 Ga0207646_10007412 Ga0207646_1000741211 178
1372 3300025922 Ga0207646_10559819 Ga0207646_105598192 178
1373 3300025923 Ga0207681_10008696 Ga0207681_100086964 178
1374 3300025923 Ga0207681_10496989 Ga0207681_104969892 178
1375 3300025924 Ga0207694_10104409 Ga0207694_101044093 178
1376 3300025924 Ga0207694_10172335 Ga0207694_101723354 178
1377 3300025925 Ga0207650_10002395 Ga0207650_1000239519 178
1378 3300025925 Ga0207650_10005005 Ga0207650_100050058 178
1379 3300025926 Ga0207659_10011510 Ga0207659_100115106 178
1380 3300025926 Ga0207659_10133918 Ga0207659_101339183 178
1381 3300025926 Ga0207659_10294806 Ga0207659_102948062 178
1382 3300025927 Ga0207687_10009078 Ga0207687_100090789 178
1383 3300025927 Ga0207687_10065082 Ga0207687_100650823 178
1384 3300025927 Ga0207687_11026906 Ga0207687_110269061 178
1385 3300025931 Ga0207644_10040202 Ga0207644_100402022 178
1386 3300025931 Ga0207644_10053826 Ga0207644_100538266 178
1387 3300025932 Ga0207690_10214872 Ga0207690_102148723 178
1388 3300025933 Ga0207706_10004872 Ga0207706_1000487218 178
1389 3300025934 Ga0207686_10023271 Ga0207686_100232715 178
1390 3300025934 Ga0207686_10037323 Ga0207686_100373234 178
1391 3300025934 Ga0207686_10307097 Ga0207686_103070973 178
1392 3300025935 Ga0207709_10025729 Ga0207709_100257293 178
1393 3300025937 Ga0207669_10014704 Ga0207669_100147046 178
1394 3300025938 Ga0207704_10073496 Ga0207704_100734963 178
1395 3300025940 Ga0207691_10002209 Ga0207691_1000220917 178
1396 3300025941 Ga0207711_10023017 Ga0207711_100230177 178
1397 3300025941 Ga0207711_10055511 Ga0207711_100555112 178
1398 3300025942 Ga0207689_10172806 Ga0207689_101728063 178
1399 3300025942 Ga0207689_10750222 Ga0207689_107502222 178
1400 3300025945 Ga0207679_10003258 Ga0207679_100032587 178
1401 3300025960 Ga0207651_10011007 Ga0207651_100110072 178
1402 3300025961 Ga0207712_10013482 Ga0207712_1001348210 178
1403 3300025961 Ga0207712_10492863 Ga0207712_104928632 178
1404 3300025972 Ga0207668_10024762 Ga0207668_1002476210 178
1405 3300025981 Ga0207640_10249687 Ga0207640_102496872 178
1406 3300025986 Ga0207658_10048296 Ga0207658_100482962 178
1407 3300025986 Ga0207658_10054635 Ga0207658_100546354 178
1408 3300026023 Ga0207677_10006799 Ga0207677_1000679913 178
1409 3300026023 Ga0207677_10946695 Ga0207677_109466952 178
1410 3300026035 Ga0207703_10146296 Ga0207703_101462962 178
1411 3300026067 Ga0207678_10008107 Ga0207678_1000810713 178
1412 3300026075 Ga0207708_10006675 Ga0207708_100066753 178
1413 3300026075 Ga0207708_10030576 Ga0207708_100305765 178
1414 3300026075 Ga0207708_10076955 Ga0207708_100769554 178
1415 3300026075 Ga0207708_10873556 Ga0207708_108735562 178
1416 3300026088 Ga0207641_10085368 Ga0207641_100853686 178
1417 3300026089 Ga0207648_10007348 Ga0207648_1000734818 178
1418 3300026089 Ga0207648_10048888 Ga0207648_100488884 178
1419 3300026095 Ga0207676_10000647 Ga0207676_1000064715 178
1420 3300026116 Ga0207674_10019413 Ga0207674_1001941313 178
1421 3300026118 Ga0207675_100005964 Ga0207675_1000059647 178
1422 3300026118 Ga0207675_101105711 Ga0207675_1011057112 178
1423 3300026121 Ga0207683_10000991 Ga0207683_1000099124 178
1424 3300026121 Ga0207683_10108188 Ga0207683_101081884 178
1425 3300026121 Ga0207683_10840083 Ga0207683_108400831 178
1426 3300026142 Ga0207698_10044888 Ga0207698_100448883 178
1427 3300027543 Ga0209999_1009868 Ga0209999_10098683 178
1428 3300027665 Ga0209983_1007723 Ga0209983_10077234 178
1429 3300027907 Ga0207428_10002487 Ga0207428_1000248722 178
1430 3300027907 Ga0207428_10013220 Ga0207428_100132205 178
1431 3300027907 Ga0207428_10023327 Ga0207428_100233275 178
1432 3300027907 Ga0207428_10083638 Ga0207428_100836383 178
1433 3300028379 Ga0268266_10106712 Ga0268266_101067124 178
1434 3300028380 Ga0268265_10071252 Ga0268265_100712522 178
1435 3300028380 Ga0268265_10247143 Ga0268265_102471432 178
1436 3300028558 Ga0265326_10000442 Ga0265326_1000044215 178
1437 3300028563 Ga0265319_1021178 Ga0265319_10211785 178
1438 3300028577 Ga0265318_10012644 Ga0265318_100126445 178
1439 3300029277 Ga0311001_1093307 Ga0311001_10933073 178
1440 3300029285 Ga0310981_1013259 Ga0310981_10132591 178
1441 3300029285 Ga0310981_1079615 Ga0310981_10796155 178
1442 3300030744 Ga0316181_1063037 Ga0316181_10630373 178
1443 3300031235 Ga0265330_10003732 Ga0265330_1000373215 178
1444 3300031240 Ga0265320_10107131 Ga0265320_101071312 178
1445 3300031249 Ga0265339_10273637 Ga0265339_102736372 178
1446 3300031344 Ga0265316_10008770 Ga0265316_1000877011 178
1447 3300031456 Ga0307513_10236173 Ga0307513_102361733 178
1448 3300031548 Ga0307408_100207056 Ga0307408_1002070563 178
1449 3300031649 Ga0307514_10006548 Ga0307514_100065486 178
1450 3300031665 Ga0316575_10005334 Ga0316575_100053348 178
1451 3300031691 Ga0316579_10004029 Ga0316579_100040296 178
1452 3300031712 Ga0265342_10001795 Ga0265342_1000179518 178
1453 3300031727 Ga0316576_10002066 Ga0316576_1000206611 178
1454 3300031727 Ga0316576_10002234 Ga0316576_1000223412 178
1455 3300031727 Ga0316576_10374564 Ga0316576_103745642 178
1456 3300031727 Ga0316576_10852362 Ga0316576_108523622 178
1457 3300031728 Ga0316578_10003703 Ga0316578_1000370311 178
1458 3300031728 Ga0316578_10004884 Ga0316578_1000488410 178
1459 3300031728 Ga0316578_10005682 Ga0316578_100056829 178
1460 3300031728 Ga0316578_10157286 Ga0316578_101572862 178
1461 3300031733 Ga0316577_10015885 Ga0316577_100158852 178
1462 3300031733 Ga0316577_10028995 Ga0316577_100289952 178
1463 3300031733 Ga0316577_10065100 Ga0316577_100651003 178
1464 3300031824 Ga0307413_10072160 Ga0307413_100721604 178
1465 3300031852 Ga0307410_10009398 Ga0307410_100093988 178
1466 3300031852 Ga0307410_10033428 Ga0307410_100334285 178
1467 3300031995 Ga0307409_100233006 Ga0307409_1002330061 178
1468 3300031995 Ga0307409_100427179 Ga0307409_1004271793 178
1469 3300032002 Ga0307416_100011043 Ga0307416_1000110439 178
1470 3300032004 Ga0307414_10236130 Ga0307414_102361302 178
1471 3300032005 Ga0307411_10329258 Ga0307411_103292583 178
1472 3300032126 Ga0307415_101219423 Ga0307415_1012194232 178
1473 3300032137 Ga0316585_10018757 Ga0316585_100187573 178
1474 3300032137 Ga0316585_10137148 Ga0316585_101371482 178
1475 3300032139 Ga0316580_10003748 Ga0316580_100037486 178
1476 3300032139 Ga0316580_10006478 Ga0316580_100064782 178
1477 3300032139 Ga0316580_10007750 Ga0316580_100077502 178
1478 3300032168 Ga0316593_10011313 Ga0316593_100113132 178
1479 3300032168 Ga0316593_10014263 Ga0316593_100142634 178
1480 3300032168 Ga0316593_10037011 Ga0316593_100370111 178
1481 3300032168 Ga0316593_10227609 Ga0316593_102276091 178
1482 3300033524 Ga0316592_1008584 Ga0316592_10085845 178
1483 3300033527 Ga0316586_1010333 Ga0316586_10103333 178
1484 3300033528 Ga0316588_1001948 Ga0316588_10019482 178
1485 3300033541 Ga0316596_1143210 Ga0316596_11432101 178
1486 3300034820 Ga0373959_0056514 Ga0373959_0056514_159_710 178
1487 3300035083 Ga0373926_0000779 Ga0373926_0000779_5772_6323 178
1488 3300035089 Ga0373944_0001205 Ga0373944_0001205_3190_3741 178
1489 3300035090 Ga0373949_0011265 Ga0373949_0011265_290_841 178
1490 3300035090 Ga0373949_0074695 Ga0373949_0074695_42_584 178
1491 3300035091 Ga0373951_0096161 Ga0373951_0096161_111_662 178
1492 3300035111 Ga0373923_0003280 Ga0373923_0003280_1784_2335 178
1493 3300035112 Ga0373932_0119512 Ga0373932_0119512_32_583 178
1494 3300035113 Ga0373936_0008117 Ga0373936_0008117_2482_3033 178
1495 3300035114 Ga0373939_0010335 Ga0373939_0010335_1141_1692 178
1496 3300035121 Ga0373960_0083547 Ga0373960_0083547_171_722 178
1497 3300035170 Ga0373943_0058166 Ga0373943_0058166_585_1136 178
1498 3300035171 Ga0373946_0001819 Ga0373946_0001819_4547_5098 178
1499 3300035171 Ga0373946_0157615 Ga0373946_0157615_342_893 178
1500 3300035172 Ga0373955_0022416 Ga0373955_0022416_2368_2919 178
1501 3300035242 Ga0373962_0049998 Ga0373962_0049998_600_1151 178
1502 3300035398 Ga0316574_0003943 Ga0316574_0003943_307_846 178
1503 3300035398 Ga0316574_0014627 Ga0316574_0014627_2093_2635 178
1504 3300035398 Ga0316574_0062602 Ga0316574_0062602_1150_1692 178
1505 3300035398 Ga0316574_0314325 Ga0316574_0314325_73_609 178
1506 3300035410 Ga0373924_0007751 Ga0373924_0007751_2838_3389 178
1507 3300035691 Ga0373931_0036427 Ga0373931_0036427_1775_2326 178
1508 3300035691 Ga0373931_0042427 Ga0373931_0042427_205_756 178
1509 3300035692 Ga0373935_0001471 Ga0373935_0001471_9083_9634 178
1510 3300035692 Ga0373935_0327465 Ga0373935_0327465_169_720 178
1511 3300035695 Ga0373927_0010402 Ga0373927_0010402_3057_3608 178
1512 3300035725 Ga0373947_0006076 Ga0373947_0006076_820_1365 178
1513 3300035725 Ga0373947_0022680 Ga0373947_0022680_631_1182 178
1514 3300035725 Ga0373947_0027756 Ga0373947_0027756_2712_3263 178
1515 3300036647 Ga0316582_0027404 Ga0316582_0027404_2268_2810 178
1516 3300036647 Ga0316582_0042815 Ga0316582_0042815_1872_2411 178
1517 3300036712 Ga0316584_0002452 Ga0316584_0002452_7214_7756 178
1518 3300036712 Ga0316584_0003844 Ga0316584_0003844_7801_8343 178
1519 3300036712 Ga0316584_0017224 Ga0316584_0017224_3129_3668 178
1520 3300036712 Ga0316584_0054632 Ga0316584_0054632_2078_2620 178
1521 3300037068 Ga0373925_0079947 Ga0373925_0079947_1532_2077 178
1522 3300037068 Ga0373925_0148269 Ga0373925_0148269_980_1531 178
1523 3300037312 Ga0395899_0047414 Ga0395899_0047414_2570_3121 178
1524 3300037312 Ga0395899_0082934 Ga0395899_0082934_427_963 178
1525 3300037312 Ga0395899_0132514 Ga0395899_0132514_797_1348 178
1526 3300037418 Ga0395900_0026851 Ga0395900_0026851_4429_4965 178
1527 3300037418 Ga0395900_0098179 Ga0395900_0098179_2156_2707 178
1528 3300037418 Ga0395900_0426275 Ga0395900_0426275_289_825 178
1529 3300037466 Ga0395898_0037450 Ga0395898_0037450_997_1548 178
1530 3300037466 Ga0395898_0125346 Ga0395898_0125346_1836_2372 178
1531 3300037466 Ga0395898_0199525 Ga0395898_0199525_226_762 178
1532 3300037466 Ga0395898_1075316 Ga0395898_1075316_85_636 178
1533 3300037471 Ga0395905_0025006 Ga0395905_0025006_3881_4432 178
1534 3300037471 Ga0395905_0375965 Ga0395905_0375965_170_706 178
1535 3300038443 Ga0395901_0104024 Ga0395901_0104024_868_1419 178
1536 3300038443 Ga0395901_0551179 Ga0395901_0551179_600_1136 178
1537 3300038443 Ga0395901_0717817 Ga0395901_0717817_33_569 178
1538 3300038735 Ga0400485_00886 Ga0400485_00886_6131_6673 178
1539 3300041404 Ga0439436_0020680 Ga0439436_0020680_1363_1899 178
1540 3300041405 Ga0439438_030759 Ga0439438_030759_425_961 178
1541 3300041405 Ga0439438_098410 Ga0439438_098410_156_692 178
1542 3300041411 Ga0439466_0024167 Ga0439466_0024167_950_1486 178
1543 3300041411 Ga0439466_0062696 Ga0439466_0062696_507_1043 178
1544 3300041446 Ga0451794_41478 Ga0451794_41478_74_610 178
1545 3300041453 Ga0451797_1023958 Ga0451797_1023958_167_703 178
1546 3300041453 Ga0451797_1549316 Ga0451797_1549316_562_1098 178
1547 3300041511 Ga0451855_0152540 Ga0451855_0152540_836_1381 178
1548 3300041997 Ga0439431_0038684 Ga0439431_0038684_198_734 178
1549 3300041997 Ga0439431_0156020 Ga0439431_0156020_15_551 178
1550 3300041999 Ga0439433_0005951 Ga0439433_0005951_1175_1711 178
1551 3300042002 Ga0439442_000004 Ga0439442_000004_37763_38299 178
1552 3300042003 Ga0439443_062105 Ga0439443_062105_106_657 178
1553 3300042006 Ga0439432_099743 Ga0439432_099743_61_597 178
1554 3300042006 Ga0439432_109368 Ga0439432_109368_17_553 178
1555 3300042007 Ga0439449_0006377 Ga0439449_0006377_2621_3157 178
1556 3300042007 Ga0439449_0026523 Ga0439449_0026523_978_1514 178
1557 3300042010 Ga0439452_043370 Ga0439452_043370_47_583 178
1558 3300042014 Ga0439457_005183 Ga0439457_005183_1092_1628 178
1559 3300042015 Ga0439462_0018668 Ga0439462_0018668_356_892 178
1560 3300042121 Ga0450919_011883 Ga0450919_011883_419_955 178
1561 3300042125 Ga0450923_111802 Ga0450923_111802_76_612 178
1562 3300042128 Ga0450897_002107 Ga0450897_002107_445_981 178
1563 3300042145 Ga0450906_005765 Ga0450906_005765_637_1173 178
1564 3300042146 Ga0450907_000666 Ga0450907_000666_280_816 178
1565 3300042184 Ga0450908_009279 Ga0450908_009279_595_1131 178
1566 3300042435 Ga0439434_0000752 Ga0439434_0000752_724_1260 178
1567 3300042435 Ga0439434_0027903 Ga0439434_0027903_323_859 178
1568 3300042435 Ga0439434_0169683 Ga0439434_0169683_171_707 178
1569 3300042439 Ga0439464_0010468 Ga0439464_0010468_189_740 178
1570 3300042531 Ga0450918_006155 Ga0450918_006155_407_943 178
1571 3300042876 Ga0451577_0000006 Ga0451577_0000006_423537_424073 178
1572 3300042876 Ga0451577_0301573 Ga0451577_0301573_474_1025 178
1573 3300042876 Ga0451577_0969230 Ga0451577_0969230_93_629 178
1574 3300044658 Ga0466972_0056469 Ga0466972_0056469_199_735 178
1575 3300044658 Ga0466972_0164282 Ga0466972_0164282_186_734 178
1576 3300044673 Ga0453683_0000088 Ga0453683_0000088_133034_133570 178
1577 3300044712 Ga0453684_0000037 Ga0453684_0000037_423532_424068 178
1578 3300044712 Ga0453684_0130862 Ga0453684_0130862_1803_2354 178
1579 3300044735 Ga0466968_0100908 Ga0466968_0100908_322_858 178
1580 3300044765 Ga0466970_0213492 Ga0466970_0213492_32_568 178
1581 3300045051 Ga0451576_0022970 Ga0451576_0022970_1062_1598 178
1582 3300045976 Ga0466967_1112395 Ga0466967_1112395_153_689 178
1583 3300046455 Ga0495603_0030908 Ga0495603_0030908_545_1081 178
1584 3300046455 Ga0495603_0075258 Ga0495603_0075258_929_1474 178
1585 3300046455 Ga0495603_0115060 Ga0495603_0115060_54_605 178
1586 3300046459 Ga0495629_0010441 Ga0495629_0010441_5770_6315 178
1587 3300046459 Ga0495629_0047780 Ga0495629_0047780_788_1339 178
1588 3300046460 Ga0495638_0038595 Ga0495638_0038595_2261_2797 178
1589 3300046461 Ga0495641_0001712 Ga0495641_0001712_1821_2372 178
1590 3300046463 Ga0495653_0157318 Ga0495653_0157318_537_1088 178
1591 3300046472 Ga0495580_0271136 Ga0495580_0271136_585_1130 178
1592 3300046473 Ga0495582_0000026 Ga0495582_0000026_11706_12251 178
1593 3300046473 Ga0495582_0005324 Ga0495582_0005324_2514_3065 178
1594 3300046474 Ga0495605_0123228 Ga0495605_0123228_464_1012 178
1595 3300046474 Ga0495605_0247733 Ga0495605_0247733_194_745 178
1596 3300046475 Ga0495639_0047249 Ga0495639_0047249_1347_1898 178
1597 3300046475 Ga0495639_0201544 Ga0495639_0201544_81_629 178
1598 3300046476 Ga0495662_0003638 Ga0495662_0003638_4568_5119 178
1599 3300046491 Ga0495584_0267224 Ga0495584_0267224_266_817 178
1600 3300046491 Ga0495584_0456963 Ga0495584_0456963_11_562 178
1601 3300046492 Ga0495585_0023597 Ga0495585_0023597_995_1546 178
1602 3300046492 Ga0495585_0048221 Ga0495585_0048221_419_967 178
1603 3300046499 Ga0495594_0042303 Ga0495594_0042303_933_1484 178
1604 3300046499 Ga0495594_0467805 Ga0495594_0467805_27_578 178
1605 3300046500 Ga0495596_0023223 Ga0495596_0023223_190_741 178
1606 3300046500 Ga0495596_0248560 Ga0495596_0248560_40_576 178
1607 3300046501 Ga0495607_0021661 Ga0495607_0021661_861_1409 178
1608 3300046506 Ga0495583_0283746 Ga0495583_0283746_44_595 178
1609 3300046507 Ga0495606_0036953 Ga0495606_0036953_548_1084 178
1610 3300046512 Ga0495610_0029296 Ga0495610_0029296_1049_1585 178
1611 3300046515 Ga0495620_0090280 Ga0495620_0090280_220_756 178
1612 3300046522 Ga0495643_0004644 Ga0495643_0004644_3700_4236 178
1613 3300046522 Ga0495643_0124706 Ga0495643_0124706_438_974 178
1614 3300046523 Ga0495644_0056910 Ga0495644_0056910_741_1277 178
1615 3300046523 Ga0495644_0057300 Ga0495644_0057300_776_1327 178
1616 3300046523 Ga0495644_0140726 Ga0495644_0140726_132_680 178
1617 3300046525 Ga0495663_0010458 Ga0495663_0010458_408_956 178
1618 3300046525 Ga0495663_0041507 Ga0495663_0041507_627_1163 178
1619 3300046525 Ga0495663_0091788 Ga0495663_0091788_158_709 178
1620 3300046526 Ga0495666_0006954 Ga0495666_0006954_4019_4570 178
1621 3300046528 Ga0495642_0028275 Ga0495642_0028275_1192_1728 178
1622 3300046528 Ga0495642_0039600 Ga0495642_0039600_1289_1840 178
1623 3300046531 Ga0495665_0008026 Ga0495665_0008026_4874_5425 178
1624 3300046531 Ga0495665_0030104 Ga0495665_0030104_1494_2042 178
1625 3300046531 Ga0495665_0039621 Ga0495665_0039621_288_833 178
1626 3300046533 Ga0495640_0011449 Ga0495640_0011449_4490_5041 178
1627 3300046533 Ga0495640_0509516 Ga0495640_0509516_162_713 178
1628 3300046535 Ga0495586_0006998 Ga0495586_0006998_2800_3351 178
1629 3300046537 Ga0495598_0003658 Ga0495598_0003658_925_1461 178
1630 3300046537 Ga0495598_0010163 Ga0495598_0010163_233_781 178
1631 3300046538 Ga0495609_0011725 Ga0495609_0011725_590_1138 178
1632 3300046557 Ga0495622_0015094 Ga0495622_0015094_959_1495 178
1633 3300046558 Ga0495633_0066972 Ga0495633_0066972_888_1436 178
1634 3300046558 Ga0495633_0071310 Ga0495633_0071310_499_1035 178
1635 3300046615 Ga0495656_0021465 Ga0495656_0021465_610_1146 178
1636 3300046615 Ga0495656_0022203 Ga0495656_0022203_1120_1671 178
1637 3300046615 Ga0495656_0037265 Ga0495656_0037265_922_1473 178
1638 3300046615 Ga0495656_0064313 Ga0495656_0064313_873_1409 178
1639 3300046642 Ga0495634_0013309 Ga0495634_0013309_2617_3168 178
1640 3300046648 Ga0495611_0087038 Ga0495611_0087038_110_658 178
1641 3300046663 Ga0495635_0002654 Ga0495635_0002654_9116_9667 178
1642 3300046664 Ga0495659_0022021 Ga0495659_0022021_348_899 178
1643 3300046664 Ga0495659_0034130 Ga0495659_0034130_1174_1725 178
1644 3300046664 Ga0495659_0043364 Ga0495659_0043364_615_1151 178
1645 3300046664 Ga0495659_0195772 Ga0495659_0195772_235_774 178
1646 3300046665 Ga0495661_0039834 Ga0495661_0039834_1763_2299 178
1647 3300046665 Ga0495661_0433430 Ga0495661_0433430_19_567 178
1648 3300046674 Ga0495588_0033500 Ga0495588_0033500_1857_2408 178
1649 3300046674 Ga0495588_0046907 Ga0495588_0046907_1206_1751 178
1650 3300046674 Ga0495588_0289756 Ga0495588_0289756_128_664 178
1651 3300046681 Ga0495647_0002256 Ga0495647_0002256_3904_4455 178
1652 3300046681 Ga0495647_0005065 Ga0495647_0005065_1627_2172 178
1653 3300046681 Ga0495647_0119007 Ga0495647_0119007_41_592 178
1654 3300046683 Ga0495658_0000984 Ga0495658_0000984_14280_14825 178
1655 3300046683 Ga0495658_0008704 Ga0495658_0008704_2610_3161 178
1656 3300046683 Ga0495658_0661585 Ga0495658_0661585_73_624 178
1657 3300046684 Ga0495669_0050594 Ga0495669_0050594_363_899 178
1658 3300046689 Ga0495613_0001744 Ga0495613_0001744_2482_3027 178
1659 3300046689 Ga0495613_0120378 Ga0495613_0120378_626_1171 178
1660 3300046689 Ga0495613_0179718 Ga0495613_0179718_491_1042 178
1661 3300046690 Ga0495624_0005555 Ga0495624_0005555_3268_3819 178
1662 3300046691 Ga0495670_0003300 Ga0495670_0003300_4079_4627 178
1663 3300046691 Ga0495670_0164097 Ga0495670_0164097_506_1054 178
1664 3300046691 Ga0495670_0226093 Ga0495670_0226093_349_885 178
1665 3300046692 Ga0495671_0051516 Ga0495671_0051516_369_905 178
1666 3300046692 Ga0495671_0106856 Ga0495671_0106856_668_1219 178
1667 3300046692 Ga0495671_0214401 Ga0495671_0214401_119_667 178
1668 3300046794 Ga0495589_0096703 Ga0495589_0096703_117_665 178
1669 3300047315 Ga0495581_0001983 Ga0495581_0001983_5004_5555 178
1670 3300047315 Ga0495581_0021863 Ga0495581_0021863_1773_2318 178
1671 3300047318 Ga0495636_0007362 Ga0495636_0007362_2075_2623 178
1672 3300047318 Ga0495636_0038495 Ga0495636_0038495_65_610 178
1673 3300047318 Ga0495636_0060395 Ga0495636_0060395_845_1396 178
1674 3300047318 Ga0495636_0084264 Ga0495636_0084264_488_1024 178
1675 3300047319 Ga0495674_0014139 Ga0495674_0014139_1921_2472 178
1676 3300047319 Ga0495674_0855791 Ga0495674_0855791_81_626 178
1677 3300047321 Ga0495676_0028538 Ga0495676_0028538_3424_3975 178
1678 3300047321 Ga0495676_0055381 Ga0495676_0055381_523_1068 178
1679 3300047321 Ga0495676_0121422 Ga0495676_0121422_767_1315 178
1680 3300047321 Ga0495676_0364589 Ga0495676_0364589_341_892 178
1681 3300047322 Ga0495680_0012777 Ga0495680_0012777_2463_3014 178
1682 3300047322 Ga0495680_0261175 Ga0495680_0261175_167_715 178
1683 3300047323 Ga0495683_0100151 Ga0495683_0100151_668_1219 178
1684 3300047445 Ga0495677_0013232 Ga0495677_0013232_1841_2377 178
1685 3300047469 Ga0495673_0184274 Ga0495673_0184274_169_720 178
1686 3300047472 Ga0495686_0251901 Ga0495686_0251901_378_914 178
1687 3300048089 Ga0495614_0007394 Ga0495614_0007394_1706_2257 178
1688 3300048089 Ga0495614_0014788 Ga0495614_0014788_899_1444 178
1689 3300048090 Ga0495615_0036383 Ga0495615_0036383_518_1069 178
1690 3300048903 Ga0496100_0028774 Ga0496100_0028774_1627_2163 178
1691 3300048903 Ga0496100_0051293 Ga0496100_0051293_217_765 178
1692 3300048903 Ga0496100_0241720 Ga0496100_0241720_39_575 178
1693 3300048904 Ga0496101_0017813 Ga0496101_0017813_1989_2525 178
1694 3300048904 Ga0496101_0073312 Ga0496101_0073312_1295_1846 178
1695 3300048904 Ga0496101_0132976 Ga0496101_0132976_490_1038 178
1696 3300048904 Ga0496101_0289904 Ga0496101_0289904_192_728 178
1697 3300048905 Ga0496102_0018082 Ga0496102_0018082_4033_4581 178
1698 3300048905 Ga0496102_0032510 Ga0496102_0032510_3180_3716 178
1699 3300048905 Ga0496102_0148457 Ga0496102_0148457_1627_2163 178
1700 3300048906 Ga0496103_0107100 Ga0496103_0107100_348_896 178
1701 3300048906 Ga0496103_0209555 Ga0496103_0209555_73_621 178
1702 3300048906 Ga0496103_0265804 Ga0496103_0265804_81_617 178
1703 3300048906 Ga0496103_0373127 Ga0496103_0373127_55_591 178
1704 3300048907 Ga0496104_0039107 Ga0496104_0039107_1311_1847 178
1705 3300048907 Ga0496104_0219344 Ga0496104_0219344_572_1120 178
1706 3300048909 Ga0496106_0008171 Ga0496106_0008171_6636_7184 178
1707 3300048909 Ga0496106_0037041 Ga0496106_0037041_3074_3610 178
1708 3300048910 Ga0496107_0007516 Ga0496107_0007516_2546_3094 178
1709 3300048910 Ga0496107_0044904 Ga0496107_0044904_1158_1709 178
1710 3300048910 Ga0496107_0055567 Ga0496107_0055567_2156_2701 178
1711 3300048911 Ga0496108_0009206 Ga0496108_0009206_5931_6482 178
1712 3300048911 Ga0496108_0015179 Ga0496108_0015179_3625_4161 178
1713 3300048911 Ga0496108_0083893 Ga0496108_0083893_657_1193 178
1714 3300048911 Ga0496108_0157383 Ga0496108_0157383_746_1294 178
1715 3300048912 Ga0496109_0002583 Ga0496109_0002583_12570_13118 178
1716 3300048912 Ga0496109_0010105 Ga0496109_0010105_3027_3578 178
1717 3300048912 Ga0496109_0049180 Ga0496109_0049180_847_1395 178
1718 3300048912 Ga0496109_0056408 Ga0496109_0056408_455_991 178
1719 3300048912 Ga0496109_0162984 Ga0496109_0162984_1140_1676 178
1720 3300048912 Ga0496109_0253905 Ga0496109_0253905_156_704 178
1721 3300048912 Ga0496109_0580958 Ga0496109_0580958_115_666 178
1722 3300048913 Ga0496110_0001862 Ga0496110_0001862_5582_6118 178
1723 3300048913 Ga0496110_0016596 Ga0496110_0016596_1989_2525 178
1724 3300048913 Ga0496110_0026567 Ga0496110_0026567_798_1346 178
1725 3300048914 Ga0496111_0003250 Ga0496111_0003250_7187_7735 178
1726 3300048915 Ga0496112_0010568 Ga0496112_0010568_5842_6378 178
1727 3300048915 Ga0496112_0146086 Ga0496112_0146086_1146_1694 178
1728 3300048916 Ga0496113_0039497 Ga0496113_0039497_1311_1847 178
1729 3300048916 Ga0496113_0061435 Ga0496113_0061435_39_590 178
1730 3300048917 Ga0496114_0015605 Ga0496114_0015605_4852_5400 178
1731 3300048917 Ga0496114_0046931 Ga0496114_0046931_1066_1602 178
1732 3300048918 Ga0496115_0066390 Ga0496115_0066390_1314_1850 178
1733 3300048919 Ga0496116_0321775 Ga0496116_0321775_95_631 178
1734 3300048920 Ga0496117_0004445 Ga0496117_0004445_7216_7752 178
1735 3300048920 Ga0496117_0006530 Ga0496117_0006530_6519_7055 178
1736 3300048920 Ga0496117_0031402 Ga0496117_0031402_2876_3412 178
1737 3300048920 Ga0496117_0193004 Ga0496117_0193004_172_708 178
1738 3300048920 Ga0496117_0305048 Ga0496117_0305048_208_744 178
1739 3300048921 Ga0496118_0000116 Ga0496118_0000116_142624_143160 178
1740 3300048921 Ga0496118_0008749 Ga0496118_0008749_4163_4699 178
1741 3300048922 Ga0496119_0003034 Ga0496119_0003034_13069_13605 178
1742 3300048922 Ga0496119_0009462 Ga0496119_0009462_2460_2996 178
1743 3300048922 Ga0496119_0043692 Ga0496119_0043692_339_875 178
1744 3300048923 Ga0496120_0127975 Ga0496120_0127975_599_1135 178
1745 3300048923 Ga0496120_0173658 Ga0496120_0173658_456_992 178
1746 3300048924 Ga0496121_0231337 Ga0496121_0231337_526_1062 178
1747 3300048924 Ga0496121_0336102 Ga0496121_0336102_172_708 178
1748 3300048924 Ga0496121_0478811 Ga0496121_0478811_72_608 178
1749 3300048925 Ga0496122_0000799 Ga0496122_0000799_21466_22002 178
1750 3300048925 Ga0496122_0010341 Ga0496122_0010341_7716_8252 178
1751 3300048926 Ga0496123_0000009 Ga0496123_0000009_382663_383199 178
1752 3300048926 Ga0496123_0130096 Ga0496123_0130096_741_1277 178
1753 3300048927 Ga0496124_0000135 Ga0496124_0000135_3162_3698 178
1754 3300048927 Ga0496124_0006965 Ga0496124_0006965_5675_6211 178
1755 3300048927 Ga0496124_0008978 Ga0496124_0008978_7091_7627 178
1756 3300048927 Ga0496124_0029307 Ga0496124_0029307_1402_1938 178
1757 3300048928 Ga0496125_0067302 Ga0496125_0067302_1144_1680 178
1758 3300048929 Ga0496126_0007225 Ga0496126_0007225_10896_11432 178
1759 3300048929 Ga0496126_0052186 Ga0496126_0052186_2396_2932 178
1760 3300048929 Ga0496126_0373200 Ga0496126_0373200_394_930 178
1761 3300048929 Ga0496126_0498105 Ga0496126_0498105_100_636 178
1762 3300049129 Ga0501309_000992 Ga0501309_000992_224_760 178
1763 3300049129 Ga0501309_061009 Ga0501309_061009_29_565 178
1764 3300049130 Ga0501310_008380 Ga0501310_008380_262_798 178
1765 3300049132 Ga0501343_007103 Ga0501343_007103_83_718 178
1766 3300049134 Ga0501345_03341 Ga0501345_03341_24_560 178
1767 3300049161 Ga0501305_026696 Ga0501305_026696_55_591 178
1768 3300049162 Ga0501307_018822 Ga0501307_018822_71_607 178
1769 3300049527 Ga0501311_020409 Ga0501311_020409_124_660 178
1770 3300049527 Ga0501311_021938 Ga0501311_021938_95_631 178
1771 3300049529 Ga0501313_001839 Ga0501313_001839_1188_1724 178
1772 3300049529 Ga0501313_002169 Ga0501313_002169_303_839 178
1773 3300049530 Ga0501314_001352 Ga0501314_001352_127_663 178
1774 3300049530 Ga0501314_001694 Ga0501314_001694_899_1435 178
1775 3300049530 Ga0501314_027782 Ga0501314_027782_31_567 178
1776 3300049531 Ga0501315_000692 Ga0501315_000692_335_871 178
1777 3300049531 Ga0501315_001500 Ga0501315_001500_103_639 178
1778 3300049531 Ga0501315_052691 Ga0501315_052691_35_571 178
1779 3300049533 Ga0501317_002781 Ga0501317_002781_1072_1608 178
1780 3300049533 Ga0501317_010725 Ga0501317_010725_191_727 178
1781 3300049533 Ga0501317_013065 Ga0501317_013065_418_954 178
1782 3300049534 Ga0501318_000828 Ga0501318_000828_337_873 178
1783 3300049534 Ga0501318_001073 Ga0501318_001073_1426_1962 178
1784 3300049534 Ga0501318_009581 Ga0501318_009581_80_616 178
1785 3300049535 Ga0501319_008189 Ga0501319_008189_135_671 178
1786 3300049537 Ga0501321_001497 Ga0501321_001497_1019_1555 178
1787 3300049537 Ga0501321_028545 Ga0501321_028545_119_655 178
1788 3300049539 Ga0501323_029854 Ga0501323_029854_163_699 178
1789 3300049539 Ga0501323_047648 Ga0501323_047648_83_619 178
1790 3300049541 Ga0501325_000439 Ga0501325_000439_1304_1840 178
1791 3300049541 Ga0501325_011999 Ga0501325_011999_13_549 178
1792 3300049543 Ga0501327_00546 Ga0501327_00546_905_1441 178
1793 3300049546 Ga0501330_003158 Ga0501330_003158_103_639 178
1794 3300049546 Ga0501330_010360 Ga0501330_010360_39_575 178
1795 3300049549 Ga0501333_000524 Ga0501333_000524_833_1369 178
1796 3300049551 Ga0501335_000127 Ga0501335_000127_344_886 178
1797 3300049551 Ga0501335_003740 Ga0501335_003740_27_563 178
1798 3300049568 Ga0501031_0108493 Ga0501031_0108493_701_1252 178
1799 3300049568 Ga0501031_0337677 Ga0501031_0337677_361_912 178
1800 3300049569 Ga0501032_0011961 Ga0501032_0011961_2340_2876 178
1801 3300049569 Ga0501032_0402229 Ga0501032_0402229_74_610 178
1802 3300049570 Ga0501033_0065847 Ga0501033_0065847_1310_1861 178
1803 3300049570 Ga0501033_0071404 Ga0501033_0071404_1687_2238 178
1804 3300049571 Ga0501034_0022444 Ga0501034_0022444_5155_5691 178
1805 3300049571 Ga0501034_0490026 Ga0501034_0490026_154_705 178
1806 3300049572 Ga0501036_0011903 Ga0501036_0011903_6053_6604 178
1807 3300049572 Ga0501036_0243639 Ga0501036_0243639_592_1143 178
1808 3300049572 Ga0501036_0937600 Ga0501036_0937600_92_628 178
1809 3300049573 Ga0501037_0011203 Ga0501037_0011203_283_819 178
1810 3300049573 Ga0501037_0522871 Ga0501037_0522871_18_554 178
1811 3300049574 Ga0501038_0018247 Ga0501038_0018247_3933_4484 178
1812 3300049574 Ga0501038_0030826 Ga0501038_0030826_327_863 178
1813 3300049574 Ga0501038_0102586 Ga0501038_0102586_1722_2258 178
1814 3300049574 Ga0501038_0124043 Ga0501038_0124043_1374_1925 178
1815 3300049575 Ga0501039_0013552 Ga0501039_0013552_2225_2776 178
1816 3300049575 Ga0501039_0020848 Ga0501039_0020848_4244_4780 178
1817 3300049575 Ga0501039_0070692 Ga0501039_0070692_387_938 178
1818 3300049575 Ga0501039_0183875 Ga0501039_0183875_706_1257 178
1819 3300049576 Ga0501040_0011876 Ga0501040_0011876_1990_2541 178
1820 3300049576 Ga0501040_0013956 Ga0501040_0013956_3903_4454 178
1821 3300049576 Ga0501040_0218554 Ga0501040_0218554_301_852 178
1822 3300049576 Ga0501040_0235015 Ga0501040_0235015_386_937 178
1823 3300049576 Ga0501040_0345860 Ga0501040_0345860_315_866 178
1824 3300049577 Ga0501041_0009630 Ga0501041_0009630_3089_3640 178
1825 3300049577 Ga0501041_0022523 Ga0501041_0022523_1940_2491 178
1826 3300049577 Ga0501041_0064655 Ga0501041_0064655_1286_1837 178
1827 3300049578 Ga0501042_0004476 Ga0501042_0004476_2768_3319 178
1828 3300049578 Ga0501042_0103379 Ga0501042_0103379_369_920 178
1829 3300049578 Ga0501042_0159447 Ga0501042_0159447_516_1067 178
1830 3300049579 Ga0501043_0007625 Ga0501043_0007625_2358_2894 178
1831 3300049579 Ga0501043_0262212 Ga0501043_0262212_13_564 178
1832 3300049579 Ga0501043_0333158 Ga0501043_0333158_205_756 178
1833 3300049579 Ga0501043_0337664 Ga0501043_0337664_580_1116 178
1834 3300049580 Ga0501046_0028648 Ga0501046_0028648_378_929 178
1835 3300049580 Ga0501046_0133876 Ga0501046_0133876_767_1318 178
1836 3300049580 Ga0501046_0134060 Ga0501046_0134060_781_1332 178
1837 3300049582 Ga0501048_0007798 Ga0501048_0007798_892_1443 178
1838 3300049582 Ga0501048_0173386 Ga0501048_0173386_359_910 178
1839 3300049583 Ga0501067_0104720 Ga0501067_0104720_786_1337 178
1840 3300049584 Ga0501068_0047975 Ga0501068_0047975_1640_2191 178
1841 3300049584 Ga0501068_0053272 Ga0501068_0053272_767_1318 178
1842 3300049584 Ga0501068_0228161 Ga0501068_0228161_320_871 178
1843 3300049585 Ga0501069_0262350 Ga0501069_0262350_443_991 178
1844 3300049585 Ga0501069_0384253 Ga0501069_0384253_42_578 178
1845 3300049585 Ga0501069_0481799 Ga0501069_0481799_119_670 178
1846 3300049586 Ga0501070_0003383 Ga0501070_0003383_11490_12026 178
1847 3300049586 Ga0501070_0060195 Ga0501070_0060195_1655_2191 178
1848 3300049587 Ga0501071_0000119 Ga0501071_0000119_12506_13042 178
1849 3300049587 Ga0501071_0018369 Ga0501071_0018369_3221_3772 178
1850 3300049587 Ga0501071_0085300 Ga0501071_0085300_143_694 178
1851 3300049587 Ga0501071_0140578 Ga0501071_0140578_387_938 178
1852 3300049587 Ga0501071_0323264 Ga0501071_0323264_479_1030 178
1853 3300049587 Ga0501071_0661802 Ga0501071_0661802_81_632 178
1854 3300049588 Ga0501072_0015537 Ga0501072_0015537_3040_3591 178
1855 3300049588 Ga0501072_0063412 Ga0501072_0063412_1734_2285 178
1856 3300049588 Ga0501072_0080713 Ga0501072_0080713_1640_2191 178
1857 3300049588 Ga0501072_0176454 Ga0501072_0176454_387_938 178
1858 3300049588 Ga0501072_0204030 Ga0501072_0204030_124_675 178
1859 3300049588 Ga0501072_0261631 Ga0501072_0261631_400_951 178
1860 3300049589 Ga0501073_0030425 Ga0501073_0030425_675_1211 178
1861 3300049590 Ga0501074_0069698 Ga0501074_0069698_387_938 178
1862 3300049590 Ga0501074_0181543 Ga0501074_0181543_30_581 178
1863 3300049590 Ga0501074_0242265 Ga0501074_0242265_387_938 178
1864 3300049591 Ga0501075_0002249 Ga0501075_0002249_11183_11734 178
1865 3300049591 Ga0501075_0035289 Ga0501075_0035289_381_932 178
1866 3300049591 Ga0501075_0144877 Ga0501075_0144877_459_1010 178
1867 3300049591 Ga0501075_0486014 Ga0501075_0486014_247_798 178
1868 3300049591 Ga0501075_0662922 Ga0501075_0662922_30_578 178
1869 3300049592 Ga0501076_0012269 Ga0501076_0012269_3651_4202 178
1870 3300049592 Ga0501076_0157759 Ga0501076_0157759_274_813 178
1871 3300049592 Ga0501076_0209858 Ga0501076_0209858_418_969 178
1872 3300049592 Ga0501076_0268317 Ga0501076_0268317_387_938 178
1873 3300049592 Ga0501076_1103686 Ga0501076_1103686_55_606 178
1874 3300049593 Ga0501077_0027673 Ga0501077_0027673_771_1322 178
1875 3300049593 Ga0501077_0077464 Ga0501077_0077464_179_730 178
1876 3300049593 Ga0501077_0117509 Ga0501077_0117509_772_1323 178
1877 3300049593 Ga0501077_0144574 Ga0501077_0144574_737_1288 178
1878 3300049741 Ga0501079_0016993 Ga0501079_0016993_2971_3522 178
1879 3300049741 Ga0501079_0046905 Ga0501079_0046905_1614_2165 178
1880 3300049741 Ga0501079_0082541 Ga0501079_0082541_1548_2099 178
1881 3300049741 Ga0501079_0179356 Ga0501079_0179356_387_938 178
1882 3300049741 Ga0501079_0300557 Ga0501079_0300557_246_794 178
1883 3300049741 Ga0501079_0632423 Ga0501079_0632423_276_827 178
1884 3300049742 Ga0501080_0662198 Ga0501080_0662198_241_792 178
1885 3300049743 Ga0501081_0147367 Ga0501081_0147367_752_1303 178
1886 3300049743 Ga0501081_0303982 Ga0501081_0303982_531_1082 178
1887 3300049743 Ga0501081_0362931 Ga0501081_0362931_70_621 178
1888 3300049744 Ga0501083_0179333 Ga0501083_0179333_487_1038 178
1889 3300049822 Ga0501035_0083246 Ga0501035_0083246_1721_2272 178
1890 3300049822 Ga0501035_0085396 Ga0501035_0085396_1863_2414 178
1891 3300049823 Ga0501044_0015806 Ga0501044_0015806_6936_7472 178
1892 3300049824 Ga0501045_0026884 Ga0501045_0026884_893_1444 178
1893 3300049824 Ga0501045_0055099 Ga0501045_0055099_496_1047 178
1894 3300049824 Ga0501045_0160621 Ga0501045_0160621_374_925 178
1895 3300049824 Ga0501045_0239404 Ga0501045_0239404_691_1242 178
1896 3300049824 Ga0501045_0467885 Ga0501045_0467885_308_859 178
1897 3300050492 nmdc:mga0yw44_61628_c1 nmdc:mga0yw44_61628_c1_263_799 178
1898 3300050492 nmdc:mga0yw44_69406_c1 nmdc:mga0yw44_69406_c1_681_1217 178
1899 3300050496 nmdc:mga07m45_186267_c1 nmdc:mga07m45_186267_c1_219_758 178
1900 3300050496 nmdc:mga07m45_221564_c1 nmdc:mga07m45_221564_c1_450_989 178
1901 3300050507 nmdc:mga05p37_10502_c1 nmdc:mga05p37_10502_c1_7941_8492 178
1902 3300050507 nmdc:mga05p37_1689242_c1 nmdc:mga05p37_1689242_c1_55_606 178
1903 3300050507 nmdc:mga05p37_17560_c2 nmdc:mga05p37_17560_c2_41_577 178
1904 3300050507 nmdc:mga05p37_33504_c1 nmdc:mga05p37_33504_c1_2849_3400 178
1905 3300050507 nmdc:mga05p37_406737_c1 nmdc:mga05p37_406737_c1_807_1343 178
1906 3300050507 nmdc:mga05p37_41972_c1 nmdc:mga05p37_41972_c1_837_1388 178
1907 3300050507 nmdc:mga05p37_51408_c1 nmdc:mga05p37_51408_c1_2394_2945 178
1908 3300050508 nmdc:mga09592_13664_c1 nmdc:mga09592_13664_c1_4548_5099 178
1909 3300050508 nmdc:mga09592_227751_c1 nmdc:mga09592_227751_c1_592_1143 178
1910 3300050509 nmdc:mga0qj67_15087_c1 nmdc:mga0qj67_15087_c1_2188_2739 178
1911 3300050509 nmdc:mga0qj67_173810_c1 nmdc:mga0qj67_173810_c1_313_864 178
1912 3300050510 nmdc:mga06r32_53547_c1 nmdc:mga06r32_53547_c1_387_938 178
1913 3300050511 nmdc:mga08y16_129080_c1 nmdc:mga08y16_129080_c1_1128_1679 178
1914 3300050511 nmdc:mga08y16_185182_c1 nmdc:mga08y16_185182_c1_1106_1657 178
1915 3300050511 nmdc:mga08y16_287696_c1 nmdc:mga08y16_287696_c1_629_1180 178
1916 3300050511 nmdc:mga08y16_720301_c1 nmdc:mga08y16_720301_c1_130_666 178
1917 3300050512 nmdc:mga0n895_204400_c1 nmdc:mga0n895_204400_c1_207_758 178
1918 3300050512 nmdc:mga0n895_277446_c1 nmdc:mga0n895_277446_c1_986_1537 178
1919 3300050513 nmdc:mga0rr50_582791_c1 nmdc:mga0rr50_582791_c1_388_924 178
1920 3300050515 nmdc:mga0a205_1011_c1 nmdc:mga0a205_1011_c1_2912_3463 178
1921 3300050515 nmdc:mga0a205_357385_c1 nmdc:mga0a205_357385_c1_326_877 178
1922 3300050515 nmdc:mga0a205_3780_c1 nmdc:mga0a205_3780_c1_7463_8014 178
1923 3300053077 Ga0495601_0532531 Ga0495601_0532531_24_575 178
1924 3300053083 Ga0495655_0025363 Ga0495655_0025363_615_1163 178
1925 3300053085 Ga0495619_0011120 Ga0495619_0011120_2399_2950 178
1926 3300053093 Ga0500651_0151229 Ga0500651_0151229_485_1021 178
1927 3300053104 Ga0500556_0000151 Ga0500556_0000151_29974_30510 178
1928 3300053117 Ga0500593_000419 Ga0500593_000419_608_1144 178
1929 3300053133 Ga0500655_001124 Ga0500655_001124_383_919 178
1930 3300053136 Ga0500559_0000050 Ga0500559_0000050_82681_83217 178
1931 3300053136 Ga0500559_0000164 Ga0500559_0000164_27188_27724 178
1932 3300053136 Ga0500559_0132725 Ga0500559_0132725_394_930 178
1933 3300053136 Ga0500559_0246886 Ga0500559_0246886_208_744 178
1934 3300053140 Ga0500573_0006750 Ga0500573_0006750_3736_4272 178
1935 3300053140 Ga0500573_0016494 Ga0500573_0016494_484_1020 178
1936 3300053140 Ga0500573_0201910 Ga0500573_0201910_452_988 178
1937 3300053140 Ga0500573_0279000 Ga0500573_0279000_224_760 178
1938 3300053140 Ga0500573_0449444 Ga0500573_0449444_34_570 178
1939 3300053142 Ga0500577_0314041 Ga0500577_0314041_48_584 178
1940 3300053153 Ga0500616_0183761 Ga0500616_0183761_184_720 178
1941 3300054114 Ga0501084_0009653 Ga0501084_0009653_4329_4880 178
1942 3300054114 Ga0501084_0051696 Ga0501084_0051696_2279_2830 178
1943 3300054114 Ga0501084_0080694 Ga0501084_0080694_1743_2294 178
1944 3300059424 Ga0590075_006327 Ga0590075_006327_462_1013 178
1945 3300059477 Ga0587084_002366 Ga0587084_002366_91_627 178
1946 3300059477 Ga0587084_039138 Ga0587084_039138_29_565 178
1947 3300059478 Ga0587093_050884 Ga0587093_050884_30_566 178
1948 3300059490 Ga0587066_047796 Ga0587066_047796_267_803 178
1949 3300059490 Ga0587066_088959 Ga0587066_088959_89_625 178
1950 3300059491 Ga0587070_026479 Ga0587070_026479_351_887 178
1951 3300059491 Ga0587070_035675 Ga0587070_035675_29_565 178
1952 3300059493 Ga0587077_036886 Ga0587077_036886_89_625 178
1953 3300059493 Ga0587077_043657 Ga0587077_043657_77_613 178
1954 3300059505 Ga0587083_0045794 Ga0587083_0045794_166_702 178
1955 3300059507 Ga0587086_040749 Ga0587086_040749_134_670 178
1956 3300059508 Ga0587088_001655 Ga0587088_001655_1470_2006 178
1957 3300059508 Ga0587088_083504 Ga0587088_083504_113_649 178
1958 3300059509 Ga0587089_013933 Ga0587089_013933_163_699 178
1959 3300059510 Ga0587090_000805 Ga0587090_000805_1984_2520 178
1960 3300059510 Ga0587090_000870 Ga0587090_000870_672_1208 178
1961 3300059510 Ga0587090_097093 Ga0587090_097093_49_585 178
1962 3300059511 Ga0587091_030410 Ga0587091_030410_369_905 178
1963 3300059512 Ga0587092_063402 Ga0587092_063402_89_625 178
1964 3300059513 Ga0587094_035122 Ga0587094_035122_77_613 178
1965 3300059514 Ga0587095_000137 Ga0587095_000137_2145_2681 178
1966 3300059603 Ga0587097_02033 Ga0587097_02033_83_619 178
1967 3300059604 Ga0587098_024447 Ga0587098_024447_166_702 178
1968 3300059605 Ga0587106_001859 Ga0587106_001859_1076_1612 178
1969 3300059605 Ga0587106_032870 Ga0587106_032870_230_766 178
1970 3300059607 Ga0587125_000214 Ga0587125_000214_2143_2679 178
1971 3300059609 Ga0587131_000266 Ga0587131_000266_350_886 178
1972 3300059622 Ga0587099_012233 Ga0587099_012233_268_804 178
1973 3300059623 Ga0587101_021575 Ga0587101_021575_166_702 178
1974 3300059623 Ga0587101_051013 Ga0587101_051013_88_624 178
1975 3300059624 Ga0587109_078434 Ga0587109_078434_29_565 178
1976 3300059624 Ga0587109_105581 Ga0587109_105581_29_565 178
1977 3300059624 Ga0587109_114759 Ga0587109_114759_23_559 178
1978 3300059626 Ga0587115_000438 Ga0587115_000438_398_934 178
1979 3300059627 Ga0587117_040625 Ga0587117_040625_29_565 178
1980 3300059628 Ga0587122_007483 Ga0587122_007483_89_625 178
1981 3300059628 Ga0587122_014505 Ga0587122_014505_177_713 178
1982 3300059630 Ga0587128_018969 Ga0587128_018969_472_1008 178
1983 3300059630 Ga0587128_052364 Ga0587128_052364_29_565 178
1984 3300059639 Ga0587062_055529 Ga0587062_055529_89_625 178
1985 3300059640 Ga0587067_026656 Ga0587067_026656_89_625 178
1986 3300059641 Ga0587068_021381 Ga0587068_021381_117_653 178
1987 3300059641 Ga0587068_028286 Ga0587068_028286_77_613 178
1988 3300059642 Ga0587069_046351 Ga0587069_046351_77_613 178
1989 3300059642 Ga0587069_055484 Ga0587069_055484_89_625 178
1990 3300059643 Ga0587072_021197 Ga0587072_021197_155_691 178
1991 3300059643 Ga0587072_036526 Ga0587072_036526_316_852 178
1992 3300059643 Ga0587072_040187 Ga0587072_040187_77_613 178
1993 3300059644 Ga0587075_032057 Ga0587075_032057_77_613 178
1994 3300059644 Ga0587075_052454 Ga0587075_052454_89_625 178
1995 3300059645 Ga0587076_023453 Ga0587076_023453_166_702 178
1996 3300059646 Ga0587078_039606 Ga0587078_039606_38_574 178
1997 3300059646 Ga0587078_040986 Ga0587078_040986_77_613 178
1998 3300059647 Ga0587079_077491 Ga0587079_077491_29_565 178
1999 3300059647 Ga0587079_080702 Ga0587079_080702_117_653 178
2000 3300059648 Ga0587100_005861 Ga0587100_005861_241_777 178
2001 3300059650 Ga0587104_007589 Ga0587104_007589_77_613 178
2002 3300059651 Ga0587105_003333 Ga0587105_003333_90_626 178
2003 3300059651 Ga0587105_006622 Ga0587105_006622_77_613 178
2004 3300059652 Ga0587107_013746 Ga0587107_013746_155_691 178
2005 3300059652 Ga0587107_059567 Ga0587107_059567_89_625 178
2006 3300059653 Ga0587108_010053 Ga0587108_010053_29_565 178
2007 3300059657 Ga0587118_12068 Ga0587118_12068_89_625 178
2008 3300059660 Ga0587124_000156 Ga0587124_000156_2157_2693 178
2009 3300060344 Ga0587071_024712 Ga0587071_024712_133_669 178
2010 3300060344 Ga0587071_030204 Ga0587071_030204_476_1012 178
2011 3300060344 Ga0587071_057034 Ga0587071_057034_29_565 178
2012 3300060346 Ga0587111_0038656 Ga0587111_0038656_88_624 178
2013 3300060353 Ga0501082_0056952 Ga0501082_0056952_59_610 178
2014 3300060353 Ga0501082_0125074 Ga0501082_0125074_648_1199 178
2015 3300060353 Ga0501082_0206605 Ga0501082_0206605_386_937 178
2016 3300060353 Ga0501082_0828328 Ga0501082_0828328_95_646 178
2017 3300061734 Ga0530510_0057241 Ga0530510_0057241_1522_2073 178
2018 3300061734 Ga0530510_0188773 Ga0530510_0188773_894_1445 178
2019 3300000549 LJQas_1002100 LJQas_10021005 179
2020 3300004799 Ga0058863_11894902 Ga0058863_118949022 179
2021 3300004800 Ga0058861_11930681 Ga0058861_119306811 179
2022 3300004801 Ga0058860_12204180 Ga0058860_122041801 179
2023 3300005327 Ga0070658_10133044 Ga0070658_101330442 179
2024 3300005334 Ga0068869_100407447 Ga0068869_1004074472 179
2025 3300005339 Ga0070660_100146286 Ga0070660_1001462863 179
2026 3300005341 Ga0070691_10009448 Ga0070691_100094483 179
2027 3300005355 Ga0070671_100539378 Ga0070671_1005393781 179
2028 3300005367 Ga0070667_100134831 Ga0070667_1001348314 179
2029 3300005441 Ga0070700_100073217 Ga0070700_1000732175 179
2030 3300005543 Ga0070672_100166292 Ga0070672_1001662921 179
2031 3300005548 Ga0070665_100582852 Ga0070665_1005828521 179
2032 3300005563 Ga0068855_100861195 Ga0068855_1008611952 179
2033 3300005578 Ga0068854_100236565 Ga0068854_1002365652 179
2034 3300005617 Ga0068859_100415479 Ga0068859_1004154792 179
2035 3300005618 Ga0068864_100854981 Ga0068864_1008549812 179
2036 3300005718 Ga0068866_10267377 Ga0068866_102673772 179
2037 3300005719 Ga0068861_100015733 Ga0068861_1000157332 179
2038 3300005834 Ga0068851_10030212 Ga0068851_100302122 179
2039 3300005844 Ga0068862_100072571 Ga0068862_1000725718 179
2040 3300006931 Ga0097620_100415496 Ga0097620_1004154962 179
2041 3300009093 Ga0105240_10382210 Ga0105240_103822102 179
2042 3300009098 Ga0105245_10126910 Ga0105245_101269102 179
2043 3300009098 Ga0105245_10506970 Ga0105245_105069701 179
2044 3300009176 Ga0105242_10078881 Ga0105242_100788812 179
2045 3300009545 Ga0105237_10301784 Ga0105237_103017842 179
2046 3300009551 Ga0105238_10542512 Ga0105238_105425122 179
2047 3300009553 Ga0105249_10565610 Ga0105249_105656102 179
2048 3300010375 Ga0105239_10413421 Ga0105239_104134213 179
2049 3300013296 Ga0157374_11788153 Ga0157374_117881531 179
2050 3300013297 Ga0157378_10088855 Ga0157378_100888556 179
2051 3300014968 Ga0157379_10582762 Ga0157379_105827622 179
2052 3300020069 Ga0197907_11163269 Ga0197907_111632691 179
2053 3300020078 Ga0206352_10228094 Ga0206352_102280944 179
2054 3300020078 Ga0206352_10464821 Ga0206352_104648212 179
2055 3300020081 Ga0206354_10614689 Ga0206354_106146892 179
2056 3300020082 Ga0206353_11006368 Ga0206353_110063683 179
2057 3300022467 Ga0224712_10044016 Ga0224712_100440163 179
2058 3300025901 Ga0207688_10191431 Ga0207688_101914313 179
2059 3300025901 Ga0207688_10273874 Ga0207688_102738742 179
2060 3300025909 Ga0207705_10252453 Ga0207705_102524531 179
2061 3300025918 Ga0207662_10009419 Ga0207662_1000941911 179
2062 3300025919 Ga0207657_10020254 Ga0207657_100202545 179
2063 3300025924 Ga0207694_10427961 Ga0207694_104279612 179
2064 3300025927 Ga0207687_10356241 Ga0207687_103562413 179
2065 3300025928 Ga0207700_10438719 Ga0207700_104387191 179
2066 3300025929 Ga0207664_11150883 Ga0207664_111508831 179
2067 3300025934 Ga0207686_10046905 Ga0207686_100469053 179
2068 3300025938 Ga0207704_10307479 Ga0207704_103074791 179
2069 3300025940 Ga0207691_10110769 Ga0207691_101107691 179
2070 3300025986 Ga0207658_10662815 Ga0207658_106628152 179
2071 3300026075 Ga0207708_10015459 Ga0207708_100154592 179
2072 3300026089 Ga0207648_10008491 Ga0207648_1000849112 179
2073 3300026095 Ga0207676_10666251 Ga0207676_106662512 179
2074 3300026116 Ga0207674_10011658 Ga0207674_1001165814 179
2075 3300026118 Ga0207675_100014683 Ga0207675_1000146838 179
2076 3300028380 Ga0268265_10124370 Ga0268265_101243704 179
2077 3300031456 Ga0307513_10133255 Ga0307513_101332554 179
2078 3300031731 Ga0307405_10002818 Ga0307405_100028185 179
2079 3300031824 Ga0307413_10031850 Ga0307413_100318502 179
2080 3300031901 Ga0307406_10008849 Ga0307406_100088495 179
2081 3300031911 Ga0307412_10018937 Ga0307412_100189372 179
2082 3300031995 Ga0307409_100012260 Ga0307409_10001226010 179
2083 3300032002 Ga0307416_100006615 Ga0307416_10000661515 179
2084 3300032002 Ga0307416_100378318 Ga0307416_1003783182 179
2085 3300032126 Ga0307415_100000047 Ga0307415_10000004747 179
2086 3300032126 Ga0307415_100128118 Ga0307415_1001281183 179
2087 3300034957 Ga0373938_0117165 Ga0373938_0117165_29_568 179
2088 3300035115 Ga0373941_0194168 Ga0373941_0194168_57_599 179
2089 3300035119 Ga0373956_0002191 Ga0373956_0002191_4646_5185 179
2090 3300037312 Ga0395899_0014432 Ga0395899_0014432_2940_3482 179
2091 3300037418 Ga0395900_0006085 Ga0395900_0006085_1750_2292 179
2092 3300037466 Ga0395898_0004658 Ga0395898_0004658_8812_9354 179
2093 3300037471 Ga0395905_0360486 Ga0395905_0360486_124_666 179
2094 3300038443 Ga0395901_0051913 Ga0395901_0051913_2912_3454 179
2095 3300041443 Ga0451789_0366743 Ga0451789_0366743_55_600 179
2096 3300041451 Ga0451791_1010988 Ga0451791_1010988_637_1182 179
2097 3300041452 Ga0451793_0361512 Ga0451793_0361512_339_884 179
2098 3300041458 Ga0451798_0506741 Ga0451798_0506741_194_733 179
2099 3300041492 Ga0451835_0399605 Ga0451835_0399605_104_643 179
2100 3300041505 Ga0451849_0786616 Ga0451849_0786616_55_600 179
2101 3300041511 Ga0451855_1498768 Ga0451855_1498768_119_664 179
2102 3300041512 Ga0451853_1639627 Ga0451853_1639627_266_811 179
2103 3300042461 Ga0439460_0236360 Ga0439460_0236360_40_579 179
2104 3300042876 Ga0451577_0382641 Ga0451577_0382641_676_1215 179
2105 3300044712 Ga0453684_0716670 Ga0453684_0716670_49_588 179
2106 3300046501 Ga0495607_0021701 Ga0495607_0021701_2526_3065 179
2107 3300046519 Ga0495632_0189773 Ga0495632_0189773_97_639 179
2108 3300046543 Ga0495645_0188009 Ga0495645_0188009_184_723 179
2109 3300046675 Ga0495657_0177544 Ga0495657_0177544_663_1202 179
2110 3300047323 Ga0495683_0003613 Ga0495683_0003613_6767_7306 179
2111 3300047445 Ga0495677_0201361 Ga0495677_0201361_79_618 179
2112 3300048905 Ga0496102_0033599 Ga0496102_0033599_2266_2805 179
2113 3300048906 Ga0496103_0264219 Ga0496103_0264219_25_564 179
2114 3300048908 Ga0496105_0294063 Ga0496105_0294063_424_963 179
2115 3300048912 Ga0496109_0690016 Ga0496109_0690016_400_939 179
2116 3300048917 Ga0496114_0099854 Ga0496114_0099854_798_1337 179
2117 3300048924 Ga0496121_0027894 Ga0496121_0027894_2651_3190 179
2118 3300049129 Ga0501309_019776 Ga0501309_019776_219_758 179
2119 3300049533 Ga0501317_000360 Ga0501317_000360_423_962 179
2120 3300049534 Ga0501318_025451 Ga0501318_025451_88_627 179
2121 3300049537 Ga0501321_043824 Ga0501321_043824_40_579 179
2122 3300049578 Ga0501042_0271189 Ga0501042_0271189_88_627 179
2123 3300049581 Ga0501047_0000278 Ga0501047_0000278_48244_48783 179
2124 3300049591 Ga0501075_0408013 Ga0501075_0408013_146_685 179
2125 3300049592 Ga0501076_0040602 Ga0501076_0040602_1268_1807 179
2126 3300049741 Ga0501079_0136256 Ga0501079_0136256_347_886 179
2127 3300050511 nmdc:mga08y16_262435_c1 nmdc:mga08y16_262435_c1_454_993 179
2128 3300053118 Ga0500594_0215828 Ga0500594_0215828_59_601 179
2129 3300053153 Ga0500616_0000947 Ga0500616_0000947_9072_9614 179
2130 3300059508 Ga0587088_047967 Ga0587088_047967_202_741 179
2131 3300059510 Ga0587090_014184 Ga0587090_014184_529_1068 179
2132 3300059511 Ga0587091_025641 Ga0587091_025641_516_1055 179
2133 3300059622 Ga0587099_011423 Ga0587099_011423_37_576 179
2134 3300059625 Ga0587113_002263 Ga0587113_002263_121_660 179
2135 3300059642 Ga0587069_053340 Ga0587069_053340_120_659 179
2136 3300059644 Ga0587075_032730 Ga0587075_032730_116_655 179
2137 3300059647 Ga0587079_015245 Ga0587079_015245_667_1206 179
2138 3300059655 Ga0587114_003562 Ga0587114_003562_46_585 179
2139 3300060344 Ga0587071_010510 Ga0587071_010510_887_1426 179
2140 3300060346 Ga0587111_0086541 Ga0587111_0086541_177_716 179
2141 3300061734 Ga0530510_0119041 Ga0530510_0119041_1313_1852 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

109

184

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

30

101

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9b-assembly1.cif.gz_BH crystal structure of the 70s ribosome with tigecycline. 0.9553 2 171
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9548 2 176
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.9533 8 171
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9508 2 176
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9477 7 172
ID Description Score Start End Superfamily
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9475 84 169 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9405 84 174 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9389 84 171 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9373 84 170 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.937 84 169 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9928 54 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9886 83 155 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6B3I972-F1-model_v4 50S ribosomal protein L6 0.9839 70 143 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6G3V3R5-F1-model_v4 deleted 0.9807 1 143
AF-A0A2J1D431-F1-model_v4 deleted 0.9758 75 169

Feature Viewer

pLDDT pTM Quality
92.17 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map