metagRoot

F497015

General Info

Members	Datasets	Scaffolds	Average Seq Length
2711	834	2693	101

Family's Representative Sequence

Representative Sequence	3300005355\|Ga0070671_100591612\|Ga0070671_1005916122
Length	119
Sequence	VRSSPRSSFHSRPEGTQTVAKLSLMEREKKRAQLVAKFAKKYAELKAAANDATKSDEERYASRLELQKLPRNAYPTRQRNRCGITGRPRGTFRKFGLSRNKIRELAFKGDIPGVVKASW

Samples

	Sample ID	Description	Type	Environment
1	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
2	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
3	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
4	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
5	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
6	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
7	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
8	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
9	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
10	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
11	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
12	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
13	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
14	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
15	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
16	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
17	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
18	2831864461	Roseateles noduli HZ7	Isolate	Nodule
19	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
20	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
21	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
22	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
23	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
24	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
25	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
26	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
27	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
28	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
29	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
30	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
31	3300003159	Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
32	3300003161	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
33	3300003162	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
34	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
35	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
36	3300003300	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
37	3300003305	Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
38	3300003308	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
39	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
40	3300003347	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM	Metagenome	Rhizosphere
41	3300003396	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM	Metagenome	Rhizosphere
42	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
43	3300003559	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
44	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
45	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
46	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
47	3300003579	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
48	3300003611	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
49	3300003613	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
50	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
51	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
52	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
53	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
54	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
55	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
56	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
57	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
58	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
59	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
60	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
61	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
62	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
63	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
64	3300004785	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
65	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
66	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
67	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
68	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
69	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
70	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
71	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
72	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
73	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
74	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
75	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
76	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
77	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
78	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
79	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
80	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
81	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
82	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
83	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
84	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
85	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
86	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
87	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
88	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
89	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
90	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
91	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
92	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
93	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
94	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
95	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
96	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
97	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
98	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
99	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
100	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
101	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
102	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
103	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
104	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
105	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
106	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
107	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
108	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
109	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
110	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
111	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
112	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
113	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
114	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
115	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
116	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
117	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
118	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
119	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
120	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
121	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
122	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
123	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
124	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
125	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
126	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
127	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
128	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
129	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
130	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
131	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
132	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
133	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
134	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
135	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
136	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
137	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
138	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
139	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
140	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
141	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
142	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
143	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
144	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
145	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
146	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
147	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
148	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
149	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
150	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
151	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
152	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
153	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
154	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
155	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
156	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
157	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
158	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
159	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
160	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
161	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
162	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
163	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
164	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
165	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
166	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
167	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
168	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
169	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
170	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
171	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
172	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
173	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
174	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
175	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
176	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
177	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
178	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
179	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
180	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
181	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
182	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
183	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
184	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
185	3300012476	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610	Metagenome	Rhizosphere
186	3300012478	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610	Metagenome	Rhizosphere
187	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
188	3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Metagenome	Rhizosphere
189	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
190	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
191	3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Metagenome	Rhizosphere
192	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
193	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
194	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
195	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
196	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
197	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
198	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
199	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
200	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
201	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
202	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
203	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
204	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
205	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
206	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
207	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
208	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
209	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
210	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
211	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
212	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
213	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
214	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
215	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
216	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
217	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
218	3300023309	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1	Metatranscriptome	Rhizosphere
219	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
220	3300025227	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
222	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
223	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
224	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
225	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
226	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
227	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
228	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
229	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
230	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
231	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
232	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
233	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
234	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
235	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
236	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
237	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
238	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
239	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
240	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
302	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
303	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
316	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
318	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
322	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
323	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
324	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
325	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
326	3300029285	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1	Metatranscriptome	Rhizosphere
327	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
328	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
329	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
330	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
331	3300030863	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
332	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
333	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
334	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
335	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
336	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
337	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
338	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
339	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
340	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
341	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
342	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
343	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
344	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
345	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
346	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
347	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
348	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
349	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
350	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
351	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
352	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
353	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
354	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
355	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
356	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
357	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
358	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
359	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
360	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
361	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
362	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
363	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
364	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
365	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
366	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
367	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
368	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
369	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
370	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
371	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
372	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
373	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
374	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
375	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
376	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
377	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
378	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
379	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
380	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
381	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
382	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
383	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
384	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
385	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
386	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
387	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
388	3300036535	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
389	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
390	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
391	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
392	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
393	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
394	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
395	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
396	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
397	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
398	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
399	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
400	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
401	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
402	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
403	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
404	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
405	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
406	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
407	3300041444	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT	Metatranscriptome	Rhizoplane
408	3300041446	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT	Metatranscriptome	Rhizoplane
409	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
410	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
411	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
412	3300041454	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT	Metatranscriptome	Rhizoplane
413	3300041455	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT	Metatranscriptome	Rhizoplane
414	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
415	3300041457	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT	Metatranscriptome	Rhizoplane
416	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
417	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
418	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
419	3300041461	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT	Metatranscriptome	Rhizoplane
420	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
421	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
422	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
423	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
424	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
425	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
426	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
427	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
428	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
429	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
430	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
431	3300041510	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT	Metatranscriptome	Unclassified
432	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
433	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
434	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
435	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
436	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
437	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
438	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
439	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
440	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
441	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
442	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
443	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
444	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
445	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
446	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
447	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
448	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
449	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
450	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
451	3300042116	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792	Metagenome	Rhizosphere
452	3300042117	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937	Metagenome	Rhizosphere
453	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
454	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
455	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
456	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
457	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
458	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
459	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
460	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
461	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
462	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
463	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
464	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
465	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
466	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
467	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
468	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
469	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
470	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
471	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
472	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
473	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
474	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
475	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
476	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
477	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
478	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
479	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
480	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
481	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
482	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
483	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
484	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
485	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
486	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
487	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
488	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
489	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
490	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
491	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
492	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
493	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
494	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
495	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
496	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
497	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
498	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
499	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
500	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
501	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
502	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
503	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
504	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
505	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
506	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
507	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
508	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
509	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
510	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
511	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
512	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
513	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
514	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
515	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
516	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
517	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
518	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
519	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
520	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
521	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
522	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
523	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
524	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
525	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
526	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
527	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
528	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
529	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
530	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
531	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
532	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
533	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
534	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
535	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
536	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
537	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
538	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
539	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
540	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
541	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
542	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
543	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
544	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
545	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
546	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
547	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
548	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
549	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
550	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
551	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
552	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
553	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
554	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
555	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
556	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
557	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
558	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
559	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
560	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
561	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
562	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
563	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
564	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
565	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
566	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
567	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
568	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
569	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
570	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
571	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
572	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
573	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
574	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
575	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
576	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
577	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
578	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
579	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
580	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
581	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
582	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
583	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
584	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
585	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
586	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
587	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
588	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
589	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
590	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
591	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
592	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
593	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
594	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
595	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
596	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
597	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
598	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
599	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
600	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
601	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
602	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
603	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
604	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
605	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
606	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
607	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
608	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
609	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
610	3300049131	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
611	3300049160	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
612	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
613	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
614	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
615	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
616	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
617	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
618	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
619	3300049516	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought	Metagenome	Rhizosphere
620	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
621	3300049518	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control	Metagenome	Rhizosphere
622	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
623	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
624	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
625	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
626	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
627	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
628	3300049529	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
629	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
630	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
631	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
632	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
633	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
634	3300049535	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
635	3300049536	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
636	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
637	3300049538	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
638	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
639	3300049540	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
640	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
641	3300049543	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
642	3300049545	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
643	3300049547	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
644	3300049549	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
645	3300049551	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
646	3300049552	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
647	3300049554	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
648	3300049556	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
649	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
650	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
651	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
652	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
653	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
654	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
655	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
656	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
657	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
658	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
659	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
660	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
661	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
662	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
663	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
664	3300049651	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought	Metagenome	Rhizosphere
665	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
666	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
667	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
668	3300049655	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought	Metagenome	Rhizosphere
669	3300049657	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought	Metagenome	Rhizosphere
670	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
671	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
672	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
673	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
674	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
675	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
676	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
677	3300049670	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought	Metagenome	Rhizosphere
678	3300049677	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control	Metagenome	Rhizosphere
679	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
680	3300049681	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought	Metagenome	Rhizosphere
681	3300049682	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought	Metagenome	Rhizosphere
682	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
683	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
684	3300049687	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought	Metagenome	Rhizosphere
685	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
686	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
687	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
688	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
689	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
690	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
691	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
692	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
693	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
694	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
695	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
696	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
697	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
698	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
699	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
700	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
701	3300049771	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control	Metagenome	Rhizosphere
702	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
703	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
704	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
705	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
706	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
707	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
708	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
709	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
710	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
711	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
712	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
713	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
714	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
715	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
716	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
717	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
718	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
719	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
720	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
721	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
722	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
723	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
724	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
725	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
726	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
727	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
728	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
729	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
730	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
731	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
732	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
733	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
734	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
735	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
736	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
737	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
738	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
739	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
740	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
741	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
742	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
743	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
744	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
745	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
746	3300053127	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere	Metagenome	Endosphere
747	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
748	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
749	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
750	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
751	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
752	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
753	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
754	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
755	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
756	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
757	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
758	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
759	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
760	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
761	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
762	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
763	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
764	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
765	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
766	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
767	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
768	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
769	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
770	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
771	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
772	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
773	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
774	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
775	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
776	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
777	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
778	3300059478	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
779	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
780	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
781	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
782	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
783	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
784	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
785	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
786	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
787	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
788	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
789	3300059509	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
790	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
791	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
792	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
793	3300059513	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
794	3300059603	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
795	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
796	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
797	3300059606	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
798	3300059607	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
799	3300059608	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
800	3300059622	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
801	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
802	3300059624	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
803	3300059625	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
804	3300059626	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
805	3300059627	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
806	3300059628	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
807	3300059629	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
808	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
809	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
810	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
811	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
812	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
813	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
814	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
815	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
816	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
817	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
818	3300059648	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
819	3300059649	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
820	3300059650	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
821	3300059651	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
822	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
823	3300059653	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
824	3300059654	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
825	3300059655	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
826	3300059656	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
827	3300059657	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
828	3300059658	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
829	3300059659	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
830	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
831	3300060247	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
832	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
833	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
834	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	85.87
Metatranscriptomes	13.46
Isolates	0.66

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.47
Nodule	0.22
Rhizoplane	4.32
Rhizosphere	78.46
Stem	0
Stem Tuber	0
Unclassified	4.54

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	2214593853	2209111006	Bacteria	523
2	JGI24747J21853_1009316	3300001978	Bacteria	969
3	JGI24743J22301_10086779	3300001991	Bacteria	664
4	JGI24735J21928_10241017	3300002067	Bacteria	527
5	JGI24745J21846_1034750	3300002073	Bacteria	614
6	JGI24738J21930_10068067	3300002075	Bacteria	735
7	JGI24035J26624_1018282	3300002126	Bacteria	729
8	JGI25154J39366_1000593	3300002738	Bacteria	17447
9	JGI25157J39369_1001134	3300002741	Bacteria	11672
10	JGI25164J39214_1002084	3300002772	Bacteria	3435
11	JGI25152J39213_1001073	3300002773	Bacteria	12895
12	JGI25150J39212_1003907	3300002774	Bacteria	3415
13	Ga0006771J45828_103610	3300003159	Bacteria	1974
14	Ga0006765J45826_106373	3300003161	Bacteria	4293
15	Ga0006778J45830_1009213	3300003162	Bacteria	15395
16	Ga0006778J45830_1028609	3300003162	Bacteria	1950
17	Ga0006759J45824_1028038	3300003163	Bacteria	4414
18	Ga0006759J45824_1029126	3300003163	Bacteria	2169
19	Ga0006759J45824_1059282	3300003163	Bacteria	1344
20	JGI25153J46596_10007740	3300003215	Bacteria	5229
21	JGI25153J46596_10008637	3300003215	Bacteria	4845
22	Ga0006758J48902_1015144	3300003300	Bacteria	3291
23	Ga0006758J48902_1016024	3300003300	Bacteria	1731
24	Ga0006758J48902_1021934	3300003300	Bacteria	1503
25	Ga0006770J48903_1001899	3300003305	Bacteria	11120
26	Ga0006770J48903_1017003	3300003305	Bacteria	2309
27	Ga0006777J48905_1014855	3300003308	Bacteria	5027
28	rootL2_10093366	3300003322	Bacteria	1694
29	JGI26128J50194_1000191	3300003347	Bacteria	2835
30	JGI26137J50245_101641	3300003396	Bacteria	690
31	Ga0007417J51691_1020817	3300003544	Bacteria	4053
32	Ga0007417J51691_1043945	3300003544	Bacteria	2500
33	Ga0007417J51691_1059733	3300003544	Bacteria	1046
34	Ga0007417J51691_1090341	3300003544	Bacteria	575
35	Ga0007427J51700_113549	3300003559	Bacteria	2002
36	Ga0007427J51700_118227	3300003559	Bacteria	1005
37	Ga0007410J51695_1005226	3300003574	Bacteria	5217
38	Ga0007410J51695_1028665	3300003574	Bacteria	3145
39	Ga0007410J51695_1032042	3300003574	Bacteria	2025
40	Ga0007410J51695_1043180	3300003574	Bacteria	4391
41	Ga0007409J51694_1019841	3300003575	Bacteria	1451
42	Ga0007409J51694_1024055	3300003575	Bacteria	9433
43	Ga0007416J51690_1027279	3300003577	Bacteria	2389
44	Ga0007416J51690_1037564	3300003577	Bacteria	4820
45	Ga0007416J51690_1051124	3300003577	Bacteria	2960
46	Ga0007416J51690_1084832	3300003577	Bacteria	596
47	Ga0007429J51699_1081577	3300003579	Bacteria	613
48	Ga0007411J51799_109097	3300003611	Bacteria	3946
49	Ga0007415J51800_107261	3300003613	Bacteria	3368
50	Ga0007415J51800_118403	3300003613	Bacteria	1154
51	Ga0032354_1037309	3300003693	Bacteria	2923
52	Ga0032354_1038503	3300003693	Bacteria	3177
53	Ga0032354_1054804	3300003693	Bacteria	1134
54	Ga0032354_1120735	3300003693	Bacteria	627
55	Ga0055539_1013170	3300003752	Bacteria	1014
56	Ga0055533_1000043	3300003756	Bacteria	229262
57	Ga0055525_1000161	3300003759	Bacteria	87478
58	Ga0055525_1000641	3300003759	Bacteria	14040
59	Ga0055535_1022599	3300003761	Bacteria	748
60	Ga0055535_1023634	3300003761	Bacteria	716
61	Ga0055535_1028550	3300003761	Bacteria	599
62	Ga0055529_1000322	3300003763	Bacteria	54232
63	Ga0055526_1000791	3300003771	Bacteria	23567
64	Ga0055526_1003343	3300003771	Bacteria	10245
65	Ga0055524_1000140	3300003775	Bacteria	85990
66	Ga0055524_1029964	3300003775	Bacteria	1596
67	Ga0055524_1029968	3300003775	Bacteria	1596
68	Ga0055528_1041283	3300003790	Bacteria	1030
69	Ga0055530_10006458	3300003791	Bacteria	5230
70	Ga0055530_10019398	3300003791	Bacteria	2061
71	Ga0055530_10047713	3300003791	Bacteria	1011
72	Ga0055540_1000133	3300003792	Bacteria	75104
73	Ga0055540_1011339	3300003792	Bacteria	2882
74	Ga0055540_1025018	3300003792	Bacteria	1470
75	Ga0055540_1026414	3300003792	Bacteria	1406
76	Ga0055531_10002079	3300003794	Bacteria	13764
77	Ga0055531_10002114	3300003794	Bacteria	13639
78	Ga0055531_10021540	3300003794	Bacteria	2495
79	Ga0055531_10034681	3300003794	Bacteria	1596
80	Ga0058692_1047259	3300003856	Bacteria	727
81	Ga0055543_1031436	3300004625	Bacteria	925
82	Ga0058858_1386099	3300004785	Bacteria	984
83	Ga0058859_10003590	3300004798	Bacteria	1079
84	Ga0058859_10014111	3300004798	Bacteria	1624
85	Ga0058859_10053023	3300004798	Bacteria	1174
86	Ga0058861_10010151	3300004800	Bacteria	753
87	Ga0058861_10032824	3300004800	Bacteria	1948
88	Ga0058861_10142005	3300004800	Bacteria	1459
89	Ga0058861_11546501	3300004800	Bacteria	622
90	Ga0058860_10015107	3300004801	Bacteria	597
91	Ga0058860_12097130	3300004801	Bacteria	644
92	Ga0058860_12226982	3300004801	Bacteria	1429
93	Ga0065714_10208968	3300005288	Bacteria	872
94	Ga0065712_10021088	3300005290	Bacteria	1548
95	Ga0065712_10476167	3300005290	Bacteria	666
96	Ga0065715_10023020	3300005293	Bacteria	1712
97	Ga0065715_10056333	3300005293	Bacteria	825
98	Ga0065715_10057067	3300005293	Bacteria	827
99	Ga0065715_10520315	3300005293	Bacteria	764
100	Ga0065707_10331922	3300005295	Bacteria	948
101	Ga0065707_10780234	3300005295	Bacteria	607
102	Ga0070658_10018142	3300005327	Bacteria	5631
103	Ga0070658_10152764	3300005327	Bacteria	1933
104	Ga0070658_10160545	3300005327	Bacteria	1885
105	Ga0070658_10376475	3300005327	Bacteria	1217
106	Ga0070658_10398274	3300005327	Bacteria	1182
107	Ga0070658_10625740	3300005327	Bacteria	933
108	Ga0070658_10765399	3300005327	Bacteria	839
109	Ga0070658_10847330	3300005327	Bacteria	794
110	Ga0070658_11431480	3300005327	Bacteria	600
111	Ga0070658_11462489	3300005327	Bacteria	593
112	Ga0070658_11518866	3300005327	Bacteria	581
113	Ga0070658_11819696	3300005327	Bacteria	526
114	Ga0070658_12002031	3300005327	Bacteria	500
115	Ga0070676_10002282	3300005328	Bacteria	9791
116	Ga0070676_10021276	3300005328	Bacteria	3630
117	Ga0070676_10078497	3300005328	Bacteria	1997
118	Ga0070676_10093888	3300005328	Bacteria	1843
119	Ga0070676_10157576	3300005328	Bacteria	1458
120	Ga0070676_10241559	3300005328	Bacteria	1201
121	Ga0070676_10518685	3300005328	Bacteria	849
122	Ga0070676_10913198	3300005328	Bacteria	655
123	Ga0070676_11223027	3300005328	Bacteria	571
124	Ga0070676_11314334	3300005328	Bacteria	552
125	Ga0070676_11528605	3300005328	Bacteria	514
126	Ga0070683_100230594	3300005329	Bacteria	1760
127	Ga0070683_100748256	3300005329	Bacteria	936
128	Ga0070683_101817471	3300005329	Bacteria	586
129	Ga0070683_101904308	3300005329	Bacteria	571
130	Ga0070690_100006927	3300005330	Bacteria	6450
131	Ga0070690_100031978	3300005330	Bacteria	3282
132	Ga0070690_101091273	3300005330	Bacteria	633
133	Ga0070690_101745641	3300005330	Bacteria	507
134	Ga0070670_100054237	3300005331	Bacteria	3441
135	Ga0070670_100064589	3300005331	Bacteria	3140
136	Ga0070670_100065507	3300005331	Bacteria	3117
137	Ga0070670_100536821	3300005331	Bacteria	1043
138	Ga0070670_101026493	3300005331	Bacteria	750
139	Ga0070670_101411232	3300005331	Bacteria	638
140	Ga0070670_101531242	3300005331	Bacteria	612
141	Ga0070670_101555237	3300005331	Bacteria	608
142	Ga0070677_10017315	3300005333	Bacteria	2578
143	Ga0070677_10069496	3300005333	Bacteria	1477
144	Ga0070677_10109386	3300005333	Bacteria	1231
145	Ga0070677_10126334	3300005333	Bacteria	1161
146	Ga0070677_10242409	3300005333	Bacteria	890
147	Ga0070677_10511145	3300005333	Bacteria	652
148	Ga0070677_10867938	3300005333	Bacteria	519
149	Ga0068869_100012739	3300005334	Bacteria	5562
150	Ga0068869_100052834	3300005334	Bacteria	2951
151	Ga0068869_100054551	3300005334	Bacteria	2910
152	Ga0068869_100146255	3300005334	Bacteria	1829
153	Ga0068869_100167482	3300005334	Bacteria	1714
154	Ga0068869_100190949	3300005334	Bacteria	1610
155	Ga0068869_101018510	3300005334	Bacteria	722
156	Ga0068869_101941450	3300005334	Bacteria	528
157	Ga0070666_10221816	3300005335	Bacteria	1334
158	Ga0070666_10224408	3300005335	Bacteria	1326
159	Ga0070666_10235916	3300005335	Bacteria	1293
160	Ga0070666_10239237	3300005335	Bacteria	1283
161	Ga0070666_10283707	3300005335	Bacteria	1177
162	Ga0070666_10340714	3300005335	Bacteria	1071
163	Ga0070666_10365843	3300005335	Bacteria	1034
164	Ga0070666_11156959	3300005335	Bacteria	576
165	Ga0070666_11338603	3300005335	Bacteria	534
166	Ga0070680_100032809	3300005336	Bacteria	4180
167	Ga0070682_100057764	3300005337	Bacteria	2445
168	Ga0070682_100761903	3300005337	Bacteria	782
169	Ga0070682_101759414	3300005337	Bacteria	540
170	Ga0068868_100045924	3300005338	Bacteria	3418
171	Ga0068868_100133352	3300005338	Bacteria	2034
172	Ga0068868_100185626	3300005338	Bacteria	1727
173	Ga0068868_100261562	3300005338	Bacteria	1459
174	Ga0068868_100272027	3300005338	Bacteria	1431
175	Ga0068868_101043555	3300005338	Bacteria	750
176	Ga0068868_101134328	3300005338	Bacteria	720
177	Ga0068868_102114706	3300005338	Bacteria	535
178	Ga0070660_100137713	3300005339	Bacteria	1957
179	Ga0070660_100190679	3300005339	Bacteria	1660
180	Ga0070660_100332256	3300005339	Bacteria	1250
181	Ga0070660_100572021	3300005339	Bacteria	943
182	Ga0070660_100619238	3300005339	Bacteria	906
183	Ga0070660_101044692	3300005339	Bacteria	691
184	Ga0070660_101102100	3300005339	Bacteria	672
185	Ga0070689_100109373	3300005340	Bacteria	2197
186	Ga0070689_100939754	3300005340	Bacteria	767
187	Ga0070691_10539873	3300005341	Bacteria	680
188	Ga0070691_10999739	3300005341	Bacteria	522
189	Ga0070687_100201346	3300005343	Bacteria	1206
190	Ga0070687_100384597	3300005343	Bacteria	916
191	Ga0070687_100986619	3300005343	Bacteria	610
192	Ga0070661_100003672	3300005344	Bacteria	10572
193	Ga0070661_100092952	3300005344	Bacteria	2235
194	Ga0070661_100105291	3300005344	Bacteria	2102
195	Ga0070661_100791616	3300005344	Bacteria	777
196	Ga0070661_101068490	3300005344	Bacteria	671
197	Ga0070692_10613329	3300005345	Bacteria	722
198	Ga0070692_10910764	3300005345	Bacteria	609
199	Ga0070668_100101221	3300005347	Bacteria	2283
200	Ga0070668_100408601	3300005347	Bacteria	1160
201	Ga0070668_100932145	3300005347	Bacteria	778
202	Ga0070668_101157832	3300005347	Bacteria	699
203	Ga0070668_101607756	3300005347	Bacteria	595
204	Ga0070668_101704626	3300005347	Bacteria	578
205	Ga0070669_100017536	3300005353	Bacteria	5107
206	Ga0070669_100075981	3300005353	Bacteria	2492
207	Ga0070669_100156484	3300005353	Bacteria	1768
208	Ga0070669_100212897	3300005353	Bacteria	1525
209	Ga0070669_100306076	3300005353	Bacteria	1279
210	Ga0070669_100346164	3300005353	Bacteria	1205
211	Ga0070669_100764005	3300005353	Bacteria	820
212	Ga0070669_101288326	3300005353	Bacteria	632
213	Ga0070675_100044665	3300005354	Bacteria	3623
214	Ga0070675_100107037	3300005354	Bacteria	2361
215	Ga0070675_100119785	3300005354	Bacteria	2235
216	Ga0070675_100124843	3300005354	Bacteria	2189
217	Ga0070675_100159250	3300005354	Bacteria	1940
218	Ga0070675_100318575	3300005354	Bacteria	1373
219	Ga0070675_100556488	3300005354	Bacteria	1038
220	Ga0070675_100685121	3300005354	Bacteria	933
221	Ga0070675_101335612	3300005354	Bacteria	661
222	Ga0070675_101910828	3300005354	Bacteria	547
223	Ga0070675_102178774	3300005354	Bacteria	511
224	Ga0070671_100019537	3300005355	Bacteria	5516
225	Ga0070671_100085884	3300005355	Bacteria	2632
226	Ga0070671_100133178	3300005355	Bacteria	2094
227	Ga0070671_100170542	3300005355	Bacteria	1840
228	Ga0070671_100250786	3300005355	Bacteria	1503
229	Ga0070671_100591612	3300005355	Bacteria	958
230	Ga0070671_100650710	3300005355	Bacteria	912
231	Ga0070671_100946220	3300005355	Bacteria	753
232	Ga0070671_101510430	3300005355	Bacteria	594
233	Ga0070671_101561963	3300005355	Bacteria	584
234	Ga0070671_101935345	3300005355	Bacteria	524
235	Ga0070671_102010048	3300005355	Bacteria	515
236	Ga0070674_100039880	3300005356	Bacteria	3174
237	Ga0070674_100056124	3300005356	Bacteria	2730
238	Ga0070674_100181740	3300005356	Bacteria	1611
239	Ga0070674_100377427	3300005356	Bacteria	1152
240	Ga0070674_100687011	3300005356	Bacteria	874
241	Ga0070674_101018456	3300005356	Bacteria	727
242	Ga0070674_101790417	3300005356	Bacteria	557
243	Ga0070673_100002927	3300005364	Bacteria	10519
244	Ga0070673_100055764	3300005364	Bacteria	3115
245	Ga0070673_100092283	3300005364	Bacteria	2476
246	Ga0070673_100117288	3300005364	Bacteria	2215
247	Ga0070673_100169356	3300005364	Bacteria	1863
248	Ga0070673_100341751	3300005364	Bacteria	1326
249	Ga0070673_101766371	3300005364	Bacteria	586
250	Ga0070673_102348507	3300005364	Bacteria	507
251	Ga0070688_100074242	3300005365	Bacteria	2183
252	Ga0070688_100375525	3300005365	Bacteria	1047
253	Ga0070688_100789518	3300005365	Bacteria	742
254	Ga0070688_100847825	3300005365	Bacteria	718
255	Ga0070659_100050300	3300005366	Bacteria	3276
256	Ga0070659_100057420	3300005366	Bacteria	3069
257	Ga0070659_100120047	3300005366	Bacteria	2128
258	Ga0070659_100428407	3300005366	Bacteria	1120
259	Ga0070659_100892058	3300005366	Bacteria	777
260	Ga0070659_101584510	3300005366	Bacteria	584
261	Ga0070659_101595526	3300005366	Bacteria	582
262	Ga0070667_100028082	3300005367	Bacteria	4683
263	Ga0070667_100083378	3300005367	Bacteria	2738
264	Ga0070667_100191574	3300005367	Bacteria	1811
265	Ga0070667_100204785	3300005367	Bacteria	1752
266	Ga0070667_100327425	3300005367	Bacteria	1383
267	Ga0070667_100773763	3300005367	Bacteria	890
268	Ga0070667_101026369	3300005367	Bacteria	770
269	Ga0070667_102257362	3300005367	Bacteria	512
270	Ga0070667_102266408	3300005367	Bacteria	511
271	Ga0070703_10308697	3300005406	Bacteria	662
272	Ga0070714_100277699	3300005435	Bacteria	1555
273	Ga0070710_10174641	3300005437	Bacteria	1341
274	Ga0070701_10253999	3300005438	Bacteria	1063
275	Ga0070711_101887476	3300005439	Bacteria	525
276	Ga0070705_101421083	3300005440	Bacteria	579
277	Ga0070700_100203545	3300005441	Bacteria	1392
278	Ga0070700_100338342	3300005441	Bacteria	1111
279	Ga0070700_100380412	3300005441	Bacteria	1055
280	Ga0070700_101264979	3300005441	Bacteria	619
281	Ga0070694_100315650	3300005444	Bacteria	1201
282	Ga0070708_100706924	3300005445	Bacteria	948
283	Ga0070663_100003492	3300005455	Bacteria	9070
284	Ga0070663_100704477	3300005455	Bacteria	858
285	Ga0070663_100705956	3300005455	Bacteria	858
286	Ga0070663_100919729	3300005455	Bacteria	757
287	Ga0070663_101736287	3300005455	Bacteria	558
288	Ga0070678_100037760	3300005456	Bacteria	3394
289	Ga0070678_100094707	3300005456	Bacteria	2299
290	Ga0070678_100104114	3300005456	Bacteria	2206
291	Ga0070678_100192574	3300005456	Bacteria	1677
292	Ga0070678_100207105	3300005456	Bacteria	1623
293	Ga0070678_100297921	3300005456	Bacteria	1369
294	Ga0070678_100794965	3300005456	Bacteria	859
295	Ga0070678_100829040	3300005456	Bacteria	841
296	Ga0070678_100875548	3300005456	Bacteria	820
297	Ga0070678_101010943	3300005456	Bacteria	764
298	Ga0070678_101214301	3300005456	Bacteria	699
299	Ga0070678_101295875	3300005456	Bacteria	678
300	Ga0070678_102328203	3300005456	Bacteria	508
301	Ga0070662_100002678	3300005457	Bacteria	10992
302	Ga0070662_100111387	3300005457	Bacteria	2085
303	Ga0070662_100613806	3300005457	Bacteria	915
304	Ga0070662_100908390	3300005457	Bacteria	751
305	Ga0070662_100997889	3300005457	Bacteria	717
306	Ga0070662_101177654	3300005457	Bacteria	658
307	Ga0070681_10088377	3300005458	Bacteria	3051
308	Ga0070681_10806729	3300005458	Bacteria	856
309	Ga0070681_11138303	3300005458	Bacteria	702
310	Ga0068867_100000552	3300005459	Bacteria	24723
311	Ga0068867_100002598	3300005459	Bacteria	12737
312	Ga0068867_100011425	3300005459	Bacteria	6266
313	Ga0068867_100069225	3300005459	Bacteria	2635
314	Ga0068867_100087646	3300005459	Bacteria	2357
315	Ga0068867_100117646	3300005459	Bacteria	2049
316	Ga0068867_100231960	3300005459	Bacteria	1493
317	Ga0068867_100453228	3300005459	Bacteria	1093
318	Ga0068867_100662908	3300005459	Bacteria	917
319	Ga0068867_100695754	3300005459	Bacteria	896
320	Ga0068867_100709486	3300005459	Bacteria	888
321	Ga0068867_100911659	3300005459	Bacteria	791
322	Ga0068867_101083928	3300005459	Bacteria	730
323	Ga0068867_101848740	3300005459	Bacteria	569
324	Ga0070685_10169141	3300005466	Bacteria	1399
325	Ga0070685_10245464	3300005466	Bacteria	1184
326	Ga0070685_10316262	3300005466	Bacteria	1057
327	Ga0070685_10394830	3300005466	Bacteria	957
328	Ga0070685_10530135	3300005466	Bacteria	838
329	Ga0070706_100015900	3300005467	Bacteria	6947
330	Ga0070706_100465093	3300005467	Bacteria	1177
331	Ga0070707_100035242	3300005468	Bacteria	4774
332	Ga0070707_100905496	3300005468	Bacteria	847
333	Ga0070698_100919936	3300005471	Bacteria	820
334	Ga0070699_100054613	3300005518	Bacteria	3457
335	Ga0070699_101191241	3300005518	Bacteria	699
336	Ga0070679_100007565	3300005530	Bacteria	10160
337	Ga0070679_100080125	3300005530	Bacteria	3254
338	Ga0070679_102099077	3300005530	Bacteria	514
339	Ga0070679_102179987	3300005530	Bacteria	504
340	Ga0070684_100178663	3300005535	Bacteria	1929
341	Ga0070684_100730944	3300005535	Bacteria	923
342	Ga0070684_101408220	3300005535	Bacteria	656
343	Ga0070697_100571805	3300005536	Bacteria	992
344	Ga0068853_100284609	3300005539	Bacteria	1524
345	Ga0068853_100330775	3300005539	Bacteria	1414
346	Ga0068853_100345863	3300005539	Bacteria	1382
347	Ga0068853_100366671	3300005539	Bacteria	1343
348	Ga0068853_100652551	3300005539	Bacteria	1002
349	Ga0068853_100776425	3300005539	Bacteria	916
350	Ga0068853_100890460	3300005539	Bacteria	854
351	Ga0068853_101125178	3300005539	Bacteria	757
352	Ga0068853_101443491	3300005539	Bacteria	666
353	Ga0068853_101854831	3300005539	Bacteria	584
354	Ga0068853_101867267	3300005539	Bacteria	582
355	Ga0068853_102224461	3300005539	Bacteria	531
356	Ga0070672_100006187	3300005543	Bacteria	8016
357	Ga0070672_100044598	3300005543	Bacteria	3426
358	Ga0070672_100065480	3300005543	Bacteria	2875
359	Ga0070672_100198587	3300005543	Bacteria	1677
360	Ga0070672_100200681	3300005543	Bacteria	1668
361	Ga0070672_100226500	3300005543	Bacteria	1569
362	Ga0070672_100232603	3300005543	Bacteria	1549
363	Ga0070672_100472996	3300005543	Bacteria	1081
364	Ga0070672_100571997	3300005543	Bacteria	982
365	Ga0070686_100084049	3300005544	Bacteria	2114
366	Ga0070686_100100818	3300005544	Bacteria	1951
367	Ga0070686_100146015	3300005544	Bacteria	1652
368	Ga0070686_100621476	3300005544	Bacteria	853
369	Ga0070695_101015916	3300005545	Bacteria	675
370	Ga0070693_100023342	3300005547	Bacteria	3305
371	Ga0070693_100069686	3300005547	Bacteria	2067
372	Ga0070693_100367668	3300005547	Bacteria	988
373	Ga0070693_101032445	3300005547	Bacteria	623
374	Ga0070665_100113328	3300005548	Bacteria	2714
375	Ga0070665_100261841	3300005548	Bacteria	1731
376	Ga0070665_100320840	3300005548	Bacteria	1553
377	Ga0070665_100554049	3300005548	Bacteria	1162
378	Ga0070665_101109575	3300005548	Bacteria	802
379	Ga0070665_101194074	3300005548	Bacteria	772
380	Ga0070665_101479735	3300005548	Bacteria	688
381	Ga0068855_100040434	3300005563	Bacteria	5534
382	Ga0068855_100053199	3300005563	Bacteria	4765
383	Ga0068855_100119155	3300005563	Bacteria	3022
384	Ga0068855_100166634	3300005563	Bacteria	2497
385	Ga0068855_100300591	3300005563	Bacteria	1777
386	Ga0068855_100401893	3300005563	Bacteria	1501
387	Ga0068855_100490245	3300005563	Bacteria	1337
388	Ga0068855_101339970	3300005563	Bacteria	739
389	Ga0068855_101718265	3300005563	Bacteria	639
390	Ga0068855_102213489	3300005563	Bacteria	552
391	Ga0068855_102228415	3300005563	Bacteria	549
392	Ga0070664_100040179	3300005564	Bacteria	3943
393	Ga0070664_100514222	3300005564	Bacteria	1105
394	Ga0070664_100700369	3300005564	Bacteria	944
395	Ga0070664_100723098	3300005564	Bacteria	928
396	Ga0070664_100873383	3300005564	Bacteria	842
397	Ga0070664_101790277	3300005564	Bacteria	582
398	Ga0070664_102182478	3300005564	Bacteria	525
399	Ga0070664_102289631	3300005564	Bacteria	512
400	Ga0068857_100040688	3300005577	Bacteria	4122
401	Ga0068857_100209439	3300005577	Bacteria	1778
402	Ga0068857_100640804	3300005577	Bacteria	1006
403	Ga0068857_100685991	3300005577	Bacteria	972
404	Ga0068857_101405747	3300005577	Bacteria	679
405	Ga0068857_102106398	3300005577	Bacteria	553
406	Ga0068857_102272213	3300005577	Bacteria	532
407	Ga0068854_100044785	3300005578	Bacteria	3143
408	Ga0068854_100273417	3300005578	Bacteria	1357
409	Ga0068854_100446089	3300005578	Bacteria	1080
410	Ga0068854_100639045	3300005578	Bacteria	912
411	Ga0068854_100823349	3300005578	Bacteria	811
412	Ga0068854_101555891	3300005578	Bacteria	601
413	Ga0068854_101905240	3300005578	Bacteria	546
414	Ga0068856_100033721	3300005614	Bacteria	5014
415	Ga0068856_100137146	3300005614	Bacteria	2452
416	Ga0068856_100183859	3300005614	Bacteria	2104
417	Ga0068856_100590718	3300005614	Bacteria	1131
418	Ga0068856_101621842	3300005614	Bacteria	660
419	Ga0068856_101651020	3300005614	Bacteria	654
420	Ga0068856_101744992	3300005614	Bacteria	635
421	Ga0068856_101982772	3300005614	Bacteria	593
422	Ga0068856_102034411	3300005614	Bacteria	584
423	Ga0068856_102047549	3300005614	Bacteria	582
424	Ga0070702_100781254	3300005615	Bacteria	736
425	Ga0070702_101222597	3300005615	Bacteria	606
426	Ga0068852_100102229	3300005616	Bacteria	2589
427	Ga0068852_100157329	3300005616	Bacteria	2118
428	Ga0068852_100315873	3300005616	Bacteria	1516
429	Ga0068852_100418900	3300005616	Bacteria	1321
430	Ga0068852_100605267	3300005616	Bacteria	1100
431	Ga0068852_100651676	3300005616	Bacteria	1060
432	Ga0068852_101752809	3300005616	Bacteria	643
433	Ga0068852_102152236	3300005616	Bacteria	579
434	Ga0068852_102464516	3300005616	Bacteria	540
435	Ga0068852_102712578	3300005616	Bacteria	514
436	Ga0068859_100364845	3300005617	Bacteria	1539
437	Ga0068859_100436599	3300005617	Bacteria	1405
438	Ga0068859_100595833	3300005617	Bacteria	1198
439	Ga0068859_101027397	3300005617	Bacteria	906
440	Ga0068864_100018772	3300005618	Bacteria	5779
441	Ga0068864_100060451	3300005618	Bacteria	3280
442	Ga0068864_100103544	3300005618	Bacteria	2527
443	Ga0068864_100144620	3300005618	Bacteria	2148
444	Ga0068864_100277415	3300005618	Bacteria	1563
445	Ga0068864_100396584	3300005618	Bacteria	1311
446	Ga0068864_101023586	3300005618	Bacteria	820
447	Ga0068864_101162343	3300005618	Bacteria	769
448	Ga0068864_102135041	3300005618	Bacteria	566
449	Ga0068866_10033530	3300005718	Bacteria	2492
450	Ga0068866_11210503	3300005718	Bacteria	545
451	Ga0068861_100004770	3300005719	Bacteria	9115
452	Ga0068861_100016735	3300005719	Bacteria	5194
453	Ga0068861_100021676	3300005719	Bacteria	4620
454	Ga0068851_10075887	3300005834	Bacteria	1747
455	Ga0068851_10096881	3300005834	Bacteria	1560
456	Ga0068851_10097792	3300005834	Bacteria	1553
457	Ga0068851_10243618	3300005834	Bacteria	1017
458	Ga0068851_10251534	3300005834	Bacteria	1002
459	Ga0068851_10669682	3300005834	Bacteria	636
460	Ga0068851_10761317	3300005834	Bacteria	600
461	Ga0068851_10797560	3300005834	Bacteria	586
462	Ga0068851_10963055	3300005834	Bacteria	537
463	Ga0068851_11084607	3300005834	Bacteria	507
464	Ga0068870_10219600	3300005840	Bacteria	1163
465	Ga0068870_11048814	3300005840	Bacteria	584
466	Ga0068863_100104362	3300005841	Bacteria	2696
467	Ga0068863_100167300	3300005841	Bacteria	2108
468	Ga0068863_100242760	3300005841	Bacteria	1739
469	Ga0068863_100951211	3300005841	Bacteria	861
470	Ga0068863_101271358	3300005841	Bacteria	742
471	Ga0068863_101973726	3300005841	Bacteria	594
472	Ga0068863_102326588	3300005841	Bacteria	545
473	Ga0068863_102707031	3300005841	Bacteria	505
474	Ga0068858_100008125	3300005842	Bacteria	10091
475	Ga0068858_100030753	3300005842	Bacteria	4986
476	Ga0068858_100194536	3300005842	Bacteria	1916
477	Ga0068858_100249510	3300005842	Bacteria	1685
478	Ga0068858_100477508	3300005842	Bacteria	1203
479	Ga0068858_100780864	3300005842	Bacteria	931
480	Ga0068858_100783674	3300005842	Bacteria	930
481	Ga0068860_100008442	3300005843	Bacteria	10260
482	Ga0068860_100065679	3300005843	Bacteria	3445
483	Ga0068860_100125619	3300005843	Bacteria	2458
484	Ga0068860_100214297	3300005843	Bacteria	1868
485	Ga0068860_100234051	3300005843	Bacteria	1785
486	Ga0068860_100416200	3300005843	Bacteria	1332
487	Ga0068860_100426403	3300005843	Bacteria	1315
488	Ga0068860_100920792	3300005843	Bacteria	891
489	Ga0068860_101792759	3300005843	Bacteria	635
490	Ga0068860_102349024	3300005843	Bacteria	553
491	Ga0068860_102723119	3300005843	Bacteria	513
492	Ga0068862_100009442	3300005844	Bacteria	8069
493	Ga0068862_100103723	3300005844	Bacteria	2490
494	Ga0068862_100471684	3300005844	Bacteria	1186
495	Ga0068862_100722741	3300005844	Bacteria	966
496	Ga0068862_100898406	3300005844	Bacteria	871
497	Ga0068862_101560070	3300005844	Bacteria	667
498	Ga0081455_10199133	3300005937	Bacteria	1501
499	Ga0081540_1248794	3300005983	Bacteria	621
500	Ga0075365_10024190	3300006038	Bacteria	3827
501	Ga0075365_10100810	3300006038	Bacteria	1977
502	Ga0075365_10318739	3300006038	Bacteria	1095
503	Ga0075365_10467937	3300006038	Bacteria	890
504	Ga0075368_10003054	3300006042	Bacteria	5542
505	Ga0075368_10027934	3300006042	Bacteria	2178
506	Ga0075368_10058905	3300006042	Bacteria	1536
507	Ga0075368_10073997	3300006042	Bacteria	1379
508	Ga0075363_100000856	3300006048	Bacteria	10631
509	Ga0075363_100005889	3300006048	Bacteria	5519
510	Ga0075363_100049841	3300006048	Bacteria	2230
511	Ga0075363_100093099	3300006048	Bacteria	1661
512	Ga0075363_100128935	3300006048	Bacteria	1418
513	Ga0075363_100179022	3300006048	Bacteria	1206
514	Ga0075363_100281906	3300006048	Bacteria	962
515	Ga0075363_100297870	3300006048	Bacteria	935
516	Ga0075363_100666391	3300006048	Bacteria	627
517	Ga0075364_10015296	3300006051	Bacteria	4757
518	Ga0075364_10032491	3300006051	Bacteria	3355
519	Ga0075364_10218269	3300006051	Bacteria	1294
520	Ga0075364_10343775	3300006051	Bacteria	1017
521	Ga0075364_10971241	3300006051	Bacteria	578
522	Ga0075364_11203213	3300006051	Bacteria	514
523	Ga0070715_10079026	3300006163	Bacteria	1489
524	Ga0070716_100069303	3300006173	Bacteria	2066
525	Ga0070716_101316293	3300006173	Bacteria	584
526	Ga0075362_10000222	3300006177	Bacteria	15765
527	Ga0075362_10010792	3300006177	Bacteria	3579
528	Ga0075362_10042495	3300006177	Bacteria	2009
529	Ga0075362_10085974	3300006177	Bacteria	1455
530	Ga0075362_10099943	3300006177	Bacteria	1355
531	Ga0075362_10168463	3300006177	Bacteria	1057
532	Ga0075362_10194303	3300006177	Bacteria	986
533	Ga0075362_10427422	3300006177	Bacteria	671
534	Ga0075362_10618676	3300006177	Bacteria	561
535	Ga0075367_10000855	3300006178	Bacteria	12145
536	Ga0075367_10001881	3300006178	Bacteria	9288
537	Ga0075367_10006379	3300006178	Bacteria	5953
538	Ga0075367_10010768	3300006178	Bacteria	4815
539	Ga0075367_10092185	3300006178	Bacteria	1844
540	Ga0075367_10129646	3300006178	Bacteria	1558
541	Ga0075367_10705296	3300006178	Bacteria	642
542	Ga0075367_10970059	3300006178	Bacteria	542
543	Ga0075369_10003827	3300006186	Bacteria	5518
544	Ga0075369_10005325	3300006186	Bacteria	4797
545	Ga0075369_10072235	3300006186	Bacteria	1520
546	Ga0075369_10110152	3300006186	Bacteria	1241
547	Ga0075369_10244703	3300006186	Bacteria	832
548	Ga0075369_10435859	3300006186	Bacteria	620
549	Ga0075369_10500016	3300006186	Bacteria	578
550	Ga0075366_10000795	3300006195	Bacteria	15124
551	Ga0075366_10016473	3300006195	Bacteria	4249
552	Ga0075366_10018148	3300006195	Bacteria	4062
553	Ga0075366_10029562	3300006195	Bacteria	3219
554	Ga0075366_10032832	3300006195	Bacteria	3056
555	Ga0075366_10033848	3300006195	Bacteria	3011
556	Ga0075366_10054228	3300006195	Bacteria	2381
557	Ga0075366_10058278	3300006195	Bacteria	2294
558	Ga0075366_10077134	3300006195	Bacteria	1989
559	Ga0075366_10102009	3300006195	Bacteria	1722
560	Ga0075366_10111379	3300006195	Bacteria	1646
561	Ga0075366_10151709	3300006195	Bacteria	1403
562	Ga0075366_10166789	3300006195	Bacteria	1335
563	Ga0075366_10173544	3300006195	Bacteria	1308
564	Ga0075366_10184543	3300006195	Bacteria	1267
565	Ga0075366_10204160	3300006195	Bacteria	1202
566	Ga0075366_10263345	3300006195	Bacteria	1052
567	Ga0075366_10283035	3300006195	Bacteria	1013
568	Ga0075366_10287953	3300006195	Bacteria	1004
569	Ga0075366_10364650	3300006195	Bacteria	887
570	Ga0075366_10431366	3300006195	Bacteria	812
571	Ga0075366_10813125	3300006195	Bacteria	581
572	Ga0075366_10908584	3300006195	Bacteria	548
573	Ga0075366_11042664	3300006195	Bacteria	510
574	Ga0075366_11042999	3300006195	Bacteria	510
575	Ga0075366_11063075	3300006195	Bacteria	505
576	Ga0097621_100047739	3300006237	Bacteria	3470
577	Ga0097621_100053861	3300006237	Bacteria	3279
578	Ga0097621_100115517	3300006237	Bacteria	2272
579	Ga0097621_100490595	3300006237	Bacteria	1111
580	Ga0097621_100662626	3300006237	Bacteria	958
581	Ga0097621_100897118	3300006237	Bacteria	825
582	Ga0097621_101646944	3300006237	Bacteria	610
583	Ga0075370_10000073	3300006353	Bacteria	30960
584	Ga0075370_10000701	3300006353	Bacteria	13221
585	Ga0075370_10001150	3300006353	Bacteria	11110
586	Ga0075370_10002824	3300006353	Bacteria	8149
587	Ga0075370_10017546	3300006353	Bacteria	3869
588	Ga0075370_10040903	3300006353	Bacteria	2616
589	Ga0075370_10064344	3300006353	Bacteria	2091
590	Ga0075370_10133093	3300006353	Bacteria	1451
591	Ga0075370_10135320	3300006353	Bacteria	1439
592	Ga0075370_10212361	3300006353	Bacteria	1143
593	Ga0075370_10411843	3300006353	Bacteria	811
594	Ga0075370_10542980	3300006353	Bacteria	703
595	Ga0075370_10652636	3300006353	Bacteria	639
596	Ga0068871_100038460	3300006358	Bacteria	3822
597	Ga0068871_100126623	3300006358	Bacteria	2162
598	Ga0068871_100138158	3300006358	Bacteria	2071
599	Ga0068871_100221491	3300006358	Bacteria	1639
600	Ga0068871_100336354	3300006358	Bacteria	1332
601	Ga0068871_100519577	3300006358	Bacteria	1075
602	Ga0068871_100540442	3300006358	Bacteria	1054
603	Ga0068871_100962100	3300006358	Bacteria	794
604	Ga0068871_101221282	3300006358	Bacteria	705
605	Ga0068871_101285712	3300006358	Bacteria	688
606	Ga0068871_101321209	3300006358	Bacteria	678
607	Ga0075428_102483602	3300006844	Bacteria	531
608	Ga0075430_100233239	3300006846	Bacteria	1526
609	Ga0075430_101442341	3300006846	Bacteria	566
610	Ga0075433_11726003	3300006852	Bacteria	539
611	Ga0075434_100344295	3300006871	Bacteria	1512
612	Ga0075434_100855539	3300006871	Bacteria	925
613	Ga0075434_102374035	3300006871	Bacteria	533
614	Ga0075429_100034628	3300006880	Bacteria	4388
615	Ga0068865_100004060	3300006881	Bacteria	8794
616	Ga0068865_100504266	3300006881	Bacteria	1009
617	Ga0068865_100647903	3300006881	Bacteria	897
618	Ga0068865_100776876	3300006881	Bacteria	825
619	Ga0068865_100847449	3300006881	Bacteria	792
620	Ga0068865_101177967	3300006881	Bacteria	677
621	Ga0068865_101321748	3300006881	Bacteria	641
622	Ga0068865_101689450	3300006881	Bacteria	570
623	Ga0068865_102008339	3300006881	Bacteria	525
624	Ga0097620_100364841	3300006931	Bacteria	1539
625	Ga0097620_100436581	3300006931	Bacteria	1405
626	Ga0097620_100595835	3300006931	Bacteria	1198
627	Ga0097620_101027326	3300006931	Bacteria	906
628	Ga0099824_1036695	3300006942	Bacteria	1406
629	Ga0099823_1000064	3300006944	Bacteria	50328
630	Ga0079104_1000053	3300006946	Bacteria	168604
631	Ga0075435_100564903	3300007076	Bacteria	986
632	Ga0105244_10252256	3300009036	Bacteria	822
633	Ga0105244_10568272	3300009036	Bacteria	521
634	Ga0105240_10005705	3300009093	Bacteria	18471
635	Ga0105240_10018079	3300009093	Bacteria	9478
636	Ga0105240_10144746	3300009093	Bacteria	2837
637	Ga0105240_10612533	3300009093	Bacteria	1198
638	Ga0105240_10627271	3300009093	Bacteria	1181
639	Ga0105240_10639362	3300009093	Bacteria	1167
640	Ga0105240_12020245	3300009093	Bacteria	599
641	Ga0111539_10313271	3300009094	Bacteria	1827
642	Ga0111539_11374449	3300009094	Bacteria	819
643	Ga0111539_11795082	3300009094	Bacteria	711
644	Ga0111539_12258942	3300009094	Bacteria	631
645	Ga0111539_13012132	3300009094	Bacteria	544
646	Ga0105245_10048884	3300009098	Bacteria	3785
647	Ga0105245_10060455	3300009098	Bacteria	3412
648	Ga0105245_10900978	3300009098	Bacteria	926
649	Ga0105245_10944794	3300009098	Bacteria	905
650	Ga0105245_11000833	3300009098	Bacteria	880
651	Ga0105245_11331110	3300009098	Bacteria	767
652	Ga0105245_12323264	3300009098	Bacteria	590
653	Ga0105245_13216584	3300009098	Bacteria	506
654	Ga0105247_10117961	3300009101	Bacteria	1716
655	Ga0105247_10250972	3300009101	Bacteria	1209
656	Ga0105247_10692669	3300009101	Bacteria	766
657	Ga0105247_11836511	3300009101	Bacteria	505
658	Ga0114129_10176739	3300009147	Bacteria	2908
659	Ga0114129_13282350	3300009147	Bacteria	524
660	Ga0105243_10001789	3300009148	Bacteria	18454
661	Ga0105243_10030050	3300009148	Bacteria	4181
662	Ga0105243_10177569	3300009148	Bacteria	1849
663	Ga0105243_10252607	3300009148	Bacteria	1575
664	Ga0105243_10310359	3300009148	Bacteria	1433
665	Ga0105243_10387979	3300009148	Bacteria	1294
666	Ga0105243_10470046	3300009148	Bacteria	1184
667	Ga0105243_11009547	3300009148	Bacteria	835
668	Ga0105243_11676343	3300009148	Bacteria	664
669	Ga0105243_13051704	3300009148	Bacteria	507
670	Ga0105241_10030533	3300009174	Bacteria	4029
671	Ga0105241_10065600	3300009174	Bacteria	2805
672	Ga0105241_10082907	3300009174	Bacteria	2514
673	Ga0105241_10534512	3300009174	Bacteria	1050
674	Ga0105241_10839128	3300009174	Bacteria	849
675	Ga0105242_10059064	3300009176	Bacteria	3146
676	Ga0105242_10542677	3300009176	Bacteria	1113
677	Ga0105242_11045283	3300009176	Bacteria	827
678	Ga0105242_11641983	3300009176	Bacteria	677
679	Ga0105248_10006768	3300009177	Bacteria	12569
680	Ga0105248_10028458	3300009177	Bacteria	6225
681	Ga0105248_10243333	3300009177	Bacteria	2025
682	Ga0105248_10325115	3300009177	Bacteria	1732
683	Ga0105248_10479812	3300009177	Bacteria	1401
684	Ga0105248_10511830	3300009177	Bacteria	1353
685	Ga0105248_10551810	3300009177	Bacteria	1300
686	Ga0105248_11331292	3300009177	Bacteria	812
687	Ga0105248_11711655	3300009177	Bacteria	713
688	Ga0105248_11999458	3300009177	Bacteria	658
689	Ga0105248_12308621	3300009177	Bacteria	612
690	Ga0105237_10000668	3300009545	Bacteria	47303
691	Ga0105237_10020609	3300009545	Bacteria	6794
692	Ga0105237_10169697	3300009545	Bacteria	2181
693	Ga0105237_10258441	3300009545	Bacteria	1744
694	Ga0105237_10866946	3300009545	Bacteria	910
695	Ga0105237_11967203	3300009545	Bacteria	593
696	Ga0105237_12543999	3300009545	Bacteria	522
697	Ga0105238_10003926	3300009551	Bacteria	14752
698	Ga0105238_10064333	3300009551	Bacteria	3668
699	Ga0105238_10088675	3300009551	Bacteria	3080
700	Ga0105238_10307837	3300009551	Bacteria	1569
701	Ga0105238_10467421	3300009551	Bacteria	1260
702	Ga0105238_10690775	3300009551	Bacteria	1032
703	Ga0105238_11045173	3300009551	Bacteria	838
704	Ga0105238_11484067	3300009551	Bacteria	706
705	Ga0105238_11787368	3300009551	Bacteria	647
706	Ga0105238_11807402	3300009551	Bacteria	643
707	Ga0105238_12027663	3300009551	Bacteria	609
708	Ga0105238_12112766	3300009551	Bacteria	597
709	Ga0105238_12440779	3300009551	Bacteria	558
710	Ga0105249_10068515	3300009553	Bacteria	3273
711	Ga0105249_10081210	3300009553	Bacteria	3013
712	Ga0105249_10311041	3300009553	Bacteria	1584
713	Ga0105249_10528771	3300009553	Bacteria	1228
714	Ga0105249_11451314	3300009553	Bacteria	758
715	Ga0105249_11515538	3300009553	Bacteria	743
716	Ga0105249_11895210	3300009553	Bacteria	669
717	Ga0105249_11928090	3300009553	Bacteria	663
718	Ga0099796_10553984	3300010159	Bacteria	517
719	Ga0105239_10001255	3300010375	Bacteria	34466
720	Ga0105239_10036283	3300010375	Bacteria	5413
721	Ga0105239_10264477	3300010375	Bacteria	1934
722	Ga0105239_10390181	3300010375	Bacteria	1575
723	Ga0105239_11220126	3300010375	Bacteria	867
724	Ga0105239_11872272	3300010375	Bacteria	696
725	Ga0105246_10060033	3300011119	Bacteria	2641
726	Ga0105246_10452402	3300011119	Bacteria	1079
727	Ga0105246_11064451	3300011119	Bacteria	736
728	Ga0105246_11326203	3300011119	Bacteria	668
729	Ga0157344_1012848	3300012476	Bacteria	634
730	Ga0157328_1000557	3300012478	Bacteria	1382
731	Ga0157341_1001034	3300012494	Bacteria	1580
732	Ga0157323_1007960	3300012495	Bacteria	778
733	Ga0157319_1000005	3300012497	Bacteria	372810
734	Ga0157314_1019229	3300012500	Bacteria	681
735	Ga0157313_1032423	3300012503	Bacteria	601
736	Ga0157327_1001789	3300012512	Bacteria	1398
737	Ga0157338_1016880	3300012515	Bacteria	811
738	Ga0157373_10040286	3300013100	Bacteria	3343
739	Ga0157373_10230096	3300013100	Bacteria	1309
740	Ga0157373_10361352	3300013100	Bacteria	1036
741	Ga0157371_10130902	3300013102	Bacteria	1785
742	Ga0157371_10172453	3300013102	Bacteria	1546
743	Ga0157370_10487010	3300013104	Bacteria	1133
744	Ga0157370_11427868	3300013104	Bacteria	623
745	Ga0157370_11728309	3300013104	Bacteria	562
746	Ga0157370_11801123	3300013104	Bacteria	549
747	Ga0157370_11959170	3300013104	Bacteria	525
748	Ga0157369_10115967	3300013105	Bacteria	2844
749	Ga0157369_10958666	3300013105	Bacteria	876
750	Ga0157369_11170315	3300013105	Bacteria	785
751	Ga0157369_11681796	3300013105	Bacteria	645
752	Ga0157374_10009298	3300013296	Bacteria	8429
753	Ga0157374_10093529	3300013296	Bacteria	2871
754	Ga0157374_10123485	3300013296	Bacteria	2501
755	Ga0157374_10156204	3300013296	Bacteria	2220
756	Ga0157374_10440133	3300013296	Bacteria	1304
757	Ga0157374_10768397	3300013296	Bacteria	979
758	Ga0157374_12114567	3300013296	Bacteria	590
759	Ga0157374_12129297	3300013296	Bacteria	588
760	Ga0157374_12543425	3300013296	Bacteria	539
761	Ga0157378_10008661	3300013297	Bacteria	8856
762	Ga0157378_10029129	3300013297	Bacteria	4874
763	Ga0157378_10058938	3300013297	Bacteria	3425
764	Ga0157378_10248653	3300013297	Bacteria	1701
765	Ga0157378_10357706	3300013297	Bacteria	1428
766	Ga0157378_10415609	3300013297	Bacteria	1328
767	Ga0157378_10435035	3300013297	Bacteria	1299
768	Ga0157378_10654939	3300013297	Bacteria	1066
769	Ga0157378_11021783	3300013297	Bacteria	862
770	Ga0157378_11176376	3300013297	Bacteria	806
771	Ga0157378_11849073	3300013297	Bacteria	652
772	Ga0163162_10004148	3300013306	Bacteria	13915
773	Ga0163162_10211873	3300013306	Bacteria	2067
774	Ga0163162_10241802	3300013306	Bacteria	1936
775	Ga0163162_10498220	3300013306	Bacteria	1349
776	Ga0163162_10505539	3300013306	Bacteria	1339
777	Ga0163162_10991743	3300013306	Bacteria	949
778	Ga0163162_11002589	3300013306	Bacteria	944
779	Ga0163162_12032354	3300013306	Bacteria	659
780	Ga0163162_12171667	3300013306	Bacteria	637
781	Ga0163162_12244874	3300013306	Bacteria	627
782	Ga0163162_12492445	3300013306	Bacteria	595
783	Ga0157372_10672052	3300013307	Bacteria	1206
784	Ga0157372_10979869	3300013307	Bacteria	980
785	Ga0157372_11410482	3300013307	Bacteria	803
786	Ga0157372_12030833	3300013307	Bacteria	661
787	Ga0157372_12711760	3300013307	Bacteria	568
788	Ga0157372_12868046	3300013307	Bacteria	552
789	Ga0157375_10041626	3300013308	Bacteria	4438
790	Ga0157375_10137647	3300013308	Bacteria	2567
791	Ga0157375_10151438	3300013308	Bacteria	2455
792	Ga0157375_10240286	3300013308	Bacteria	1971
793	Ga0157375_10367744	3300013308	Bacteria	1604
794	Ga0157375_10408421	3300013308	Bacteria	1524
795	Ga0157375_10529688	3300013308	Bacteria	1341
796	Ga0157375_10864564	3300013308	Bacteria	1050
797	Ga0157375_11014364	3300013308	Bacteria	969
798	Ga0157375_11372402	3300013308	Bacteria	832
799	Ga0157375_11631378	3300013308	Bacteria	763
800	Ga0157375_13478607	3300013308	Bacteria	524
801	Ga0163163_10510669	3300014325	Bacteria	1264
802	Ga0163163_10652447	3300014325	Bacteria	1116
803	Ga0163163_10710033	3300014325	Bacteria	1069
804	Ga0163163_11116834	3300014325	Bacteria	851
805	Ga0163163_11376690	3300014325	Bacteria	767
806	Ga0163163_11645912	3300014325	Bacteria	703
807	Ga0163163_12086389	3300014325	Bacteria	626
808	Ga0157380_10297447	3300014326	Bacteria	1485
809	Ga0157380_10349999	3300014326	Bacteria	1382
810	Ga0157380_10534216	3300014326	Bacteria	1147
811	Ga0157380_10608248	3300014326	Bacteria	1083
812	Ga0157380_11132351	3300014326	Bacteria	823
813	Ga0157380_11686701	3300014326	Bacteria	691
814	Ga0157380_12596357	3300014326	Bacteria	573
815	Ga0157380_12601282	3300014326	Bacteria	572
816	Ga0182008_10320166	3300014497	Bacteria	816
817	Ga0182008_10404115	3300014497	Bacteria	734
818	Ga0182008_10573497	3300014497	Bacteria	630
819	Ga0182008_10578449	3300014497	Bacteria	627
820	Ga0182008_10868350	3300014497	Bacteria	529
821	Ga0157377_10000368	3300014745	Bacteria	20109
822	Ga0157377_10115937	3300014745	Bacteria	1617
823	Ga0157377_10578524	3300014745	Bacteria	798
824	Ga0157379_10040412	3300014968	Bacteria	4162
825	Ga0157379_10061342	3300014968	Bacteria	3362
826	Ga0157379_10090060	3300014968	Bacteria	2752
827	Ga0157379_10111640	3300014968	Bacteria	2456
828	Ga0157379_10144632	3300014968	Bacteria	2144
829	Ga0157379_10251368	3300014968	Bacteria	1605
830	Ga0157379_10448165	3300014968	Bacteria	1191
831	Ga0157379_10473148	3300014968	Bacteria	1159
832	Ga0157379_10746074	3300014968	Bacteria	921
833	Ga0157379_11782467	3300014968	Bacteria	604
834	Ga0157376_10085443	3300014969	Bacteria	2719
835	Ga0157376_10090219	3300014969	Bacteria	2652
836	Ga0157376_10108103	3300014969	Bacteria	2443
837	Ga0157376_10158282	3300014969	Bacteria	2050
838	Ga0157376_10603077	3300014969	Bacteria	1093
839	Ga0157376_10688965	3300014969	Bacteria	1026
840	Ga0157376_10741967	3300014969	Bacteria	990
841	Ga0157376_10806919	3300014969	Bacteria	951
842	Ga0157376_10828945	3300014969	Bacteria	939
843	Ga0157376_10840073	3300014969	Bacteria	933
844	Ga0157376_11373125	3300014969	Bacteria	738
845	Ga0157376_12510272	3300014969	Bacteria	555
846	Ga0182006_1167435	3300015261	Bacteria	738
847	Ga0182006_1204682	3300015261	Bacteria	653
848	Ga0182007_10022997	3300015262	Bacteria	2195
849	Ga0182007_10061846	3300015262	Bacteria	1228
850	Ga0182007_10113966	3300015262	Bacteria	901
851	Ga0182007_10153902	3300015262	Bacteria	783
852	Ga0182007_10362989	3300015262	Bacteria	546
853	Ga0182005_1046685	3300015265	Bacteria	1177
854	Ga0163161_10009049	3300017792	Bacteria	6888
855	Ga0163161_10021239	3300017792	Bacteria	4564
856	Ga0163161_10057420	3300017792	Bacteria	2828
857	Ga0163161_10118069	3300017792	Bacteria	1990
858	Ga0163161_10562961	3300017792	Bacteria	935
859	Ga0163161_10585901	3300017792	Bacteria	918
860	Ga0163161_10876203	3300017792	Bacteria	759
861	Ga0163161_11353220	3300017792	Bacteria	620
862	Ga0206355_1548870	3300020076	Bacteria	1356
863	Ga0206352_10809616	3300020078	Bacteria	1442
864	Ga0206352_10942070	3300020078	Bacteria	714
865	Ga0206352_11007505	3300020078	Bacteria	3567
866	Ga0206352_11327706	3300020078	Bacteria	1855
867	Ga0213872_10000091	3300021361	Bacteria	83723
868	Ga0213872_10002765	3300021361	Bacteria	10055
869	Ga0213872_10004732	3300021361	Bacteria	7137
870	Ga0213872_10030149	3300021361	Bacteria	2487
871	Ga0213872_10333916	3300021361	Bacteria	624
872	Ga0213874_10133739	3300021377	Bacteria	854
873	Ga0213876_10306347	3300021384	Bacteria	844
874	Ga0256744_118233	3300023309	Bacteria	729
875	Ga0209674_100067	3300025226	Bacteria	253824
876	Ga0209674_108626	3300025226	Bacteria	1195
877	Ga0207638_1002117	3300025227	Bacteria	725
878	Ga0209563_100068	3300025230	Bacteria	254802
879	Ga0209563_100088	3300025230	Bacteria	175375
880	Ga0207427_100260	3300025231	Bacteria	41435
881	Ga0209258_102113	3300025242	Bacteria	5574
882	Ga0209258_105352	3300025242	Bacteria	2202
883	Ga0207425_1000680	3300025245	Bacteria	18554
884	Ga0209646_1000127	3300025246	Bacteria	131920
885	Ga0209026_1000004	3300025250	Bacteria	949012
886	Ga0209026_1062573	3300025250	Bacteria	522
887	Ga0209677_100201	3300025253	Bacteria	47899
888	Ga0209677_107757	3300025253	Bacteria	2205
889	Ga0209148_1002904	3300025254	Bacteria	5228
890	Ga0209759_1000129	3300025256	Bacteria	131961
891	Ga0209759_1003759	3300025256	Bacteria	5926
892	Ga0209759_1020002	3300025256	Bacteria	1568
893	Ga0209129_1000158	3300025258	Bacteria	103711
894	Ga0209565_1026953	3300025263	Bacteria	1147
895	Ga0209565_1080733	3300025263	Bacteria	536
896	Ga0209455_1000083	3300025272	Bacteria	255660
897	Ga0209673_1004093	3300025273	Bacteria	8026
898	Ga0209673_1026632	3300025273	Bacteria	1894
899	Ga0209673_1044208	3300025273	Bacteria	1236
900	Ga0209673_1057800	3300025273	Bacteria	986
901	Ga0209564_1000008	3300025295	Bacteria	953227
902	Ga0209564_1000282	3300025295	Bacteria	103837
903	Ga0209758_1000910	3300025297	Bacteria	40059
904	Ga0209758_1011080	3300025297	Bacteria	5275
905	Ga0209050_1000223	3300025298	Bacteria	125465
906	Ga0209050_1001097	3300025298	Bacteria	32856
907	Ga0209050_1004273	3300025298	Bacteria	9808
908	Ga0209050_1013102	3300025298	Bacteria	3724
909	Ga0209256_1000045	3300025299	Bacteria	325506
910	Ga0209256_1008928	3300025299	Bacteria	4516
911	Ga0209256_1009680	3300025299	Bacteria	4174
912	Ga0209051_1000004	3300025303	Bacteria	1155596
913	Ga0209051_1000938	3300025303	Bacteria	28786
914	Ga0209051_1005321	3300025303	Bacteria	7574
915	Ga0209051_1017941	3300025303	Bacteria	3149
916	Ga0209051_1018074	3300025303	Bacteria	3132
917	Ga0209051_1047179	3300025303	Bacteria	1474
918	Ga0209257_1000047	3300025304	Bacteria	460507
919	Ga0209257_1000315	3300025304	Bacteria	102293
920	Ga0209257_1019529	3300025304	Bacteria	2547
921	Ga0209257_1032769	3300025304	Bacteria	1643
922	Ga0207697_10011122	3300025315	Bacteria	3814
923	Ga0207697_10029574	3300025315	Bacteria	2242
924	Ga0207697_10084711	3300025315	Bacteria	1338
925	Ga0207656_10100216	3300025321	Bacteria	1327
926	Ga0207656_10394243	3300025321	Bacteria	695
927	Ga0207682_10002147	3300025893	Bacteria	8941
928	Ga0207682_10017992	3300025893	Bacteria	2759
929	Ga0207682_10021887	3300025893	Bacteria	2516
930	Ga0207682_10053083	3300025893	Bacteria	1680
931	Ga0207682_10337874	3300025893	Bacteria	709
932	Ga0207682_10404696	3300025893	Bacteria	645
933	Ga0207642_10017753	3300025899	Bacteria	2714
934	Ga0207642_10108364	3300025899	Bacteria	1409
935	Ga0207710_10248771	3300025900	Bacteria	888
936	Ga0207710_10276773	3300025900	Bacteria	844
937	Ga0207710_10306473	3300025900	Bacteria	803
938	Ga0207688_10063302	3300025901	Bacteria	2086
939	Ga0207688_10077775	3300025901	Bacteria	1891
940	Ga0207688_10231679	3300025901	Bacteria	1115
941	Ga0207680_10014229	3300025903	Bacteria	4110
942	Ga0207680_10692830	3300025903	Bacteria	730
943	Ga0207680_10846716	3300025903	Bacteria	656
944	Ga0207680_11161279	3300025903	Bacteria	551
945	Ga0207647_10074272	3300025904	Bacteria	2048
946	Ga0207647_10636418	3300025904	Bacteria	586
947	Ga0207685_10051930	3300025905	Bacteria	1586
948	Ga0207645_10009972	3300025907	Bacteria	6544
949	Ga0207645_10012543	3300025907	Bacteria	5748
950	Ga0207645_10047232	3300025907	Bacteria	2749
951	Ga0207645_10048474	3300025907	Bacteria	2713
952	Ga0207645_10086402	3300025907	Bacteria	2015
953	Ga0207645_10160739	3300025907	Bacteria	1469
954	Ga0207645_10704250	3300025907	Bacteria	686
955	Ga0207643_10073671	3300025908	Bacteria	1969
956	Ga0207643_10337448	3300025908	Bacteria	944
957	Ga0207643_10798113	3300025908	Bacteria	612
958	Ga0207643_10822516	3300025908	Bacteria	602
959	Ga0207705_10053354	3300025909	Bacteria	2912
960	Ga0207705_10212248	3300025909	Bacteria	1468
961	Ga0207705_10254337	3300025909	Bacteria	1340
962	Ga0207705_10282492	3300025909	Bacteria	1271
963	Ga0207705_10288409	3300025909	Bacteria	1257
964	Ga0207705_10624745	3300025909	Bacteria	838
965	Ga0207705_11187465	3300025909	Bacteria	586
966	Ga0207705_11405675	3300025909	Bacteria	530
967	Ga0207684_10009766	3300025910	Bacteria	8465
968	Ga0207684_10370574	3300025910	Bacteria	1232
969	Ga0207684_11376934	3300025910	Bacteria	578
970	Ga0207684_11602246	3300025910	Bacteria	527
971	Ga0207654_10006606	3300025911	Bacteria	5831
972	Ga0207654_10053598	3300025911	Bacteria	2329
973	Ga0207654_10442697	3300025911	Bacteria	910
974	Ga0207707_10164577	3300025912	Bacteria	1938
975	Ga0207707_10349403	3300025912	Bacteria	1274
976	Ga0207695_10010589	3300025913	Bacteria	11272
977	Ga0207695_10103337	3300025913	Bacteria	2841
978	Ga0207695_10190969	3300025913	Bacteria	1966
979	Ga0207695_10203110	3300025913	Bacteria	1895
980	Ga0207695_10497489	3300025913	Bacteria	1101
981	Ga0207695_11591238	3300025913	Bacteria	534
982	Ga0207671_10019707	3300025914	Bacteria	5152
983	Ga0207671_10047329	3300025914	Bacteria	3183
984	Ga0207671_10269801	3300025914	Bacteria	1340
985	Ga0207671_10369602	3300025914	Bacteria	1139
986	Ga0207671_10992252	3300025914	Bacteria	662
987	Ga0207671_11302842	3300025914	Bacteria	566
988	Ga0207660_10046145	3300025917	Bacteria	3073
989	Ga0207660_10242517	3300025917	Bacteria	1420
990	Ga0207662_10013351	3300025918	Bacteria	4592
991	Ga0207662_10034330	3300025918	Bacteria	2960
992	Ga0207662_10097784	3300025918	Bacteria	1815
993	Ga0207657_10092024	3300025919	Bacteria	2528
994	Ga0207657_10092779	3300025919	Bacteria	2516
995	Ga0207657_10152752	3300025919	Bacteria	1879
996	Ga0207657_10306290	3300025919	Bacteria	1258
997	Ga0207657_10476166	3300025919	Bacteria	979
998	Ga0207657_10551907	3300025919	Bacteria	901
999	Ga0207657_10738660	3300025919	Bacteria	763
1000	Ga0207657_10908135	3300025919	Bacteria	678
1001	Ga0207657_11003436	3300025919	Bacteria	640
1002	Ga0207649_10001794	3300025920	Bacteria	12285
1003	Ga0207649_10004699	3300025920	Bacteria	7389
1004	Ga0207649_10137933	3300025920	Bacteria	1665
1005	Ga0207649_10299985	3300025920	Bacteria	1174
1006	Ga0207649_10464728	3300025920	Bacteria	957
1007	Ga0207649_10639342	3300025920	Bacteria	821
1008	Ga0207649_11426757	3300025920	Bacteria	548
1009	Ga0207652_10002940	3300025921	Bacteria	14249
1010	Ga0207652_10141879	3300025921	Bacteria	2148
1011	Ga0207652_10449822	3300025921	Bacteria	1161
1012	Ga0207652_10727264	3300025921	Bacteria	884
1013	Ga0207646_10141845	3300025922	Bacteria	2164
1014	Ga0207646_10824394	3300025922	Bacteria	825
1015	Ga0207681_10005925	3300025923	Bacteria	7494
1016	Ga0207681_10021332	3300025923	Bacteria	4116
1017	Ga0207681_10083993	3300025923	Bacteria	2255
1018	Ga0207681_10222358	3300025923	Bacteria	1461
1019	Ga0207681_10635262	3300025923	Bacteria	884
1020	Ga0207681_11270753	3300025923	Bacteria	618
1021	Ga0207694_10004619	3300025924	Bacteria	10727
1022	Ga0207694_10026084	3300025924	Bacteria	4443
1023	Ga0207694_10034844	3300025924	Bacteria	3861
1024	Ga0207694_10452972	3300025924	Bacteria	1071
1025	Ga0207694_10792963	3300025924	Bacteria	800
1026	Ga0207694_10806327	3300025924	Bacteria	793
1027	Ga0207694_11346614	3300025924	Bacteria	604
1028	Ga0207694_11699401	3300025924	Bacteria	531
1029	Ga0207694_11835087	3300025924	Bacteria	509
1030	Ga0207650_10002454	3300025925	Bacteria	12900
1031	Ga0207650_10022053	3300025925	Bacteria	4507
1032	Ga0207650_10043623	3300025925	Bacteria	3293
1033	Ga0207650_10242099	3300025925	Bacteria	1458
1034	Ga0207650_10969841	3300025925	Bacteria	723
1035	Ga0207650_11251871	3300025925	Bacteria	632
1036	Ga0207650_11634927	3300025925	Bacteria	546
1037	Ga0207659_10003025	3300025926	Bacteria	10030
1038	Ga0207659_10013941	3300025926	Bacteria	5170
1039	Ga0207659_10056531	3300025926	Bacteria	2811
1040	Ga0207659_10072814	3300025926	Bacteria	2513
1041	Ga0207659_10142255	3300025926	Bacteria	1863
1042	Ga0207659_11001934	3300025926	Bacteria	719
1043	Ga0207659_11237580	3300025926	Bacteria	641
1044	Ga0207659_11764415	3300025926	Bacteria	526
1045	Ga0207687_10024918	3300025927	Bacteria	4001
1046	Ga0207687_10042371	3300025927	Bacteria	3131
1047	Ga0207687_10108511	3300025927	Bacteria	2055
1048	Ga0207644_10015416	3300025931	Bacteria	5129
1049	Ga0207644_10023313	3300025931	Bacteria	4238
1050	Ga0207644_10024978	3300025931	Bacteria	4105
1051	Ga0207644_10027492	3300025931	Bacteria	3929
1052	Ga0207644_10151897	3300025931	Bacteria	1792
1053	Ga0207644_10191672	3300025931	Bacteria	1607
1054	Ga0207644_10288580	3300025931	Bacteria	1319
1055	Ga0207644_10318792	3300025931	Bacteria	1256
1056	Ga0207644_10344784	3300025931	Bacteria	1208
1057	Ga0207644_10696345	3300025931	Bacteria	847
1058	Ga0207644_10814283	3300025931	Bacteria	781
1059	Ga0207644_11061129	3300025931	Bacteria	680
1060	Ga0207644_11271417	3300025931	Bacteria	618
1061	Ga0207644_11417438	3300025931	Bacteria	583
1062	Ga0207644_11595258	3300025931	Bacteria	547
1063	Ga0207690_10001731	3300025932	Bacteria	13411
1064	Ga0207690_10039856	3300025932	Bacteria	3067
1065	Ga0207690_10056794	3300025932	Bacteria	2642
1066	Ga0207690_10314401	3300025932	Bacteria	1229
1067	Ga0207690_10520575	3300025932	Bacteria	964
1068	Ga0207690_10539035	3300025932	Bacteria	948
1069	Ga0207690_10579998	3300025932	Bacteria	914
1070	Ga0207690_10801697	3300025932	Bacteria	778
1071	Ga0207690_11305636	3300025932	Bacteria	606
1072	Ga0207690_11796972	3300025932	Bacteria	512
1073	Ga0207706_10027642	3300025933	Bacteria	5072
1074	Ga0207706_10079225	3300025933	Bacteria	2889
1075	Ga0207706_10116108	3300025933	Bacteria	2354
1076	Ga0207706_10150050	3300025933	Bacteria	2050
1077	Ga0207706_10517899	3300025933	Bacteria	1028
1078	Ga0207706_10595316	3300025933	Bacteria	950
1079	Ga0207706_10865372	3300025933	Bacteria	765
1080	Ga0207686_10048318	3300025934	Bacteria	2635
1081	Ga0207686_10658155	3300025934	Bacteria	829
1082	Ga0207686_11059907	3300025934	Bacteria	660
1083	Ga0207686_11335114	3300025934	Bacteria	589
1084	Ga0207709_10001005	3300025935	Bacteria	20902
1085	Ga0207709_10020689	3300025935	Bacteria	3715
1086	Ga0207709_10092231	3300025935	Bacteria	1983
1087	Ga0207709_10215526	3300025935	Bacteria	1381
1088	Ga0207709_11152621	3300025935	Bacteria	638
1089	Ga0207709_11215014	3300025935	Bacteria	621
1090	Ga0207709_11328758	3300025935	Bacteria	594
1091	Ga0207709_11479356	3300025935	Bacteria	563
1092	Ga0207709_11816214	3300025935	Bacteria	507
1093	Ga0207670_10104228	3300025936	Bacteria	2031
1094	Ga0207670_10138753	3300025936	Bacteria	1791
1095	Ga0207670_11549017	3300025936	Bacteria	564
1096	Ga0207669_10027395	3300025937	Bacteria	3119
1097	Ga0207669_10115067	3300025937	Bacteria	1812
1098	Ga0207669_10348879	3300025937	Bacteria	1142
1099	Ga0207669_10573633	3300025937	Bacteria	913
1100	Ga0207669_11029438	3300025937	Bacteria	693
1101	Ga0207669_11179989	3300025937	Bacteria	648
1102	Ga0207669_11190551	3300025937	Bacteria	645
1103	Ga0207669_11438737	3300025937	Bacteria	587
1104	Ga0207669_11620198	3300025937	Bacteria	552
1105	Ga0207704_10257180	3300025938	Bacteria	1314
1106	Ga0207704_10325544	3300025938	Bacteria	1187
1107	Ga0207704_10474258	3300025938	Bacteria	1003
1108	Ga0207704_10705453	3300025938	Bacteria	836
1109	Ga0207704_11313184	3300025938	Bacteria	619
1110	Ga0207704_11531492	3300025938	Bacteria	572
1111	Ga0207665_10131977	3300025939	Bacteria	1774
1112	Ga0207691_10002550	3300025940	Bacteria	17799
1113	Ga0207691_10028785	3300025940	Bacteria	5199
1114	Ga0207691_10071477	3300025940	Bacteria	3131
1115	Ga0207691_10102749	3300025940	Bacteria	2549
1116	Ga0207691_10115353	3300025940	Bacteria	2385
1117	Ga0207691_10126451	3300025940	Bacteria	2261
1118	Ga0207691_10184053	3300025940	Bacteria	1824
1119	Ga0207691_10214431	3300025940	Bacteria	1671
1120	Ga0207691_10230836	3300025940	Bacteria	1603
1121	Ga0207691_10737701	3300025940	Bacteria	830
1122	Ga0207691_10988607	3300025940	Bacteria	702
1123	Ga0207711_10023140	3300025941	Bacteria	5200
1124	Ga0207711_10072285	3300025941	Bacteria	2996
1125	Ga0207711_10162953	3300025941	Bacteria	2020
1126	Ga0207711_10471526	3300025941	Bacteria	1169
1127	Ga0207711_10657271	3300025941	Bacteria	978
1128	Ga0207711_10872701	3300025941	Bacteria	837
1129	Ga0207711_11166178	3300025941	Bacteria	712
1130	Ga0207711_11205788	3300025941	Bacteria	698
1131	Ga0207689_10028262	3300025942	Bacteria	4692
1132	Ga0207689_10033146	3300025942	Bacteria	4292
1133	Ga0207689_10038004	3300025942	Bacteria	3989
1134	Ga0207689_10117050	3300025942	Bacteria	2191
1135	Ga0207689_10163368	3300025942	Bacteria	1835
1136	Ga0207689_10684752	3300025942	Bacteria	864
1137	Ga0207689_10931477	3300025942	Bacteria	733
1138	Ga0207661_11559816	3300025944	Bacteria	605
1139	Ga0207661_11799631	3300025944	Bacteria	558
1140	Ga0207679_10001498	3300025945	Bacteria	14638
1141	Ga0207679_10016048	3300025945	Bacteria	4965
1142	Ga0207679_10340068	3300025945	Bacteria	1305
1143	Ga0207679_10348193	3300025945	Bacteria	1291
1144	Ga0207679_10449730	3300025945	Bacteria	1142
1145	Ga0207679_10576344	3300025945	Bacteria	1012
1146	Ga0207679_10612182	3300025945	Bacteria	982
1147	Ga0207667_10100133	3300025949	Bacteria	2989
1148	Ga0207667_10188077	3300025949	Bacteria	2119
1149	Ga0207667_10345820	3300025949	Bacteria	1517
1150	Ga0207667_10360985	3300025949	Bacteria	1481
1151	Ga0207667_10480967	3300025949	Bacteria	1261
1152	Ga0207667_10735784	3300025949	Bacteria	987
1153	Ga0207667_10741266	3300025949	Bacteria	982
1154	Ga0207667_10883618	3300025949	Bacteria	886
1155	Ga0207667_11561165	3300025949	Bacteria	630
1156	Ga0207651_10003333	3300025960	Bacteria	7872
1157	Ga0207651_10004839	3300025960	Bacteria	6859
1158	Ga0207651_10043195	3300025960	Bacteria	3006
1159	Ga0207651_10059456	3300025960	Bacteria	2648
1160	Ga0207651_10063480	3300025960	Bacteria	2579
1161	Ga0207651_10077458	3300025960	Bacteria	2380
1162	Ga0207651_10163749	3300025960	Bacteria	1746
1163	Ga0207651_10274919	3300025960	Bacteria	1389
1164	Ga0207651_11842170	3300025960	Bacteria	544
1165	Ga0207712_10040645	3300025961	Bacteria	3193
1166	Ga0207712_10059578	3300025961	Bacteria	2703
1167	Ga0207712_10063392	3300025961	Bacteria	2632
1168	Ga0207712_10074729	3300025961	Bacteria	2448
1169	Ga0207712_10495669	3300025961	Bacteria	1043
1170	Ga0207712_10578339	3300025961	Bacteria	969
1171	Ga0207712_11639098	3300025961	Bacteria	577
1172	Ga0207668_10008000	3300025972	Bacteria	6291
1173	Ga0207668_10086989	3300025972	Bacteria	2284
1174	Ga0207668_11510267	3300025972	Bacteria	606
1175	Ga0207668_11897022	3300025972	Bacteria	537
1176	Ga0207668_12036217	3300025972	Bacteria	517
1177	Ga0207668_12080298	3300025972	Bacteria	511
1178	Ga0207640_10014813	3300025981	Bacteria	4497
1179	Ga0207640_10031223	3300025981	Bacteria	3289
1180	Ga0207640_10130332	3300025981	Bacteria	1817
1181	Ga0207640_10146361	3300025981	Bacteria	1729
1182	Ga0207640_10584041	3300025981	Bacteria	943
1183	Ga0207640_10842442	3300025981	Bacteria	797
1184	Ga0207640_11088892	3300025981	Bacteria	706
1185	Ga0207640_11139833	3300025981	Bacteria	691
1186	Ga0207658_10002481	3300025986	Bacteria	13444
1187	Ga0207658_10019932	3300025986	Bacteria	4641
1188	Ga0207658_10054939	3300025986	Bacteria	2948
1189	Ga0207658_10140348	3300025986	Bacteria	1954
1190	Ga0207658_10174279	3300025986	Bacteria	1775
1191	Ga0207658_10212718	3300025986	Bacteria	1621
1192	Ga0207658_10253878	3300025986	Bacteria	1495
1193	Ga0207658_10333691	3300025986	Bacteria	1316
1194	Ga0207658_10428908	3300025986	Bacteria	1167
1195	Ga0207658_10756535	3300025986	Bacteria	880
1196	Ga0207658_11180680	3300025986	Bacteria	699
1197	Ga0207677_10007737	3300026023	Bacteria	5965
1198	Ga0207677_10074516	3300026023	Bacteria	2409
1199	Ga0207677_10312532	3300026023	Bacteria	1303
1200	Ga0207677_10694583	3300026023	Bacteria	902
1201	Ga0207677_10979441	3300026023	Bacteria	766
1202	Ga0207677_12267460	3300026023	Bacteria	505
1203	Ga0207703_10027342	3300026035	Bacteria	4492
1204	Ga0207703_10030166	3300026035	Bacteria	4283
1205	Ga0207703_10067259	3300026035	Bacteria	2949
1206	Ga0207703_10139551	3300026035	Bacteria	2102
1207	Ga0207703_10194715	3300026035	Bacteria	1798
1208	Ga0207703_10882867	3300026035	Bacteria	856
1209	Ga0207703_11400290	3300026035	Bacteria	673
1210	Ga0207639_10145450	3300026041	Bacteria	1980
1211	Ga0207639_10204156	3300026041	Bacteria	1697
1212	Ga0207639_10359680	3300026041	Bacteria	1302
1213	Ga0207639_10458426	3300026041	Bacteria	1158
1214	Ga0207639_10460001	3300026041	Bacteria	1157
1215	Ga0207639_11301369	3300026041	Bacteria	682
1216	Ga0207639_11466741	3300026041	Bacteria	640
1217	Ga0207639_12154784	3300026041	Bacteria	519
1218	Ga0207678_10008286	3300026067	Bacteria	9159
1219	Ga0207678_10039587	3300026067	Bacteria	4091
1220	Ga0207678_10090610	3300026067	Bacteria	2613
1221	Ga0207678_10099481	3300026067	Bacteria	2484
1222	Ga0207678_10387740	3300026067	Bacteria	1208
1223	Ga0207678_10798352	3300026067	Bacteria	833
1224	Ga0207708_10168085	3300026075	Bacteria	1735
1225	Ga0207708_10386452	3300026075	Bacteria	1155
1226	Ga0207702_10001875	3300026078	Bacteria	20626
1227	Ga0207702_10004993	3300026078	Bacteria	11656
1228	Ga0207702_10150760	3300026078	Bacteria	2115
1229	Ga0207702_11310819	3300026078	Bacteria	718
1230	Ga0207641_10118498	3300026088	Bacteria	2358
1231	Ga0207641_10131093	3300026088	Bacteria	2251
1232	Ga0207641_10199091	3300026088	Bacteria	1846
1233	Ga0207641_10305951	3300026088	Bacteria	1503
1234	Ga0207641_10848739	3300026088	Bacteria	905
1235	Ga0207641_11389175	3300026088	Bacteria	703
1236	Ga0207648_10002176	3300026089	Bacteria	21281
1237	Ga0207648_10005939	3300026089	Bacteria	12211
1238	Ga0207648_10015751	3300026089	Bacteria	6936
1239	Ga0207648_10087281	3300026089	Bacteria	2722
1240	Ga0207648_10111939	3300026089	Bacteria	2397
1241	Ga0207648_10159685	3300026089	Bacteria	1991
1242	Ga0207648_10173287	3300026089	Bacteria	1908
1243	Ga0207648_10300208	3300026089	Bacteria	1440
1244	Ga0207648_10316553	3300026089	Bacteria	1402
1245	Ga0207648_10987304	3300026089	Bacteria	788
1246	Ga0207648_10998152	3300026089	Bacteria	784
1247	Ga0207648_11181691	3300026089	Bacteria	718
1248	Ga0207648_11851580	3300026089	Bacteria	565
1249	Ga0207676_10010346	3300026095	Bacteria	6641
1250	Ga0207676_10011142	3300026095	Bacteria	6420
1251	Ga0207676_10095279	3300026095	Bacteria	2454
1252	Ga0207676_10154150	3300026095	Bacteria	1982
1253	Ga0207676_10640795	3300026095	Bacteria	1024
1254	Ga0207676_11032456	3300026095	Bacteria	811
1255	Ga0207676_11149135	3300026095	Bacteria	769
1256	Ga0207674_10004293	3300026116	Bacteria	17188
1257	Ga0207674_10158756	3300026116	Bacteria	2216
1258	Ga0207674_10171993	3300026116	Bacteria	2119
1259	Ga0207674_10373308	3300026116	Bacteria	1379
1260	Ga0207674_10522615	3300026116	Bacteria	1146
1261	Ga0207674_10908217	3300026116	Bacteria	849
1262	Ga0207674_12168973	3300026116	Bacteria	519
1263	Ga0207675_100006663	3300026118	Bacteria	10927
1264	Ga0207675_100039987	3300026118	Bacteria	4376
1265	Ga0207675_100094405	3300026118	Bacteria	2814
1266	Ga0207675_100255531	3300026118	Bacteria	1697
1267	Ga0207675_100314320	3300026118	Bacteria	1528
1268	Ga0207675_102060528	3300026118	Bacteria	587
1269	Ga0207683_10005923	3300026121	Bacteria	10474
1270	Ga0207683_10032302	3300026121	Bacteria	4548
1271	Ga0207683_10106560	3300026121	Bacteria	2506
1272	Ga0207683_10119357	3300026121	Bacteria	2366
1273	Ga0207683_10124519	3300026121	Bacteria	2316
1274	Ga0207683_10166036	3300026121	Bacteria	1997
1275	Ga0207683_10172753	3300026121	Bacteria	1958
1276	Ga0207683_10282833	3300026121	Bacteria	1516
1277	Ga0207683_10350849	3300026121	Bacteria	1354
1278	Ga0207683_10444257	3300026121	Bacteria	1195
1279	Ga0207683_10538613	3300026121	Bacteria	1079
1280	Ga0207683_10664863	3300026121	Bacteria	965
1281	Ga0207683_11632104	3300026121	Bacteria	594
1282	Ga0207698_10180633	3300026142	Bacteria	1869
1283	Ga0207698_10670460	3300026142	Bacteria	1029
1284	Ga0207698_10828991	3300026142	Bacteria	929
1285	Ga0207698_11477637	3300026142	Bacteria	695
1286	Ga0207698_11616826	3300026142	Bacteria	663
1287	Ga0207698_11633654	3300026142	Bacteria	660
1288	Ga0207698_12009821	3300026142	Bacteria	592
1289	Ga0207698_12293423	3300026142	Bacteria	552
1290	Ga0209281_1000147	3300027111	Bacteria	168586
1291	Ga0209389_1000305	3300027296	Bacteria	30534
1292	Ga0209371_1008392	3300027312	Bacteria	3443
1293	Ga0209969_1000889	3300027360	Bacteria	4040
1294	Ga0209981_1007951	3300027378	Bacteria	1435
1295	Ga0209996_1000729	3300027395	Bacteria	3938
1296	Ga0209995_1000242	3300027471	Bacteria	8706
1297	Ga0209968_1000130	3300027526	Bacteria	13315
1298	Ga0209999_1001613	3300027543	Bacteria	3888
1299	Ga0209970_1058219	3300027614	Bacteria	706
1300	Ga0210002_1016004	3300027617	Bacteria	1184
1301	Ga0210002_1064635	3300027617	Bacteria	641
1302	Ga0209971_1044032	3300027682	Bacteria	1076
1303	Ga0209966_1000117	3300027695	Bacteria	35145
1304	Ga0209998_10002530	3300027717	Bacteria	4163
1305	Ga0209813_10001024	3300027866	Bacteria	6287
1306	Ga0209813_10024775	3300027866	Bacteria	1720
1307	Ga0209813_10212611	3300027866	Bacteria	721
1308	Ga0209974_10000149	3300027876	Bacteria	21195
1309	Ga0207428_10148534	3300027907	Bacteria	1785
1310	Ga0268266_10346670	3300028379	Bacteria	1395
1311	Ga0268266_10427489	3300028379	Bacteria	1256
1312	Ga0268266_10532322	3300028379	Bacteria	1124
1313	Ga0268266_10767937	3300028379	Bacteria	930
1314	Ga0268266_10883517	3300028379	Bacteria	864
1315	Ga0268266_11175617	3300028379	Bacteria	742
1316	Ga0268266_11214193	3300028379	Bacteria	729
1317	Ga0268266_12261457	3300028379	Bacteria	515
1318	Ga0268265_10047973	3300028380	Bacteria	3203
1319	Ga0268265_10173673	3300028380	Bacteria	1844
1320	Ga0268265_10409039	3300028380	Bacteria	1256
1321	Ga0268265_10592306	3300028380	Bacteria	1058
1322	Ga0268265_11158377	3300028380	Bacteria	769
1323	Ga0268265_11429491	3300028380	Bacteria	694
1324	Ga0268265_12561104	3300028380	Bacteria	516
1325	Ga0268264_10002070	3300028381	Bacteria	17906
1326	Ga0268264_10002318	3300028381	Bacteria	16843
1327	Ga0268264_10052271	3300028381	Bacteria	3407
1328	Ga0268264_10053634	3300028381	Bacteria	3364
1329	Ga0268264_10057251	3300028381	Bacteria	3260
1330	Ga0268264_10235007	3300028381	Bacteria	1695
1331	Ga0268264_10510540	3300028381	Bacteria	1174
1332	Ga0268264_10751893	3300028381	Bacteria	971
1333	Ga0268264_11113125	3300028381	Bacteria	798
1334	Ga0268264_11731604	3300028381	Bacteria	635
1335	Ga0268264_11813004	3300028381	Bacteria	620
1336	Ga0268264_12252049	3300028381	Bacteria	552
1337	Ga0268264_12388956	3300028381	Bacteria	535
1338	Ga0265334_10236347	3300028573	Bacteria	630
1339	Ga0265318_10335649	3300028577	Bacteria	552
1340	Ga0265336_10000028	3300028666	Bacteria	179201
1341	Ga0307517_10014561	3300028786	Bacteria	10553
1342	Ga0307517_10103679	3300028786	Bacteria	2221
1343	Ga0307517_10178695	3300028786	Bacteria	1375
1344	Ga0307517_10467546	3300028786	Bacteria	649
1345	Ga0307515_10002443	3300028794	Bacteria	40478
1346	Ga0307515_10021273	3300028794	Bacteria	11511
1347	Ga0307515_10053115	3300028794	Bacteria	5987
1348	Ga0307515_10089443	3300028794	Bacteria	3877
1349	Ga0307515_10095676	3300028794	Bacteria	3652
1350	Ga0307515_10108460	3300028794	Bacteria	3271
1351	Ga0307515_10186828	3300028794	Bacteria	1998
1352	Ga0307515_10297559	3300028794	Bacteria	1302
1353	Ga0307515_10558047	3300028794	Bacteria	755
1354	Ga0307515_10703559	3300028794	Bacteria	626
1355	Ga0307515_10830111	3300028794	Bacteria	549
1356	Ga0307515_10889888	3300028794	Bacteria	520
1357	Ga0310981_1011192	3300029285	Bacteria	742
1358	Ga0265324_10000286	3300029957	Bacteria	37420
1359	Ga0268256_1008739	3300030500	Bacteria	3443
1360	Ga0307511_10070244	3300030521	Bacteria	2566
1361	Ga0307512_10045873	3300030522	Bacteria	3571
1362	Ga0307512_10091067	3300030522	Bacteria	2123
1363	Ga0307512_10098413	3300030522	Bacteria	1996
1364	Ga0265766_1023713	3300030863	Bacteria	518
1365	Ga0265331_10028635	3300031250	Bacteria	2784
1366	Ga0265327_10000020	3300031251	Bacteria	424552
1367	Ga0265327_10000178	3300031251	Bacteria	135732
1368	Ga0307513_10019109	3300031456	Bacteria	8167
1369	Ga0307513_10034953	3300031456	Bacteria	5631
1370	Ga0307513_10063852	3300031456	Bacteria	3884
1371	Ga0307513_10076724	3300031456	Bacteria	3464
1372	Ga0307513_10184235	3300031456	Bacteria	1947
1373	Ga0307513_10220352	3300031456	Bacteria	1719
1374	Ga0307513_10418258	3300031456	Bacteria	1071
1375	Ga0307513_10640561	3300031456	Bacteria	770
1376	Ga0307513_10781816	3300031456	Bacteria	660
1377	Ga0307509_10003616	3300031507	Bacteria	23221
1378	Ga0307509_10036139	3300031507	Bacteria	5413
1379	Ga0307509_10111735	3300031507	Bacteria	2734
1380	Ga0307509_10141229	3300031507	Bacteria	2343
1381	Ga0307509_10282377	3300031507	Bacteria	1420
1382	Ga0307509_10426950	3300031507	Bacteria	1025
1383	Ga0307408_100000089	3300031548	Bacteria	100712
1384	Ga0307408_100013705	3300031548	Bacteria	5383
1385	Ga0307408_100193528	3300031548	Bacteria	1640
1386	Ga0307408_100223586	3300031548	Bacteria	1537
1387	Ga0307408_100260880	3300031548	Bacteria	1434
1388	Ga0307408_100519381	3300031548	Bacteria	1046
1389	Ga0307408_100867961	3300031548	Bacteria	824
1390	Ga0307408_100891679	3300031548	Bacteria	813
1391	Ga0307408_101084960	3300031548	Bacteria	742
1392	Ga0307408_101148342	3300031548	Bacteria	722
1393	Ga0307408_101272701	3300031548	Bacteria	688
1394	Ga0307408_101902321	3300031548	Bacteria	570
1395	Ga0307508_10000392	3300031616	Bacteria	52650
1396	Ga0307508_10061685	3300031616	Bacteria	3311
1397	Ga0307508_10407074	3300031616	Bacteria	952
1398	Ga0307508_10626816	3300031616	Bacteria	679
1399	Ga0307514_10000339	3300031649	Bacteria	111130
1400	Ga0307514_10034392	3300031649	Bacteria	4039
1401	Ga0307514_10178976	3300031649	Bacteria	1370
1402	Ga0307514_10213346	3300031649	Bacteria	1195
1403	Ga0307516_10000048	3300031730	Bacteria	130378
1404	Ga0307516_10011689	3300031730	Bacteria	9527
1405	Ga0307516_10019197	3300031730	Bacteria	7085
1406	Ga0307516_10027941	3300031730	Bacteria	5714
1407	Ga0307516_10040356	3300031730	Bacteria	4647
1408	Ga0307516_10330542	3300031730	Bacteria	1193
1409	Ga0307516_10388826	3300031730	Bacteria	1055
1410	Ga0307516_10547312	3300031730	Bacteria	811
1411	Ga0307405_10012091	3300031731	Bacteria	4554
1412	Ga0307405_10046436	3300031731	Bacteria	2668
1413	Ga0307405_10170412	3300031731	Bacteria	1552
1414	Ga0307405_10833335	3300031731	Bacteria	775
1415	Ga0307405_11115363	3300031731	Bacteria	679
1416	Ga0307413_10032313	3300031824	Bacteria	2965
1417	Ga0307413_10410080	3300031824	Bacteria	1064
1418	Ga0307413_10919579	3300031824	Bacteria	744
1419	Ga0307518_10376266	3300031838	Bacteria	809
1420	Ga0307410_10073323	3300031852	Bacteria	2380
1421	Ga0307410_10140307	3300031852	Bacteria	1787
1422	Ga0307410_10220441	3300031852	Bacteria	1459
1423	Ga0307410_10342405	3300031852	Bacteria	1192
1424	Ga0307410_10348481	3300031852	Bacteria	1183
1425	Ga0307410_10531987	3300031852	Bacteria	971
1426	Ga0307410_11106003	3300031852	Bacteria	687
1427	Ga0307406_10004866	3300031901	Bacteria	7314
1428	Ga0307406_10166340	3300031901	Bacteria	1591
1429	Ga0307406_10239255	3300031901	Bacteria	1361
1430	Ga0307406_10545912	3300031901	Bacteria	947
1431	Ga0307406_11001006	3300031901	Bacteria	717
1432	Ga0307406_11013214	3300031901	Bacteria	713
1433	Ga0307406_11038287	3300031901	Bacteria	705
1434	Ga0307407_10061462	3300031903	Bacteria	2196
1435	Ga0307407_11293391	3300031903	Bacteria	572
1436	Ga0307407_11565053	3300031903	Bacteria	522
1437	Ga0307412_10011559	3300031911	Bacteria	5119
1438	Ga0307412_10074922	3300031911	Bacteria	2320
1439	Ga0307412_10094847	3300031911	Bacteria	2096
1440	Ga0307412_10160061	3300031911	Bacteria	1671
1441	Ga0307412_10384737	3300031911	Bacteria	1137
1442	Ga0307412_10526033	3300031911	Bacteria	989
1443	Ga0307412_10636065	3300031911	Bacteria	908
1444	Ga0307412_10702321	3300031911	Bacteria	868
1445	Ga0307412_10743465	3300031911	Bacteria	846
1446	Ga0307412_11113541	3300031911	Bacteria	703
1447	Ga0307412_11218927	3300031911	Bacteria	674
1448	Ga0307409_100000577	3300031995	Bacteria	15970
1449	Ga0307409_100308882	3300031995	Bacteria	1475
1450	Ga0307409_100330064	3300031995	Bacteria	1431
1451	Ga0307409_100686881	3300031995	Bacteria	1021
1452	Ga0307409_101899002	3300031995	Bacteria	625
1453	Ga0307416_100025728	3300032002	Bacteria	4321
1454	Ga0307416_100028404	3300032002	Bacteria	4159
1455	Ga0307416_100043561	3300032002	Bacteria	3515
1456	Ga0307416_100231430	3300032002	Bacteria	1782
1457	Ga0307416_100287538	3300032002	Bacteria	1625
1458	Ga0307416_100431676	3300032002	Bacteria	1365
1459	Ga0307416_100600388	3300032002	Bacteria	1180
1460	Ga0307416_101811421	3300032002	Bacteria	714
1461	Ga0307416_102406474	3300032002	Bacteria	626
1462	Ga0307414_10057302	3300032004	Bacteria	2738
1463	Ga0307414_10074321	3300032004	Bacteria	2462
1464	Ga0307414_10129728	3300032004	Bacteria	1955
1465	Ga0307414_10358891	3300032004	Bacteria	1253
1466	Ga0307414_10649410	3300032004	Bacteria	951
1467	Ga0307414_10988167	3300032004	Bacteria	774
1468	Ga0307414_11606532	3300032004	Bacteria	606
1469	Ga0307411_10000085	3300032005	Bacteria	28904
1470	Ga0307411_10069652	3300032005	Bacteria	2376
1471	Ga0307411_10249959	3300032005	Bacteria	1393
1472	Ga0307411_10583866	3300032005	Bacteria	958
1473	Ga0307411_10817801	3300032005	Bacteria	822
1474	Ga0307411_11856363	3300032005	Bacteria	560
1475	Ga0307415_100034663	3300032126	Bacteria	3289
1476	Ga0307415_100039097	3300032126	Bacteria	3132
1477	Ga0307415_100299333	3300032126	Bacteria	1332
1478	Ga0307415_102130051	3300032126	Bacteria	548
1479	Ga0307507_10087876	3300033179	Bacteria	2685
1480	Ga0307507_10154935	3300033179	Bacteria	1711
1481	Ga0307510_10160136	3300033180	Bacteria	1849
1482	Ga0307510_10170741	3300033180	Bacteria	1754
1483	Ga0373948_0007447	3300034817	Bacteria	1841
1484	Ga0373950_0076850	3300034818	Bacteria	692
1485	Ga0373959_0026537	3300034820	Bacteria	1145
1486	Ga0373959_0057324	3300034820	Bacteria	855
1487	Ga0373938_0017777	3300034957	Bacteria	1403
1488	Ga0373938_0089052	3300034957	Bacteria	761
1489	Ga0373926_0079568	3300035083	Bacteria	1211
1490	Ga0373926_0366139	3300035083	Bacteria	567
1491	Ga0373928_0014100	3300035084	Bacteria	1612
1492	Ga0373929_0265161	3300035085	Bacteria	503
1493	Ga0373934_0009951	3300035086	Bacteria	3568
1494	Ga0373940_0013733	3300035088	Bacteria	1966
1495	Ga0373940_0039203	3300035088	Bacteria	1296
1496	Ga0373940_0047957	3300035088	Bacteria	1193
1497	Ga0373944_0122432	3300035089	Bacteria	897
1498	Ga0373944_0376072	3300035089	Bacteria	544
1499	Ga0373949_0033918	3300035090	Bacteria	1228
1500	Ga0373949_0161197	3300035090	Bacteria	654
1501	Ga0373951_0036869	3300035091	Bacteria	1168
1502	Ga0373951_0066119	3300035091	Bacteria	913
1503	Ga0373923_0045641	3300035111	Bacteria	1820
1504	Ga0373932_0121153	3300035112	Bacteria	872
1505	Ga0373932_0247749	3300035112	Bacteria	649
1506	Ga0373936_0126258	3300035113	Bacteria	1097
1507	Ga0373936_0244382	3300035113	Bacteria	800
1508	Ga0373939_0000348	3300035114	Bacteria	11798
1509	Ga0373939_0028000	3300035114	Bacteria	1601
1510	Ga0373941_0115506	3300035115	Bacteria	951
1511	Ga0373945_0062010	3300035116	Bacteria	1397
1512	Ga0373945_0242168	3300035116	Bacteria	759
1513	Ga0373945_0381565	3300035116	Bacteria	615
1514	Ga0373953_0042168	3300035117	Bacteria	1818
1515	Ga0373956_0136201	3300035119	Bacteria	1152
1516	Ga0373956_0352378	3300035119	Bacteria	702
1517	Ga0373957_0070420	3300035120	Bacteria	1367
1518	Ga0373960_0114684	3300035121	Bacteria	888
1519	Ga0373943_0205596	3300035170	Bacteria	1091
1520	Ga0373943_0266450	3300035170	Bacteria	965
1521	Ga0373943_0325661	3300035170	Bacteria	877
1522	Ga0373946_0202063	3300035171	Bacteria	952
1523	Ga0373946_0248443	3300035171	Bacteria	867
1524	Ga0373946_0325416	3300035171	Bacteria	764
1525	Ga0373955_0092432	3300035172	Bacteria	1726
1526	Ga0373955_0847039	3300035172	Bacteria	562
1527	Ga0373961_0015414	3300035241	Bacteria	1954
1528	Ga0373961_0381993	3300035241	Bacteria	537
1529	Ga0373924_0102911	3300035410	Bacteria	1229
1530	Ga0373924_0311908	3300035410	Bacteria	699
1531	Ga0373931_0000535	3300035691	Bacteria	15604
1532	Ga0373931_0001474	3300035691	Bacteria	10131
1533	Ga0373931_0008660	3300035691	Bacteria	4836
1534	Ga0373931_0022499	3300035691	Bacteria	3173
1535	Ga0373931_0459977	3300035691	Bacteria	815
1536	Ga0373935_0466874	3300035692	Bacteria	913
1537	Ga0373935_0648367	3300035692	Bacteria	774
1538	Ga0373935_1366174	3300035692	Bacteria	529
1539	Ga0373927_0108327	3300035695	Bacteria	1810
1540	Ga0373927_0120122	3300035695	Bacteria	1715
1541	Ga0373927_0421769	3300035695	Bacteria	881
1542	Ga0373933_0382352	3300035724	Bacteria	917
1543	Ga0373947_0185796	3300035725	Bacteria	1355
1544	Ga0373947_0474762	3300035725	Bacteria	848
1545	Ga0373947_0566338	3300035725	Bacteria	774
1546	Ga0373947_0588958	3300035725	Bacteria	758
1547	Ga0373937_0488619	3300036401	Bacteria	1169
1548	Ga0373937_0703249	3300036401	Bacteria	957
1549	Ga0265778_002283	3300036457	Bacteria	1835
1550	Ga0310110_007052	3300036535	Bacteria	1643
1551	Ga0373925_0089907	3300037068	Bacteria	2346
1552	Ga0373925_0226591	3300037068	Bacteria	1493
1553	Ga0373925_0269257	3300037068	Bacteria	1370
1554	Ga0373925_1714838	3300037068	Bacteria	513
1555	Ga0395899_0028029	3300037312	Bacteria	4241
1556	Ga0395899_0100034	3300037312	Bacteria	2094
1557	Ga0395899_0342891	3300037312	Bacteria	1001
1558	Ga0395900_0000542	3300037418	Bacteria	52856
1559	Ga0395900_0019646	3300037418	Bacteria	6888
1560	Ga0395900_0033722	3300037418	Bacteria	5268
1561	Ga0395900_0438382	3300037418	Bacteria	1264
1562	Ga0395900_0521739	3300037418	Bacteria	1136
1563	Ga0395898_0003063	3300037466	Bacteria	18941
1564	Ga0395898_0004013	3300037466	Bacteria	16185
1565	Ga0395898_0010146	3300037466	Bacteria	9859
1566	Ga0395898_0012209	3300037466	Bacteria	8885
1567	Ga0395898_0395446	3300037466	Bacteria	1318
1568	Ga0395905_0002507	3300037471	Bacteria	20284
1569	Ga0395905_0004938	3300037471	Bacteria	13738
1570	Ga0395905_0008603	3300037471	Bacteria	10059
1571	Ga0395905_0013480	3300037471	Bacteria	7832
1572	Ga0395905_0023115	3300037471	Bacteria	5877
1573	Ga0395905_0032891	3300037471	Bacteria	4875
1574	Ga0395905_0038305	3300037471	Bacteria	4498
1575	Ga0395905_0067703	3300037471	Bacteria	3344
1576	Ga0395905_0097413	3300037471	Bacteria	2761
1577	Ga0395905_0265078	3300037471	Bacteria	1603
1578	Ga0395905_0304457	3300037471	Bacteria	1481
1579	Ga0395905_0481490	3300037471	Bacteria	1140
1580	Ga0395905_0630830	3300037471	Bacteria	973
1581	Ga0395901_0001925	3300038443	Bacteria	21375
1582	Ga0395901_0014473	3300038443	Bacteria	8024
1583	Ga0395901_0093407	3300038443	Bacteria	3150
1584	Ga0395901_1682451	3300038443	Bacteria	586
1585	Ga0436365_0023403	3300039437	Bacteria	2605
1586	Ga0436361_0264239	3300039447	Bacteria	513
1587	Ga0436361_0277444	3300039447	Bacteria	636
1588	Ga0436361_0405071	3300039447	Bacteria	13061
1589	Ga0436361_0560599	3300039447	Bacteria	694
1590	Ga0436361_0568601	3300039447	Bacteria	1301
1591	Ga0436361_0570086	3300039447	Bacteria	6186
1592	Ga0436361_0714431	3300039447	Bacteria	79592
1593	Ga0436361_0846450	3300039447	Bacteria	1737
1594	Ga0436361_1080792	3300039447	Bacteria	887
1595	Ga0436363_0160364	3300039450	Bacteria	878
1596	Ga0436363_0544282	3300039450	Bacteria	1232
1597	Ga0436363_0965849	3300039450	Bacteria	1295
1598	Ga0439436_0040359	3300041404	Bacteria	1338
1599	Ga0439438_145999	3300041405	Bacteria	565
1600	Ga0439439_0073294	3300041406	Bacteria	919
1601	Ga0439453_0104985	3300041408	Bacteria	634
1602	Ga0439461_0011743	3300041410	Bacteria	1630
1603	Ga0439461_0024350	3300041410	Bacteria	1223
1604	Ga0439461_0095235	3300041410	Bacteria	719
1605	Ga0439461_0118099	3300041410	Bacteria	661
1606	Ga0439466_0106597	3300041411	Bacteria	871
1607	Ga0439465_0005103	3300041413	Bacteria	4212
1608	Ga0439465_0010171	3300041413	Bacteria	2956
1609	Ga0439465_0061840	3300041413	Bacteria	1242
1610	Ga0439465_0261466	3300041413	Bacteria	642
1611	Ga0451787_047981	3300041441	Bacteria	526
1612	Ga0451789_0166480	3300041443	Bacteria	966
1613	Ga0451789_0965253	3300041443	Bacteria	2538
1614	Ga0451790_23077	3300041444	Bacteria	868
1615	Ga0451790_47197	3300041444	Bacteria	1058
1616	Ga0451794_02261	3300041446	Bacteria	957
1617	Ga0451794_03533	3300041446	Bacteria	1513
1618	Ga0451794_21839	3300041446	Bacteria	896
1619	Ga0451791_0033323	3300041451	Bacteria	898
1620	Ga0451791_0167116	3300041451	Bacteria	1168
1621	Ga0451791_1331173	3300041451	Bacteria	630
1622	Ga0451793_0077150	3300041452	Bacteria	585
1623	Ga0451793_0560974	3300041452	Bacteria	735
1624	Ga0451793_1338571	3300041452	Bacteria	1262
1625	Ga0451793_1492943	3300041452	Bacteria	537
1626	Ga0451797_0593740	3300041453	Bacteria	1059
1627	Ga0451797_0784698	3300041453	Bacteria	976
1628	Ga0451799_34005	3300041454	Bacteria	916
1629	Ga0451801_02522	3300041455	Bacteria	1085
1630	Ga0451801_26122	3300041455	Bacteria	1026
1631	Ga0451801_40786	3300041455	Bacteria	1763
1632	Ga0451795_0013989	3300041456	Bacteria	2986
1633	Ga0451795_1662122	3300041456	Bacteria	655
1634	Ga0451795_1676515	3300041456	Bacteria	761
1635	Ga0451803_03143	3300041457	Bacteria	807
1636	Ga0451798_0237297	3300041458	Bacteria	2302
1637	Ga0451798_0434508	3300041458	Bacteria	768
1638	Ga0451800_0810391	3300041459	Bacteria	583
1639	Ga0451800_0830017	3300041459	Bacteria	637
1640	Ga0451800_1183293	3300041459	Bacteria	874
1641	Ga0451800_1232355	3300041459	Bacteria	2467
1642	Ga0451800_1546204	3300041459	Bacteria	1668
1643	Ga0451802_0106731	3300041460	Bacteria	1281
1644	Ga0451802_0433132	3300041460	Bacteria	1756
1645	Ga0451802_1381453	3300041460	Bacteria	582
1646	Ga0451805_010980	3300041461	Bacteria	3772
1647	Ga0451805_039282	3300041461	Bacteria	1073
1648	Ga0451805_102604	3300041461	Bacteria	1449
1649	Ga0451805_106515	3300041461	Bacteria	550
1650	Ga0451804_0350671	3300041463	Bacteria	3764
1651	Ga0451804_0734827	3300041463	Bacteria	980
1652	Ga0451807_0037261	3300041486	Bacteria	1481
1653	Ga0451807_1280507	3300041486	Bacteria	1302
1654	Ga0451807_1506488	3300041486	Bacteria	1542
1655	Ga0451807_2557829	3300041486	Bacteria	613
1656	Ga0451833_0316321	3300041491	Bacteria	1235
1657	Ga0451833_0454442	3300041491	Bacteria	578
1658	Ga0451833_0770229	3300041491	Bacteria	866
1659	Ga0451835_0635417	3300041492	Bacteria	1032
1660	Ga0451837_0653876	3300041494	Bacteria	576
1661	Ga0451837_1583729	3300041494	Bacteria	1063
1662	Ga0451839_0386917	3300041496	Bacteria	1341
1663	Ga0451845_0920152	3300041501	Bacteria	730
1664	Ga0451847_0492633	3300041503	Bacteria	994
1665	Ga0451849_0509842	3300041505	Bacteria	706
1666	Ga0451851_0137890	3300041507	Bacteria	923
1667	Ga0451843_0970979	3300041509	Bacteria	812
1668	Ga0451843_1344647	3300041509	Bacteria	544
1669	Ga0451854_29665	3300041510	Bacteria	1060
1670	Ga0451855_0043459	3300041511	Bacteria	1949
1671	Ga0451853_0666568	3300041512	Bacteria	908
1672	Ga0451853_0949970	3300041512	Bacteria	888
1673	Ga0451853_1066481	3300041512	Bacteria	2648
1674	Ga0451853_3056834	3300041512	Bacteria	558
1675	Ga0451853_3291537	3300041512	Bacteria	827
1676	Ga0451853_4042749	3300041512	Bacteria	1692
1677	Ga0439431_0002412	3300041997	Bacteria	4137
1678	Ga0439433_0025440	3300041999	Bacteria	1337
1679	Ga0439437_004427	3300042000	Bacteria	1530
1680	Ga0439441_066668	3300042001	Bacteria	766
1681	Ga0439441_095905	3300042001	Bacteria	660
1682	Ga0439441_159424	3300042001	Bacteria	535
1683	Ga0439442_139711	3300042002	Bacteria	536
1684	Ga0439443_004303	3300042003	Bacteria	1845
1685	Ga0439445_0009991	3300042004	Bacteria	2240
1686	Ga0439445_0035690	3300042004	Bacteria	1306
1687	Ga0439445_0195651	3300042004	Bacteria	596
1688	Ga0439448_0121579	3300042005	Bacteria	896
1689	Ga0439448_0196488	3300042005	Bacteria	706
1690	Ga0439448_0196960	3300042005	Bacteria	706
1691	Ga0439432_167758	3300042006	Bacteria	641
1692	Ga0439449_0041597	3300042007	Bacteria	1709
1693	Ga0439449_0153638	3300042007	Bacteria	858
1694	Ga0439450_062997	3300042008	Bacteria	899
1695	Ga0439452_034134	3300042010	Bacteria	1231
1696	Ga0439454_011152	3300042011	Bacteria	1196
1697	Ga0439454_053617	3300042011	Bacteria	686
1698	Ga0439455_0002630	3300042012	Bacteria	3302
1699	Ga0439455_0004568	3300042012	Bacteria	2751
1700	Ga0439455_0028934	3300042012	Bacteria	1367
1701	Ga0439455_0134550	3300042012	Bacteria	698
1702	Ga0439456_167275	3300042013	Bacteria	516
1703	Ga0439457_056273	3300042014	Bacteria	887
1704	Ga0439462_0063869	3300042015	Bacteria	997
1705	Ga0439462_0158458	3300042015	Bacteria	638
1706	Ga0450912_001673	3300042116	Bacteria	1395
1707	Ga0450912_037112	3300042116	Bacteria	521
1708	Ga0450913_000876	3300042117	Bacteria	1473
1709	Ga0450917_000001	3300042120	Bacteria	12228
1710	Ga0450919_000025	3300042121	Bacteria	12249
1711	Ga0450920_004654	3300042122	Bacteria	2420
1712	Ga0450923_159589	3300042125	Bacteria	549
1713	Ga0450888_000612	3300042126	Bacteria	3384
1714	Ga0450890_000549	3300042127	Bacteria	5493
1715	Ga0450890_000550	3300042127	Bacteria	5489
1716	Ga0450890_020407	3300042127	Bacteria	897
1717	Ga0450897_033099	3300042128	Bacteria	591
1718	Ga0450891_000262	3300042129	Bacteria	5316
1719	Ga0450892_001360	3300042130	Bacteria	2438
1720	Ga0450892_016864	3300042130	Bacteria	691
1721	Ga0450896_008784	3300042133	Bacteria	1404
1722	Ga0450898_014524	3300042134	Bacteria	1324
1723	Ga0450898_116347	3300042134	Bacteria	568
1724	Ga0450899_002878	3300042135	Bacteria	1862
1725	Ga0450900_032950	3300042136	Bacteria	758
1726	Ga0450902_009473	3300042137	Bacteria	1533
1727	Ga0450904_002939	3300042139	Bacteria	1920
1728	Ga0450904_013862	3300042139	Bacteria	803
1729	Ga0450889_000161	3300042144	Bacteria	6993
1730	Ga0439446_0031377	3300042156	Bacteria	1538
1731	Ga0439446_0042365	3300042156	Bacteria	1343
1732	Ga0439446_0048248	3300042156	Bacteria	1268
1733	Ga0439446_0049014	3300042156	Bacteria	1258
1734	Ga0439446_0057763	3300042156	Bacteria	1168
1735	Ga0439458_0101130	3300042157	Bacteria	748
1736	Ga0439458_0217814	3300042157	Bacteria	525
1737	Ga0450909_078743	3300042185	Bacteria	532
1738	Ga0439434_0007708	3300042435	Bacteria	3155
1739	Ga0439434_0015184	3300042435	Bacteria	2296
1740	Ga0439434_0022473	3300042435	Bacteria	1896
1741	Ga0439434_0075520	3300042435	Bacteria	1065
1742	Ga0439434_0093449	3300042435	Bacteria	964
1743	Ga0439434_0095345	3300042435	Bacteria	955
1744	Ga0439435_0103450	3300042436	Bacteria	877
1745	Ga0439444_0056821	3300042437	Bacteria	808
1746	Ga0439459_0000309	3300042438	Bacteria	5891
1747	Ga0439464_0010621	3300042439	Bacteria	2431
1748	Ga0439464_0071151	3300042439	Bacteria	1029
1749	Ga0439464_0276895	3300042439	Bacteria	545
1750	Ga0439460_0002749	3300042461	Bacteria	4235
1751	Ga0439460_0164920	3300042461	Bacteria	744
1752	Ga0450916_000427	3300042530	Bacteria	3595
1753	Ga0450918_000123	3300042531	Bacteria	16624
1754	Ga0450893_0002832	3300042532	Bacteria	2720
1755	Ga0450893_0032228	3300042532	Bacteria	938
1756	Ga0450893_0090967	3300042532	Bacteria	612
1757	Ga0450901_006221	3300042533	Bacteria	1226
1758	Ga0450901_042815	3300042533	Bacteria	512
1759	Ga0451577_0004524	3300042876	Bacteria	14637
1760	Ga0451577_0069675	3300042876	Bacteria	3136
1761	Ga0451577_0287511	3300042876	Bacteria	1490
1762	Ga0466969_0000018	3300044656	Bacteria	102911
1763	Ga0466969_0001561	3300044656	Bacteria	12286
1764	Ga0466969_0002589	3300044656	Bacteria	9661
1765	Ga0466969_0002653	3300044656	Bacteria	9554
1766	Ga0466969_0012551	3300044656	Bacteria	4465
1767	Ga0466969_0071313	3300044656	Bacteria	1670
1768	Ga0466972_0004583	3300044658	Bacteria	6926
1769	Ga0466972_0007374	3300044658	Bacteria	5527
1770	Ga0466972_0026175	3300044658	Bacteria	2890
1771	Ga0466972_0028508	3300044658	Bacteria	2753
1772	Ga0453683_0846513	3300044673	Bacteria	603
1773	Ga0453683_1072917	3300044673	Bacteria	536
1774	Ga0466965_0008031	3300044683	Bacteria	4871
1775	Ga0466965_0018301	3300044683	Bacteria	3357
1776	Ga0466965_0065957	3300044683	Bacteria	1814
1777	Ga0466965_0125350	3300044683	Bacteria	1328
1778	Ga0466965_0154522	3300044683	Bacteria	1200
1779	Ga0466966_0009766	3300044684	Bacteria	6359
1780	Ga0466966_0010593	3300044684	Bacteria	6129
1781	Ga0466966_0021693	3300044684	Bacteria	4215
1782	Ga0466966_0026863	3300044684	Bacteria	3755
1783	Ga0466966_0058141	3300044684	Bacteria	2444
1784	Ga0466966_0852006	3300044684	Bacteria	549
1785	Ga0466961_0004306	3300044693	Bacteria	8909
1786	Ga0466961_0005561	3300044693	Bacteria	7954
1787	Ga0466961_0026432	3300044693	Bacteria	3731
1788	Ga0466961_0166639	3300044693	Bacteria	1371
1789	Ga0466961_0168219	3300044693	Bacteria	1364
1790	Ga0466961_0229178	3300044693	Bacteria	1143
1791	Ga0466961_0582188	3300044693	Bacteria	673
1792	Ga0466963_0028896	3300044694	Bacteria	3564
1793	Ga0466963_0112607	3300044694	Bacteria	1868
1794	Ga0466963_0293883	3300044694	Bacteria	1142
1795	Ga0466963_1064302	3300044694	Bacteria	569
1796	Ga0466964_0000637	3300044706	Bacteria	11177
1797	Ga0466964_0003200	3300044706	Bacteria	5954
1798	Ga0466964_0355907	3300044706	Bacteria	753
1799	Ga0466964_0443013	3300044706	Bacteria	687
1800	Ga0453684_0077473	3300044712	Bacteria	4166
1801	Ga0453684_0218561	3300044712	Bacteria	2209
1802	Ga0453684_0261576	3300044712	Bacteria	1981
1803	Ga0453684_0436833	3300044712	Bacteria	1459
1804	Ga0453684_0517923	3300044712	Bacteria	1318
1805	Ga0453684_0567071	3300044712	Bacteria	1248
1806	Ga0453684_1614105	3300044712	Bacteria	665
1807	Ga0453684_1916968	3300044712	Bacteria	599
1808	Ga0453684_1966885	3300044712	Bacteria	590
1809	Ga0466971_0001482	3300044719	Bacteria	9910
1810	Ga0466971_0002400	3300044719	Bacteria	7905
1811	Ga0466971_0003261	3300044719	Bacteria	6925
1812	Ga0466971_0609832	3300044719	Bacteria	545
1813	Ga0466968_0007045	3300044735	Bacteria	4261
1814	Ga0466968_0012515	3300044735	Bacteria	3324
1815	Ga0466968_0028269	3300044735	Bacteria	2312
1816	Ga0466968_0079400	3300044735	Bacteria	1439
1817	Ga0466970_0025081	3300044765	Bacteria	3120
1818	Ga0466970_0030706	3300044765	Bacteria	2834
1819	Ga0466970_0034790	3300044765	Bacteria	2668
1820	Ga0466970_0249881	3300044765	Bacteria	993
1821	Ga0466970_0609825	3300044765	Bacteria	633
1822	Ga0466957_0006128	3300044842	Bacteria	6786
1823	Ga0466957_0029622	3300044842	Bacteria	3265
1824	Ga0466957_0039679	3300044842	Bacteria	2841
1825	Ga0466957_0062776	3300044842	Bacteria	2282
1826	Ga0466957_0443586	3300044842	Bacteria	893
1827	Ga0466960_0006778	3300044901	Bacteria	4613
1828	Ga0466960_0010573	3300044901	Bacteria	3835
1829	Ga0466960_0076355	3300044901	Bacteria	1678
1830	Ga0466960_0304968	3300044901	Bacteria	898
1831	Ga0466960_0369837	3300044901	Bacteria	821
1832	Ga0466960_0446045	3300044901	Bacteria	751
1833	Ga0466959_0000855	3300045049	Bacteria	17985
1834	Ga0466959_0003145	3300045049	Bacteria	10707
1835	Ga0466959_0014533	3300045049	Bacteria	5725
1836	Ga0466959_0051414	3300045049	Bacteria	3022
1837	Ga0466959_0664657	3300045049	Bacteria	699
1838	Ga0451576_0003595	3300045051	Bacteria	21077
1839	Ga0451576_0075129	3300045051	Bacteria	3516
1840	Ga0451576_0168870	3300045051	Bacteria	2283
1841	Ga0451576_0200992	3300045051	Bacteria	2081
1842	Ga0451576_0279243	3300045051	Bacteria	1746
1843	Ga0451576_0519894	3300045051	Bacteria	1250
1844	Ga0451576_0643341	3300045051	Bacteria	1114
1845	Ga0451576_1059663	3300045051	Bacteria	849
1846	Ga0451576_1160016	3300045051	Bacteria	807
1847	Ga0451576_1268553	3300045051	Bacteria	768
1848	Ga0466958_0002207	3300045836	Bacteria	9697
1849	Ga0466958_0022101	3300045836	Bacteria	3722
1850	Ga0466958_0217971	3300045836	Bacteria	1217
1851	Ga0466967_0003037	3300045976	Bacteria	10770
1852	Ga0466967_0505904	3300045976	Bacteria	1186
1853	Ga0466967_0631274	3300045976	Bacteria	1058
1854	Ga0466967_2534945	3300045976	Bacteria	508
1855	Ga0495592_0000203	3300046454	Bacteria	50733
1856	Ga0495592_0114305	3300046454	Bacteria	1907
1857	Ga0495592_0385126	3300046454	Bacteria	891
1858	Ga0495603_0167391	3300046455	Bacteria	1273
1859	Ga0495590_0004188	3300046457	Bacteria	5838
1860	Ga0495590_0011864	3300046457	Bacteria	3248
1861	Ga0495590_0076553	3300046457	Bacteria	1177
1862	Ga0495629_0208823	3300046459	Bacteria	1349
1863	Ga0495629_0856910	3300046459	Bacteria	597
1864	Ga0495638_0050878	3300046460	Bacteria	2587
1865	Ga0495638_0131647	3300046460	Bacteria	1468
1866	Ga0495638_0162714	3300046460	Bacteria	1286
1867	Ga0495638_0462993	3300046460	Bacteria	645
1868	Ga0495641_0201200	3300046461	Bacteria	893
1869	Ga0495641_0429904	3300046461	Bacteria	600
1870	Ga0495651_0074163	3300046462	Bacteria	2582
1871	Ga0495651_0348222	3300046462	Bacteria	980
1872	Ga0495653_0329348	3300046463	Bacteria	988
1873	Ga0495650_0007879	3300046471	Bacteria	6324
1874	Ga0495650_0065725	3300046471	Bacteria	1438
1875	Ga0495650_0117494	3300046471	Bacteria	982
1876	Ga0495650_0139121	3300046471	Bacteria	880
1877	Ga0495650_0279128	3300046471	Bacteria	562
1878	Ga0495580_0359190	3300046472	Bacteria	986
1879	Ga0495580_0946552	3300046472	Bacteria	551
1880	Ga0495582_0204500	3300046473	Bacteria	1128
1881	Ga0495605_0372512	3300046474	Bacteria	597
1882	Ga0495639_0020558	3300046475	Bacteria	2885
1883	Ga0495639_0095232	3300046475	Bacteria	1401
1884	Ga0495664_0437961	3300046477	Bacteria	783
1885	Ga0495584_0376939	3300046491	Bacteria	721
1886	Ga0495585_0010449	3300046492	Bacteria	5520
1887	Ga0495585_0167749	3300046492	Bacteria	1136
1888	Ga0495594_0698049	3300046499	Bacteria	574
1889	Ga0495596_0227076	3300046500	Bacteria	725
1890	Ga0495607_0337333	3300046501	Bacteria	699
1891	Ga0495583_0000510	3300046506	Bacteria	55787
1892	Ga0495583_0124309	3300046506	Bacteria	1083
1893	Ga0495583_0237254	3300046506	Bacteria	734
1894	Ga0495606_0003088	3300046507	Bacteria	18141
1895	Ga0495606_0055743	3300046507	Bacteria	2555
1896	Ga0495606_0348343	3300046507	Bacteria	787
1897	Ga0495608_0083536	3300046511	Bacteria	2073
1898	Ga0495608_0411968	3300046511	Bacteria	826
1899	Ga0495608_0482142	3300046511	Bacteria	752
1900	Ga0495610_0007369	3300046512	Bacteria	7341
1901	Ga0495610_0025318	3300046512	Bacteria	3186
1902	Ga0495610_0152175	3300046512	Bacteria	986
1903	Ga0495618_0210570	3300046514	Bacteria	1229
1904	Ga0495620_0021563	3300046515	Bacteria	3126
1905	Ga0495620_0412949	3300046515	Bacteria	511
1906	Ga0495628_0102358	3300046516	Bacteria	2210
1907	Ga0495628_0282688	3300046516	Bacteria	1232
1908	Ga0495630_0113383	3300046517	Bacteria	2054
1909	Ga0495630_0126006	3300046517	Bacteria	1944
1910	Ga0495631_0022122	3300046518	Bacteria	2957
1911	Ga0495631_0249790	3300046518	Bacteria	756
1912	Ga0495632_0014757	3300046519	Bacteria	4407
1913	Ga0495632_0065630	3300046519	Bacteria	1753
1914	Ga0495632_0140722	3300046519	Bacteria	1119
1915	Ga0495632_0443790	3300046519	Bacteria	563
1916	Ga0495643_0019121	3300046522	Bacteria	3966
1917	Ga0495643_0244020	3300046522	Bacteria	841
1918	Ga0495648_0189097	3300046524	Bacteria	1040
1919	Ga0495648_0297242	3300046524	Bacteria	758
1920	Ga0495648_0356901	3300046524	Bacteria	666
1921	Ga0495666_0107065	3300046526	Bacteria	1315
1922	Ga0495642_0053512	3300046528	Bacteria	1664
1923	Ga0495642_0088118	3300046528	Bacteria	1312
1924	Ga0495652_0122016	3300046529	Bacteria	2076
1925	Ga0495652_0781990	3300046529	Bacteria	637
1926	Ga0495654_0056414	3300046530	Bacteria	1899
1927	Ga0495665_0139846	3300046531	Bacteria	1266
1928	Ga0495586_0061618	3300046535	Bacteria	2042
1929	Ga0495586_0227722	3300046535	Bacteria	1060
1930	Ga0495586_0724940	3300046535	Bacteria	574
1931	Ga0495598_0020184	3300046537	Bacteria	1756
1932	Ga0495598_0031772	3300046537	Bacteria	1487
1933	Ga0495621_0004071	3300046539	Bacteria	4071
1934	Ga0495621_0012556	3300046539	Bacteria	2642
1935	Ga0495621_0195902	3300046539	Bacteria	811
1936	Ga0495645_0034282	3300046543	Bacteria	3704
1937	Ga0495645_0098975	3300046543	Bacteria	2075
1938	Ga0495645_0385066	3300046543	Bacteria	896
1939	Ga0495622_0022381	3300046557	Bacteria	2945
1940	Ga0495633_0120456	3300046558	Bacteria	1216
1941	Ga0495633_0243197	3300046558	Bacteria	822
1942	Ga0495667_0115936	3300046559	Bacteria	1731
1943	Ga0495656_0175931	3300046615	Bacteria	1049
1944	Ga0495668_0089410	3300046616	Bacteria	1688
1945	Ga0495668_0173003	3300046616	Bacteria	1183
1946	Ga0495668_0179895	3300046616	Bacteria	1158
1947	Ga0495668_0752842	3300046616	Bacteria	539
1948	Ga0495634_0233781	3300046642	Bacteria	1130
1949	Ga0495634_0524292	3300046642	Bacteria	693
1950	Ga0495611_0033426	3300046648	Bacteria	2269
1951	Ga0495611_0137743	3300046648	Bacteria	1140
1952	Ga0495611_0166890	3300046648	Bacteria	1029
1953	Ga0495625_0006868	3300046660	Bacteria	10052
1954	Ga0495625_0039878	3300046660	Bacteria	3427
1955	Ga0495625_0340532	3300046660	Bacteria	950
1956	Ga0495625_0710714	3300046660	Bacteria	592
1957	Ga0495625_0772937	3300046660	Bacteria	561
1958	Ga0495635_0073555	3300046663	Bacteria	2341
1959	Ga0495635_0412158	3300046663	Bacteria	896
1960	Ga0495635_0754799	3300046663	Bacteria	629
1961	Ga0495659_0146199	3300046664	Bacteria	946
1962	Ga0495588_0504878	3300046674	Bacteria	634
1963	Ga0495657_0099043	3300046675	Bacteria	1860
1964	Ga0495623_0189415	3300046679	Bacteria	1190
1965	Ga0495647_0085698	3300046681	Bacteria	1284
1966	Ga0495647_0124789	3300046681	Bacteria	1086
1967	Ga0495647_0218435	3300046681	Bacteria	841
1968	Ga0495647_0313460	3300046681	Bacteria	709
1969	Ga0495647_0501229	3300046681	Bacteria	565
1970	Ga0495658_0085813	3300046683	Bacteria	1856
1971	Ga0495658_0105468	3300046683	Bacteria	1688
1972	Ga0495658_0134744	3300046683	Bacteria	1506
1973	Ga0495658_0312758	3300046683	Bacteria	995
1974	Ga0495669_0084855	3300046684	Bacteria	1457
1975	Ga0495669_0106577	3300046684	Bacteria	1306
1976	Ga0495613_0091108	3300046689	Bacteria	2208
1977	Ga0495613_0647344	3300046689	Bacteria	700
1978	Ga0495624_0466516	3300046690	Bacteria	756
1979	Ga0495670_0361131	3300046691	Bacteria	782
1980	Ga0495670_0483316	3300046691	Bacteria	672
1981	Ga0495671_0186235	3300046692	Bacteria	1008
1982	Ga0495649_0000961	3300046694	Bacteria	22764
1983	Ga0495649_0006057	3300046694	Bacteria	7562
1984	Ga0495589_0004694	3300046794	Bacteria	7256
1985	Ga0495589_0074447	3300046794	Bacteria	1657
1986	Ga0495660_0151509	3300046810	Bacteria	1144
1987	Ga0495660_0403761	3300046810	Bacteria	598
1988	Ga0495581_0291649	3300047315	Bacteria	954
1989	Ga0495581_0754856	3300047315	Bacteria	560
1990	Ga0495604_0658881	3300047317	Bacteria	667
1991	Ga0495636_0078088	3300047318	Bacteria	1422
1992	Ga0495672_0429913	3300047320	Bacteria	599
1993	Ga0495676_0010234	3300047321	Bacteria	8515
1994	Ga0495676_0556838	3300047321	Bacteria	749
1995	Ga0495680_0264442	3300047322	Bacteria	1216
1996	Ga0495680_0889342	3300047322	Bacteria	576
1997	Ga0495683_0124071	3300047323	Bacteria	1223
1998	Ga0495687_036928	3300047443	Bacteria	2180
1999	Ga0495677_0169910	3300047445	Bacteria	843
2000	Ga0495679_076308	3300047446	Bacteria	958
2001	Ga0495685_088317	3300047447	Bacteria	1029
2002	Ga0495685_287289	3300047447	Bacteria	518
2003	Ga0495673_0135384	3300047469	Bacteria	965
2004	Ga0495681_0173444	3300047470	Bacteria	891
2005	Ga0495684_0188245	3300047471	Bacteria	1527
2006	Ga0495686_0004619	3300047472	Bacteria	11207
2007	Ga0495686_0039632	3300047472	Bacteria	3008
2008	Ga0495686_0066900	3300047472	Bacteria	2219
2009	Ga0495686_0067186	3300047472	Bacteria	2213
2010	Ga0495593_0038039	3300047673	Bacteria	2600
2011	Ga0495593_0172300	3300047673	Bacteria	1091
2012	Ga0495602_0185169	3300048088	Bacteria	1602
2013	Ga0495602_1038412	3300048088	Bacteria	539
2014	Ga0495614_0095045	3300048089	Bacteria	1299
2015	Ga0495614_0502354	3300048089	Bacteria	577
2016	Ga0495615_0017661	3300048090	Bacteria	1558
2017	Ga0495626_0074338	3300048091	Bacteria	1521
2018	Ga0496100_0252057	3300048903	Bacteria	1306
2019	Ga0496100_0333732	3300048903	Bacteria	1142
2020	Ga0496100_0472643	3300048903	Bacteria	963
2021	Ga0496100_1276362	3300048903	Bacteria	579
2022	Ga0496100_1364919	3300048903	Bacteria	559
2023	Ga0496101_0463082	3300048904	Bacteria	1000
2024	Ga0496101_0633712	3300048904	Bacteria	845
2025	Ga0496101_0977528	3300048904	Bacteria	666
2026	Ga0496101_1190889	3300048904	Bacteria	597
2027	Ga0496102_0060302	3300048905	Bacteria	3470
2028	Ga0496102_0351251	3300048905	Bacteria	1388
2029	Ga0496102_1304750	3300048905	Bacteria	645
2030	Ga0496102_1385053	3300048905	Bacteria	622
2031	Ga0496103_0130430	3300048906	Bacteria	1605
2032	Ga0496103_0784048	3300048906	Bacteria	602
2033	Ga0496104_0042754	3300048907	Bacteria	4254
2034	Ga0496104_0104722	3300048907	Bacteria	2711
2035	Ga0496104_0445409	3300048907	Bacteria	1207
2036	Ga0496104_0716495	3300048907	Bacteria	908
2037	Ga0496104_0872243	3300048907	Bacteria	805
2038	Ga0496105_0277574	3300048908	Bacteria	1352
2039	Ga0496105_0289103	3300048908	Bacteria	1320
2040	Ga0496105_0987196	3300048908	Bacteria	630
2041	Ga0496106_0113183	3300048909	Bacteria	2115
2042	Ga0496106_0173396	3300048909	Bacteria	1710
2043	Ga0496106_0275442	3300048909	Bacteria	1347
2044	Ga0496106_0405347	3300048909	Bacteria	1096
2045	Ga0496106_0453539	3300048909	Bacteria	1030
2046	Ga0496106_0659469	3300048909	Bacteria	836
2047	Ga0496106_0870911	3300048909	Bacteria	712
2048	Ga0496107_0032434	3300048910	Bacteria	3733
2049	Ga0496107_0499242	3300048910	Bacteria	903
2050	Ga0496108_0005999	3300048911	Bacteria	9840
2051	Ga0496108_0009350	3300048911	Bacteria	7937
2052	Ga0496108_0042133	3300048911	Bacteria	3811
2053	Ga0496108_0089279	3300048911	Bacteria	2619
2054	Ga0496108_0097580	3300048911	Bacteria	2504
2055	Ga0496108_0132496	3300048911	Bacteria	2142
2056	Ga0496108_0681315	3300048911	Bacteria	892
2057	Ga0496108_1363297	3300048911	Bacteria	594
2058	Ga0496109_0084426	3300048912	Bacteria	2930
2059	Ga0496109_0188205	3300048912	Bacteria	1939
2060	Ga0496109_0220464	3300048912	Bacteria	1784
2061	Ga0496109_0259357	3300048912	Bacteria	1637
2062	Ga0496109_0267867	3300048912	Bacteria	1609
2063	Ga0496109_0442069	3300048912	Bacteria	1228
2064	Ga0496109_0461604	3300048912	Bacteria	1199
2065	Ga0496109_1285147	3300048912	Bacteria	668
2066	Ga0496109_1471351	3300048912	Bacteria	616
2067	Ga0496110_0367167	3300048913	Bacteria	1311
2068	Ga0496110_0585154	3300048913	Bacteria	1013
2069	Ga0496110_0672888	3300048913	Bacteria	936
2070	Ga0496110_1212241	3300048913	Bacteria	664
2071	Ga0496110_1829231	3300048913	Bacteria	517
2072	Ga0496111_0402807	3300048914	Bacteria	1011
2073	Ga0496111_0611350	3300048914	Bacteria	797
2074	Ga0496112_0018422	3300048915	Bacteria	6573
2075	Ga0496112_0462843	3300048915	Bacteria	1206
2076	Ga0496112_0475015	3300048915	Bacteria	1187
2077	Ga0496113_0089439	3300048916	Bacteria	2370
2078	Ga0496113_0211725	3300048916	Bacteria	1543
2079	Ga0496113_0215057	3300048916	Bacteria	1531
2080	Ga0496113_0310758	3300048916	Bacteria	1263
2081	Ga0496113_0520577	3300048916	Bacteria	955
2082	Ga0496113_1530567	3300048916	Bacteria	514
2083	Ga0496114_0010053	3300048917	Bacteria	7523
2084	Ga0496114_0198844	3300048917	Bacteria	1755
2085	Ga0496114_0360775	3300048917	Bacteria	1285
2086	Ga0496114_0414600	3300048917	Bacteria	1193
2087	Ga0496114_0929831	3300048917	Bacteria	751
2088	Ga0496115_0030230	3300048918	Bacteria	4260
2089	Ga0496115_1370005	3300048918	Bacteria	524
2090	Ga0496117_0269106	3300048920	Bacteria	919
2091	Ga0496121_0042385	3300048924	Bacteria	3960
2092	Ga0496122_0439798	3300048925	Bacteria	650
2093	Ga0496124_0001830	3300048927	Bacteria	29398
2094	Ga0496124_0030272	3300048927	Bacteria	4807
2095	Ga0496124_0506789	3300048927	Bacteria	808
2096	Ga0496125_0013937	3300048928	Bacteria	7862
2097	Ga0496125_0090638	3300048928	Bacteria	2294
2098	Ga0496125_0413814	3300048928	Bacteria	784
2099	Ga0496125_0579762	3300048928	Bacteria	616
2100	Ga0496126_0684633	3300048929	Bacteria	799
2101	Ga0501306_000061	3300049127	Bacteria	5674
2102	Ga0501306_001000	3300049127	Bacteria	2483
2103	Ga0501306_001910	3300049127	Bacteria	2048
2104	Ga0501306_002632	3300049127	Bacteria	1864
2105	Ga0501306_004240	3300049127	Bacteria	1597
2106	Ga0501306_008288	3300049127	Bacteria	1264
2107	Ga0501306_010649	3300049127	Bacteria	1161
2108	Ga0501306_021776	3300049127	Bacteria	900
2109	Ga0501306_034908	3300049127	Bacteria	761
2110	Ga0501306_090060	3300049127	Bacteria	538
2111	Ga0501308_000386	3300049128	Bacteria	2793
2112	Ga0501308_001895	3300049128	Bacteria	1757
2113	Ga0501308_004481	3300049128	Bacteria	1348
2114	Ga0501308_004862	3300049128	Bacteria	1314
2115	Ga0501308_005770	3300049128	Bacteria	1247
2116	Ga0501308_008299	3300049128	Bacteria	1109
2117	Ga0501308_061660	3300049128	Bacteria	567
2118	Ga0501308_071466	3300049128	Bacteria	540
2119	Ga0501308_079555	3300049128	Bacteria	520
2120	Ga0501309_000014	3300049129	Bacteria	8867
2121	Ga0501309_001211	3300049129	Bacteria	2453
2122	Ga0501309_018080	3300049129	Bacteria	971
2123	Ga0501309_027708	3300049129	Bacteria	823
2124	Ga0501309_031747	3300049129	Bacteria	782
2125	Ga0501310_000059	3300049130	Bacteria	10166
2126	Ga0501310_002023	3300049130	Bacteria	1893
2127	Ga0501310_004096	3300049130	Bacteria	1450
2128	Ga0501310_005085	3300049130	Bacteria	1342
2129	Ga0501310_006346	3300049130	Bacteria	1240
2130	Ga0501310_009745	3300049130	Bacteria	1063
2131	Ga0501310_010559	3300049130	Bacteria	1032
2132	Ga0501310_011089	3300049130	Bacteria	1016
2133	Ga0501310_011540	3300049130	Bacteria	1001
2134	Ga0501341_08841	3300049131	Bacteria	647
2135	Ga0501304_000014	3300049160	Bacteria	8417
2136	Ga0501304_000512	3300049160	Bacteria	2059
2137	Ga0501304_001736	3300049160	Bacteria	1438
2138	Ga0501304_008754	3300049160	Bacteria	858
2139	Ga0501304_009642	3300049160	Bacteria	832
2140	Ga0501304_020524	3300049160	Bacteria	652
2141	Ga0501304_021454	3300049160	Bacteria	643
2142	Ga0501304_023767	3300049160	Bacteria	621
2143	Ga0501305_000004	3300049161	Bacteria	13267
2144	Ga0501305_000819	3300049161	Bacteria	2765
2145	Ga0501305_002640	3300049161	Bacteria	1956
2146	Ga0501305_002660	3300049161	Bacteria	1951
2147	Ga0501305_012826	3300049161	Bacteria	1151
2148	Ga0501305_017017	3300049161	Bacteria	1042
2149	Ga0501305_050112	3300049161	Bacteria	699
2150	Ga0501305_067210	3300049161	Bacteria	625
2151	Ga0501305_067211	3300049161	Bacteria	625
2152	Ga0501305_113880	3300049161	Bacteria	514
2153	Ga0501307_000029	3300049162	Bacteria	5210
2154	Ga0501307_000963	3300049162	Bacteria	2241
2155	Ga0501307_001704	3300049162	Bacteria	1920
2156	Ga0501307_003905	3300049162	Bacteria	1491
2157	Ga0501307_004808	3300049162	Bacteria	1399
2158	Ga0501307_015778	3300049162	Bacteria	936
2159	Ga0501307_044648	3300049162	Bacteria	652
2160	Ga0495678_114127	3300049459	Bacteria	917
2161	Ga0495682_0058348	3300049460	Bacteria	1396
2162	Ga0495682_0222752	3300049460	Bacteria	668
2163	Ga0501290_008662	3300049513	Bacteria	1289
2164	Ga0501290_024194	3300049513	Bacteria	845
2165	Ga0501291_001472	3300049514	Bacteria	2738
2166	Ga0501291_116080	3300049514	Bacteria	575
2167	Ga0501292_005043	3300049515	Bacteria	1828
2168	Ga0501292_061064	3300049515	Bacteria	684
2169	Ga0501293_004264	3300049516	Bacteria	1124
2170	Ga0501294_003852	3300049517	Bacteria	1414
2171	Ga0501294_020684	3300049517	Bacteria	711
2172	Ga0501295_181222	3300049518	Bacteria	528
2173	Ga0501298_091097	3300049521	Bacteria	683
2174	Ga0501299_065889	3300049522	Bacteria	777
2175	Ga0501300_000354	3300049523	Bacteria	6950
2176	Ga0501300_037689	3300049523	Bacteria	723
2177	Ga0501303_012181	3300049526	Bacteria	826
2178	Ga0501311_000038	3300049527	Bacteria	5334
2179	Ga0501311_004807	3300049527	Bacteria	1454
2180	Ga0501311_020049	3300049527	Bacteria	901
2181	Ga0501311_030615	3300049527	Bacteria	778
2182	Ga0501311_038497	3300049527	Bacteria	718
2183	Ga0501311_079369	3300049527	Bacteria	556
2184	Ga0501312_000016	3300049528	Bacteria	9244
2185	Ga0501312_002743	3300049528	Bacteria	1929
2186	Ga0501312_003126	3300049528	Bacteria	1852
2187	Ga0501312_023589	3300049528	Bacteria	928
2188	Ga0501312_025631	3300049528	Bacteria	899
2189	Ga0501312_030444	3300049528	Bacteria	844
2190	Ga0501312_034796	3300049528	Bacteria	804
2191	Ga0501312_037564	3300049528	Bacteria	781
2192	Ga0501312_039210	3300049528	Bacteria	769
2193	Ga0501312_098174	3300049528	Bacteria	547
2194	Ga0501313_002333	3300049529	Bacteria	1790
2195	Ga0501313_003194	3300049529	Bacteria	1613
2196	Ga0501313_004401	3300049529	Bacteria	1446
2197	Ga0501313_012245	3300049529	Bacteria	997
2198	Ga0501313_012722	3300049529	Bacteria	983
2199	Ga0501313_016733	3300049529	Bacteria	882
2200	Ga0501314_000017	3300049530	Bacteria	8558
2201	Ga0501314_000291	3300049530	Bacteria	2937
2202	Ga0501314_002757	3300049530	Bacteria	1379
2203	Ga0501314_003125	3300049530	Bacteria	1321
2204	Ga0501314_012188	3300049530	Bacteria	822
2205	Ga0501314_045989	3300049530	Bacteria	518
2206	Ga0501314_047758	3300049530	Bacteria	512
2207	Ga0501315_000346	3300049531	Bacteria	3048
2208	Ga0501315_003778	3300049531	Bacteria	1539
2209	Ga0501315_004450	3300049531	Bacteria	1466
2210	Ga0501315_011517	3300049531	Bacteria	1081
2211	Ga0501315_019718	3300049531	Bacteria	899
2212	Ga0501315_020831	3300049531	Bacteria	883
2213	Ga0501315_021446	3300049531	Bacteria	875
2214	Ga0501315_029896	3300049531	Bacteria	780
2215	Ga0501316_000872	3300049532	Bacteria	2338
2216	Ga0501316_001021	3300049532	Bacteria	2235
2217	Ga0501316_027141	3300049532	Bacteria	752
2218	Ga0501316_074638	3300049532	Bacteria	518
2219	Ga0501317_000290	3300049533	Bacteria	3266
2220	Ga0501317_004064	3300049533	Bacteria	1501
2221	Ga0501317_005768	3300049533	Bacteria	1339
2222	Ga0501317_008980	3300049533	Bacteria	1164
2223	Ga0501317_026465	3300049533	Bacteria	818
2224	Ga0501317_035748	3300049533	Bacteria	740
2225	Ga0501317_064768	3300049533	Bacteria	606
2226	Ga0501318_000131	3300049534	Bacteria	3541
2227	Ga0501318_000548	3300049534	Bacteria	2463
2228	Ga0501318_000712	3300049534	Bacteria	2277
2229	Ga0501318_000842	3300049534	Bacteria	2162
2230	Ga0501318_008820	3300049534	Bacteria	1087
2231	Ga0501318_024472	3300049534	Bacteria	786
2232	Ga0501318_076796	3300049534	Bacteria	535
2233	Ga0501319_001099	3300049535	Bacteria	1496
2234	Ga0501319_006366	3300049535	Bacteria	869
2235	Ga0501319_015690	3300049535	Bacteria	645
2236	Ga0501319_020124	3300049535	Bacteria	594
2237	Ga0501320_000131	3300049536	Bacteria	3444
2238	Ga0501320_000368	3300049536	Bacteria	2523
2239	Ga0501320_001178	3300049536	Bacteria	1838
2240	Ga0501320_002176	3300049536	Bacteria	1543
2241	Ga0501320_007324	3300049536	Bacteria	1059
2242	Ga0501320_011109	3300049536	Bacteria	928
2243	Ga0501320_012754	3300049536	Bacteria	889
2244	Ga0501320_047658	3300049536	Bacteria	577
2245	Ga0501321_000120	3300049537	Bacteria	3982
2246	Ga0501321_001939	3300049537	Bacteria	1730
2247	Ga0501321_003376	3300049537	Bacteria	1456
2248	Ga0501321_015469	3300049537	Bacteria	898
2249	Ga0501322_000402	3300049538	Bacteria	1998
2250	Ga0501322_001921	3300049538	Bacteria	1230
2251	Ga0501322_003039	3300049538	Bacteria	1066
2252	Ga0501322_004500	3300049538	Bacteria	940
2253	Ga0501322_009218	3300049538	Bacteria	744
2254	Ga0501322_011890	3300049538	Bacteria	686
2255	Ga0501323_000187	3300049539	Bacteria	3964
2256	Ga0501323_000789	3300049539	Bacteria	2528
2257	Ga0501323_006346	3300049539	Bacteria	1319
2258	Ga0501323_008999	3300049539	Bacteria	1170
2259	Ga0501323_024201	3300049539	Bacteria	819
2260	Ga0501323_068888	3300049539	Bacteria	563
2261	Ga0501323_072213	3300049539	Bacteria	554
2262	Ga0501324_000221	3300049540	Bacteria	2719
2263	Ga0501325_000034	3300049541	Bacteria	3949
2264	Ga0501325_005902	3300049541	Bacteria	989
2265	Ga0501325_021461	3300049541	Bacteria	684
2266	Ga0501325_043809	3300049541	Bacteria	552
2267	Ga0501327_05188	3300049543	Bacteria	764
2268	Ga0501329_01093	3300049545	Bacteria	1126
2269	Ga0501331_04395	3300049547	Bacteria	784
2270	Ga0501331_05271	3300049547	Bacteria	735
2271	Ga0501333_004818	3300049549	Bacteria	860
2272	Ga0501335_001771	3300049551	Bacteria	1695
2273	Ga0501336_003790	3300049552	Bacteria	1037
2274	Ga0501336_027491	3300049552	Bacteria	546
2275	Ga0501338_08820	3300049554	Bacteria	666
2276	Ga0501340_001368	3300049556	Bacteria	1306
2277	Ga0501340_005147	3300049556	Bacteria	844
2278	Ga0501340_024199	3300049556	Bacteria	524
2279	Ga0501032_0396197	3300049569	Bacteria	887
2280	Ga0501034_0080413	3300049571	Bacteria	3262
2281	Ga0501036_0190196	3300049572	Bacteria	1727
2282	Ga0501038_0476077	3300049574	Bacteria	957
2283	Ga0501042_0241064	3300049578	Bacteria	1305
2284	Ga0501043_0000090	3300049579	Bacteria	81336
2285	Ga0501043_0044507	3300049579	Bacteria	3490
2286	Ga0501046_0000126	3300049580	Bacteria	81334
2287	Ga0501046_0029736	3300049580	Bacteria	4440
2288	Ga0501047_0000160	3300049581	Bacteria	81946
2289	Ga0501047_0030021	3300049581	Bacteria	5240
2290	Ga0501048_0003429	3300049582	Bacteria	12039
2291	Ga0501048_1393230	3300049582	Bacteria	504
2292	Ga0501067_0101508	3300049583	Bacteria	1599
2293	Ga0501073_0691400	3300049589	Bacteria	704
2294	Ga0501073_0858074	3300049589	Bacteria	625
2295	Ga0501074_0224902	3300049590	Bacteria	1336
2296	Ga0501076_1311449	3300049592	Bacteria	595
2297	Ga0501198_000043	3300049649	Bacteria	44170
2298	Ga0501199_015399	3300049650	Bacteria	855
2299	Ga0501201_004715	3300049651	Bacteria	1267
2300	Ga0501202_000808	3300049652	Bacteria	4708
2301	Ga0501202_068297	3300049652	Bacteria	815
2302	Ga0501206_009648	3300049653	Bacteria	1286
2303	Ga0501206_011506	3300049653	Bacteria	1195
2304	Ga0501206_056624	3300049653	Bacteria	635
2305	Ga0501207_026079	3300049654	Bacteria	961
2306	Ga0501207_059914	3300049654	Bacteria	696
2307	Ga0501208_025836	3300049655	Bacteria	1001
2308	Ga0501210_008848	3300049657	Bacteria	784
2309	Ga0501211_000022	3300049658	Bacteria	11753
2310	Ga0501216_119832	3300049660	Bacteria	599
2311	Ga0501217_050216	3300049661	Bacteria	1088
2312	Ga0501222_000051	3300049662	Bacteria	43800
2313	Ga0501222_002187	3300049662	Bacteria	2713
2314	Ga0501222_012076	3300049662	Bacteria	1139
2315	Ga0501223_007701	3300049663	Bacteria	2200
2316	Ga0501227_003969	3300049665	Bacteria	3187
2317	Ga0501235_001228	3300049669	Bacteria	5397
2318	Ga0501235_018958	3300049669	Bacteria	1526
2319	Ga0501236_044001	3300049670	Bacteria	747
2320	Ga0501236_045218	3300049670	Bacteria	741
2321	Ga0501247_056126	3300049677	Bacteria	595
2322	Ga0501249_003813	3300049679	Bacteria	3043
2323	Ga0501251_026457	3300049681	Bacteria	803
2324	Ga0501252_007150	3300049682	Bacteria	1258
2325	Ga0501253_000109	3300049683	Bacteria	5987
2326	Ga0501257_072238	3300049686	Bacteria	883
2327	Ga0501257_146633	3300049686	Bacteria	648
2328	Ga0501258_000137	3300049687	Bacteria	4092
2329	Ga0501261_024879	3300049690	Bacteria	879
2330	Ga0501261_094887	3300049690	Bacteria	559
2331	Ga0501221_001094	3300049704	Bacteria	4449
2332	Ga0501225_0006245	3300049705	Bacteria	3481
2333	Ga0501225_0268577	3300049705	Bacteria	567
2334	Ga0501229_001006	3300049706	Bacteria	3217
2335	Ga0501229_046104	3300049706	Bacteria	633
2336	Ga0501245_081691	3300049708	Bacteria	626
2337	Ga0501080_0044455	3300049742	Bacteria	4134
2338	Ga0501083_0159916	3300049744	Bacteria	1474
2339	Ga0501241_041689	3300049758	Bacteria	891
2340	Ga0501262_000590	3300049759	Bacteria	4309
2341	Ga0501262_012757	3300049759	Bacteria	1077
2342	Ga0501264_023177	3300049761	Bacteria	672
2343	Ga0501264_038383	3300049761	Bacteria	578
2344	Ga0501266_028852	3300049763	Bacteria	785
2345	Ga0501267_000666	3300049764	Bacteria	2729
2346	Ga0501268_001964	3300049765	Bacteria	2639
2347	Ga0501269_001030	3300049766	Bacteria	3942
2348	Ga0501272_000140	3300049769	Bacteria	5782
2349	Ga0501273_016888	3300049770	Bacteria	960
2350	Ga0501274_054769	3300049771	Bacteria	508
2351	Ga0501279_052894	3300049775	Bacteria	648
2352	Ga0501280_039085	3300049776	Bacteria	765
2353	Ga0501280_054761	3300049776	Bacteria	680
2354	Ga0501281_09341	3300049777	Bacteria	689
2355	Ga0501282_013783	3300049778	Bacteria	876
2356	Ga0501035_0020355	3300049822	Bacteria	6092
2357	Ga0501044_0041861	3300049823	Bacteria	4768
2358	Ga0501044_0057237	3300049823	Bacteria	4001
2359	Ga0501045_0000882	3300049824	Bacteria	19499
2360	Ga0501226_002381	3300049853	Bacteria	2305
2361	nmdc:mga03683_107312_c1	3300050489	Bacteria	1232
2362	nmdc:mga03683_113966_c1	3300050489	Bacteria	1198
2363	nmdc:mga03683_130671_c1	3300050489	Bacteria	1123
2364	nmdc:mga03683_13626_c1	3300050489	Bacteria	2997
2365	nmdc:mga03683_137878_c1	3300050489	Bacteria	1095
2366	nmdc:mga03683_18745_c1	3300050489	Bacteria	2635
2367	nmdc:mga03683_305393_c1	3300050489	Bacteria	747
2368	nmdc:mga03683_340428_c1	3300050489	Bacteria	709
2369	nmdc:mga03683_38113_c1	3300050489	Bacteria	1962
2370	nmdc:mga03683_40005_c1	3300050489	Bacteria	1921
2371	nmdc:mga03683_408709_c1	3300050489	Bacteria	649
2372	nmdc:mga03683_60917_c2	3300050489	Bacteria	1346
2373	nmdc:mga03683_65613_c1	3300050489	Bacteria	1542
2374	nmdc:mga03683_703292_c1	3300050489	Bacteria	500
2375	nmdc:mga03n38_134111_c1	3300050490	Bacteria	1230
2376	nmdc:mga03n38_141615_c1	3300050490	Bacteria	1201
2377	nmdc:mga03n38_264042_c1	3300050490	Bacteria	914
2378	nmdc:mga03n38_282162_c1	3300050490	Bacteria	887
2379	nmdc:mga03n38_374893_c1	3300050490	Bacteria	779
2380	nmdc:mga03n38_4317_c1	3300050490	Bacteria	4691
2381	nmdc:mga03n38_4851_c1	3300050490	Bacteria	4507
2382	nmdc:mga03n38_581661_c1	3300050490	Bacteria	636
2383	nmdc:mga03n38_96135_c1	3300050490	Bacteria	1420
2384	nmdc:mga00v17_113515_c1	3300050491	Bacteria	1720
2385	nmdc:mga00v17_13392_c1	3300050491	Bacteria	4553
2386	nmdc:mga00v17_17620_c1	3300050491	Bacteria	4047
2387	nmdc:mga00v17_198473_c1	3300050491	Bacteria	1297
2388	nmdc:mga00v17_533261_c1	3300050491	Bacteria	760
2389	nmdc:mga00v17_839825_c1	3300050491	Bacteria	584
2390	nmdc:mga0yw44_22084_c1	3300050492	Bacteria	3562
2391	nmdc:mga0yw44_283449_c1	3300050492	Bacteria	1108
2392	nmdc:mga0yw44_486323_c1	3300050492	Bacteria	837
2393	nmdc:mga0k408_1021_c1	3300050493	Bacteria	15347
2394	nmdc:mga0k408_12806_c1	3300050493	Bacteria	4590
2395	nmdc:mga0k408_13979_c1	3300050493	Bacteria	4412
2396	nmdc:mga0k408_144341_c1	3300050493	Bacteria	1417
2397	nmdc:mga0k408_145503_c1	3300050493	Bacteria	1411
2398	nmdc:mga0k408_149455_c1	3300050493	Bacteria	1391
2399	nmdc:mga0k408_153520_c1	3300050493	Bacteria	1371
2400	nmdc:mga0k408_17134_c1	3300050493	Bacteria	4032
2401	nmdc:mga0k408_219_c1	3300050493	Bacteria	23656
2402	nmdc:mga0k408_22144_c1	3300050493	Bacteria	3577
2403	nmdc:mga0k408_23422_c1	3300050493	Bacteria	3483
2404	nmdc:mga0k408_23786_c1	3300050493	Bacteria	3460
2405	nmdc:mga0k408_255163_c1	3300050493	Bacteria	1047
2406	nmdc:mga0k408_28249_c1	3300050493	Bacteria	3190
2407	nmdc:mga0k408_283141_c1	3300050493	Bacteria	990
2408	nmdc:mga0k408_318491_c1	3300050493	Bacteria	928
2409	nmdc:mga0k408_325174_c1	3300050493	Bacteria	918
2410	nmdc:mga0k408_34347_c1	3300050493	Bacteria	2903
2411	nmdc:mga0k408_389586_c1	3300050493	Bacteria	830
2412	nmdc:mga0k408_407607_c1	3300050493	Bacteria	809
2413	nmdc:mga0k408_46982_c1	3300050493	Bacteria	2494
2414	nmdc:mga0k408_485423_c1	3300050493	Bacteria	733
2415	nmdc:mga0k408_49108_c1	3300050493	Bacteria	2443
2416	nmdc:mga0k408_52239_c1	3300050493	Bacteria	2369
2417	nmdc:mga0k408_576153_c1	3300050493	Bacteria	665
2418	nmdc:mga0k408_59597_c1	3300050493	Bacteria	2218
2419	nmdc:mga0k408_6946_c1	3300050493	Bacteria	6039
2420	nmdc:mga0k408_715878_c1	3300050493	Bacteria	586
2421	nmdc:mga0k408_7194_c1	3300050493	Bacteria	5950
2422	nmdc:mga0k408_887151_c1	3300050493	Bacteria	518
2423	nmdc:mga06z11_11386_c1	3300050494	Bacteria	3834
2424	nmdc:mga06z11_1936_c1	3300050494	Bacteria	7811
2425	nmdc:mga06z11_267106_c1	3300050494	Bacteria	1011
2426	nmdc:mga06z11_3023_c1	3300050494	Bacteria	6473
2427	nmdc:mga06z11_31530_c1	3300050494	Bacteria	2577
2428	nmdc:mga06z11_49595_c1	3300050494	Bacteria	2143
2429	nmdc:mga06z11_766715_c1	3300050494	Bacteria	588
2430	nmdc:mga06z11_888211_c1	3300050494	Bacteria	543
2431	nmdc:mga04h51_124738_c1	3300050495	Bacteria	963
2432	nmdc:mga04h51_127546_c1	3300050495	Bacteria	954
2433	nmdc:mga04h51_174528_c1	3300050495	Bacteria	834
2434	nmdc:mga04h51_278768_c1	3300050495	Bacteria	677
2435	nmdc:mga07m45_13904_c1	3300050496	Bacteria	4278
2436	nmdc:mga07m45_15127_c1	3300050496	Bacteria	4120
2437	nmdc:mga07m45_173746_c1	3300050496	Bacteria	1253
2438	nmdc:mga07m45_248853_c1	3300050496	Bacteria	1034
2439	nmdc:mga07m45_2931_c1	3300050496	Bacteria	8100
2440	nmdc:mga07m45_333439_c1	3300050496	Bacteria	882
2441	nmdc:mga07m45_380028_c1	3300050496	Bacteria	820
2442	nmdc:mga07m45_386083_c1	3300050496	Bacteria	813
2443	nmdc:mga07m45_398_c1	3300050496	Bacteria	17925
2444	nmdc:mga07m45_401346_c1	3300050496	Bacteria	796
2445	nmdc:mga07m45_535287_c1	3300050496	Bacteria	678
2446	nmdc:mga07m45_670_c1	3300050496	Bacteria	14551
2447	nmdc:mga07m45_6867_c1	3300050496	Bacteria	5791
2448	nmdc:mga07m45_69529_c1	3300050496	Bacteria	2002
2449	nmdc:mga07m45_71727_c1	3300050496	Bacteria	1971
2450	nmdc:mga07m45_74068_c1	3300050496	Bacteria	1940
2451	nmdc:mga07m45_74708_c1	3300050496	Bacteria	1631
2452	nmdc:mga05p37_217522_c1	3300050507	Bacteria	2307
2453	nmdc:mga09592_38477_c1	3300050508	Bacteria	4016
2454	nmdc:mga0qj67_972254_c1	3300050509	Bacteria	667
2455	nmdc:mga0n895_412583_c1	3300050512	Bacteria	1365
2456	nmdc:mga0rr50_369987_c1	3300050513	Bacteria	1207
2457	nmdc:mga0rr50_423398_c1	3300050513	Bacteria	1126
2458	nmdc:mga0sz30_159984_c1	3300050516	Bacteria	998
2459	nmdc:mga0sz30_172155_c1	3300050516	Bacteria	960
2460	nmdc:mga0sz30_396728_c1	3300050516	Bacteria	618
2461	nmdc:mga0sz30_3989_c1	3300050516	Bacteria	5314
2462	nmdc:mga0sz30_7140_c1	3300050516	Bacteria	4180
2463	Ga0495612_0100041	3300053078	Bacteria	1234
2464	Ga0495612_0132131	3300053078	Bacteria	1079
2465	Ga0500635_0000036	3300053080	Bacteria	94740
2466	Ga0500635_0116347	3300053080	Bacteria	997
2467	Ga0495595_0288249	3300053084	Bacteria	825
2468	Ga0495595_0329422	3300053084	Bacteria	769
2469	Ga0495619_0076699	3300053085	Bacteria	2244
2470	Ga0495619_0264261	3300053085	Bacteria	1192
2471	Ga0495619_0598312	3300053085	Bacteria	755
2472	Ga0500578_0000292	3300053086	Bacteria	61943
2473	Ga0500578_0079895	3300053086	Bacteria	2081
2474	Ga0500578_0234096	3300053086	Bacteria	1112
2475	Ga0500643_048658	3300053087	Bacteria	1218
2476	Ga0500644_0003475	3300053088	Bacteria	3899
2477	Ga0500646_0014216	3300053090	Bacteria	2064
2478	Ga0500646_0053402	3300053090	Bacteria	1172
2479	Ga0500646_0123475	3300053090	Bacteria	835
2480	Ga0500646_0192798	3300053090	Bacteria	696
2481	Ga0500647_0344943	3300053091	Bacteria	622
2482	Ga0500583_0174143	3300053092	Bacteria	1072
2483	Ga0500583_0437592	3300053092	Bacteria	622
2484	Ga0500651_0000274	3300053093	Bacteria	30518
2485	Ga0500651_0129786	3300053093	Bacteria	1525
2486	Ga0500651_0169517	3300053093	Bacteria	1302
2487	Ga0500651_0199263	3300053093	Bacteria	1182
2488	Ga0500651_0567225	3300053093	Bacteria	619
2489	Ga0500566_0489662	3300053094	Bacteria	531
2490	Ga0500641_0103989	3300053096	Bacteria	1219
2491	Ga0500650_0150156	3300053098	Bacteria	1077
2492	Ga0500650_0261559	3300053098	Bacteria	774
2493	Ga0500650_0385441	3300053098	Bacteria	608
2494	Ga0500557_070242	3300053105	Bacteria	1148
2495	Ga0500562_019007	3300053108	Bacteria	1775
2496	Ga0500562_081775	3300053108	Bacteria	874
2497	Ga0500569_001743	3300053109	Bacteria	4166
2498	Ga0500593_000235	3300053117	Bacteria	22775
2499	Ga0500593_079766	3300053117	Bacteria	1405
2500	Ga0500594_0013014	3300053118	Bacteria	1970
2501	Ga0500594_0061291	3300053118	Bacteria	1085
2502	Ga0500607_155896	3300053121	Bacteria	1051
2503	Ga0500608_137024	3300053122	Bacteria	1090
2504	Ga0500621_263949	3300053126	Bacteria	571
2505	Ga0500623_140348	3300053127	Bacteria	1016
2506	Ga0500628_006199	3300053129	Bacteria	2015
2507	Ga0500628_052264	3300053129	Bacteria	973
2508	Ga0500642_0002530	3300053130	Bacteria	5383
2509	Ga0500652_000400	3300053131	Bacteria	15538
2510	Ga0500652_118135	3300053131	Bacteria	1108
2511	Ga0500652_343050	3300053131	Bacteria	566
2512	Ga0500655_072343	3300053133	Bacteria	703
2513	Ga0500655_090443	3300053133	Bacteria	635
2514	Ga0500658_0190721	3300053134	Bacteria	935
2515	Ga0500658_0276932	3300053134	Bacteria	771
2516	Ga0500559_0003187	3300053136	Bacteria	8153
2517	Ga0500564_123671	3300053138	Bacteria	1125
2518	Ga0500564_150120	3300053138	Bacteria	994
2519	Ga0500564_358607	3300053138	Bacteria	540
2520	Ga0500568_0013644	3300053139	Bacteria	3696
2521	Ga0500568_0015583	3300053139	Bacteria	3401
2522	Ga0500568_0079576	3300053139	Bacteria	1245
2523	Ga0500573_0400656	3300053140	Bacteria	650
2524	Ga0500577_0017376	3300053142	Bacteria	2289
2525	Ga0500577_0517424	3300053142	Bacteria	521
2526	Ga0500579_229208	3300053143	Bacteria	634
2527	Ga0500588_0096304	3300053146	Bacteria	1014
2528	Ga0500589_138916	3300053147	Bacteria	1004
2529	Ga0500590_019884	3300053148	Bacteria	3481
2530	Ga0500604_0203201	3300053151	Bacteria	681
2531	Ga0500616_0096791	3300053153	Bacteria	1450
2532	Ga0500619_000012	3300053154	Bacteria	57280
2533	Ga0500622_0000198	3300053156	Bacteria	63633
2534	Ga0500622_0000978	3300053156	Bacteria	24237
2535	Ga0500622_0001316	3300053156	Bacteria	20204
2536	Ga0500627_0127318	3300053158	Bacteria	1150
2537	Ga0500627_0420048	3300053158	Bacteria	567
2538	Ga0500633_0204488	3300053160	Bacteria	739
2539	Ga0500633_0219524	3300053160	Bacteria	710
2540	Ga0500638_200485	3300053162	Bacteria	845
2541	Ga0500636_0125261	3300053177	Bacteria	1437
2542	Ga0500636_0259833	3300053177	Bacteria	879
2543	Ga0500636_0362004	3300053177	Bacteria	688
2544	Ga0500570_133500	3300053724	Bacteria	935
2545	Ga0500570_160073	3300053724	Bacteria	777
2546	Ga0500645_030754	3300053730	Bacteria	1615
2547	Ga0500645_051755	3300053730	Bacteria	1197
2548	Ga0500587_000541	3300053739	Bacteria	4638
2549	Ga0500587_006132	3300053739	Bacteria	1604
2550	Ga0500661_007894	3300055283	Bacteria	1962
2551	Ga0500661_081846	3300055283	Bacteria	599
2552	Ga0590071_001831	3300059421	Bacteria	5489
2553	Ga0590071_038065	3300059421	Bacteria	1155
2554	Ga0590074_018003	3300059423	Bacteria	1208
2555	Ga0590075_011325	3300059424	Bacteria	2155
2556	Ga0590077_044190	3300059426	Bacteria	994
2557	Ga0587084_000147	3300059477	Bacteria	4251
2558	Ga0587084_007162	3300059477	Bacteria	1376
2559	Ga0587084_008054	3300059477	Bacteria	1324
2560	Ga0587084_031229	3300059477	Bacteria	858
2561	Ga0587084_045471	3300059477	Bacteria	760
2562	Ga0587093_000068	3300059478	Bacteria	4574
2563	Ga0587093_012311	3300059478	Bacteria	1036
2564	Ga0587093_012919	3300059478	Bacteria	1020
2565	Ga0587093_015159	3300059478	Bacteria	970
2566	Ga0587093_024862	3300059478	Bacteria	827
2567	Ga0587093_029806	3300059478	Bacteria	779
2568	Ga0587066_004510	3300059490	Bacteria	1719
2569	Ga0587070_002116	3300059491	Bacteria	2196
2570	Ga0587070_006831	3300059491	Bacteria	1557
2571	Ga0587070_031617	3300059491	Bacteria	963
2572	Ga0587070_081479	3300059491	Bacteria	711
2573	Ga0587073_0000528	3300059492	Bacteria	3601
2574	Ga0587073_0008893	3300059492	Bacteria	1640
2575	Ga0587073_0012121	3300059492	Bacteria	1487
2576	Ga0587077_000950	3300059493	Bacteria	2876
2577	Ga0587077_001041	3300059493	Bacteria	2802
2578	Ga0587077_009175	3300059493	Bacteria	1494
2579	Ga0587077_129044	3300059493	Bacteria	639
2580	Ga0587080_004865	3300059503	Bacteria	1772
2581	Ga0587080_014447	3300059503	Bacteria	1221
2582	Ga0587082_002352	3300059504	Bacteria	2123
2583	Ga0587083_0000260	3300059505	Bacteria	4088
2584	Ga0587083_0012252	3300059505	Bacteria	1435
2585	Ga0587083_0040117	3300059505	Bacteria	976
2586	Ga0587083_0191195	3300059505	Bacteria	579
2587	Ga0587083_0259322	3300059505	Bacteria	521
2588	Ga0587083_0266027	3300059505	Bacteria	516
2589	Ga0587085_015499	3300059506	Bacteria	1090
2590	Ga0587085_056964	3300059506	Bacteria	728
2591	Ga0587085_058469	3300059506	Bacteria	723
2592	Ga0587085_133075	3300059506	Bacteria	558
2593	Ga0587086_008906	3300059507	Bacteria	1183
2594	Ga0587086_064159	3300059507	Bacteria	618
2595	Ga0587086_090797	3300059507	Bacteria	551
2596	Ga0587088_000741	3300059508	Bacteria	2965
2597	Ga0587088_006778	3300059508	Bacteria	1560
2598	Ga0587088_195602	3300059508	Bacteria	514
2599	Ga0587089_018404	3300059509	Bacteria	947
2600	Ga0587089_020539	3300059509	Bacteria	910
2601	Ga0587090_000971	3300059510	Bacteria	2719
2602	Ga0587090_049944	3300059510	Bacteria	764
2603	Ga0587090_091394	3300059510	Bacteria	624
2604	Ga0587090_125515	3300059510	Bacteria	561
2605	Ga0587091_039562	3300059511	Bacteria	924
2606	Ga0587092_003731	3300059512	Bacteria	1756
2607	Ga0587092_013128	3300059512	Bacteria	1179
2608	Ga0587092_073250	3300059512	Bacteria	663
2609	Ga0587092_096409	3300059512	Bacteria	604
2610	Ga0587094_003475	3300059513	Bacteria	1723
2611	Ga0587094_010050	3300059513	Bacteria	1221
2612	Ga0587094_028199	3300059513	Bacteria	856
2613	Ga0587094_069464	3300059513	Bacteria	632
2614	Ga0587097_02529	3300059603	Bacteria	738
2615	Ga0587098_035784	3300059604	Bacteria	703
2616	Ga0587098_054348	3300059604	Bacteria	615
2617	Ga0587106_001662	3300059605	Bacteria	2033
2618	Ga0587121_02582	3300059606	Bacteria	956
2619	Ga0587125_000700	3300059607	Bacteria	2137
2620	Ga0587129_000468	3300059608	Bacteria	1815
2621	Ga0587099_000652	3300059622	Bacteria	2125
2622	Ga0587101_000448	3300059623	Bacteria	2910
2623	Ga0587101_001008	3300059623	Bacteria	2281
2624	Ga0587101_004157	3300059623	Bacteria	1530
2625	Ga0587101_010971	3300059623	Bacteria	1149
2626	Ga0587101_026212	3300059623	Bacteria	878
2627	Ga0587109_006245	3300059624	Bacteria	1751
2628	Ga0587109_008034	3300059624	Bacteria	1616
2629	Ga0587109_056099	3300059624	Bacteria	819
2630	Ga0587109_122734	3300059624	Bacteria	618
2631	Ga0587113_008074	3300059625	Bacteria	928
2632	Ga0587115_001117	3300059626	Bacteria	2323
2633	Ga0587117_063472	3300059627	Bacteria	640
2634	Ga0587117_093858	3300059627	Bacteria	564
2635	Ga0587122_005247	3300059628	Bacteria	1080
2636	Ga0587127_000506	3300059629	Bacteria	1817
2637	Ga0587128_001730	3300059630	Bacteria	2132
2638	Ga0587062_000400	3300059639	Bacteria	2970
2639	Ga0587062_027267	3300059639	Bacteria	853
2640	Ga0587062_028098	3300059639	Bacteria	845
2641	Ga0587062_091595	3300059639	Bacteria	580
2642	Ga0587067_002743	3300059640	Bacteria	2128
2643	Ga0587068_001309	3300059641	Bacteria	2740
2644	Ga0587068_029396	3300059641	Bacteria	945
2645	Ga0587068_053393	3300059641	Bacteria	762
2646	Ga0587068_083374	3300059641	Bacteria	648
2647	Ga0587068_092276	3300059641	Bacteria	626
2648	Ga0587069_045331	3300059642	Bacteria	765
2649	Ga0587069_066565	3300059642	Bacteria	676
2650	Ga0587072_001392	3300059643	Bacteria	2980
2651	Ga0587072_008796	3300059643	Bacteria	1606
2652	Ga0587072_047141	3300059643	Bacteria	854
2653	Ga0587072_155637	3300059643	Bacteria	555
2654	Ga0587075_006388	3300059644	Bacteria	1446
2655	Ga0587076_002043	3300059645	Bacteria	2197
2656	Ga0587076_002122	3300059645	Bacteria	2173
2657	Ga0587076_044132	3300059645	Bacteria	845
2658	Ga0587076_191621	3300059645	Bacteria	521
2659	Ga0587078_001557	3300059646	Bacteria	2075
2660	Ga0587078_045221	3300059646	Bacteria	632
2661	Ga0587079_003155	3300059647	Bacteria	2119
2662	Ga0587079_068918	3300059647	Bacteria	785
2663	Ga0587100_000850	3300059648	Bacteria	1621
2664	Ga0587102_000785	3300059649	Bacteria	1981
2665	Ga0587104_001238	3300059650	Bacteria	1321
2666	Ga0587105_000221	3300059651	Bacteria	2056
2667	Ga0587107_000989	3300059652	Bacteria	2150
2668	Ga0587108_001930	3300059653	Bacteria	1340
2669	Ga0587110_002686	3300059654	Bacteria	1429
2670	Ga0587114_002480	3300059655	Bacteria	1723
2671	Ga0587116_04474	3300059656	Bacteria	814
2672	Ga0587118_00289	3300059657	Bacteria	2380
2673	Ga0587119_011551	3300059658	Bacteria	1018
2674	Ga0587119_011607	3300059658	Bacteria	1017
2675	Ga0587119_063465	3300059658	Bacteria	574
2676	Ga0587120_003884	3300059659	Bacteria	1093
2677	Ga0587124_001322	3300059660	Bacteria	1596
2678	Ga0587124_004370	3300059660	Bacteria	1089
2679	Ga0587124_024795	3300059660	Bacteria	633
2680	Ga0587096_00044	3300060247	Bacteria	2129
2681	Ga0587071_000529	3300060344	Bacteria	3833
2682	Ga0587071_055691	3300060344	Bacteria	828
2683	Ga0587071_105901	3300060344	Bacteria	656
2684	Ga0587071_188855	3300060344	Bacteria	533
2685	Ga0587111_0000186	3300060346	Bacteria	4817
2686	Ga0587111_0000227	3300060346	Bacteria	4609
2687	Ga0587111_0000325	3300060346	Bacteria	4182
2688	Ga0587111_0028503	3300060346	Bacteria	1125
2689	Ga0466962_0000718	3300061719	Bacteria	14786
2690	Ga0466962_0014522	3300061719	Bacteria	3795
2691	Ga0466962_0019514	3300061719	Bacteria	3258
2692	Ga0466962_0034516	3300061719	Bacteria	2421
2693	Ga0466962_0222415	3300061719	Bacteria	925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005329	Ga0070683_100748256	Ga0070683_1007482561	96
2	3300005535	Ga0070684_100730944	Ga0070684_1007309442	96
3	3300012515	Ga0157338_1016880	Ga0157338_10168802	96
4	3300013307	Ga0157372_12868046	Ga0157372_128680461	96
5	3300014497	Ga0182008_10404115	Ga0182008_104041152	96
6	3300026116	Ga0207674_10171993	Ga0207674_101719934	96
7	3300037471	Ga0395905_0032891	Ga0395905_0032891_2403_2693	96
8	3300037471	Ga0395905_0265078	Ga0395905_0265078_915_1205	96
9	3300038443	Ga0395901_1682451	Ga0395901_1682451_266_556	96
10	3300042876	Ga0451577_0287511	Ga0451577_0287511_806_1096	96
11	3300044656	Ga0466969_0002653	Ga0466969_0002653_6168_6458	96
12	3300044656	Ga0466969_0071313	Ga0466969_0071313_1301_1591	96
13	3300044658	Ga0466972_0028508	Ga0466972_0028508_372_662	96
14	3300044683	Ga0466965_0154522	Ga0466965_0154522_605_895	96
15	3300044684	Ga0466966_0058141	Ga0466966_0058141_1762_2052	96
16	3300044684	Ga0466966_0852006	Ga0466966_0852006_103_393	96
17	3300044693	Ga0466961_0229178	Ga0466961_0229178_575_865	96
18	3300044693	Ga0466961_0582188	Ga0466961_0582188_157_447	96
19	3300044706	Ga0466964_0355907	Ga0466964_0355907_414_704	96
20	3300044706	Ga0466964_0443013	Ga0466964_0443013_247_537	96
21	3300044712	Ga0453684_1916968	Ga0453684_1916968_215_505	96
22	3300044719	Ga0466971_0609832	Ga0466971_0609832_191_481	96
23	3300044735	Ga0466968_0079400	Ga0466968_0079400_728_1018	96
24	3300044765	Ga0466970_0034790	Ga0466970_0034790_1526_1816	96
25	3300044842	Ga0466957_0039679	Ga0466957_0039679_919_1209	96
26	3300044901	Ga0466960_0010573	Ga0466960_0010573_1906_2196	96
27	3300045049	Ga0466959_0051414	Ga0466959_0051414_44_334	96
28	3300045051	Ga0451576_0200992	Ga0451576_0200992_1481_1771	96
29	3300045836	Ga0466958_0217971	Ga0466958_0217971_844_1134	96
30	3300049160	Ga0501304_021454	Ga0501304_021454_302_592	96
31	3300049571	Ga0501034_0080413	Ga0501034_0080413_1578_1868	96
32	3300049572	Ga0501036_0190196	Ga0501036_0190196_1364_1654	96
33	3300049574	Ga0501038_0476077	Ga0501038_0476077_124_414	96
34	3300049579	Ga0501043_0044507	Ga0501043_0044507_2246_2536	96
35	3300049580	Ga0501046_0029736	Ga0501046_0029736_347_637	96
36	3300049581	Ga0501047_0030021	Ga0501047_0030021_2458_2748	96
37	3300049589	Ga0501073_0858074	Ga0501073_0858074_86_376	96
38	3300049590	Ga0501074_0224902	Ga0501074_0224902_981_1271	96
39	3300049742	Ga0501080_0044455	Ga0501080_0044455_3495_3785	96
40	3300049744	Ga0501083_0159916	Ga0501083_0159916_992_1282	96
41	3300049822	Ga0501035_0020355	Ga0501035_0020355_4157_4447	96
42	3300049823	Ga0501044_0041861	Ga0501044_0041861_1124_1414	96
43	3300061719	Ga0466962_0034516	Ga0466962_0034516_746_1036	96
44	iso_pu_bacteria	2585428057	2587725923	97
45	iso_pu_bacteria	2585428058	2587735574	97
46	iso_pu_bacteria	2585428062	2587758987	97
47	iso_pu_bacteria	2588253510	2588292864	97
48	iso_pu_bacteria	2643221544	2643746687	97
49	iso_pu_bacteria	2643221585	2643937421	97
50	iso_pu_bacteria	2643221592	2643967973	97
51	iso_pu_bacteria	2643221625	2644143127	97
52	iso_pu_bacteria	2643221639	2644218753	97
53	iso_pu_bacteria	2643221644	2644247751	97
54	iso_pu_bacteria	2643221646	2644256840	97
55	iso_pu_bacteria	2643221648	2644271785	97
56	iso_pu_bacteria	2643221654	2644305901	97
57	iso_pu_bacteria	2643221656	2644314959	97
58	iso_pu_bacteria	2643221660	2644338010	97
59	iso_pu_bacteria	2738541337	2739057972	97
60	iso_pu_bacteria	2831864461	2831867514	97
61	iso_pu_bacteria	2886848708	2886854504	97
62	3300009093	Ga0105240_10005705	Ga0105240_100057056	98
63	3300009551	Ga0105238_10307837	Ga0105238_103078372	98
64	3300038443	Ga0395901_0093407	Ga0395901_0093407_2551_2847	98
65	3300049161	Ga0501305_002660	Ga0501305_002660_1053_1349	98
66	3300049690	Ga0501261_024879	Ga0501261_024879_129_425	98
67	3300049770	Ga0501273_016888	Ga0501273_016888_417_713	98
68	3300012478	Ga0157328_1000557	Ga0157328_10005572	100
69	2209111006	2214593853	2213632718	101
70	3300001978	JGI24747J21853_1009316	JGI24747J21853_10093162	101
71	3300001991	JGI24743J22301_10086779	JGI24743J22301_100867791	101
72	3300002067	JGI24735J21928_10241017	JGI24735J21928_102410172	101
73	3300002073	JGI24745J21846_1034750	JGI24745J21846_10347502	101
74	3300002075	JGI24738J21930_10068067	JGI24738J21930_100680672	101
75	3300002126	JGI24035J26624_1018282	JGI24035J26624_10182822	101
76	3300002738	JGI25154J39366_1000593	JGI25154J39366_100059314	101
77	3300002741	JGI25157J39369_1001134	JGI25157J39369_10011342	101
78	3300002772	JGI25164J39214_1002084	JGI25164J39214_10020842	101
79	3300002773	JGI25152J39213_1001073	JGI25152J39213_10010739	101
80	3300002774	JGI25150J39212_1003907	JGI25150J39212_10039075	101
81	3300003159	Ga0006771J45828_103610	Ga0006771J45828_1036104	101
82	3300003161	Ga0006765J45826_106373	Ga0006765J45826_1063735	101
83	3300003162	Ga0006778J45830_1009213	Ga0006778J45830_100921316	101
84	3300003162	Ga0006778J45830_1028609	Ga0006778J45830_10286094	101
85	3300003163	Ga0006759J45824_1028038	Ga0006759J45824_10280384	101
86	3300003163	Ga0006759J45824_1029126	Ga0006759J45824_10291264	101
87	3300003163	Ga0006759J45824_1059282	Ga0006759J45824_10592822	101
88	3300003215	JGI25153J46596_10007740	JGI25153J46596_100077408	101
89	3300003215	JGI25153J46596_10008637	JGI25153J46596_100086372	101
90	3300003300	Ga0006758J48902_1015144	Ga0006758J48902_10151444	101
91	3300003300	Ga0006758J48902_1016024	Ga0006758J48902_10160243	101
92	3300003300	Ga0006758J48902_1021934	Ga0006758J48902_10219344	101
93	3300003305	Ga0006770J48903_1001899	Ga0006770J48903_10018998	101
94	3300003305	Ga0006770J48903_1017003	Ga0006770J48903_10170034	101
95	3300003308	Ga0006777J48905_1014855	Ga0006777J48905_10148554	101
96	3300003322	rootL2_10093366	rootL2_100933664	101
97	3300003347	JGI26128J50194_1000191	JGI26128J50194_10001913	101
98	3300003396	JGI26137J50245_101641	JGI26137J50245_1016412	101
99	3300003544	Ga0007417J51691_1020817	Ga0007417J51691_10208174	101
100	3300003544	Ga0007417J51691_1043945	Ga0007417J51691_10439454	101
101	3300003544	Ga0007417J51691_1059733	Ga0007417J51691_10597332	101
102	3300003544	Ga0007417J51691_1090341	Ga0007417J51691_10903412	101
103	3300003559	Ga0007427J51700_113549	Ga0007427J51700_1135494	101
104	3300003559	Ga0007427J51700_118227	Ga0007427J51700_1182272	101
105	3300003574	Ga0007410J51695_1005226	Ga0007410J51695_10052265	101
106	3300003574	Ga0007410J51695_1028665	Ga0007410J51695_10286654	101
107	3300003574	Ga0007410J51695_1032042	Ga0007410J51695_10320424	101
108	3300003574	Ga0007410J51695_1043180	Ga0007410J51695_10431804	101
109	3300003575	Ga0007409J51694_1019841	Ga0007409J51694_10198414	101
110	3300003575	Ga0007409J51694_1024055	Ga0007409J51694_10240554	101
111	3300003577	Ga0007416J51690_1027279	Ga0007416J51690_10272794	101
112	3300003577	Ga0007416J51690_1037564	Ga0007416J51690_10375644	101
113	3300003577	Ga0007416J51690_1051124	Ga0007416J51690_10511244	101
114	3300003577	Ga0007416J51690_1084832	Ga0007416J51690_10848322	101
115	3300003579	Ga0007429J51699_1081577	Ga0007429J51699_10815772	101
116	3300003611	Ga0007411J51799_109097	Ga0007411J51799_1090974	101
117	3300003613	Ga0007415J51800_107261	Ga0007415J51800_1072614	101
118	3300003613	Ga0007415J51800_118403	Ga0007415J51800_1184032	101
119	3300003693	Ga0032354_1037309	Ga0032354_10373097	101
120	3300003693	Ga0032354_1038503	Ga0032354_10385034	101
121	3300003693	Ga0032354_1054804	Ga0032354_10548041	101
122	3300003693	Ga0032354_1120735	Ga0032354_11207351	101
123	3300003752	Ga0055539_1013170	Ga0055539_10131702	101
124	3300003756	Ga0055533_1000043	Ga0055533_1000043178	101
125	3300003759	Ga0055525_1000161	Ga0055525_100016117	101
126	3300003759	Ga0055525_1000641	Ga0055525_10006416	101
127	3300003761	Ga0055535_1022599	Ga0055535_10225992	101
128	3300003761	Ga0055535_1023634	Ga0055535_10236342	101
129	3300003761	Ga0055535_1028550	Ga0055535_10285502	101
130	3300003763	Ga0055529_1000322	Ga0055529_100032245	101
131	3300003771	Ga0055526_1000791	Ga0055526_100079116	101
132	3300003771	Ga0055526_1003343	Ga0055526_100334312	101
133	3300003775	Ga0055524_1000140	Ga0055524_100014016	101
134	3300003775	Ga0055524_1029964	Ga0055524_10299644	101
135	3300003775	Ga0055524_1029968	Ga0055524_10299681	101
136	3300003790	Ga0055528_1041283	Ga0055528_10412832	101
137	3300003791	Ga0055530_10006458	Ga0055530_100064585	101
138	3300003791	Ga0055530_10019398	Ga0055530_100193982	101
139	3300003791	Ga0055530_10047713	Ga0055530_100477132	101
140	3300003792	Ga0055540_1000133	Ga0055540_10001334	101
141	3300003792	Ga0055540_1011339	Ga0055540_10113392	101
142	3300003792	Ga0055540_1025018	Ga0055540_10250182	101
143	3300003792	Ga0055540_1026414	Ga0055540_10264142	101
144	3300003794	Ga0055531_10002079	Ga0055531_1000207917	101
145	3300003794	Ga0055531_10002114	Ga0055531_1000211417	101
146	3300003794	Ga0055531_10021540	Ga0055531_100215403	101
147	3300003794	Ga0055531_10034681	Ga0055531_100346811	101
148	3300003856	Ga0058692_1047259	Ga0058692_10472592	101
149	3300004625	Ga0055543_1031436	Ga0055543_10314362	101
150	3300004785	Ga0058858_1386099	Ga0058858_13860992	101
151	3300004798	Ga0058859_10003590	Ga0058859_100035902	101
152	3300004798	Ga0058859_10014111	Ga0058859_100141112	101
153	3300004798	Ga0058859_10053023	Ga0058859_100530231	101
154	3300004800	Ga0058861_10010151	Ga0058861_100101512	101
155	3300004800	Ga0058861_10032824	Ga0058861_100328241	101
156	3300004800	Ga0058861_10142005	Ga0058861_101420053	101
157	3300004800	Ga0058861_11546501	Ga0058861_115465012	101
158	3300004801	Ga0058860_10015107	Ga0058860_100151071	101
159	3300004801	Ga0058860_12097130	Ga0058860_120971301	101
160	3300004801	Ga0058860_12226982	Ga0058860_122269822	101
161	3300005288	Ga0065714_10208968	Ga0065714_102089682	101
162	3300005290	Ga0065712_10021088	Ga0065712_100210884	101
163	3300005290	Ga0065712_10476167	Ga0065712_104761672	101
164	3300005293	Ga0065715_10023020	Ga0065715_100230202	101
165	3300005293	Ga0065715_10056333	Ga0065715_100563332	101
166	3300005293	Ga0065715_10057067	Ga0065715_100570671	101
167	3300005293	Ga0065715_10520315	Ga0065715_105203152	101
168	3300005295	Ga0065707_10331922	Ga0065707_103319222	101
169	3300005295	Ga0065707_10780234	Ga0065707_107802342	101
170	3300005327	Ga0070658_10018142	Ga0070658_100181423	101
171	3300005327	Ga0070658_10152764	Ga0070658_101527643	101
172	3300005327	Ga0070658_10160545	Ga0070658_101605453	101
173	3300005327	Ga0070658_10376475	Ga0070658_103764753	101
174	3300005327	Ga0070658_10398274	Ga0070658_103982742	101
175	3300005327	Ga0070658_10625740	Ga0070658_106257402	101
176	3300005327	Ga0070658_10765399	Ga0070658_107653991	101
177	3300005327	Ga0070658_10847330	Ga0070658_108473302	101
178	3300005327	Ga0070658_11431480	Ga0070658_114314801	101
179	3300005327	Ga0070658_11462489	Ga0070658_114624891	101
180	3300005327	Ga0070658_11518866	Ga0070658_115188662	101
181	3300005327	Ga0070658_11819696	Ga0070658_118196961	101
182	3300005327	Ga0070658_12002031	Ga0070658_120020312	101
183	3300005328	Ga0070676_10002282	Ga0070676_100022824	101
184	3300005328	Ga0070676_10021276	Ga0070676_100212763	101
185	3300005328	Ga0070676_10078497	Ga0070676_100784974	101
186	3300005328	Ga0070676_10093888	Ga0070676_100938884	101
187	3300005328	Ga0070676_10157576	Ga0070676_101575762	101
188	3300005328	Ga0070676_10241559	Ga0070676_102415591	101
189	3300005328	Ga0070676_10518685	Ga0070676_105186852	101
190	3300005328	Ga0070676_10913198	Ga0070676_109131981	101
191	3300005328	Ga0070676_11223027	Ga0070676_112230272	101
192	3300005328	Ga0070676_11314334	Ga0070676_113143341	101
193	3300005328	Ga0070676_11528605	Ga0070676_115286051	101
194	3300005329	Ga0070683_100230594	Ga0070683_1002305941	101
195	3300005329	Ga0070683_101817471	Ga0070683_1018174712	101
196	3300005329	Ga0070683_101904308	Ga0070683_1019043081	101
197	3300005330	Ga0070690_100006927	Ga0070690_10000692710	101
198	3300005330	Ga0070690_100031978	Ga0070690_1000319786	101
199	3300005330	Ga0070690_101091273	Ga0070690_1010912731	101
200	3300005330	Ga0070690_101745641	Ga0070690_1017456411	101
201	3300005331	Ga0070670_100054237	Ga0070670_1000542375	101
202	3300005331	Ga0070670_100064589	Ga0070670_1000645895	101
203	3300005331	Ga0070670_100065507	Ga0070670_1000655077	101
204	3300005331	Ga0070670_100536821	Ga0070670_1005368212	101
205	3300005331	Ga0070670_101026493	Ga0070670_1010264931	101
206	3300005331	Ga0070670_101411232	Ga0070670_1014112322	101
207	3300005331	Ga0070670_101531242	Ga0070670_1015312422	101
208	3300005331	Ga0070670_101555237	Ga0070670_1015552372	101
209	3300005333	Ga0070677_10017315	Ga0070677_100173152	101
210	3300005333	Ga0070677_10069496	Ga0070677_100694962	101
211	3300005333	Ga0070677_10109386	Ga0070677_101093863	101
212	3300005333	Ga0070677_10126334	Ga0070677_101263342	101
213	3300005333	Ga0070677_10242409	Ga0070677_102424091	101
214	3300005333	Ga0070677_10511145	Ga0070677_105111452	101
215	3300005333	Ga0070677_10867938	Ga0070677_108679381	101
216	3300005334	Ga0068869_100012739	Ga0068869_1000127394	101
217	3300005334	Ga0068869_100052834	Ga0068869_1000528345	101
218	3300005334	Ga0068869_100054551	Ga0068869_1000545516	101
219	3300005334	Ga0068869_100146255	Ga0068869_1001462554	101
220	3300005334	Ga0068869_100167482	Ga0068869_1001674824	101
221	3300005334	Ga0068869_100190949	Ga0068869_1001909494	101
222	3300005334	Ga0068869_101018510	Ga0068869_1010185102	101
223	3300005334	Ga0068869_101941450	Ga0068869_1019414502	101
224	3300005335	Ga0070666_10221816	Ga0070666_102218162	101
225	3300005335	Ga0070666_10224408	Ga0070666_102244083	101
226	3300005335	Ga0070666_10235916	Ga0070666_102359163	101
227	3300005335	Ga0070666_10239237	Ga0070666_102392372	101
228	3300005335	Ga0070666_10283707	Ga0070666_102837071	101
229	3300005335	Ga0070666_10340714	Ga0070666_103407142	101
230	3300005335	Ga0070666_10365843	Ga0070666_103658432	101
231	3300005335	Ga0070666_11156959	Ga0070666_111569592	101
232	3300005335	Ga0070666_11338603	Ga0070666_113386031	101
233	3300005336	Ga0070680_100032809	Ga0070680_1000328096	101
234	3300005337	Ga0070682_100057764	Ga0070682_1000577645	101
235	3300005337	Ga0070682_100761903	Ga0070682_1007619031	101
236	3300005337	Ga0070682_101759414	Ga0070682_1017594142	101
237	3300005338	Ga0068868_100045924	Ga0068868_1000459241	101
238	3300005338	Ga0068868_100133352	Ga0068868_1001333523	101
239	3300005338	Ga0068868_100185626	Ga0068868_1001856263	101
240	3300005338	Ga0068868_100261562	Ga0068868_1002615623	101
241	3300005338	Ga0068868_100272027	Ga0068868_1002720272	101
242	3300005338	Ga0068868_101043555	Ga0068868_1010435552	101
243	3300005338	Ga0068868_101134328	Ga0068868_1011343281	101
244	3300005338	Ga0068868_102114706	Ga0068868_1021147061	101
245	3300005339	Ga0070660_100137713	Ga0070660_1001377134	101
246	3300005339	Ga0070660_100190679	Ga0070660_1001906792	101
247	3300005339	Ga0070660_100332256	Ga0070660_1003322562	101
248	3300005339	Ga0070660_100572021	Ga0070660_1005720211	101
249	3300005339	Ga0070660_100619238	Ga0070660_1006192382	101
250	3300005339	Ga0070660_101044692	Ga0070660_1010446922	101
251	3300005339	Ga0070660_101102100	Ga0070660_1011021002	101
252	3300005340	Ga0070689_100109373	Ga0070689_1001093734	101
253	3300005340	Ga0070689_100939754	Ga0070689_1009397542	101
254	3300005341	Ga0070691_10539873	Ga0070691_105398732	101
255	3300005341	Ga0070691_10999739	Ga0070691_109997391	101
256	3300005343	Ga0070687_100201346	Ga0070687_1002013461	101
257	3300005343	Ga0070687_100384597	Ga0070687_1003845972	101
258	3300005343	Ga0070687_100986619	Ga0070687_1009866191	101
259	3300005344	Ga0070661_100003672	Ga0070661_1000036729	101
260	3300005344	Ga0070661_100092952	Ga0070661_1000929525	101
261	3300005344	Ga0070661_100105291	Ga0070661_1001052915	101
262	3300005344	Ga0070661_100791616	Ga0070661_1007916162	101
263	3300005344	Ga0070661_101068490	Ga0070661_1010684902	101
264	3300005345	Ga0070692_10613329	Ga0070692_106133291	101
265	3300005345	Ga0070692_10910764	Ga0070692_109107641	101
266	3300005347	Ga0070668_100101221	Ga0070668_1001012214	101
267	3300005347	Ga0070668_100408601	Ga0070668_1004086012	101
268	3300005347	Ga0070668_100932145	Ga0070668_1009321452	101
269	3300005347	Ga0070668_101157832	Ga0070668_1011578321	101
270	3300005347	Ga0070668_101607756	Ga0070668_1016077562	101
271	3300005347	Ga0070668_101704626	Ga0070668_1017046261	101
272	3300005353	Ga0070669_100017536	Ga0070669_1000175364	101
273	3300005353	Ga0070669_100075981	Ga0070669_1000759813	101
274	3300005353	Ga0070669_100156484	Ga0070669_1001564842	101
275	3300005353	Ga0070669_100212897	Ga0070669_1002128973	101
276	3300005353	Ga0070669_100306076	Ga0070669_1003060762	101
277	3300005353	Ga0070669_100346164	Ga0070669_1003461643	101
278	3300005353	Ga0070669_100764005	Ga0070669_1007640052	101
279	3300005353	Ga0070669_101288326	Ga0070669_1012883262	101
280	3300005354	Ga0070675_100044665	Ga0070675_1000446654	101
281	3300005354	Ga0070675_100107037	Ga0070675_1001070373	101
282	3300005354	Ga0070675_100119785	Ga0070675_1001197855	101
283	3300005354	Ga0070675_100124843	Ga0070675_1001248433	101
284	3300005354	Ga0070675_100159250	Ga0070675_1001592505	101
285	3300005354	Ga0070675_100318575	Ga0070675_1003185753	101
286	3300005354	Ga0070675_100556488	Ga0070675_1005564882	101
287	3300005354	Ga0070675_100685121	Ga0070675_1006851212	101
288	3300005354	Ga0070675_101335612	Ga0070675_1013356121	101
289	3300005354	Ga0070675_101910828	Ga0070675_1019108281	101
290	3300005354	Ga0070675_102178774	Ga0070675_1021787742	101
291	3300005355	Ga0070671_100019537	Ga0070671_1000195376	101
292	3300005355	Ga0070671_100085884	Ga0070671_1000858844	101
293	3300005355	Ga0070671_100133178	Ga0070671_1001331783	101
294	3300005355	Ga0070671_100170542	Ga0070671_1001705423	101
295	3300005355	Ga0070671_100250786	Ga0070671_1002507862	101
296	3300005355	Ga0070671_100591612	Ga0070671_1005916122	101
297	3300005355	Ga0070671_100650710	Ga0070671_1006507101	101
298	3300005355	Ga0070671_100946220	Ga0070671_1009462202	101
299	3300005355	Ga0070671_101510430	Ga0070671_1015104301	101
300	3300005355	Ga0070671_101561963	Ga0070671_1015619632	101
301	3300005355	Ga0070671_101935345	Ga0070671_1019353451	101
302	3300005355	Ga0070671_102010048	Ga0070671_1020100482	101
303	3300005356	Ga0070674_100039880	Ga0070674_1000398807	101
304	3300005356	Ga0070674_100056124	Ga0070674_1000561244	101
305	3300005356	Ga0070674_100181740	Ga0070674_1001817401	101
306	3300005356	Ga0070674_100377427	Ga0070674_1003774271	101
307	3300005356	Ga0070674_100687011	Ga0070674_1006870111	101
308	3300005356	Ga0070674_101018456	Ga0070674_1010184562	101
309	3300005356	Ga0070674_101790417	Ga0070674_1017904172	101
310	3300005364	Ga0070673_100002927	Ga0070673_10000292715	101
311	3300005364	Ga0070673_100055764	Ga0070673_1000557647	101
312	3300005364	Ga0070673_100092283	Ga0070673_1000922835	101
313	3300005364	Ga0070673_100117288	Ga0070673_1001172883	101
314	3300005364	Ga0070673_100169356	Ga0070673_1001693565	101
315	3300005364	Ga0070673_100341751	Ga0070673_1003417512	101
316	3300005364	Ga0070673_101766371	Ga0070673_1017663712	101
317	3300005364	Ga0070673_102348507	Ga0070673_1023485071	101
318	3300005365	Ga0070688_100074242	Ga0070688_1000742421	101
319	3300005365	Ga0070688_100375525	Ga0070688_1003755253	101
320	3300005365	Ga0070688_100789518	Ga0070688_1007895182	101
321	3300005365	Ga0070688_100847825	Ga0070688_1008478251	101
322	3300005366	Ga0070659_100050300	Ga0070659_1000503007	101
323	3300005366	Ga0070659_100057420	Ga0070659_1000574204	101
324	3300005366	Ga0070659_100120047	Ga0070659_1001200473	101
325	3300005366	Ga0070659_100428407	Ga0070659_1004284071	101
326	3300005366	Ga0070659_100892058	Ga0070659_1008920582	101
327	3300005366	Ga0070659_101584510	Ga0070659_1015845101	101
328	3300005366	Ga0070659_101595526	Ga0070659_1015955261	101
329	3300005367	Ga0070667_100028082	Ga0070667_1000280828	101
330	3300005367	Ga0070667_100083378	Ga0070667_1000833783	101
331	3300005367	Ga0070667_100191574	Ga0070667_1001915742	101
332	3300005367	Ga0070667_100204785	Ga0070667_1002047852	101
333	3300005367	Ga0070667_100327425	Ga0070667_1003274252	101
334	3300005367	Ga0070667_100773763	Ga0070667_1007737632	101
335	3300005367	Ga0070667_101026369	Ga0070667_1010263692	101
336	3300005367	Ga0070667_102257362	Ga0070667_1022573621	101
337	3300005367	Ga0070667_102266408	Ga0070667_1022664081	101
338	3300005406	Ga0070703_10308697	Ga0070703_103086972	101
339	3300005435	Ga0070714_100277699	Ga0070714_1002776992	101
340	3300005437	Ga0070710_10174641	Ga0070710_101746412	101
341	3300005438	Ga0070701_10253999	Ga0070701_102539992	101
342	3300005439	Ga0070711_101887476	Ga0070711_1018874761	101
343	3300005440	Ga0070705_101421083	Ga0070705_1014210831	101
344	3300005441	Ga0070700_100203545	Ga0070700_1002035453	101
345	3300005441	Ga0070700_100338342	Ga0070700_1003383423	101
346	3300005441	Ga0070700_100380412	Ga0070700_1003804122	101
347	3300005441	Ga0070700_101264979	Ga0070700_1012649791	101
348	3300005444	Ga0070694_100315650	Ga0070694_1003156502	101
349	3300005445	Ga0070708_100706924	Ga0070708_1007069242	101
350	3300005455	Ga0070663_100003492	Ga0070663_1000034924	101
351	3300005455	Ga0070663_100704477	Ga0070663_1007044772	101
352	3300005455	Ga0070663_100705956	Ga0070663_1007059562	101
353	3300005455	Ga0070663_100919729	Ga0070663_1009197292	101
354	3300005455	Ga0070663_101736287	Ga0070663_1017362871	101
355	3300005456	Ga0070678_100037760	Ga0070678_1000377604	101
356	3300005456	Ga0070678_100094707	Ga0070678_1000947071	101
357	3300005456	Ga0070678_100104114	Ga0070678_1001041142	101
358	3300005456	Ga0070678_100192574	Ga0070678_1001925744	101
359	3300005456	Ga0070678_100207105	Ga0070678_1002071054	101
360	3300005456	Ga0070678_100297921	Ga0070678_1002979212	101
361	3300005456	Ga0070678_100794965	Ga0070678_1007949652	101
362	3300005456	Ga0070678_100829040	Ga0070678_1008290402	101
363	3300005456	Ga0070678_100875548	Ga0070678_1008755482	101
364	3300005456	Ga0070678_101010943	Ga0070678_1010109432	101
365	3300005456	Ga0070678_101214301	Ga0070678_1012143011	101
366	3300005456	Ga0070678_101295875	Ga0070678_1012958752	101
367	3300005456	Ga0070678_102328203	Ga0070678_1023282031	101
368	3300005457	Ga0070662_100002678	Ga0070662_1000026788	101
369	3300005457	Ga0070662_100111387	Ga0070662_1001113875	101
370	3300005457	Ga0070662_100613806	Ga0070662_1006138062	101
371	3300005457	Ga0070662_100908390	Ga0070662_1009083902	101
372	3300005457	Ga0070662_100997889	Ga0070662_1009978892	101
373	3300005457	Ga0070662_101177654	Ga0070662_1011776541	101
374	3300005458	Ga0070681_10088377	Ga0070681_100883776	101
375	3300005458	Ga0070681_10806729	Ga0070681_108067292	101
376	3300005458	Ga0070681_11138303	Ga0070681_111383032	101
377	3300005459	Ga0068867_100000552	Ga0068867_10000055224	101
378	3300005459	Ga0068867_100002598	Ga0068867_10000259812	101
379	3300005459	Ga0068867_100011425	Ga0068867_1000114254	101
380	3300005459	Ga0068867_100069225	Ga0068867_1000692252	101
381	3300005459	Ga0068867_100087646	Ga0068867_1000876463	101
382	3300005459	Ga0068867_100117646	Ga0068867_1001176462	101
383	3300005459	Ga0068867_100231960	Ga0068867_1002319602	101
384	3300005459	Ga0068867_100453228	Ga0068867_1004532282	101
385	3300005459	Ga0068867_100662908	Ga0068867_1006629082	101
386	3300005459	Ga0068867_100695754	Ga0068867_1006957542	101
387	3300005459	Ga0068867_100709486	Ga0068867_1007094862	101
388	3300005459	Ga0068867_100911659	Ga0068867_1009116591	101
389	3300005459	Ga0068867_101083928	Ga0068867_1010839281	101
390	3300005459	Ga0068867_101848740	Ga0068867_1018487402	101
391	3300005466	Ga0070685_10169141	Ga0070685_101691413	101
392	3300005466	Ga0070685_10245464	Ga0070685_102454642	101
393	3300005466	Ga0070685_10316262	Ga0070685_103162623	101
394	3300005466	Ga0070685_10394830	Ga0070685_103948302	101
395	3300005466	Ga0070685_10530135	Ga0070685_105301352	101
396	3300005467	Ga0070706_100015900	Ga0070706_1000159002	101
397	3300005467	Ga0070706_100465093	Ga0070706_1004650933	101
398	3300005468	Ga0070707_100035242	Ga0070707_1000352422	101
399	3300005468	Ga0070707_100905496	Ga0070707_1009054961	101
400	3300005471	Ga0070698_100919936	Ga0070698_1009199362	101
401	3300005518	Ga0070699_100054613	Ga0070699_1000546138	101
402	3300005518	Ga0070699_101191241	Ga0070699_1011912412	101
403	3300005530	Ga0070679_100007565	Ga0070679_1000075658	101
404	3300005530	Ga0070679_100080125	Ga0070679_1000801257	101
405	3300005530	Ga0070679_102099077	Ga0070679_1020990771	101
406	3300005530	Ga0070679_102179987	Ga0070679_1021799872	101
407	3300005535	Ga0070684_100178663	Ga0070684_1001786634	101
408	3300005535	Ga0070684_101408220	Ga0070684_1014082202	101
409	3300005536	Ga0070697_100571805	Ga0070697_1005718052	101
410	3300005539	Ga0068853_100284609	Ga0068853_1002846093	101
411	3300005539	Ga0068853_100330775	Ga0068853_1003307752	101
412	3300005539	Ga0068853_100345863	Ga0068853_1003458631	101
413	3300005539	Ga0068853_100366671	Ga0068853_1003666713	101
414	3300005539	Ga0068853_100652551	Ga0068853_1006525512	101
415	3300005539	Ga0068853_100776425	Ga0068853_1007764252	101
416	3300005539	Ga0068853_100890460	Ga0068853_1008904602	101
417	3300005539	Ga0068853_101125178	Ga0068853_1011251782	101
418	3300005539	Ga0068853_101443491	Ga0068853_1014434912	101
419	3300005539	Ga0068853_101854831	Ga0068853_1018548311	101
420	3300005539	Ga0068853_101867267	Ga0068853_1018672671	101
421	3300005539	Ga0068853_102224461	Ga0068853_1022244612	101
422	3300005543	Ga0070672_100006187	Ga0070672_10000618713	101
423	3300005543	Ga0070672_100044598	Ga0070672_1000445984	101
424	3300005543	Ga0070672_100065480	Ga0070672_1000654806	101
425	3300005543	Ga0070672_100198587	Ga0070672_1001985872	101
426	3300005543	Ga0070672_100200681	Ga0070672_1002006812	101
427	3300005543	Ga0070672_100226500	Ga0070672_1002265002	101
428	3300005543	Ga0070672_100232603	Ga0070672_1002326032	101
429	3300005543	Ga0070672_100472996	Ga0070672_1004729962	101
430	3300005543	Ga0070672_100571997	Ga0070672_1005719972	101
431	3300005544	Ga0070686_100084049	Ga0070686_1000840492	101
432	3300005544	Ga0070686_100100818	Ga0070686_1001008182	101
433	3300005544	Ga0070686_100146015	Ga0070686_1001460152	101
434	3300005544	Ga0070686_100621476	Ga0070686_1006214762	101
435	3300005545	Ga0070695_101015916	Ga0070695_1010159162	101
436	3300005547	Ga0070693_100023342	Ga0070693_1000233424	101
437	3300005547	Ga0070693_100069686	Ga0070693_1000696862	101
438	3300005547	Ga0070693_100367668	Ga0070693_1003676682	101
439	3300005547	Ga0070693_101032445	Ga0070693_1010324451	101
440	3300005548	Ga0070665_100113328	Ga0070665_1001133284	101
441	3300005548	Ga0070665_100261841	Ga0070665_1002618413	101
442	3300005548	Ga0070665_100320840	Ga0070665_1003208403	101
443	3300005548	Ga0070665_100554049	Ga0070665_1005540492	101
444	3300005548	Ga0070665_101109575	Ga0070665_1011095752	101
445	3300005548	Ga0070665_101194074	Ga0070665_1011940741	101
446	3300005548	Ga0070665_101479735	Ga0070665_1014797351	101
447	3300005563	Ga0068855_100040434	Ga0068855_1000404348	101
448	3300005563	Ga0068855_100053199	Ga0068855_1000531995	101
449	3300005563	Ga0068855_100119155	Ga0068855_1001191557	101
450	3300005563	Ga0068855_100166634	Ga0068855_1001666341	101
451	3300005563	Ga0068855_100300591	Ga0068855_1003005912	101
452	3300005563	Ga0068855_100401893	Ga0068855_1004018932	101
453	3300005563	Ga0068855_100490245	Ga0068855_1004902452	101
454	3300005563	Ga0068855_101339970	Ga0068855_1013399702	101
455	3300005563	Ga0068855_101718265	Ga0068855_1017182652	101
456	3300005563	Ga0068855_102213489	Ga0068855_1022134892	101
457	3300005563	Ga0068855_102228415	Ga0068855_1022284152	101
458	3300005564	Ga0070664_100040179	Ga0070664_1000401795	101
459	3300005564	Ga0070664_100514222	Ga0070664_1005142222	101
460	3300005564	Ga0070664_100700369	Ga0070664_1007003692	101
461	3300005564	Ga0070664_100723098	Ga0070664_1007230982	101
462	3300005564	Ga0070664_100873383	Ga0070664_1008733832	101
463	3300005564	Ga0070664_101790277	Ga0070664_1017902772	101
464	3300005564	Ga0070664_102182478	Ga0070664_1021824782	101
465	3300005564	Ga0070664_102289631	Ga0070664_1022896311	101
466	3300005577	Ga0068857_100040688	Ga0068857_1000406884	101
467	3300005577	Ga0068857_100209439	Ga0068857_1002094394	101
468	3300005577	Ga0068857_100640804	Ga0068857_1006408042	101
469	3300005577	Ga0068857_100685991	Ga0068857_1006859912	101
470	3300005577	Ga0068857_101405747	Ga0068857_1014057471	101
471	3300005577	Ga0068857_102106398	Ga0068857_1021063982	101
472	3300005577	Ga0068857_102272213	Ga0068857_1022722131	101
473	3300005578	Ga0068854_100044785	Ga0068854_1000447858	101
474	3300005578	Ga0068854_100273417	Ga0068854_1002734171	101
475	3300005578	Ga0068854_100446089	Ga0068854_1004460892	101
476	3300005578	Ga0068854_100639045	Ga0068854_1006390452	101
477	3300005578	Ga0068854_100823349	Ga0068854_1008233492	101
478	3300005578	Ga0068854_101555891	Ga0068854_1015558911	101
479	3300005578	Ga0068854_101905240	Ga0068854_1019052401	101
480	3300005614	Ga0068856_100033721	Ga0068856_1000337214	101
481	3300005614	Ga0068856_100137146	Ga0068856_1001371465	101
482	3300005614	Ga0068856_100183859	Ga0068856_1001838592	101
483	3300005614	Ga0068856_100590718	Ga0068856_1005907183	101
484	3300005614	Ga0068856_101621842	Ga0068856_1016218422	101
485	3300005614	Ga0068856_101651020	Ga0068856_1016510202	101
486	3300005614	Ga0068856_101744992	Ga0068856_1017449922	101
487	3300005614	Ga0068856_101982772	Ga0068856_1019827722	101
488	3300005614	Ga0068856_102034411	Ga0068856_1020344112	101
489	3300005614	Ga0068856_102047549	Ga0068856_1020475492	101
490	3300005615	Ga0070702_100781254	Ga0070702_1007812541	101
491	3300005615	Ga0070702_101222597	Ga0070702_1012225972	101
492	3300005616	Ga0068852_100102229	Ga0068852_1001022295	101
493	3300005616	Ga0068852_100157329	Ga0068852_1001573295	101
494	3300005616	Ga0068852_100315873	Ga0068852_1003158732	101
495	3300005616	Ga0068852_100418900	Ga0068852_1004189003	101
496	3300005616	Ga0068852_100605267	Ga0068852_1006052671	101
497	3300005616	Ga0068852_100651676	Ga0068852_1006516763	101
498	3300005616	Ga0068852_101752809	Ga0068852_1017528092	101
499	3300005616	Ga0068852_102152236	Ga0068852_1021522362	101
500	3300005616	Ga0068852_102464516	Ga0068852_1024645162	101
501	3300005616	Ga0068852_102712578	Ga0068852_1027125782	101
502	3300005617	Ga0068859_100364845	Ga0068859_1003648453	101
503	3300005617	Ga0068859_100436599	Ga0068859_1004365992	101
504	3300005617	Ga0068859_100595833	Ga0068859_1005958332	101
505	3300005617	Ga0068859_101027397	Ga0068859_1010273972	101
506	3300005618	Ga0068864_100018772	Ga0068864_1000187728	101
507	3300005618	Ga0068864_100060451	Ga0068864_1000604515	101
508	3300005618	Ga0068864_100103544	Ga0068864_1001035445	101
509	3300005618	Ga0068864_100144620	Ga0068864_1001446203	101
510	3300005618	Ga0068864_100277415	Ga0068864_1002774152	101
511	3300005618	Ga0068864_100396584	Ga0068864_1003965841	101
512	3300005618	Ga0068864_101023586	Ga0068864_1010235862	101
513	3300005618	Ga0068864_101162343	Ga0068864_1011623432	101
514	3300005618	Ga0068864_102135041	Ga0068864_1021350412	101
515	3300005718	Ga0068866_10033530	Ga0068866_100335301	101
516	3300005718	Ga0068866_11210503	Ga0068866_112105032	101
517	3300005719	Ga0068861_100004770	Ga0068861_10000477015	101
518	3300005719	Ga0068861_100016735	Ga0068861_1000167358	101
519	3300005719	Ga0068861_100021676	Ga0068861_1000216768	101
520	3300005834	Ga0068851_10075887	Ga0068851_100758872	101
521	3300005834	Ga0068851_10096881	Ga0068851_100968812	101
522	3300005834	Ga0068851_10097792	Ga0068851_100977922	101
523	3300005834	Ga0068851_10243618	Ga0068851_102436182	101
524	3300005834	Ga0068851_10251534	Ga0068851_102515342	101
525	3300005834	Ga0068851_10669682	Ga0068851_106696822	101
526	3300005834	Ga0068851_10761317	Ga0068851_107613172	101
527	3300005834	Ga0068851_10797560	Ga0068851_107975602	101
528	3300005834	Ga0068851_10963055	Ga0068851_109630552	101
529	3300005834	Ga0068851_11084607	Ga0068851_110846071	101
530	3300005840	Ga0068870_10219600	Ga0068870_102196003	101
531	3300005840	Ga0068870_11048814	Ga0068870_110488142	101
532	3300005841	Ga0068863_100104362	Ga0068863_1001043624	101
533	3300005841	Ga0068863_100167300	Ga0068863_1001673002	101
534	3300005841	Ga0068863_100242760	Ga0068863_1002427603	101
535	3300005841	Ga0068863_100951211	Ga0068863_1009512112	101
536	3300005841	Ga0068863_101271358	Ga0068863_1012713582	101
537	3300005841	Ga0068863_101973726	Ga0068863_1019737262	101
538	3300005841	Ga0068863_102326588	Ga0068863_1023265882	101
539	3300005841	Ga0068863_102707031	Ga0068863_1027070312	101
540	3300005842	Ga0068858_100008125	Ga0068858_10000812511	101
541	3300005842	Ga0068858_100030753	Ga0068858_1000307538	101
542	3300005842	Ga0068858_100194536	Ga0068858_1001945365	101
543	3300005842	Ga0068858_100249510	Ga0068858_1002495104	101
544	3300005842	Ga0068858_100477508	Ga0068858_1004775083	101
545	3300005842	Ga0068858_100780864	Ga0068858_1007808642	101
546	3300005842	Ga0068858_100783674	Ga0068858_1007836742	101
547	3300005843	Ga0068860_100008442	Ga0068860_1000084428	101
548	3300005843	Ga0068860_100065679	Ga0068860_1000656792	101
549	3300005843	Ga0068860_100125619	Ga0068860_1001256192	101
550	3300005843	Ga0068860_100214297	Ga0068860_1002142973	101
551	3300005843	Ga0068860_100234051	Ga0068860_1002340513	101
552	3300005843	Ga0068860_100416200	Ga0068860_1004162003	101
553	3300005843	Ga0068860_100426403	Ga0068860_1004264032	101
554	3300005843	Ga0068860_100920792	Ga0068860_1009207922	101
555	3300005843	Ga0068860_101792759	Ga0068860_1017927592	101
556	3300005843	Ga0068860_102349024	Ga0068860_1023490242	101
557	3300005843	Ga0068860_102723119	Ga0068860_1027231191	101
558	3300005844	Ga0068862_100009442	Ga0068862_1000094425	101
559	3300005844	Ga0068862_100103723	Ga0068862_1001037233	101
560	3300005844	Ga0068862_100471684	Ga0068862_1004716842	101
561	3300005844	Ga0068862_100722741	Ga0068862_1007227412	101
562	3300005844	Ga0068862_100898406	Ga0068862_1008984062	101
563	3300005844	Ga0068862_101560070	Ga0068862_1015600702	101
564	3300005937	Ga0081455_10199133	Ga0081455_101991333	101
565	3300005983	Ga0081540_1248794	Ga0081540_12487941	101
566	3300006038	Ga0075365_10024190	Ga0075365_100241907	101
567	3300006038	Ga0075365_10100810	Ga0075365_101008103	101
568	3300006038	Ga0075365_10318739	Ga0075365_103187393	101
569	3300006038	Ga0075365_10467937	Ga0075365_104679371	101
570	3300006042	Ga0075368_10003054	Ga0075368_100030548	101
571	3300006042	Ga0075368_10027934	Ga0075368_100279344	101
572	3300006042	Ga0075368_10058905	Ga0075368_100589052	101
573	3300006042	Ga0075368_10073997	Ga0075368_100739973	101
574	3300006048	Ga0075363_100000856	Ga0075363_10000085613	101
575	3300006048	Ga0075363_100005889	Ga0075363_1000058895	101
576	3300006048	Ga0075363_100049841	Ga0075363_1000498412	101
577	3300006048	Ga0075363_100093099	Ga0075363_1000930992	101
578	3300006048	Ga0075363_100128935	Ga0075363_1001289352	101
579	3300006048	Ga0075363_100179022	Ga0075363_1001790222	101
580	3300006048	Ga0075363_100281906	Ga0075363_1002819062	101
581	3300006048	Ga0075363_100297870	Ga0075363_1002978702	101
582	3300006048	Ga0075363_100666391	Ga0075363_1006663912	101
583	3300006051	Ga0075364_10015296	Ga0075364_100152964	101
584	3300006051	Ga0075364_10032491	Ga0075364_100324915	101
585	3300006051	Ga0075364_10218269	Ga0075364_102182692	101
586	3300006051	Ga0075364_10343775	Ga0075364_103437752	101
587	3300006051	Ga0075364_10971241	Ga0075364_109712412	101
588	3300006051	Ga0075364_11203213	Ga0075364_112032131	101
589	3300006163	Ga0070715_10079026	Ga0070715_100790263	101
590	3300006173	Ga0070716_100069303	Ga0070716_1000693032	101
591	3300006173	Ga0070716_101316293	Ga0070716_1013162932	101
592	3300006177	Ga0075362_10000222	Ga0075362_1000022218	101
593	3300006177	Ga0075362_10010792	Ga0075362_100107926	101
594	3300006177	Ga0075362_10042495	Ga0075362_100424955	101
595	3300006177	Ga0075362_10085974	Ga0075362_100859743	101
596	3300006177	Ga0075362_10099943	Ga0075362_100999432	101
597	3300006177	Ga0075362_10168463	Ga0075362_101684633	101
598	3300006177	Ga0075362_10194303	Ga0075362_101943032	101
599	3300006177	Ga0075362_10427422	Ga0075362_104274222	101
600	3300006177	Ga0075362_10618676	Ga0075362_106186761	101
601	3300006178	Ga0075367_10000855	Ga0075367_1000085510	101
602	3300006178	Ga0075367_10001881	Ga0075367_1000188113	101
603	3300006178	Ga0075367_10006379	Ga0075367_1000637913	101
604	3300006178	Ga0075367_10010768	Ga0075367_100107682	101
605	3300006178	Ga0075367_10092185	Ga0075367_100921854	101
606	3300006178	Ga0075367_10129646	Ga0075367_101296462	101
607	3300006178	Ga0075367_10705296	Ga0075367_107052962	101
608	3300006178	Ga0075367_10970059	Ga0075367_109700592	101
609	3300006186	Ga0075369_10003827	Ga0075369_100038278	101
610	3300006186	Ga0075369_10005325	Ga0075369_100053256	101
611	3300006186	Ga0075369_10072235	Ga0075369_100722353	101
612	3300006186	Ga0075369_10110152	Ga0075369_101101522	101
613	3300006186	Ga0075369_10244703	Ga0075369_102447032	101
614	3300006186	Ga0075369_10435859	Ga0075369_104358591	101
615	3300006186	Ga0075369_10500016	Ga0075369_105000161	101
616	3300006195	Ga0075366_10000795	Ga0075366_100007955	101
617	3300006195	Ga0075366_10016473	Ga0075366_100164737	101
618	3300006195	Ga0075366_10018148	Ga0075366_100181486	101
619	3300006195	Ga0075366_10029562	Ga0075366_100295625	101
620	3300006195	Ga0075366_10032832	Ga0075366_100328323	101
621	3300006195	Ga0075366_10033848	Ga0075366_100338482	101
622	3300006195	Ga0075366_10054228	Ga0075366_100542282	101
623	3300006195	Ga0075366_10058278	Ga0075366_100582783	101
624	3300006195	Ga0075366_10077134	Ga0075366_100771342	101
625	3300006195	Ga0075366_10102009	Ga0075366_101020094	101
626	3300006195	Ga0075366_10111379	Ga0075366_101113793	101
627	3300006195	Ga0075366_10151709	Ga0075366_101517091	101
628	3300006195	Ga0075366_10166789	Ga0075366_101667893	101
629	3300006195	Ga0075366_10173544	Ga0075366_101735442	101
630	3300006195	Ga0075366_10184543	Ga0075366_101845433	101
631	3300006195	Ga0075366_10204160	Ga0075366_102041603	101
632	3300006195	Ga0075366_10263345	Ga0075366_102633452	101
633	3300006195	Ga0075366_10283035	Ga0075366_102830352	101
634	3300006195	Ga0075366_10287953	Ga0075366_102879532	101
635	3300006195	Ga0075366_10364650	Ga0075366_103646502	101
636	3300006195	Ga0075366_10431366	Ga0075366_104313662	101
637	3300006195	Ga0075366_10813125	Ga0075366_108131252	101
638	3300006195	Ga0075366_10908584	Ga0075366_109085842	101
639	3300006195	Ga0075366_11042664	Ga0075366_110426641	101
640	3300006195	Ga0075366_11042999	Ga0075366_110429992	101
641	3300006195	Ga0075366_11063075	Ga0075366_110630752	101
642	3300006237	Ga0097621_100047739	Ga0097621_1000477396	101
643	3300006237	Ga0097621_100053861	Ga0097621_1000538612	101
644	3300006237	Ga0097621_100115517	Ga0097621_1001155172	101
645	3300006237	Ga0097621_100490595	Ga0097621_1004905952	101
646	3300006237	Ga0097621_100662626	Ga0097621_1006626263	101
647	3300006237	Ga0097621_100897118	Ga0097621_1008971181	101
648	3300006237	Ga0097621_101646944	Ga0097621_1016469441	101
649	3300006353	Ga0075370_10000073	Ga0075370_1000007317	101
650	3300006353	Ga0075370_10000701	Ga0075370_1000070112	101
651	3300006353	Ga0075370_10001150	Ga0075370_100011509	101
652	3300006353	Ga0075370_10002824	Ga0075370_1000282414	101
653	3300006353	Ga0075370_10017546	Ga0075370_100175464	101
654	3300006353	Ga0075370_10040903	Ga0075370_100409032	101
655	3300006353	Ga0075370_10064344	Ga0075370_100643443	101
656	3300006353	Ga0075370_10133093	Ga0075370_101330932	101
657	3300006353	Ga0075370_10135320	Ga0075370_101353202	101
658	3300006353	Ga0075370_10212361	Ga0075370_102123612	101
659	3300006353	Ga0075370_10411843	Ga0075370_104118431	101
660	3300006353	Ga0075370_10542980	Ga0075370_105429802	101
661	3300006353	Ga0075370_10652636	Ga0075370_106526362	101
662	3300006358	Ga0068871_100038460	Ga0068871_1000384602	101
663	3300006358	Ga0068871_100126623	Ga0068871_1001266233	101
664	3300006358	Ga0068871_100138158	Ga0068871_1001381582	101
665	3300006358	Ga0068871_100221491	Ga0068871_1002214912	101
666	3300006358	Ga0068871_100336354	Ga0068871_1003363542	101
667	3300006358	Ga0068871_100519577	Ga0068871_1005195772	101
668	3300006358	Ga0068871_100540442	Ga0068871_1005404422	101
669	3300006358	Ga0068871_100962100	Ga0068871_1009621002	101
670	3300006358	Ga0068871_101221282	Ga0068871_1012212821	101
671	3300006358	Ga0068871_101285712	Ga0068871_1012857122	101
672	3300006358	Ga0068871_101321209	Ga0068871_1013212092	101
673	3300006844	Ga0075428_102483602	Ga0075428_1024836022	101
674	3300006846	Ga0075430_100233239	Ga0075430_1002332392	101
675	3300006846	Ga0075430_101442341	Ga0075430_1014423412	101
676	3300006852	Ga0075433_11726003	Ga0075433_117260032	101
677	3300006871	Ga0075434_100344295	Ga0075434_1003442952	101
678	3300006871	Ga0075434_100855539	Ga0075434_1008555392	101
679	3300006871	Ga0075434_102374035	Ga0075434_1023740351	101
680	3300006880	Ga0075429_100034628	Ga0075429_1000346283	101
681	3300006881	Ga0068865_100004060	Ga0068865_1000040604	101
682	3300006881	Ga0068865_100504266	Ga0068865_1005042663	101
683	3300006881	Ga0068865_100647903	Ga0068865_1006479032	101
684	3300006881	Ga0068865_100776876	Ga0068865_1007768762	101
685	3300006881	Ga0068865_100847449	Ga0068865_1008474492	101
686	3300006881	Ga0068865_101177967	Ga0068865_1011779672	101
687	3300006881	Ga0068865_101321748	Ga0068865_1013217481	101
688	3300006881	Ga0068865_101689450	Ga0068865_1016894502	101
689	3300006881	Ga0068865_102008339	Ga0068865_1020083391	101
690	3300006931	Ga0097620_100364841	Ga0097620_1003648413	101
691	3300006931	Ga0097620_100436581	Ga0097620_1004365812	101
692	3300006931	Ga0097620_100595835	Ga0097620_1005958352	101
693	3300006931	Ga0097620_101027326	Ga0097620_1010273261	101
694	3300006942	Ga0099824_1036695	Ga0099824_10366952	101
695	3300006944	Ga0099823_1000064	Ga0099823_100006417	101
696	3300006946	Ga0079104_1000053	Ga0079104_100005317	101
697	3300007076	Ga0075435_100564903	Ga0075435_1005649032	101
698	3300009036	Ga0105244_10252256	Ga0105244_102522561	101
699	3300009036	Ga0105244_10568272	Ga0105244_105682722	101
700	3300009093	Ga0105240_10018079	Ga0105240_1001807913	101
701	3300009093	Ga0105240_10144746	Ga0105240_101447466	101
702	3300009093	Ga0105240_10612533	Ga0105240_106125332	101
703	3300009093	Ga0105240_10627271	Ga0105240_106272712	101
704	3300009093	Ga0105240_10639362	Ga0105240_106393623	101
705	3300009093	Ga0105240_12020245	Ga0105240_120202452	101
706	3300009094	Ga0111539_10313271	Ga0111539_103132712	101
707	3300009094	Ga0111539_11374449	Ga0111539_113744491	101
708	3300009094	Ga0111539_11795082	Ga0111539_117950821	101
709	3300009094	Ga0111539_12258942	Ga0111539_122589421	101
710	3300009094	Ga0111539_13012132	Ga0111539_130121321	101
711	3300009098	Ga0105245_10048884	Ga0105245_100488844	101
712	3300009098	Ga0105245_10060455	Ga0105245_100604555	101
713	3300009098	Ga0105245_10900978	Ga0105245_109009781	101
714	3300009098	Ga0105245_10944794	Ga0105245_109447942	101
715	3300009098	Ga0105245_11000833	Ga0105245_110008332	101
716	3300009098	Ga0105245_11331110	Ga0105245_113311102	101
717	3300009098	Ga0105245_12323264	Ga0105245_123232642	101
718	3300009098	Ga0105245_13216584	Ga0105245_132165842	101
719	3300009101	Ga0105247_10117961	Ga0105247_101179613	101
720	3300009101	Ga0105247_10250972	Ga0105247_102509722	101
721	3300009101	Ga0105247_10692669	Ga0105247_106926692	101
722	3300009101	Ga0105247_11836511	Ga0105247_118365112	101
723	3300009147	Ga0114129_10176739	Ga0114129_101767395	101
724	3300009147	Ga0114129_13282350	Ga0114129_132823502	101
725	3300009148	Ga0105243_10001789	Ga0105243_1000178918	101
726	3300009148	Ga0105243_10030050	Ga0105243_100300509	101
727	3300009148	Ga0105243_10177569	Ga0105243_101775691	101
728	3300009148	Ga0105243_10252607	Ga0105243_102526074	101
729	3300009148	Ga0105243_10310359	Ga0105243_103103593	101
730	3300009148	Ga0105243_10387979	Ga0105243_103879793	101
731	3300009148	Ga0105243_10470046	Ga0105243_104700463	101
732	3300009148	Ga0105243_11009547	Ga0105243_110095472	101
733	3300009148	Ga0105243_11676343	Ga0105243_116763432	101
734	3300009148	Ga0105243_13051704	Ga0105243_130517042	101
735	3300009174	Ga0105241_10030533	Ga0105241_100305335	101
736	3300009174	Ga0105241_10065600	Ga0105241_100656002	101
737	3300009174	Ga0105241_10082907	Ga0105241_100829074	101
738	3300009174	Ga0105241_10534512	Ga0105241_105345122	101
739	3300009174	Ga0105241_10839128	Ga0105241_108391282	101
740	3300009176	Ga0105242_10059064	Ga0105242_100590645	101
741	3300009176	Ga0105242_10542677	Ga0105242_105426772	101
742	3300009176	Ga0105242_11045283	Ga0105242_110452832	101
743	3300009176	Ga0105242_11641983	Ga0105242_116419832	101
744	3300009177	Ga0105248_10006768	Ga0105248_1000676816	101
745	3300009177	Ga0105248_10028458	Ga0105248_1002845812	101
746	3300009177	Ga0105248_10243333	Ga0105248_102433334	101
747	3300009177	Ga0105248_10325115	Ga0105248_103251152	101
748	3300009177	Ga0105248_10479812	Ga0105248_104798123	101
749	3300009177	Ga0105248_10511830	Ga0105248_105118303	101
750	3300009177	Ga0105248_10551810	Ga0105248_105518103	101
751	3300009177	Ga0105248_11331292	Ga0105248_113312922	101
752	3300009177	Ga0105248_11711655	Ga0105248_117116552	101
753	3300009177	Ga0105248_11999458	Ga0105248_119994582	101
754	3300009177	Ga0105248_12308621	Ga0105248_123086212	101
755	3300009545	Ga0105237_10000668	Ga0105237_1000066846	101
756	3300009545	Ga0105237_10020609	Ga0105237_100206092	101
757	3300009545	Ga0105237_10169697	Ga0105237_101696974	101
758	3300009545	Ga0105237_10258441	Ga0105237_102584413	101
759	3300009545	Ga0105237_10866946	Ga0105237_108669462	101
760	3300009545	Ga0105237_11967203	Ga0105237_119672031	101
761	3300009545	Ga0105237_12543999	Ga0105237_125439992	101
762	3300009551	Ga0105238_10003926	Ga0105238_1000392614	101
763	3300009551	Ga0105238_10064333	Ga0105238_100643338	101
764	3300009551	Ga0105238_10088675	Ga0105238_100886755	101
765	3300009551	Ga0105238_10467421	Ga0105238_104674213	101
766	3300009551	Ga0105238_10690775	Ga0105238_106907753	101
767	3300009551	Ga0105238_11045173	Ga0105238_110451732	101
768	3300009551	Ga0105238_11484067	Ga0105238_114840672	101
769	3300009551	Ga0105238_11787368	Ga0105238_117873682	101
770	3300009551	Ga0105238_11807402	Ga0105238_118074022	101
771	3300009551	Ga0105238_12027663	Ga0105238_120276632	101
772	3300009551	Ga0105238_12112766	Ga0105238_121127662	101
773	3300009551	Ga0105238_12440779	Ga0105238_124407792	101
774	3300009553	Ga0105249_10068515	Ga0105249_100685155	101
775	3300009553	Ga0105249_10081210	Ga0105249_100812105	101
776	3300009553	Ga0105249_10311041	Ga0105249_103110411	101
777	3300009553	Ga0105249_10528771	Ga0105249_105287711	101
778	3300009553	Ga0105249_11451314	Ga0105249_114513142	101
779	3300009553	Ga0105249_11515538	Ga0105249_115155382	101
780	3300009553	Ga0105249_11895210	Ga0105249_118952102	101
781	3300009553	Ga0105249_11928090	Ga0105249_119280902	101
782	3300010159	Ga0099796_10553984	Ga0099796_105539841	101
783	3300010375	Ga0105239_10001255	Ga0105239_1000125534	101
784	3300010375	Ga0105239_10036283	Ga0105239_100362835	101
785	3300010375	Ga0105239_10264477	Ga0105239_102644775	101
786	3300010375	Ga0105239_10390181	Ga0105239_103901812	101
787	3300010375	Ga0105239_11220126	Ga0105239_112201262	101
788	3300010375	Ga0105239_11872272	Ga0105239_118722721	101
789	3300011119	Ga0105246_10060033	Ga0105246_100600332	101
790	3300011119	Ga0105246_10452402	Ga0105246_104524022	101
791	3300011119	Ga0105246_11064451	Ga0105246_110644512	101
792	3300011119	Ga0105246_11326203	Ga0105246_113262031	101
793	3300012476	Ga0157344_1012848	Ga0157344_10128482	101
794	3300012494	Ga0157341_1001034	Ga0157341_10010342	101
795	3300012495	Ga0157323_1007960	Ga0157323_10079602	101
796	3300012497	Ga0157319_1000005	Ga0157319_100000517	101
797	3300012500	Ga0157314_1019229	Ga0157314_10192292	101
798	3300012503	Ga0157313_1032423	Ga0157313_10324232	101
799	3300012512	Ga0157327_1001789	Ga0157327_10017893	101
800	3300013100	Ga0157373_10040286	Ga0157373_100402864	101
801	3300013100	Ga0157373_10230096	Ga0157373_102300962	101
802	3300013100	Ga0157373_10361352	Ga0157373_103613523	101
803	3300013102	Ga0157371_10130902	Ga0157371_101309024	101
804	3300013102	Ga0157371_10172453	Ga0157371_101724534	101
805	3300013104	Ga0157370_10487010	Ga0157370_104870103	101
806	3300013104	Ga0157370_11427868	Ga0157370_114278682	101
807	3300013104	Ga0157370_11728309	Ga0157370_117283092	101
808	3300013104	Ga0157370_11801123	Ga0157370_118011232	101
809	3300013104	Ga0157370_11959170	Ga0157370_119591702	101
810	3300013105	Ga0157369_10115967	Ga0157369_101159673	101
811	3300013105	Ga0157369_10958666	Ga0157369_109586662	101
812	3300013105	Ga0157369_11170315	Ga0157369_111703152	101
813	3300013105	Ga0157369_11681796	Ga0157369_116817962	101
814	3300013296	Ga0157374_10009298	Ga0157374_100092985	101
815	3300013296	Ga0157374_10093529	Ga0157374_100935293	101
816	3300013296	Ga0157374_10123485	Ga0157374_101234856	101
817	3300013296	Ga0157374_10156204	Ga0157374_101562042	101
818	3300013296	Ga0157374_10440133	Ga0157374_104401333	101
819	3300013296	Ga0157374_10768397	Ga0157374_107683972	101
820	3300013296	Ga0157374_12114567	Ga0157374_121145672	101
821	3300013296	Ga0157374_12129297	Ga0157374_121292972	101
822	3300013296	Ga0157374_12543425	Ga0157374_125434252	101
823	3300013297	Ga0157378_10008661	Ga0157378_100086615	101
824	3300013297	Ga0157378_10029129	Ga0157378_100291295	101
825	3300013297	Ga0157378_10058938	Ga0157378_100589384	101
826	3300013297	Ga0157378_10248653	Ga0157378_102486533	101
827	3300013297	Ga0157378_10357706	Ga0157378_103577062	101
828	3300013297	Ga0157378_10415609	Ga0157378_104156093	101
829	3300013297	Ga0157378_10435035	Ga0157378_104350353	101
830	3300013297	Ga0157378_10654939	Ga0157378_106549391	101
831	3300013297	Ga0157378_11021783	Ga0157378_110217832	101
832	3300013297	Ga0157378_11176376	Ga0157378_111763762	101
833	3300013297	Ga0157378_11849073	Ga0157378_118490732	101
834	3300013306	Ga0163162_10004148	Ga0163162_1000414817	101
835	3300013306	Ga0163162_10211873	Ga0163162_102118734	101
836	3300013306	Ga0163162_10241802	Ga0163162_102418022	101
837	3300013306	Ga0163162_10498220	Ga0163162_104982203	101
838	3300013306	Ga0163162_10505539	Ga0163162_105055393	101
839	3300013306	Ga0163162_10991743	Ga0163162_109917432	101
840	3300013306	Ga0163162_11002589	Ga0163162_110025892	101
841	3300013306	Ga0163162_12032354	Ga0163162_120323542	101
842	3300013306	Ga0163162_12171667	Ga0163162_121716671	101
843	3300013306	Ga0163162_12244874	Ga0163162_122448741	101
844	3300013306	Ga0163162_12492445	Ga0163162_124924451	101
845	3300013307	Ga0157372_10672052	Ga0157372_106720523	101
846	3300013307	Ga0157372_10979869	Ga0157372_109798692	101
847	3300013307	Ga0157372_11410482	Ga0157372_114104822	101
848	3300013307	Ga0157372_12030833	Ga0157372_120308332	101
849	3300013307	Ga0157372_12711760	Ga0157372_127117602	101
850	3300013308	Ga0157375_10041626	Ga0157375_100416268	101
851	3300013308	Ga0157375_10137647	Ga0157375_101376474	101
852	3300013308	Ga0157375_10151438	Ga0157375_101514385	101
853	3300013308	Ga0157375_10240286	Ga0157375_102402863	101
854	3300013308	Ga0157375_10367744	Ga0157375_103677441	101
855	3300013308	Ga0157375_10408421	Ga0157375_104084214	101
856	3300013308	Ga0157375_10529688	Ga0157375_105296883	101
857	3300013308	Ga0157375_10864564	Ga0157375_108645642	101
858	3300013308	Ga0157375_11014364	Ga0157375_110143642	101
859	3300013308	Ga0157375_11372402	Ga0157375_113724022	101
860	3300013308	Ga0157375_11631378	Ga0157375_116313782	101
861	3300013308	Ga0157375_13478607	Ga0157375_134786071	101
862	3300014325	Ga0163163_10510669	Ga0163163_105106692	101
863	3300014325	Ga0163163_10652447	Ga0163163_106524473	101
864	3300014325	Ga0163163_10710033	Ga0163163_107100333	101
865	3300014325	Ga0163163_11116834	Ga0163163_111168342	101
866	3300014325	Ga0163163_11376690	Ga0163163_113766902	101
867	3300014325	Ga0163163_11645912	Ga0163163_116459122	101
868	3300014325	Ga0163163_12086389	Ga0163163_120863892	101
869	3300014326	Ga0157380_10297447	Ga0157380_102974472	101
870	3300014326	Ga0157380_10349999	Ga0157380_103499991	101
871	3300014326	Ga0157380_10534216	Ga0157380_105342164	101
872	3300014326	Ga0157380_10608248	Ga0157380_106082483	101
873	3300014326	Ga0157380_11132351	Ga0157380_111323512	101
874	3300014326	Ga0157380_11686701	Ga0157380_116867012	101
875	3300014326	Ga0157380_12596357	Ga0157380_125963572	101
876	3300014326	Ga0157380_12601282	Ga0157380_126012822	101
877	3300014497	Ga0182008_10320166	Ga0182008_103201662	101
878	3300014497	Ga0182008_10573497	Ga0182008_105734972	101
879	3300014497	Ga0182008_10578449	Ga0182008_105784491	101
880	3300014497	Ga0182008_10868350	Ga0182008_108683502	101
881	3300014745	Ga0157377_10000368	Ga0157377_1000036815	101
882	3300014745	Ga0157377_10115937	Ga0157377_101159373	101
883	3300014745	Ga0157377_10578524	Ga0157377_105785242	101
884	3300014968	Ga0157379_10040412	Ga0157379_100404125	101
885	3300014968	Ga0157379_10061342	Ga0157379_100613425	101
886	3300014968	Ga0157379_10090060	Ga0157379_100900605	101
887	3300014968	Ga0157379_10111640	Ga0157379_101116405	101
888	3300014968	Ga0157379_10144632	Ga0157379_101446325	101
889	3300014968	Ga0157379_10251368	Ga0157379_102513684	101
890	3300014968	Ga0157379_10448165	Ga0157379_104481653	101
891	3300014968	Ga0157379_10473148	Ga0157379_104731482	101
892	3300014968	Ga0157379_10746074	Ga0157379_107460742	101
893	3300014968	Ga0157379_11782467	Ga0157379_117824672	101
894	3300014969	Ga0157376_10085443	Ga0157376_100854434	101
895	3300014969	Ga0157376_10090219	Ga0157376_100902195	101
896	3300014969	Ga0157376_10108103	Ga0157376_101081035	101
897	3300014969	Ga0157376_10158282	Ga0157376_101582823	101
898	3300014969	Ga0157376_10603077	Ga0157376_106030772	101
899	3300014969	Ga0157376_10688965	Ga0157376_106889652	101
900	3300014969	Ga0157376_10741967	Ga0157376_107419673	101
901	3300014969	Ga0157376_10806919	Ga0157376_108069192	101
902	3300014969	Ga0157376_10828945	Ga0157376_108289452	101
903	3300014969	Ga0157376_10840073	Ga0157376_108400732	101
904	3300014969	Ga0157376_11373125	Ga0157376_113731252	101
905	3300014969	Ga0157376_12510272	Ga0157376_125102721	101
906	3300015261	Ga0182006_1167435	Ga0182006_11674352	101
907	3300015261	Ga0182006_1204682	Ga0182006_12046821	101
908	3300015262	Ga0182007_10022997	Ga0182007_100229972	101
909	3300015262	Ga0182007_10061846	Ga0182007_100618463	101
910	3300015262	Ga0182007_10113966	Ga0182007_101139661	101
911	3300015262	Ga0182007_10153902	Ga0182007_101539022	101
912	3300015262	Ga0182007_10362989	Ga0182007_103629892	101
913	3300015265	Ga0182005_1046685	Ga0182005_10466851	101
914	3300017792	Ga0163161_10009049	Ga0163161_1000904910	101
915	3300017792	Ga0163161_10021239	Ga0163161_100212395	101
916	3300017792	Ga0163161_10057420	Ga0163161_100574204	101
917	3300017792	Ga0163161_10118069	Ga0163161_101180691	101
918	3300017792	Ga0163161_10562961	Ga0163161_105629612	101
919	3300017792	Ga0163161_10585901	Ga0163161_105859012	101
920	3300017792	Ga0163161_10876203	Ga0163161_108762031	101
921	3300017792	Ga0163161_11353220	Ga0163161_113532201	101
922	3300020076	Ga0206355_1548870	Ga0206355_15488701	101
923	3300020078	Ga0206352_10809616	Ga0206352_108096162	101
924	3300020078	Ga0206352_10942070	Ga0206352_109420702	101
925	3300020078	Ga0206352_11007505	Ga0206352_110075057	101
926	3300020078	Ga0206352_11327706	Ga0206352_113277061	101
927	3300021361	Ga0213872_10000091	Ga0213872_1000009117	101
928	3300021361	Ga0213872_10002765	Ga0213872_1000276511	101
929	3300021361	Ga0213872_10004732	Ga0213872_100047325	101
930	3300021361	Ga0213872_10030149	Ga0213872_100301493	101
931	3300021361	Ga0213872_10333916	Ga0213872_103339161	101
932	3300021377	Ga0213874_10133739	Ga0213874_101337392	101
933	3300021384	Ga0213876_10306347	Ga0213876_103063472	101
934	3300023309	Ga0256744_118233	Ga0256744_1182332	101
935	3300025226	Ga0209674_100067	Ga0209674_100067198	101
936	3300025226	Ga0209674_108626	Ga0209674_1086261	101
937	3300025227	Ga0207638_1002117	Ga0207638_10021172	101
938	3300025230	Ga0209563_100068	Ga0209563_100068198	101
939	3300025230	Ga0209563_100088	Ga0209563_10008876	101
940	3300025231	Ga0207427_100260	Ga0207427_10026037	101
941	3300025242	Ga0209258_102113	Ga0209258_1021134	101
942	3300025242	Ga0209258_105352	Ga0209258_1053522	101
943	3300025245	Ga0207425_1000680	Ga0207425_100068014	101
944	3300025246	Ga0209646_1000127	Ga0209646_100012718	101
945	3300025250	Ga0209026_1000004	Ga0209026_1000004760	101
946	3300025250	Ga0209026_1062573	Ga0209026_10625732	101
947	3300025253	Ga0209677_100201	Ga0209677_10020135	101
948	3300025253	Ga0209677_107757	Ga0209677_1077572	101
949	3300025254	Ga0209148_1002904	Ga0209148_10029047	101
950	3300025256	Ga0209759_1000129	Ga0209759_1000129116	101
951	3300025256	Ga0209759_1003759	Ga0209759_10037595	101
952	3300025256	Ga0209759_1020002	Ga0209759_10200022	101
953	3300025258	Ga0209129_1000158	Ga0209129_100015846	101
954	3300025263	Ga0209565_1026953	Ga0209565_10269532	101
955	3300025263	Ga0209565_1080733	Ga0209565_10807332	101
956	3300025272	Ga0209455_1000083	Ga0209455_1000083191	101
957	3300025273	Ga0209673_1004093	Ga0209673_10040934	101
958	3300025273	Ga0209673_1026632	Ga0209673_10266324	101
959	3300025273	Ga0209673_1044208	Ga0209673_10442083	101
960	3300025273	Ga0209673_1057800	Ga0209673_10578002	101
961	3300025295	Ga0209564_1000008	Ga0209564_100000833	101
962	3300025295	Ga0209564_1000282	Ga0209564_100028246	101
963	3300025297	Ga0209758_1000910	Ga0209758_10009109	101
964	3300025297	Ga0209758_1011080	Ga0209758_10110803	101
965	3300025298	Ga0209050_1000223	Ga0209050_100022369	101
966	3300025298	Ga0209050_1001097	Ga0209050_100109731	101
967	3300025298	Ga0209050_1004273	Ga0209050_100427312	101
968	3300025298	Ga0209050_1013102	Ga0209050_10131028	101
969	3300025299	Ga0209256_1000045	Ga0209256_1000045234	101
970	3300025299	Ga0209256_1008928	Ga0209256_10089283	101
971	3300025299	Ga0209256_1009680	Ga0209256_10096807	101
972	3300025303	Ga0209051_1000004	Ga0209051_1000004970	101
973	3300025303	Ga0209051_1000938	Ga0209051_100093835	101
974	3300025303	Ga0209051_1005321	Ga0209051_10053215	101
975	3300025303	Ga0209051_1017941	Ga0209051_10179418	101
976	3300025303	Ga0209051_1018074	Ga0209051_10180744	101
977	3300025303	Ga0209051_1047179	Ga0209051_10471792	101
978	3300025304	Ga0209257_1000047	Ga0209257_1000047400	101
979	3300025304	Ga0209257_1000315	Ga0209257_1000315103	101
980	3300025304	Ga0209257_1019529	Ga0209257_10195293	101
981	3300025304	Ga0209257_1032769	Ga0209257_10327692	101
982	3300025315	Ga0207697_10011122	Ga0207697_100111226	101
983	3300025315	Ga0207697_10029574	Ga0207697_100295742	101
984	3300025315	Ga0207697_10084711	Ga0207697_100847113	101
985	3300025321	Ga0207656_10100216	Ga0207656_101002162	101
986	3300025321	Ga0207656_10394243	Ga0207656_103942432	101
987	3300025893	Ga0207682_10002147	Ga0207682_100021477	101
988	3300025893	Ga0207682_10017992	Ga0207682_100179925	101
989	3300025893	Ga0207682_10021887	Ga0207682_100218872	101
990	3300025893	Ga0207682_10053083	Ga0207682_100530834	101
991	3300025893	Ga0207682_10337874	Ga0207682_103378742	101
992	3300025893	Ga0207682_10404696	Ga0207682_104046961	101
993	3300025899	Ga0207642_10017753	Ga0207642_100177536	101
994	3300025899	Ga0207642_10108364	Ga0207642_101083642	101
995	3300025900	Ga0207710_10248771	Ga0207710_102487711	101
996	3300025900	Ga0207710_10276773	Ga0207710_102767732	101
997	3300025900	Ga0207710_10306473	Ga0207710_103064731	101
998	3300025901	Ga0207688_10063302	Ga0207688_100633025	101
999	3300025901	Ga0207688_10077775	Ga0207688_100777753	101
1000	3300025901	Ga0207688_10231679	Ga0207688_102316792	101
1001	3300025903	Ga0207680_10014229	Ga0207680_100142298	101
1002	3300025903	Ga0207680_10692830	Ga0207680_106928301	101
1003	3300025903	Ga0207680_10846716	Ga0207680_108467161	101
1004	3300025903	Ga0207680_11161279	Ga0207680_111612792	101
1005	3300025904	Ga0207647_10074272	Ga0207647_100742723	101
1006	3300025904	Ga0207647_10636418	Ga0207647_106364182	101
1007	3300025905	Ga0207685_10051930	Ga0207685_100519303	101
1008	3300025907	Ga0207645_10009972	Ga0207645_100099728	101
1009	3300025907	Ga0207645_10012543	Ga0207645_100125439	101
1010	3300025907	Ga0207645_10047232	Ga0207645_100472323	101
1011	3300025907	Ga0207645_10048474	Ga0207645_100484744	101
1012	3300025907	Ga0207645_10086402	Ga0207645_100864024	101
1013	3300025907	Ga0207645_10160739	Ga0207645_101607391	101
1014	3300025907	Ga0207645_10704250	Ga0207645_107042502	101
1015	3300025908	Ga0207643_10073671	Ga0207643_100736712	101
1016	3300025908	Ga0207643_10337448	Ga0207643_103374482	101
1017	3300025908	Ga0207643_10798113	Ga0207643_107981132	101
1018	3300025908	Ga0207643_10822516	Ga0207643_108225162	101
1019	3300025909	Ga0207705_10053354	Ga0207705_100533543	101
1020	3300025909	Ga0207705_10212248	Ga0207705_102122483	101
1021	3300025909	Ga0207705_10254337	Ga0207705_102543372	101
1022	3300025909	Ga0207705_10282492	Ga0207705_102824922	101
1023	3300025909	Ga0207705_10288409	Ga0207705_102884093	101
1024	3300025909	Ga0207705_10624745	Ga0207705_106247452	101
1025	3300025909	Ga0207705_11187465	Ga0207705_111874651	101
1026	3300025909	Ga0207705_11405675	Ga0207705_114056751	101
1027	3300025910	Ga0207684_10009766	Ga0207684_1000976617	101
1028	3300025910	Ga0207684_10370574	Ga0207684_103705742	101
1029	3300025910	Ga0207684_11376934	Ga0207684_113769341	101
1030	3300025910	Ga0207684_11602246	Ga0207684_116022461	101
1031	3300025911	Ga0207654_10006606	Ga0207654_100066068	101
1032	3300025911	Ga0207654_10053598	Ga0207654_100535982	101
1033	3300025911	Ga0207654_10442697	Ga0207654_104426972	101
1034	3300025912	Ga0207707_10164577	Ga0207707_101645772	101
1035	3300025912	Ga0207707_10349403	Ga0207707_103494032	101
1036	3300025913	Ga0207695_10010589	Ga0207695_1001058915	101
1037	3300025913	Ga0207695_10103337	Ga0207695_101033373	101
1038	3300025913	Ga0207695_10190969	Ga0207695_101909695	101
1039	3300025913	Ga0207695_10203110	Ga0207695_102031103	101
1040	3300025913	Ga0207695_10497489	Ga0207695_104974892	101
1041	3300025913	Ga0207695_11591238	Ga0207695_115912381	101
1042	3300025914	Ga0207671_10019707	Ga0207671_100197078	101
1043	3300025914	Ga0207671_10047329	Ga0207671_100473294	101
1044	3300025914	Ga0207671_10269801	Ga0207671_102698011	101
1045	3300025914	Ga0207671_10369602	Ga0207671_103696022	101
1046	3300025914	Ga0207671_10992252	Ga0207671_109922522	101
1047	3300025914	Ga0207671_11302842	Ga0207671_113028421	101
1048	3300025917	Ga0207660_10046145	Ga0207660_100461454	101
1049	3300025917	Ga0207660_10242517	Ga0207660_102425173	101
1050	3300025918	Ga0207662_10013351	Ga0207662_1001335110	101
1051	3300025918	Ga0207662_10034330	Ga0207662_100343304	101
1052	3300025918	Ga0207662_10097784	Ga0207662_100977842	101
1053	3300025919	Ga0207657_10092024	Ga0207657_100920242	101
1054	3300025919	Ga0207657_10092779	Ga0207657_100927795	101
1055	3300025919	Ga0207657_10152752	Ga0207657_101527524	101
1056	3300025919	Ga0207657_10306290	Ga0207657_103062902	101
1057	3300025919	Ga0207657_10476166	Ga0207657_104761662	101
1058	3300025919	Ga0207657_10551907	Ga0207657_105519072	101
1059	3300025919	Ga0207657_10738660	Ga0207657_107386602	101
1060	3300025919	Ga0207657_10908135	Ga0207657_109081352	101
1061	3300025919	Ga0207657_11003436	Ga0207657_110034361	101
1062	3300025920	Ga0207649_10001794	Ga0207649_100017946	101
1063	3300025920	Ga0207649_10004699	Ga0207649_100046992	101
1064	3300025920	Ga0207649_10137933	Ga0207649_101379331	101
1065	3300025920	Ga0207649_10299985	Ga0207649_102999853	101
1066	3300025920	Ga0207649_10464728	Ga0207649_104647282	101
1067	3300025920	Ga0207649_10639342	Ga0207649_106393422	101
1068	3300025920	Ga0207649_11426757	Ga0207649_114267571	101
1069	3300025921	Ga0207652_10002940	Ga0207652_1000294013	101
1070	3300025921	Ga0207652_10141879	Ga0207652_101418794	101
1071	3300025921	Ga0207652_10449822	Ga0207652_104498221	101
1072	3300025921	Ga0207652_10727264	Ga0207652_107272641	101
1073	3300025922	Ga0207646_10141845	Ga0207646_101418452	101
1074	3300025922	Ga0207646_10824394	Ga0207646_108243941	101
1075	3300025923	Ga0207681_10005925	Ga0207681_100059254	101
1076	3300025923	Ga0207681_10021332	Ga0207681_100213326	101
1077	3300025923	Ga0207681_10083993	Ga0207681_100839933	101
1078	3300025923	Ga0207681_10222358	Ga0207681_102223584	101
1079	3300025923	Ga0207681_10635262	Ga0207681_106352622	101
1080	3300025923	Ga0207681_11270753	Ga0207681_112707532	101
1081	3300025924	Ga0207694_10004619	Ga0207694_100046195	101
1082	3300025924	Ga0207694_10026084	Ga0207694_100260846	101
1083	3300025924	Ga0207694_10034844	Ga0207694_100348444	101
1084	3300025924	Ga0207694_10452972	Ga0207694_104529722	101
1085	3300025924	Ga0207694_10792963	Ga0207694_107929632	101
1086	3300025924	Ga0207694_10806327	Ga0207694_108063271	101
1087	3300025924	Ga0207694_11346614	Ga0207694_113466142	101
1088	3300025924	Ga0207694_11699401	Ga0207694_116994012	101
1089	3300025924	Ga0207694_11835087	Ga0207694_118350872	101
1090	3300025925	Ga0207650_10002454	Ga0207650_1000245417	101
1091	3300025925	Ga0207650_10022053	Ga0207650_100220535	101
1092	3300025925	Ga0207650_10043623	Ga0207650_100436238	101
1093	3300025925	Ga0207650_10242099	Ga0207650_102420991	101
1094	3300025925	Ga0207650_10969841	Ga0207650_109698412	101
1095	3300025925	Ga0207650_11251871	Ga0207650_112518711	101
1096	3300025925	Ga0207650_11634927	Ga0207650_116349271	101
1097	3300025926	Ga0207659_10003025	Ga0207659_100030255	101
1098	3300025926	Ga0207659_10013941	Ga0207659_1001394112	101
1099	3300025926	Ga0207659_10056531	Ga0207659_100565314	101
1100	3300025926	Ga0207659_10072814	Ga0207659_100728142	101
1101	3300025926	Ga0207659_10142255	Ga0207659_101422553	101
1102	3300025926	Ga0207659_11001934	Ga0207659_110019342	101
1103	3300025926	Ga0207659_11237580	Ga0207659_112375801	101
1104	3300025926	Ga0207659_11764415	Ga0207659_117644152	101
1105	3300025927	Ga0207687_10024918	Ga0207687_100249185	101
1106	3300025927	Ga0207687_10042371	Ga0207687_100423714	101
1107	3300025927	Ga0207687_10108511	Ga0207687_101085112	101
1108	3300025931	Ga0207644_10015416	Ga0207644_100154168	101
1109	3300025931	Ga0207644_10023313	Ga0207644_100233137	101
1110	3300025931	Ga0207644_10024978	Ga0207644_100249785	101
1111	3300025931	Ga0207644_10027492	Ga0207644_100274928	101
1112	3300025931	Ga0207644_10151897	Ga0207644_101518973	101
1113	3300025931	Ga0207644_10191672	Ga0207644_101916724	101
1114	3300025931	Ga0207644_10288580	Ga0207644_102885802	101
1115	3300025931	Ga0207644_10318792	Ga0207644_103187923	101
1116	3300025931	Ga0207644_10344784	Ga0207644_103447843	101
1117	3300025931	Ga0207644_10696345	Ga0207644_106963452	101
1118	3300025931	Ga0207644_10814283	Ga0207644_108142831	101
1119	3300025931	Ga0207644_11061129	Ga0207644_110611291	101
1120	3300025931	Ga0207644_11271417	Ga0207644_112714172	101
1121	3300025931	Ga0207644_11417438	Ga0207644_114174382	101
1122	3300025931	Ga0207644_11595258	Ga0207644_115952582	101
1123	3300025932	Ga0207690_10001731	Ga0207690_100017318	101
1124	3300025932	Ga0207690_10039856	Ga0207690_100398565	101
1125	3300025932	Ga0207690_10056794	Ga0207690_100567942	101
1126	3300025932	Ga0207690_10314401	Ga0207690_103144013	101
1127	3300025932	Ga0207690_10520575	Ga0207690_105205752	101
1128	3300025932	Ga0207690_10539035	Ga0207690_105390352	101
1129	3300025932	Ga0207690_10579998	Ga0207690_105799982	101
1130	3300025932	Ga0207690_10801697	Ga0207690_108016972	101
1131	3300025932	Ga0207690_11305636	Ga0207690_113056362	101
1132	3300025932	Ga0207690_11796972	Ga0207690_117969722	101
1133	3300025933	Ga0207706_10027642	Ga0207706_100276428	101
1134	3300025933	Ga0207706_10079225	Ga0207706_100792255	101
1135	3300025933	Ga0207706_10116108	Ga0207706_101161082	101
1136	3300025933	Ga0207706_10150050	Ga0207706_101500505	101
1137	3300025933	Ga0207706_10517899	Ga0207706_105178992	101
1138	3300025933	Ga0207706_10595316	Ga0207706_105953162	101
1139	3300025933	Ga0207706_10865372	Ga0207706_108653722	101
1140	3300025934	Ga0207686_10048318	Ga0207686_100483183	101
1141	3300025934	Ga0207686_10658155	Ga0207686_106581552	101
1142	3300025934	Ga0207686_11059907	Ga0207686_110599072	101
1143	3300025934	Ga0207686_11335114	Ga0207686_113351142	101
1144	3300025935	Ga0207709_10001005	Ga0207709_1000100518	101
1145	3300025935	Ga0207709_10020689	Ga0207709_100206892	101
1146	3300025935	Ga0207709_10092231	Ga0207709_100922313	101
1147	3300025935	Ga0207709_10215526	Ga0207709_102155263	101
1148	3300025935	Ga0207709_11152621	Ga0207709_111526212	101
1149	3300025935	Ga0207709_11215014	Ga0207709_112150142	101
1150	3300025935	Ga0207709_11328758	Ga0207709_113287582	101
1151	3300025935	Ga0207709_11479356	Ga0207709_114793562	101
1152	3300025935	Ga0207709_11816214	Ga0207709_118162142	101
1153	3300025936	Ga0207670_10104228	Ga0207670_101042283	101
1154	3300025936	Ga0207670_10138753	Ga0207670_101387532	101
1155	3300025936	Ga0207670_11549017	Ga0207670_115490171	101
1156	3300025937	Ga0207669_10027395	Ga0207669_100273952	101
1157	3300025937	Ga0207669_10115067	Ga0207669_101150672	101
1158	3300025937	Ga0207669_10348879	Ga0207669_103488793	101
1159	3300025937	Ga0207669_10573633	Ga0207669_105736332	101
1160	3300025937	Ga0207669_11029438	Ga0207669_110294382	101
1161	3300025937	Ga0207669_11179989	Ga0207669_111799892	101
1162	3300025937	Ga0207669_11190551	Ga0207669_111905512	101
1163	3300025937	Ga0207669_11438737	Ga0207669_114387372	101
1164	3300025937	Ga0207669_11620198	Ga0207669_116201982	101
1165	3300025938	Ga0207704_10257180	Ga0207704_102571802	101
1166	3300025938	Ga0207704_10325544	Ga0207704_103255443	101
1167	3300025938	Ga0207704_10474258	Ga0207704_104742582	101
1168	3300025938	Ga0207704_10705453	Ga0207704_107054532	101
1169	3300025938	Ga0207704_11313184	Ga0207704_113131842	101
1170	3300025938	Ga0207704_11531492	Ga0207704_115314922	101
1171	3300025939	Ga0207665_10131977	Ga0207665_101319772	101
1172	3300025940	Ga0207691_10002550	Ga0207691_1000255013	101
1173	3300025940	Ga0207691_10028785	Ga0207691_100287852	101
1174	3300025940	Ga0207691_10071477	Ga0207691_100714774	101
1175	3300025940	Ga0207691_10102749	Ga0207691_101027495	101
1176	3300025940	Ga0207691_10115353	Ga0207691_101153534	101
1177	3300025940	Ga0207691_10126451	Ga0207691_101264515	101
1178	3300025940	Ga0207691_10184053	Ga0207691_101840533	101
1179	3300025940	Ga0207691_10214431	Ga0207691_102144314	101
1180	3300025940	Ga0207691_10230836	Ga0207691_102308362	101
1181	3300025940	Ga0207691_10737701	Ga0207691_107377012	101
1182	3300025940	Ga0207691_10988607	Ga0207691_109886072	101
1183	3300025941	Ga0207711_10023140	Ga0207711_100231405	101
1184	3300025941	Ga0207711_10072285	Ga0207711_100722855	101
1185	3300025941	Ga0207711_10162953	Ga0207711_101629534	101
1186	3300025941	Ga0207711_10471526	Ga0207711_104715263	101
1187	3300025941	Ga0207711_10657271	Ga0207711_106572712	101
1188	3300025941	Ga0207711_10872701	Ga0207711_108727012	101
1189	3300025941	Ga0207711_11166178	Ga0207711_111661782	101
1190	3300025941	Ga0207711_11205788	Ga0207711_112057882	101
1191	3300025942	Ga0207689_10028262	Ga0207689_100282625	101
1192	3300025942	Ga0207689_10033146	Ga0207689_100331466	101
1193	3300025942	Ga0207689_10038004	Ga0207689_100380043	101
1194	3300025942	Ga0207689_10117050	Ga0207689_101170505	101
1195	3300025942	Ga0207689_10163368	Ga0207689_101633684	101
1196	3300025942	Ga0207689_10684752	Ga0207689_106847522	101
1197	3300025942	Ga0207689_10931477	Ga0207689_109314772	101
1198	3300025944	Ga0207661_11559816	Ga0207661_115598162	101
1199	3300025944	Ga0207661_11799631	Ga0207661_117996312	101
1200	3300025945	Ga0207679_10001498	Ga0207679_100014989	101
1201	3300025945	Ga0207679_10016048	Ga0207679_100160488	101
1202	3300025945	Ga0207679_10340068	Ga0207679_103400682	101
1203	3300025945	Ga0207679_10348193	Ga0207679_103481932	101
1204	3300025945	Ga0207679_10449730	Ga0207679_104497303	101
1205	3300025945	Ga0207679_10576344	Ga0207679_105763442	101
1206	3300025945	Ga0207679_10612182	Ga0207679_106121823	101
1207	3300025949	Ga0207667_10100133	Ga0207667_101001332	101
1208	3300025949	Ga0207667_10188077	Ga0207667_101880773	101
1209	3300025949	Ga0207667_10345820	Ga0207667_103458203	101
1210	3300025949	Ga0207667_10360985	Ga0207667_103609853	101
1211	3300025949	Ga0207667_10480967	Ga0207667_104809672	101
1212	3300025949	Ga0207667_10735784	Ga0207667_107357842	101
1213	3300025949	Ga0207667_10741266	Ga0207667_107412663	101
1214	3300025949	Ga0207667_10883618	Ga0207667_108836182	101
1215	3300025949	Ga0207667_11561165	Ga0207667_115611652	101
1216	3300025960	Ga0207651_10003333	Ga0207651_100033333	101
1217	3300025960	Ga0207651_10004839	Ga0207651_1000483914	101
1218	3300025960	Ga0207651_10043195	Ga0207651_100431952	101
1219	3300025960	Ga0207651_10059456	Ga0207651_100594567	101
1220	3300025960	Ga0207651_10063480	Ga0207651_100634803	101
1221	3300025960	Ga0207651_10077458	Ga0207651_100774582	101
1222	3300025960	Ga0207651_10163749	Ga0207651_101637492	101
1223	3300025960	Ga0207651_10274919	Ga0207651_102749193	101
1224	3300025960	Ga0207651_11842170	Ga0207651_118421702	101
1225	3300025961	Ga0207712_10040645	Ga0207712_100406454	101
1226	3300025961	Ga0207712_10059578	Ga0207712_100595783	101
1227	3300025961	Ga0207712_10063392	Ga0207712_100633924	101
1228	3300025961	Ga0207712_10074729	Ga0207712_100747294	101
1229	3300025961	Ga0207712_10495669	Ga0207712_104956692	101
1230	3300025961	Ga0207712_10578339	Ga0207712_105783392	101
1231	3300025961	Ga0207712_11639098	Ga0207712_116390982	101
1232	3300025972	Ga0207668_10008000	Ga0207668_100080003	101
1233	3300025972	Ga0207668_10086989	Ga0207668_100869894	101
1234	3300025972	Ga0207668_11510267	Ga0207668_115102672	101
1235	3300025972	Ga0207668_11897022	Ga0207668_118970222	101
1236	3300025972	Ga0207668_12036217	Ga0207668_120362171	101
1237	3300025972	Ga0207668_12080298	Ga0207668_120802982	101
1238	3300025981	Ga0207640_10014813	Ga0207640_100148132	101
1239	3300025981	Ga0207640_10031223	Ga0207640_100312238	101
1240	3300025981	Ga0207640_10130332	Ga0207640_101303324	101
1241	3300025981	Ga0207640_10146361	Ga0207640_101463613	101
1242	3300025981	Ga0207640_10584041	Ga0207640_105840412	101
1243	3300025981	Ga0207640_10842442	Ga0207640_108424422	101
1244	3300025981	Ga0207640_11088892	Ga0207640_110888921	101
1245	3300025981	Ga0207640_11139833	Ga0207640_111398332	101
1246	3300025986	Ga0207658_10002481	Ga0207658_100024816	101
1247	3300025986	Ga0207658_10019932	Ga0207658_100199325	101
1248	3300025986	Ga0207658_10054939	Ga0207658_100549395	101
1249	3300025986	Ga0207658_10140348	Ga0207658_101403485	101
1250	3300025986	Ga0207658_10174279	Ga0207658_101742793	101
1251	3300025986	Ga0207658_10212718	Ga0207658_102127184	101
1252	3300025986	Ga0207658_10253878	Ga0207658_102538781	101
1253	3300025986	Ga0207658_10333691	Ga0207658_103336913	101
1254	3300025986	Ga0207658_10428908	Ga0207658_104289082	101
1255	3300025986	Ga0207658_10756535	Ga0207658_107565352	101
1256	3300025986	Ga0207658_11180680	Ga0207658_111806802	101
1257	3300026023	Ga0207677_10007737	Ga0207677_100077372	101
1258	3300026023	Ga0207677_10074516	Ga0207677_100745162	101
1259	3300026023	Ga0207677_10312532	Ga0207677_103125321	101
1260	3300026023	Ga0207677_10694583	Ga0207677_106945832	101
1261	3300026023	Ga0207677_10979441	Ga0207677_109794412	101
1262	3300026023	Ga0207677_12267460	Ga0207677_122674602	101
1263	3300026035	Ga0207703_10027342	Ga0207703_100273428	101
1264	3300026035	Ga0207703_10030166	Ga0207703_100301668	101
1265	3300026035	Ga0207703_10067259	Ga0207703_100672597	101
1266	3300026035	Ga0207703_10139551	Ga0207703_101395515	101
1267	3300026035	Ga0207703_10194715	Ga0207703_101947154	101
1268	3300026035	Ga0207703_10882867	Ga0207703_108828672	101
1269	3300026035	Ga0207703_11400290	Ga0207703_114002902	101
1270	3300026041	Ga0207639_10145450	Ga0207639_101454503	101
1271	3300026041	Ga0207639_10204156	Ga0207639_102041564	101
1272	3300026041	Ga0207639_10359680	Ga0207639_103596803	101
1273	3300026041	Ga0207639_10458426	Ga0207639_104584262	101
1274	3300026041	Ga0207639_10460001	Ga0207639_104600012	101
1275	3300026041	Ga0207639_11301369	Ga0207639_113013692	101
1276	3300026041	Ga0207639_11466741	Ga0207639_114667412	101
1277	3300026041	Ga0207639_12154784	Ga0207639_121547841	101
1278	3300026067	Ga0207678_10008286	Ga0207678_1000828616	101
1279	3300026067	Ga0207678_10039587	Ga0207678_100395872	101
1280	3300026067	Ga0207678_10090610	Ga0207678_100906103	101
1281	3300026067	Ga0207678_10099481	Ga0207678_100994815	101
1282	3300026067	Ga0207678_10387740	Ga0207678_103877402	101
1283	3300026067	Ga0207678_10798352	Ga0207678_107983522	101
1284	3300026075	Ga0207708_10168085	Ga0207708_101680852	101
1285	3300026075	Ga0207708_10386452	Ga0207708_103864522	101
1286	3300026078	Ga0207702_10001875	Ga0207702_1000187512	101
1287	3300026078	Ga0207702_10004993	Ga0207702_1000499316	101
1288	3300026078	Ga0207702_10150760	Ga0207702_101507604	101
1289	3300026078	Ga0207702_11310819	Ga0207702_113108192	101
1290	3300026088	Ga0207641_10118498	Ga0207641_101184984	101
1291	3300026088	Ga0207641_10131093	Ga0207641_101310935	101
1292	3300026088	Ga0207641_10199091	Ga0207641_101990911	101
1293	3300026088	Ga0207641_10305951	Ga0207641_103059512	101
1294	3300026088	Ga0207641_10848739	Ga0207641_108487392	101
1295	3300026088	Ga0207641_11389175	Ga0207641_113891752	101
1296	3300026089	Ga0207648_10002176	Ga0207648_1000217621	101
1297	3300026089	Ga0207648_10005939	Ga0207648_1000593914	101
1298	3300026089	Ga0207648_10015751	Ga0207648_1001575113	101
1299	3300026089	Ga0207648_10087281	Ga0207648_100872817	101
1300	3300026089	Ga0207648_10111939	Ga0207648_101119394	101
1301	3300026089	Ga0207648_10159685	Ga0207648_101596852	101
1302	3300026089	Ga0207648_10173287	Ga0207648_101732874	101
1303	3300026089	Ga0207648_10300208	Ga0207648_103002081	101
1304	3300026089	Ga0207648_10316553	Ga0207648_103165534	101
1305	3300026089	Ga0207648_10987304	Ga0207648_109873042	101
1306	3300026089	Ga0207648_10998152	Ga0207648_109981522	101
1307	3300026089	Ga0207648_11181691	Ga0207648_111816912	101
1308	3300026089	Ga0207648_11851580	Ga0207648_118515802	101
1309	3300026095	Ga0207676_10010346	Ga0207676_100103462	101
1310	3300026095	Ga0207676_10011142	Ga0207676_100111425	101
1311	3300026095	Ga0207676_10095279	Ga0207676_100952793	101
1312	3300026095	Ga0207676_10154150	Ga0207676_101541503	101
1313	3300026095	Ga0207676_10640795	Ga0207676_106407952	101
1314	3300026095	Ga0207676_11032456	Ga0207676_110324562	101
1315	3300026095	Ga0207676_11149135	Ga0207676_111491352	101
1316	3300026116	Ga0207674_10004293	Ga0207674_1000429320	101
1317	3300026116	Ga0207674_10158756	Ga0207674_101587564	101
1318	3300026116	Ga0207674_10373308	Ga0207674_103733082	101
1319	3300026116	Ga0207674_10522615	Ga0207674_105226152	101
1320	3300026116	Ga0207674_10908217	Ga0207674_109082172	101
1321	3300026116	Ga0207674_12168973	Ga0207674_121689732	101
1322	3300026118	Ga0207675_100006663	Ga0207675_10000666314	101
1323	3300026118	Ga0207675_100039987	Ga0207675_1000399878	101
1324	3300026118	Ga0207675_100094405	Ga0207675_1000944057	101
1325	3300026118	Ga0207675_100255531	Ga0207675_1002555314	101
1326	3300026118	Ga0207675_100314320	Ga0207675_1003143203	101
1327	3300026118	Ga0207675_102060528	Ga0207675_1020605282	101
1328	3300026121	Ga0207683_10005923	Ga0207683_100059238	101
1329	3300026121	Ga0207683_10032302	Ga0207683_100323024	101
1330	3300026121	Ga0207683_10106560	Ga0207683_101065605	101
1331	3300026121	Ga0207683_10119357	Ga0207683_101193575	101
1332	3300026121	Ga0207683_10124519	Ga0207683_101245192	101
1333	3300026121	Ga0207683_10166036	Ga0207683_101660363	101
1334	3300026121	Ga0207683_10172753	Ga0207683_101727534	101
1335	3300026121	Ga0207683_10282833	Ga0207683_102828332	101
1336	3300026121	Ga0207683_10350849	Ga0207683_103508492	101
1337	3300026121	Ga0207683_10444257	Ga0207683_104442573	101
1338	3300026121	Ga0207683_10538613	Ga0207683_105386132	101
1339	3300026121	Ga0207683_10664863	Ga0207683_106648632	101
1340	3300026121	Ga0207683_11632104	Ga0207683_116321041	101
1341	3300026142	Ga0207698_10180633	Ga0207698_101806332	101
1342	3300026142	Ga0207698_10670460	Ga0207698_106704602	101
1343	3300026142	Ga0207698_10828991	Ga0207698_108289912	101
1344	3300026142	Ga0207698_11477637	Ga0207698_114776372	101
1345	3300026142	Ga0207698_11616826	Ga0207698_116168261	101
1346	3300026142	Ga0207698_11633654	Ga0207698_116336541	101
1347	3300026142	Ga0207698_12009821	Ga0207698_120098212	101
1348	3300026142	Ga0207698_12293423	Ga0207698_122934232	101
1349	3300027111	Ga0209281_1000147	Ga0209281_100014717	101
1350	3300027296	Ga0209389_1000305	Ga0209389_100030531	101
1351	3300027312	Ga0209371_1008392	Ga0209371_10083923	101
1352	3300027360	Ga0209969_1000889	Ga0209969_10008893	101
1353	3300027378	Ga0209981_1007951	Ga0209981_10079514	101
1354	3300027395	Ga0209996_1000729	Ga0209996_10007295	101
1355	3300027471	Ga0209995_1000242	Ga0209995_100024212	101
1356	3300027526	Ga0209968_1000130	Ga0209968_100013014	101
1357	3300027543	Ga0209999_1001613	Ga0209999_10016138	101
1358	3300027614	Ga0209970_1058219	Ga0209970_10582192	101
1359	3300027617	Ga0210002_1016004	Ga0210002_10160043	101
1360	3300027617	Ga0210002_1064635	Ga0210002_10646352	101
1361	3300027682	Ga0209971_1044032	Ga0209971_10440322	101
1362	3300027695	Ga0209966_1000117	Ga0209966_100011736	101
1363	3300027717	Ga0209998_10002530	Ga0209998_100025308	101
1364	3300027866	Ga0209813_10001024	Ga0209813_100010248	101
1365	3300027866	Ga0209813_10024775	Ga0209813_100247754	101
1366	3300027866	Ga0209813_10212611	Ga0209813_102126112	101
1367	3300027876	Ga0209974_10000149	Ga0209974_1000014917	101
1368	3300027907	Ga0207428_10148534	Ga0207428_101485343	101
1369	3300028379	Ga0268266_10346670	Ga0268266_103466702	101
1370	3300028379	Ga0268266_10427489	Ga0268266_104274892	101
1371	3300028379	Ga0268266_10532322	Ga0268266_105323221	101
1372	3300028379	Ga0268266_10767937	Ga0268266_107679372	101
1373	3300028379	Ga0268266_10883517	Ga0268266_108835172	101
1374	3300028379	Ga0268266_11175617	Ga0268266_111756172	101
1375	3300028379	Ga0268266_11214193	Ga0268266_112141932	101
1376	3300028379	Ga0268266_12261457	Ga0268266_122614572	101
1377	3300028380	Ga0268265_10047973	Ga0268265_100479732	101
1378	3300028380	Ga0268265_10173673	Ga0268265_101736733	101
1379	3300028380	Ga0268265_10409039	Ga0268265_104090392	101
1380	3300028380	Ga0268265_10592306	Ga0268265_105923062	101
1381	3300028380	Ga0268265_11158377	Ga0268265_111583772	101
1382	3300028380	Ga0268265_11429491	Ga0268265_114294912	101
1383	3300028380	Ga0268265_12561104	Ga0268265_125611041	101
1384	3300028381	Ga0268264_10002070	Ga0268264_1000207021	101
1385	3300028381	Ga0268264_10002318	Ga0268264_1000231819	101
1386	3300028381	Ga0268264_10052271	Ga0268264_100522716	101
1387	3300028381	Ga0268264_10053634	Ga0268264_100536342	101
1388	3300028381	Ga0268264_10057251	Ga0268264_100572514	101
1389	3300028381	Ga0268264_10235007	Ga0268264_102350073	101
1390	3300028381	Ga0268264_10510540	Ga0268264_105105403	101
1391	3300028381	Ga0268264_10751893	Ga0268264_107518932	101
1392	3300028381	Ga0268264_11113125	Ga0268264_111131252	101
1393	3300028381	Ga0268264_11731604	Ga0268264_117316042	101
1394	3300028381	Ga0268264_11813004	Ga0268264_118130042	101
1395	3300028381	Ga0268264_12252049	Ga0268264_122520492	101
1396	3300028381	Ga0268264_12388956	Ga0268264_123889561	101
1397	3300028573	Ga0265334_10236347	Ga0265334_102363472	101
1398	3300028577	Ga0265318_10335649	Ga0265318_103356491	101
1399	3300028666	Ga0265336_10000028	Ga0265336_1000002819	101
1400	3300028786	Ga0307517_10014561	Ga0307517_100145619	101
1401	3300028786	Ga0307517_10103679	Ga0307517_101036792	101
1402	3300028786	Ga0307517_10178695	Ga0307517_101786952	101
1403	3300028786	Ga0307517_10467546	Ga0307517_104675462	101
1404	3300028794	Ga0307515_10002443	Ga0307515_100024435	101
1405	3300028794	Ga0307515_10021273	Ga0307515_1002127317	101
1406	3300028794	Ga0307515_10053115	Ga0307515_100531155	101
1407	3300028794	Ga0307515_10089443	Ga0307515_100894439	101
1408	3300028794	Ga0307515_10095676	Ga0307515_100956761	101
1409	3300028794	Ga0307515_10108460	Ga0307515_101084605	101
1410	3300028794	Ga0307515_10186828	Ga0307515_101868282	101
1411	3300028794	Ga0307515_10297559	Ga0307515_102975592	101
1412	3300028794	Ga0307515_10558047	Ga0307515_105580472	101
1413	3300028794	Ga0307515_10703559	Ga0307515_107035592	101
1414	3300028794	Ga0307515_10830111	Ga0307515_108301111	101
1415	3300028794	Ga0307515_10889888	Ga0307515_108898882	101
1416	3300029285	Ga0310981_1011192	Ga0310981_10111922	101
1417	3300029957	Ga0265324_10000286	Ga0265324_1000028633	101
1418	3300030500	Ga0268256_1008739	Ga0268256_10087393	101
1419	3300030521	Ga0307511_10070244	Ga0307511_100702443	101
1420	3300030522	Ga0307512_10045873	Ga0307512_100458738	101
1421	3300030522	Ga0307512_10091067	Ga0307512_100910674	101
1422	3300030522	Ga0307512_10098413	Ga0307512_100984133	101
1423	3300030863	Ga0265766_1023713	Ga0265766_10237132	101
1424	3300031250	Ga0265331_10028635	Ga0265331_100286356	101
1425	3300031251	Ga0265327_10000020	Ga0265327_10000020381	101
1426	3300031251	Ga0265327_10000178	Ga0265327_100001784	101
1427	3300031456	Ga0307513_10019109	Ga0307513_1001910915	101
1428	3300031456	Ga0307513_10034953	Ga0307513_100349533	101
1429	3300031456	Ga0307513_10063852	Ga0307513_100638524	101
1430	3300031456	Ga0307513_10076724	Ga0307513_100767241	101
1431	3300031456	Ga0307513_10184235	Ga0307513_101842353	101
1432	3300031456	Ga0307513_10220352	Ga0307513_102203524	101
1433	3300031456	Ga0307513_10418258	Ga0307513_104182582	101
1434	3300031456	Ga0307513_10640561	Ga0307513_106405612	101
1435	3300031456	Ga0307513_10781816	Ga0307513_107818162	101
1436	3300031507	Ga0307509_10003616	Ga0307509_1000361629	101
1437	3300031507	Ga0307509_10036139	Ga0307509_1003613911	101
1438	3300031507	Ga0307509_10111735	Ga0307509_101117353	101
1439	3300031507	Ga0307509_10141229	Ga0307509_101412294	101
1440	3300031507	Ga0307509_10282377	Ga0307509_102823773	101
1441	3300031507	Ga0307509_10426950	Ga0307509_104269503	101
1442	3300031548	Ga0307408_100000089	Ga0307408_10000008931	101
1443	3300031548	Ga0307408_100013705	Ga0307408_1000137058	101
1444	3300031548	Ga0307408_100193528	Ga0307408_1001935283	101
1445	3300031548	Ga0307408_100223586	Ga0307408_1002235862	101
1446	3300031548	Ga0307408_100260880	Ga0307408_1002608802	101
1447	3300031548	Ga0307408_100519381	Ga0307408_1005193813	101
1448	3300031548	Ga0307408_100867961	Ga0307408_1008679612	101
1449	3300031548	Ga0307408_100891679	Ga0307408_1008916792	101
1450	3300031548	Ga0307408_101084960	Ga0307408_1010849602	101
1451	3300031548	Ga0307408_101148342	Ga0307408_1011483421	101
1452	3300031548	Ga0307408_101272701	Ga0307408_1012727012	101
1453	3300031548	Ga0307408_101902321	Ga0307408_1019023212	101
1454	3300031616	Ga0307508_10000392	Ga0307508_1000039243	101
1455	3300031616	Ga0307508_10061685	Ga0307508_100616852	101
1456	3300031616	Ga0307508_10407074	Ga0307508_104070741	101
1457	3300031616	Ga0307508_10626816	Ga0307508_106268162	101
1458	3300031649	Ga0307514_10000339	Ga0307514_1000033959	101
1459	3300031649	Ga0307514_10034392	Ga0307514_100343928	101
1460	3300031649	Ga0307514_10178976	Ga0307514_101789763	101
1461	3300031649	Ga0307514_10213346	Ga0307514_102133462	101
1462	3300031730	Ga0307516_10000048	Ga0307516_1000004817	101
1463	3300031730	Ga0307516_10011689	Ga0307516_1001168917	101
1464	3300031730	Ga0307516_10019197	Ga0307516_1001919713	101
1465	3300031730	Ga0307516_10027941	Ga0307516_1002794111	101
1466	3300031730	Ga0307516_10040356	Ga0307516_100403565	101
1467	3300031730	Ga0307516_10330542	Ga0307516_103305423	101
1468	3300031730	Ga0307516_10388826	Ga0307516_103888262	101
1469	3300031730	Ga0307516_10547312	Ga0307516_105473122	101
1470	3300031731	Ga0307405_10012091	Ga0307405_100120917	101
1471	3300031731	Ga0307405_10046436	Ga0307405_100464365	101
1472	3300031731	Ga0307405_10170412	Ga0307405_101704123	101
1473	3300031731	Ga0307405_10833335	Ga0307405_108333352	101
1474	3300031731	Ga0307405_11115363	Ga0307405_111153632	101
1475	3300031824	Ga0307413_10032313	Ga0307413_100323133	101
1476	3300031824	Ga0307413_10410080	Ga0307413_104100802	101
1477	3300031824	Ga0307413_10919579	Ga0307413_109195792	101
1478	3300031838	Ga0307518_10376266	Ga0307518_103762662	101
1479	3300031852	Ga0307410_10073323	Ga0307410_100733235	101
1480	3300031852	Ga0307410_10140307	Ga0307410_101403074	101
1481	3300031852	Ga0307410_10220441	Ga0307410_102204412	101
1482	3300031852	Ga0307410_10342405	Ga0307410_103424052	101
1483	3300031852	Ga0307410_10348481	Ga0307410_103484812	101
1484	3300031852	Ga0307410_10531987	Ga0307410_105319872	101
1485	3300031852	Ga0307410_11106003	Ga0307410_111060032	101
1486	3300031901	Ga0307406_10004866	Ga0307406_100048668	101
1487	3300031901	Ga0307406_10166340	Ga0307406_101663402	101
1488	3300031901	Ga0307406_10239255	Ga0307406_102392552	101
1489	3300031901	Ga0307406_10545912	Ga0307406_105459122	101
1490	3300031901	Ga0307406_11001006	Ga0307406_110010062	101
1491	3300031901	Ga0307406_11013214	Ga0307406_110132142	101
1492	3300031901	Ga0307406_11038287	Ga0307406_110382871	101
1493	3300031903	Ga0307407_10061462	Ga0307407_100614625	101
1494	3300031903	Ga0307407_11293391	Ga0307407_112933912	101
1495	3300031903	Ga0307407_11565053	Ga0307407_115650531	101
1496	3300031911	Ga0307412_10011559	Ga0307412_100115592	101
1497	3300031911	Ga0307412_10074922	Ga0307412_100749222	101
1498	3300031911	Ga0307412_10094847	Ga0307412_100948473	101
1499	3300031911	Ga0307412_10160061	Ga0307412_101600612	101
1500	3300031911	Ga0307412_10384737	Ga0307412_103847372	101
1501	3300031911	Ga0307412_10526033	Ga0307412_105260333	101
1502	3300031911	Ga0307412_10636065	Ga0307412_106360652	101
1503	3300031911	Ga0307412_10702321	Ga0307412_107023212	101
1504	3300031911	Ga0307412_10743465	Ga0307412_107434652	101
1505	3300031911	Ga0307412_11113541	Ga0307412_111135412	101
1506	3300031911	Ga0307412_11218927	Ga0307412_112189272	101
1507	3300031995	Ga0307409_100000577	Ga0307409_10000057723	101
1508	3300031995	Ga0307409_100308882	Ga0307409_1003088822	101
1509	3300031995	Ga0307409_100330064	Ga0307409_1003300643	101
1510	3300031995	Ga0307409_100686881	Ga0307409_1006868811	101
1511	3300031995	Ga0307409_101899002	Ga0307409_1018990022	101
1512	3300032002	Ga0307416_100025728	Ga0307416_1000257281	101
1513	3300032002	Ga0307416_100028404	Ga0307416_1000284048	101
1514	3300032002	Ga0307416_100043561	Ga0307416_1000435615	101
1515	3300032002	Ga0307416_100231430	Ga0307416_1002314302	101
1516	3300032002	Ga0307416_100287538	Ga0307416_1002875383	101
1517	3300032002	Ga0307416_100431676	Ga0307416_1004316762	101
1518	3300032002	Ga0307416_100600388	Ga0307416_1006003882	101
1519	3300032002	Ga0307416_101811421	Ga0307416_1018114212	101
1520	3300032002	Ga0307416_102406474	Ga0307416_1024064742	101
1521	3300032004	Ga0307414_10057302	Ga0307414_100573023	101
1522	3300032004	Ga0307414_10074321	Ga0307414_100743214	101
1523	3300032004	Ga0307414_10129728	Ga0307414_101297282	101
1524	3300032004	Ga0307414_10358891	Ga0307414_103588913	101
1525	3300032004	Ga0307414_10649410	Ga0307414_106494103	101
1526	3300032004	Ga0307414_10988167	Ga0307414_109881672	101
1527	3300032004	Ga0307414_11606532	Ga0307414_116065322	101
1528	3300032005	Ga0307411_10000085	Ga0307411_1000008530	101
1529	3300032005	Ga0307411_10069652	Ga0307411_100696522	101
1530	3300032005	Ga0307411_10249959	Ga0307411_102499593	101
1531	3300032005	Ga0307411_10583866	Ga0307411_105838662	101
1532	3300032005	Ga0307411_10817801	Ga0307411_108178012	101
1533	3300032005	Ga0307411_11856363	Ga0307411_118563632	101
1534	3300032126	Ga0307415_100034663	Ga0307415_1000346635	101
1535	3300032126	Ga0307415_100039097	Ga0307415_1000390975	101
1536	3300032126	Ga0307415_100299333	Ga0307415_1002993332	101
1537	3300032126	Ga0307415_102130051	Ga0307415_1021300512	101
1538	3300033179	Ga0307507_10087876	Ga0307507_100878763	101
1539	3300033179	Ga0307507_10154935	Ga0307507_101549352	101
1540	3300033180	Ga0307510_10160136	Ga0307510_101601364	101
1541	3300033180	Ga0307510_10170741	Ga0307510_101707413	101
1542	3300034817	Ga0373948_0007447	Ga0373948_0007447_349_654	101
1543	3300034818	Ga0373950_0076850	Ga0373950_0076850_206_511	101
1544	3300034820	Ga0373959_0026537	Ga0373959_0026537_438_743	101
1545	3300034820	Ga0373959_0057324	Ga0373959_0057324_250_555	101
1546	3300034957	Ga0373938_0017777	Ga0373938_0017777_41_346	101
1547	3300034957	Ga0373938_0089052	Ga0373938_0089052_433_738	101
1548	3300035083	Ga0373926_0079568	Ga0373926_0079568_773_1078	101
1549	3300035083	Ga0373926_0366139	Ga0373926_0366139_32_337	101
1550	3300035084	Ga0373928_0014100	Ga0373928_0014100_332_637	101
1551	3300035085	Ga0373929_0265161	Ga0373929_0265161_16_321	101
1552	3300035086	Ga0373934_0009951	Ga0373934_0009951_3208_3513	101
1553	3300035088	Ga0373940_0013733	Ga0373940_0013733_798_1103	101
1554	3300035088	Ga0373940_0039203	Ga0373940_0039203_500_805	101
1555	3300035088	Ga0373940_0047957	Ga0373940_0047957_215_520	101
1556	3300035089	Ga0373944_0122432	Ga0373944_0122432_66_371	101
1557	3300035089	Ga0373944_0376072	Ga0373944_0376072_58_363	101
1558	3300035090	Ga0373949_0033918	Ga0373949_0033918_782_1087	101
1559	3300035090	Ga0373949_0161197	Ga0373949_0161197_155_460	101
1560	3300035091	Ga0373951_0036869	Ga0373951_0036869_658_963	101
1561	3300035091	Ga0373951_0066119	Ga0373951_0066119_218_523	101
1562	3300035111	Ga0373923_0045641	Ga0373923_0045641_448_753	101
1563	3300035112	Ga0373932_0121153	Ga0373932_0121153_389_694	101
1564	3300035112	Ga0373932_0247749	Ga0373932_0247749_82_387	101
1565	3300035113	Ga0373936_0126258	Ga0373936_0126258_411_716	101
1566	3300035113	Ga0373936_0244382	Ga0373936_0244382_385_690	101
1567	3300035114	Ga0373939_0000348	Ga0373939_0000348_3709_4014	101
1568	3300035114	Ga0373939_0028000	Ga0373939_0028000_166_471	101
1569	3300035115	Ga0373941_0115506	Ga0373941_0115506_467_772	101
1570	3300035116	Ga0373945_0062010	Ga0373945_0062010_819_1124	101
1571	3300035116	Ga0373945_0242168	Ga0373945_0242168_25_330	101
1572	3300035116	Ga0373945_0381565	Ga0373945_0381565_285_590	101
1573	3300035117	Ga0373953_0042168	Ga0373953_0042168_886_1191	101
1574	3300035119	Ga0373956_0136201	Ga0373956_0136201_217_522	101
1575	3300035119	Ga0373956_0352378	Ga0373956_0352378_37_342	101
1576	3300035120	Ga0373957_0070420	Ga0373957_0070420_270_575	101
1577	3300035121	Ga0373960_0114684	Ga0373960_0114684_477_782	101
1578	3300035170	Ga0373943_0205596	Ga0373943_0205596_339_644	101
1579	3300035170	Ga0373943_0266450	Ga0373943_0266450_380_685	101
1580	3300035170	Ga0373943_0325661	Ga0373943_0325661_156_461	101
1581	3300035171	Ga0373946_0202063	Ga0373946_0202063_332_637	101
1582	3300035171	Ga0373946_0248443	Ga0373946_0248443_176_481	101
1583	3300035171	Ga0373946_0325416	Ga0373946_0325416_422_727	101
1584	3300035172	Ga0373955_0092432	Ga0373955_0092432_905_1210	101
1585	3300035172	Ga0373955_0847039	Ga0373955_0847039_227_532	101
1586	3300035241	Ga0373961_0015414	Ga0373961_0015414_1200_1505	101
1587	3300035241	Ga0373961_0381993	Ga0373961_0381993_150_455	101
1588	3300035410	Ga0373924_0102911	Ga0373924_0102911_660_965	101
1589	3300035410	Ga0373924_0311908	Ga0373924_0311908_160_465	101
1590	3300035691	Ga0373931_0000535	Ga0373931_0000535_2984_3289	101
1591	3300035691	Ga0373931_0001474	Ga0373931_0001474_6062_6367	101
1592	3300035691	Ga0373931_0008660	Ga0373931_0008660_1097_1402	101
1593	3300035691	Ga0373931_0022499	Ga0373931_0022499_583_888	101
1594	3300035691	Ga0373931_0459977	Ga0373931_0459977_281_586	101
1595	3300035692	Ga0373935_0466874	Ga0373935_0466874_445_750	101
1596	3300035692	Ga0373935_0648367	Ga0373935_0648367_343_648	101
1597	3300035692	Ga0373935_1366174	Ga0373935_1366174_125_430	101
1598	3300035695	Ga0373927_0108327	Ga0373927_0108327_1081_1386	101
1599	3300035695	Ga0373927_0120122	Ga0373927_0120122_166_471	101
1600	3300035695	Ga0373927_0421769	Ga0373927_0421769_56_361	101
1601	3300035724	Ga0373933_0382352	Ga0373933_0382352_394_699	101
1602	3300035725	Ga0373947_0185796	Ga0373947_0185796_948_1253	101
1603	3300035725	Ga0373947_0474762	Ga0373947_0474762_173_478	101
1604	3300035725	Ga0373947_0566338	Ga0373947_0566338_83_388	101
1605	3300035725	Ga0373947_0588958	Ga0373947_0588958_321_626	101
1606	3300036401	Ga0373937_0488619	Ga0373937_0488619_646_951	101
1607	3300036401	Ga0373937_0703249	Ga0373937_0703249_383_688	101
1608	3300036457	Ga0265778_002283	Ga0265778_002283_99_404	101
1609	3300036535	Ga0310110_007052	Ga0310110_007052_97_402	101
1610	3300037068	Ga0373925_0089907	Ga0373925_0089907_346_651	101
1611	3300037068	Ga0373925_0226591	Ga0373925_0226591_171_476	101
1612	3300037068	Ga0373925_0269257	Ga0373925_0269257_805_1110	101
1613	3300037068	Ga0373925_1714838	Ga0373925_1714838_18_323	101
1614	3300037312	Ga0395899_0028029	Ga0395899_0028029_2857_3162	101
1615	3300037312	Ga0395899_0100034	Ga0395899_0100034_523_828	101
1616	3300037312	Ga0395899_0342891	Ga0395899_0342891_118_423	101
1617	3300037418	Ga0395900_0000542	Ga0395900_0000542_26819_27124	101
1618	3300037418	Ga0395900_0019646	Ga0395900_0019646_3861_4166	101
1619	3300037418	Ga0395900_0033722	Ga0395900_0033722_4837_5142	101
1620	3300037418	Ga0395900_0438382	Ga0395900_0438382_491_796	101
1621	3300037418	Ga0395900_0521739	Ga0395900_0521739_295_600	101
1622	3300037466	Ga0395898_0003063	Ga0395898_0003063_10823_11128	101
1623	3300037466	Ga0395898_0004013	Ga0395898_0004013_5828_6133	101
1624	3300037466	Ga0395898_0010146	Ga0395898_0010146_3206_3511	101
1625	3300037466	Ga0395898_0012209	Ga0395898_0012209_4838_5143	101
1626	3300037466	Ga0395898_0395446	Ga0395898_0395446_984_1289	101
1627	3300037471	Ga0395905_0002507	Ga0395905_0002507_12230_12535	101
1628	3300037471	Ga0395905_0004938	Ga0395905_0004938_1415_1720	101
1629	3300037471	Ga0395905_0008603	Ga0395905_0008603_2721_3026	101
1630	3300037471	Ga0395905_0013480	Ga0395905_0013480_741_1046	101
1631	3300037471	Ga0395905_0023115	Ga0395905_0023115_1461_1766	101
1632	3300037471	Ga0395905_0038305	Ga0395905_0038305_2217_2522	101
1633	3300037471	Ga0395905_0067703	Ga0395905_0067703_2521_2826	101
1634	3300037471	Ga0395905_0097413	Ga0395905_0097413_1220_1525	101
1635	3300037471	Ga0395905_0304457	Ga0395905_0304457_80_385	101
1636	3300037471	Ga0395905_0481490	Ga0395905_0481490_86_391	101
1637	3300037471	Ga0395905_0630830	Ga0395905_0630830_217_522	101
1638	3300038443	Ga0395901_0001925	Ga0395901_0001925_9684_9989	101
1639	3300038443	Ga0395901_0014473	Ga0395901_0014473_1418_1723	101
1640	3300039437	Ga0436365_0023403	Ga0436365_0023403_642_947	101
1641	3300039447	Ga0436361_0264239	Ga0436361_0264239_50_355	101
1642	3300039447	Ga0436361_0277444	Ga0436361_0277444_236_541	101
1643	3300039447	Ga0436361_0405071	Ga0436361_0405071_7399_7704	101
1644	3300039447	Ga0436361_0560599	Ga0436361_0560599_176_481	101
1645	3300039447	Ga0436361_0568601	Ga0436361_0568601_498_803	101
1646	3300039447	Ga0436361_0570086	Ga0436361_0570086_4795_5100	101
1647	3300039447	Ga0436361_0714431	Ga0436361_0714431_6342_6647	101
1648	3300039447	Ga0436361_0846450	Ga0436361_0846450_346_651	101
1649	3300039447	Ga0436361_1080792	Ga0436361_1080792_50_355	101
1650	3300039450	Ga0436363_0160364	Ga0436363_0160364_111_416	101
1651	3300039450	Ga0436363_0544282	Ga0436363_0544282_414_719	101
1652	3300039450	Ga0436363_0965849	Ga0436363_0965849_136_441	101
1653	3300041404	Ga0439436_0040359	Ga0439436_0040359_467_772	101
1654	3300041405	Ga0439438_145999	Ga0439438_145999_179_484	101
1655	3300041406	Ga0439439_0073294	Ga0439439_0073294_224_529	101
1656	3300041408	Ga0439453_0104985	Ga0439453_0104985_20_325	101
1657	3300041410	Ga0439461_0011743	Ga0439461_0011743_415_720	101
1658	3300041410	Ga0439461_0024350	Ga0439461_0024350_698_1003	101
1659	3300041410	Ga0439461_0095235	Ga0439461_0095235_31_336	101
1660	3300041410	Ga0439461_0118099	Ga0439461_0118099_201_506	101
1661	3300041411	Ga0439466_0106597	Ga0439466_0106597_343_648	101
1662	3300041413	Ga0439465_0005103	Ga0439465_0005103_2478_2783	101
1663	3300041413	Ga0439465_0010171	Ga0439465_0010171_1072_1377	101
1664	3300041413	Ga0439465_0061840	Ga0439465_0061840_117_422	101
1665	3300041413	Ga0439465_0261466	Ga0439465_0261466_82_387	101
1666	3300041441	Ga0451787_047981	Ga0451787_047981_148_453	101
1667	3300041443	Ga0451789_0166480	Ga0451789_0166480_588_893	101
1668	3300041443	Ga0451789_0965253	Ga0451789_0965253_1289_1594	101
1669	3300041444	Ga0451790_23077	Ga0451790_23077_213_518	101
1670	3300041444	Ga0451790_47197	Ga0451790_47197_238_543	101
1671	3300041446	Ga0451794_02261	Ga0451794_02261_97_402	101
1672	3300041446	Ga0451794_03533	Ga0451794_03533_436_741	101
1673	3300041446	Ga0451794_21839	Ga0451794_21839_217_522	101
1674	3300041451	Ga0451791_0033323	Ga0451791_0033323_211_516	101
1675	3300041451	Ga0451791_0167116	Ga0451791_0167116_298_603	101
1676	3300041451	Ga0451791_1331173	Ga0451791_1331173_173_478	101
1677	3300041452	Ga0451793_0077150	Ga0451793_0077150_82_387	101
1678	3300041452	Ga0451793_0560974	Ga0451793_0560974_331_636	101
1679	3300041452	Ga0451793_1338571	Ga0451793_1338571_827_1132	101
1680	3300041452	Ga0451793_1492943	Ga0451793_1492943_93_398	101
1681	3300041453	Ga0451797_0593740	Ga0451797_0593740_169_474	101
1682	3300041453	Ga0451797_0784698	Ga0451797_0784698_459_764	101
1683	3300041454	Ga0451799_34005	Ga0451799_34005_258_563	101
1684	3300041455	Ga0451801_02522	Ga0451801_02522_726_1031	101
1685	3300041455	Ga0451801_26122	Ga0451801_26122_197_502	101
1686	3300041455	Ga0451801_40786	Ga0451801_40786_478_783	101
1687	3300041456	Ga0451795_0013989	Ga0451795_0013989_472_777	101
1688	3300041456	Ga0451795_1662122	Ga0451795_1662122_105_410	101
1689	3300041456	Ga0451795_1676515	Ga0451795_1676515_188_493	101
1690	3300041457	Ga0451803_03143	Ga0451803_03143_464_769	101
1691	3300041458	Ga0451798_0237297	Ga0451798_0237297_1197_1502	101
1692	3300041458	Ga0451798_0434508	Ga0451798_0434508_252_557	101
1693	3300041459	Ga0451800_0810391	Ga0451800_0810391_222_527	101
1694	3300041459	Ga0451800_0830017	Ga0451800_0830017_312_617	101
1695	3300041459	Ga0451800_1183293	Ga0451800_1183293_356_661	101
1696	3300041459	Ga0451800_1232355	Ga0451800_1232355_1746_2051	101
1697	3300041459	Ga0451800_1546204	Ga0451800_1546204_539_844	101
1698	3300041460	Ga0451802_0106731	Ga0451802_0106731_286_591	101
1699	3300041460	Ga0451802_0433132	Ga0451802_0433132_1395_1700	101
1700	3300041460	Ga0451802_1381453	Ga0451802_1381453_219_524	101
1701	3300041461	Ga0451805_010980	Ga0451805_010980_1215_1520	101
1702	3300041461	Ga0451805_039282	Ga0451805_039282_172_477	101
1703	3300041461	Ga0451805_102604	Ga0451805_102604_812_1117	101
1704	3300041461	Ga0451805_106515	Ga0451805_106515_129_434	101
1705	3300041463	Ga0451804_0350671	Ga0451804_0350671_2510_2815	101
1706	3300041463	Ga0451804_0734827	Ga0451804_0734827_457_762	101
1707	3300041486	Ga0451807_0037261	Ga0451807_0037261_861_1166	101
1708	3300041486	Ga0451807_1280507	Ga0451807_1280507_578_883	101
1709	3300041486	Ga0451807_1506488	Ga0451807_1506488_490_795	101
1710	3300041486	Ga0451807_2557829	Ga0451807_2557829_286_591	101
1711	3300041491	Ga0451833_0316321	Ga0451833_0316321_622_927	101
1712	3300041491	Ga0451833_0454442	Ga0451833_0454442_251_556	101
1713	3300041491	Ga0451833_0770229	Ga0451833_0770229_462_767	101
1714	3300041492	Ga0451835_0635417	Ga0451835_0635417_305_610	101
1715	3300041494	Ga0451837_0653876	Ga0451837_0653876_151_456	101
1716	3300041494	Ga0451837_1583729	Ga0451837_1583729_680_985	101
1717	3300041496	Ga0451839_0386917	Ga0451839_0386917_183_488	101
1718	3300041501	Ga0451845_0920152	Ga0451845_0920152_180_485	101
1719	3300041503	Ga0451847_0492633	Ga0451847_0492633_259_564	101
1720	3300041505	Ga0451849_0509842	Ga0451849_0509842_105_410	101
1721	3300041507	Ga0451851_0137890	Ga0451851_0137890_192_497	101
1722	3300041509	Ga0451843_0970979	Ga0451843_0970979_371_676	101
1723	3300041509	Ga0451843_1344647	Ga0451843_1344647_171_476	101
1724	3300041510	Ga0451854_29665	Ga0451854_29665_402_707	101
1725	3300041511	Ga0451855_0043459	Ga0451855_0043459_609_914	101
1726	3300041512	Ga0451853_0666568	Ga0451853_0666568_269_574	101
1727	3300041512	Ga0451853_0949970	Ga0451853_0949970_270_575	101
1728	3300041512	Ga0451853_1066481	Ga0451853_1066481_150_455	101
1729	3300041512	Ga0451853_3056834	Ga0451853_3056834_157_462	101
1730	3300041512	Ga0451853_3291537	Ga0451853_3291537_214_519	101
1731	3300041512	Ga0451853_4042749	Ga0451853_4042749_709_1014	101
1732	3300041997	Ga0439431_0002412	Ga0439431_0002412_1936_2241	101
1733	3300041999	Ga0439433_0025440	Ga0439433_0025440_710_1015	101
1734	3300042000	Ga0439437_004427	Ga0439437_004427_919_1224	101
1735	3300042001	Ga0439441_066668	Ga0439441_066668_326_631	101
1736	3300042001	Ga0439441_095905	Ga0439441_095905_109_414	101
1737	3300042001	Ga0439441_159424	Ga0439441_159424_17_322	101
1738	3300042002	Ga0439442_139711	Ga0439442_139711_152_457	101
1739	3300042003	Ga0439443_004303	Ga0439443_004303_25_330	101
1740	3300042004	Ga0439445_0009991	Ga0439445_0009991_1401_1706	101
1741	3300042004	Ga0439445_0035690	Ga0439445_0035690_700_1005	101
1742	3300042004	Ga0439445_0195651	Ga0439445_0195651_144_449	101
1743	3300042005	Ga0439448_0121579	Ga0439448_0121579_20_325	101
1744	3300042005	Ga0439448_0196488	Ga0439448_0196488_45_350	101
1745	3300042005	Ga0439448_0196960	Ga0439448_0196960_97_402	101
1746	3300042006	Ga0439432_167758	Ga0439432_167758_73_378	101
1747	3300042007	Ga0439449_0041597	Ga0439449_0041597_576_881	101
1748	3300042007	Ga0439449_0153638	Ga0439449_0153638_224_529	101
1749	3300042008	Ga0439450_062997	Ga0439450_062997_257_562	101
1750	3300042010	Ga0439452_034134	Ga0439452_034134_587_892	101
1751	3300042011	Ga0439454_011152	Ga0439454_011152_755_1060	101
1752	3300042011	Ga0439454_053617	Ga0439454_053617_346_651	101
1753	3300042012	Ga0439455_0002630	Ga0439455_0002630_1587_1892	101
1754	3300042012	Ga0439455_0004568	Ga0439455_0004568_1818_2123	101
1755	3300042012	Ga0439455_0028934	Ga0439455_0028934_358_663	101
1756	3300042012	Ga0439455_0134550	Ga0439455_0134550_199_504	101
1757	3300042013	Ga0439456_167275	Ga0439456_167275_10_315	101
1758	3300042014	Ga0439457_056273	Ga0439457_056273_79_384	101
1759	3300042015	Ga0439462_0063869	Ga0439462_0063869_459_764	101
1760	3300042015	Ga0439462_0158458	Ga0439462_0158458_37_342	101
1761	3300042116	Ga0450912_001673	Ga0450912_001673_595_900	101
1762	3300042116	Ga0450912_037112	Ga0450912_037112_86_391	101
1763	3300042117	Ga0450913_000876	Ga0450913_000876_169_474	101
1764	3300042120	Ga0450917_000001	Ga0450917_000001_3800_4105	101
1765	3300042121	Ga0450919_000025	Ga0450919_000025_5005_5310	101
1766	3300042122	Ga0450920_004654	Ga0450920_004654_1649_1954	101
1767	3300042125	Ga0450923_159589	Ga0450923_159589_180_485	101
1768	3300042126	Ga0450888_000612	Ga0450888_000612_2922_3227	101
1769	3300042127	Ga0450890_000549	Ga0450890_000549_1981_2286	101
1770	3300042127	Ga0450890_000550	Ga0450890_000550_46_351	101
1771	3300042127	Ga0450890_020407	Ga0450890_020407_459_764	101
1772	3300042128	Ga0450897_033099	Ga0450897_033099_58_363	101
1773	3300042129	Ga0450891_000262	Ga0450891_000262_2197_2502	101
1774	3300042130	Ga0450892_001360	Ga0450892_001360_496_801	101
1775	3300042130	Ga0450892_016864	Ga0450892_016864_179_484	101
1776	3300042133	Ga0450896_008784	Ga0450896_008784_1030_1335	101
1777	3300042134	Ga0450898_014524	Ga0450898_014524_841_1146	101
1778	3300042134	Ga0450898_116347	Ga0450898_116347_77_382	101
1779	3300042135	Ga0450899_002878	Ga0450899_002878_1039_1344	101
1780	3300042136	Ga0450900_032950	Ga0450900_032950_203_508	101
1781	3300042137	Ga0450902_009473	Ga0450902_009473_991_1296	101
1782	3300042139	Ga0450904_002939	Ga0450904_002939_1348_1653	101
1783	3300042139	Ga0450904_013862	Ga0450904_013862_155_460	101
1784	3300042144	Ga0450889_000161	Ga0450889_000161_5878_6183	101
1785	3300042156	Ga0439446_0031377	Ga0439446_0031377_1118_1423	101
1786	3300042156	Ga0439446_0042365	Ga0439446_0042365_917_1222	101
1787	3300042156	Ga0439446_0048248	Ga0439446_0048248_34_339	101
1788	3300042156	Ga0439446_0049014	Ga0439446_0049014_746_1051	101
1789	3300042156	Ga0439446_0057763	Ga0439446_0057763_295_600	101
1790	3300042157	Ga0439458_0101130	Ga0439458_0101130_174_479	101
1791	3300042157	Ga0439458_0217814	Ga0439458_0217814_76_381	101
1792	3300042185	Ga0450909_078743	Ga0450909_078743_25_330	101
1793	3300042435	Ga0439434_0007708	Ga0439434_0007708_878_1183	101
1794	3300042435	Ga0439434_0015184	Ga0439434_0015184_36_341	101
1795	3300042435	Ga0439434_0022473	Ga0439434_0022473_830_1135	101
1796	3300042435	Ga0439434_0075520	Ga0439434_0075520_594_899	101
1797	3300042435	Ga0439434_0093449	Ga0439434_0093449_298_603	101
1798	3300042435	Ga0439434_0095345	Ga0439434_0095345_450_755	101
1799	3300042436	Ga0439435_0103450	Ga0439435_0103450_258_563	101
1800	3300042437	Ga0439444_0056821	Ga0439444_0056821_364_669	101
1801	3300042438	Ga0439459_0000309	Ga0439459_0000309_1894_2199	101
1802	3300042439	Ga0439464_0010621	Ga0439464_0010621_990_1295	101
1803	3300042439	Ga0439464_0071151	Ga0439464_0071151_272_577	101
1804	3300042439	Ga0439464_0276895	Ga0439464_0276895_227_532	101
1805	3300042461	Ga0439460_0002749	Ga0439460_0002749_3176_3481	101
1806	3300042461	Ga0439460_0164920	Ga0439460_0164920_142_447	101
1807	3300042530	Ga0450916_000427	Ga0450916_000427_664_969	101
1808	3300042531	Ga0450918_000123	Ga0450918_000123_7819_8124	101
1809	3300042532	Ga0450893_0002832	Ga0450893_0002832_2130_2435	101
1810	3300042532	Ga0450893_0032228	Ga0450893_0032228_529_834	101
1811	3300042532	Ga0450893_0090967	Ga0450893_0090967_102_407	101
1812	3300042533	Ga0450901_006221	Ga0450901_006221_190_495	101
1813	3300042533	Ga0450901_042815	Ga0450901_042815_197_502	101
1814	3300042876	Ga0451577_0004524	Ga0451577_0004524_5673_5978	101
1815	3300042876	Ga0451577_0069675	Ga0451577_0069675_2130_2435	101
1816	3300044656	Ga0466969_0000018	Ga0466969_0000018_2235_2540	101
1817	3300044656	Ga0466969_0001561	Ga0466969_0001561_7967_8272	101
1818	3300044656	Ga0466969_0002589	Ga0466969_0002589_7202_7507	101
1819	3300044656	Ga0466969_0012551	Ga0466969_0012551_1846_2151	101
1820	3300044658	Ga0466972_0004583	Ga0466972_0004583_5889_6194	101
1821	3300044658	Ga0466972_0007374	Ga0466972_0007374_814_1119	101
1822	3300044658	Ga0466972_0026175	Ga0466972_0026175_1058_1363	101
1823	3300044673	Ga0453683_0846513	Ga0453683_0846513_279_584	101
1824	3300044673	Ga0453683_1072917	Ga0453683_1072917_11_316	101
1825	3300044683	Ga0466965_0008031	Ga0466965_0008031_3019_3324	101
1826	3300044683	Ga0466965_0018301	Ga0466965_0018301_29_334	101
1827	3300044683	Ga0466965_0065957	Ga0466965_0065957_13_318	101
1828	3300044683	Ga0466965_0125350	Ga0466965_0125350_567_872	101
1829	3300044684	Ga0466966_0009766	Ga0466966_0009766_5712_6017	101
1830	3300044684	Ga0466966_0010593	Ga0466966_0010593_2473_2778	101
1831	3300044684	Ga0466966_0021693	Ga0466966_0021693_1554_1859	101
1832	3300044684	Ga0466966_0026863	Ga0466966_0026863_2725_3030	101
1833	3300044693	Ga0466961_0004306	Ga0466961_0004306_7324_7629	101
1834	3300044693	Ga0466961_0005561	Ga0466961_0005561_4789_5094	101
1835	3300044693	Ga0466961_0026432	Ga0466961_0026432_847_1152	101
1836	3300044693	Ga0466961_0166639	Ga0466961_0166639_920_1225	101
1837	3300044693	Ga0466961_0168219	Ga0466961_0168219_111_416	101
1838	3300044694	Ga0466963_0028896	Ga0466963_0028896_76_381	101
1839	3300044694	Ga0466963_0112607	Ga0466963_0112607_799_1104	101
1840	3300044694	Ga0466963_0293883	Ga0466963_0293883_475_780	101
1841	3300044694	Ga0466963_1064302	Ga0466963_1064302_81_386	101
1842	3300044706	Ga0466964_0000637	Ga0466964_0000637_7413_7718	101
1843	3300044706	Ga0466964_0003200	Ga0466964_0003200_1777_2082	101
1844	3300044712	Ga0453684_0077473	Ga0453684_0077473_892_1197	101
1845	3300044712	Ga0453684_0218561	Ga0453684_0218561_851_1156	101
1846	3300044712	Ga0453684_0261576	Ga0453684_0261576_192_497	101
1847	3300044712	Ga0453684_0436833	Ga0453684_0436833_225_530	101
1848	3300044712	Ga0453684_0517923	Ga0453684_0517923_275_580	101
1849	3300044712	Ga0453684_0567071	Ga0453684_0567071_150_455	101
1850	3300044712	Ga0453684_1614105	Ga0453684_1614105_221_526	101
1851	3300044712	Ga0453684_1966885	Ga0453684_1966885_204_509	101
1852	3300044719	Ga0466971_0001482	Ga0466971_0001482_2402_2707	101
1853	3300044719	Ga0466971_0002400	Ga0466971_0002400_6875_7180	101
1854	3300044719	Ga0466971_0003261	Ga0466971_0003261_3626_3931	101
1855	3300044735	Ga0466968_0007045	Ga0466968_0007045_1933_2238	101
1856	3300044735	Ga0466968_0012515	Ga0466968_0012515_1753_2058	101
1857	3300044735	Ga0466968_0028269	Ga0466968_0028269_118_423	101
1858	3300044765	Ga0466970_0025081	Ga0466970_0025081_271_576	101
1859	3300044765	Ga0466970_0030706	Ga0466970_0030706_1053_1358	101
1860	3300044765	Ga0466970_0249881	Ga0466970_0249881_79_384	101
1861	3300044765	Ga0466970_0609825	Ga0466970_0609825_29_334	101
1862	3300044842	Ga0466957_0006128	Ga0466957_0006128_824_1129	101
1863	3300044842	Ga0466957_0029622	Ga0466957_0029622_2832_3137	101
1864	3300044842	Ga0466957_0062776	Ga0466957_0062776_1343_1648	101
1865	3300044842	Ga0466957_0443586	Ga0466957_0443586_479_784	101
1866	3300044901	Ga0466960_0006778	Ga0466960_0006778_3471_3776	101
1867	3300044901	Ga0466960_0076355	Ga0466960_0076355_1172_1477	101
1868	3300044901	Ga0466960_0304968	Ga0466960_0304968_87_392	101
1869	3300044901	Ga0466960_0369837	Ga0466960_0369837_371_676	101
1870	3300044901	Ga0466960_0446045	Ga0466960_0446045_135_440	101
1871	3300045049	Ga0466959_0000855	Ga0466959_0000855_7749_8054	101
1872	3300045049	Ga0466959_0003145	Ga0466959_0003145_6330_6635	101
1873	3300045049	Ga0466959_0014533	Ga0466959_0014533_3730_4035	101
1874	3300045049	Ga0466959_0664657	Ga0466959_0664657_28_333	101
1875	3300045051	Ga0451576_0003595	Ga0451576_0003595_17704_18009	101
1876	3300045051	Ga0451576_0075129	Ga0451576_0075129_2482_2787	101
1877	3300045051	Ga0451576_0168870	Ga0451576_0168870_1943_2248	101
1878	3300045051	Ga0451576_0279243	Ga0451576_0279243_717_1022	101
1879	3300045051	Ga0451576_0519894	Ga0451576_0519894_926_1231	101
1880	3300045051	Ga0451576_0643341	Ga0451576_0643341_636_941	101
1881	3300045051	Ga0451576_1059663	Ga0451576_1059663_236_541	101
1882	3300045051	Ga0451576_1160016	Ga0451576_1160016_55_360	101
1883	3300045051	Ga0451576_1268553	Ga0451576_1268553_230_535	101
1884	3300045836	Ga0466958_0002207	Ga0466958_0002207_1100_1405	101
1885	3300045836	Ga0466958_0022101	Ga0466958_0022101_2658_2963	101
1886	3300045976	Ga0466967_0003037	Ga0466967_0003037_5159_5464	101
1887	3300045976	Ga0466967_0505904	Ga0466967_0505904_609_914	101
1888	3300045976	Ga0466967_0631274	Ga0466967_0631274_713_1018	101
1889	3300045976	Ga0466967_2534945	Ga0466967_2534945_50_355	101
1890	3300046454	Ga0495592_0000203	Ga0495592_0000203_42796_43101	101
1891	3300046454	Ga0495592_0114305	Ga0495592_0114305_1411_1716	101
1892	3300046454	Ga0495592_0385126	Ga0495592_0385126_544_849	101
1893	3300046455	Ga0495603_0167391	Ga0495603_0167391_573_878	101
1894	3300046457	Ga0495590_0004188	Ga0495590_0004188_4534_4839	101
1895	3300046457	Ga0495590_0011864	Ga0495590_0011864_1453_1758	101
1896	3300046457	Ga0495590_0076553	Ga0495590_0076553_271_576	101
1897	3300046459	Ga0495629_0208823	Ga0495629_0208823_310_615	101
1898	3300046459	Ga0495629_0856910	Ga0495629_0856910_212_517	101
1899	3300046460	Ga0495638_0050878	Ga0495638_0050878_112_417	101
1900	3300046460	Ga0495638_0131647	Ga0495638_0131647_885_1190	101
1901	3300046460	Ga0495638_0162714	Ga0495638_0162714_217_522	101
1902	3300046460	Ga0495638_0462993	Ga0495638_0462993_98_403	101
1903	3300046461	Ga0495641_0201200	Ga0495641_0201200_75_380	101
1904	3300046461	Ga0495641_0429904	Ga0495641_0429904_26_388	101
1905	3300046462	Ga0495651_0074163	Ga0495651_0074163_1938_2243	101
1906	3300046462	Ga0495651_0348222	Ga0495651_0348222_103_408	101
1907	3300046463	Ga0495653_0329348	Ga0495653_0329348_604_909	101
1908	3300046471	Ga0495650_0007879	Ga0495650_0007879_4293_4598	101
1909	3300046471	Ga0495650_0065725	Ga0495650_0065725_600_905	101
1910	3300046471	Ga0495650_0117494	Ga0495650_0117494_597_902	101
1911	3300046471	Ga0495650_0139121	Ga0495650_0139121_382_687	101
1912	3300046471	Ga0495650_0279128	Ga0495650_0279128_185_490	101
1913	3300046472	Ga0495580_0359190	Ga0495580_0359190_98_403	101
1914	3300046472	Ga0495580_0946552	Ga0495580_0946552_132_437	101
1915	3300046473	Ga0495582_0204500	Ga0495582_0204500_759_1064	101
1916	3300046474	Ga0495605_0372512	Ga0495605_0372512_81_386	101
1917	3300046475	Ga0495639_0020558	Ga0495639_0020558_1755_2060	101
1918	3300046475	Ga0495639_0095232	Ga0495639_0095232_852_1157	101
1919	3300046477	Ga0495664_0437961	Ga0495664_0437961_132_437	101
1920	3300046491	Ga0495584_0376939	Ga0495584_0376939_73_378	101
1921	3300046492	Ga0495585_0010449	Ga0495585_0010449_3208_3513	101
1922	3300046492	Ga0495585_0167749	Ga0495585_0167749_358_663	101
1923	3300046499	Ga0495594_0698049	Ga0495594_0698049_41_346	101
1924	3300046500	Ga0495596_0227076	Ga0495596_0227076_185_490	101
1925	3300046501	Ga0495607_0337333	Ga0495607_0337333_178_483	101
1926	3300046506	Ga0495583_0000510	Ga0495583_0000510_14359_14664	101
1927	3300046506	Ga0495583_0124309	Ga0495583_0124309_613_918	101
1928	3300046506	Ga0495583_0237254	Ga0495583_0237254_88_393	101
1929	3300046507	Ga0495606_0003088	Ga0495606_0003088_3488_3793	101
1930	3300046507	Ga0495606_0055743	Ga0495606_0055743_90_395	101
1931	3300046507	Ga0495606_0348343	Ga0495606_0348343_398_703	101
1932	3300046511	Ga0495608_0083536	Ga0495608_0083536_1252_1557	101
1933	3300046511	Ga0495608_0411968	Ga0495608_0411968_156_461	101
1934	3300046511	Ga0495608_0482142	Ga0495608_0482142_133_438	101
1935	3300046512	Ga0495610_0007369	Ga0495610_0007369_1861_2166	101
1936	3300046512	Ga0495610_0025318	Ga0495610_0025318_2069_2374	101
1937	3300046512	Ga0495610_0152175	Ga0495610_0152175_12_317	101
1938	3300046514	Ga0495618_0210570	Ga0495618_0210570_304_609	101
1939	3300046515	Ga0495620_0021563	Ga0495620_0021563_180_485	101
1940	3300046515	Ga0495620_0412949	Ga0495620_0412949_22_327	101
1941	3300046516	Ga0495628_0102358	Ga0495628_0102358_1820_2125	101
1942	3300046516	Ga0495628_0282688	Ga0495628_0282688_747_1052	101
1943	3300046517	Ga0495630_0113383	Ga0495630_0113383_230_535	101
1944	3300046517	Ga0495630_0126006	Ga0495630_0126006_774_1079	101
1945	3300046518	Ga0495631_0022122	Ga0495631_0022122_864_1169	101
1946	3300046518	Ga0495631_0249790	Ga0495631_0249790_302_607	101
1947	3300046519	Ga0495632_0014757	Ga0495632_0014757_3702_4007	101
1948	3300046519	Ga0495632_0065630	Ga0495632_0065630_1212_1517	101
1949	3300046519	Ga0495632_0140722	Ga0495632_0140722_400_705	101
1950	3300046519	Ga0495632_0443790	Ga0495632_0443790_59_364	101
1951	3300046522	Ga0495643_0019121	Ga0495643_0019121_3651_3956	101
1952	3300046522	Ga0495643_0244020	Ga0495643_0244020_395_700	101
1953	3300046524	Ga0495648_0189097	Ga0495648_0189097_116_421	101
1954	3300046524	Ga0495648_0297242	Ga0495648_0297242_203_508	101
1955	3300046524	Ga0495648_0356901	Ga0495648_0356901_101_406	101
1956	3300046526	Ga0495666_0107065	Ga0495666_0107065_664_969	101
1957	3300046528	Ga0495642_0053512	Ga0495642_0053512_1210_1515	101
1958	3300046528	Ga0495642_0088118	Ga0495642_0088118_221_526	101
1959	3300046529	Ga0495652_0122016	Ga0495652_0122016_956_1261	101
1960	3300046529	Ga0495652_0781990	Ga0495652_0781990_174_479	101
1961	3300046530	Ga0495654_0056414	Ga0495654_0056414_1098_1403	101
1962	3300046531	Ga0495665_0139846	Ga0495665_0139846_429_734	101
1963	3300046535	Ga0495586_0061618	Ga0495586_0061618_1024_1329	101
1964	3300046535	Ga0495586_0227722	Ga0495586_0227722_143_448	101
1965	3300046535	Ga0495586_0724940	Ga0495586_0724940_50_355	101
1966	3300046537	Ga0495598_0020184	Ga0495598_0020184_32_337	101
1967	3300046537	Ga0495598_0031772	Ga0495598_0031772_402_707	101
1968	3300046539	Ga0495621_0004071	Ga0495621_0004071_741_1046	101
1969	3300046539	Ga0495621_0012556	Ga0495621_0012556_1454_1759	101
1970	3300046539	Ga0495621_0195902	Ga0495621_0195902_370_675	101
1971	3300046543	Ga0495645_0034282	Ga0495645_0034282_1903_2208	101
1972	3300046543	Ga0495645_0098975	Ga0495645_0098975_1006_1311	101
1973	3300046543	Ga0495645_0385066	Ga0495645_0385066_101_406	101
1974	3300046557	Ga0495622_0022381	Ga0495622_0022381_2390_2695	101
1975	3300046558	Ga0495633_0120456	Ga0495633_0120456_766_1071	101
1976	3300046558	Ga0495633_0243197	Ga0495633_0243197_33_338	101
1977	3300046559	Ga0495667_0115936	Ga0495667_0115936_396_701	101
1978	3300046615	Ga0495656_0175931	Ga0495656_0175931_592_897	101
1979	3300046616	Ga0495668_0089410	Ga0495668_0089410_100_405	101
1980	3300046616	Ga0495668_0173003	Ga0495668_0173003_773_1078	101
1981	3300046616	Ga0495668_0179895	Ga0495668_0179895_591_896	101
1982	3300046616	Ga0495668_0752842	Ga0495668_0752842_29_334	101
1983	3300046642	Ga0495634_0233781	Ga0495634_0233781_371_676	101
1984	3300046642	Ga0495634_0524292	Ga0495634_0524292_295_600	101
1985	3300046648	Ga0495611_0033426	Ga0495611_0033426_1505_1810	101
1986	3300046648	Ga0495611_0137743	Ga0495611_0137743_590_895	101
1987	3300046648	Ga0495611_0166890	Ga0495611_0166890_196_501	101
1988	3300046660	Ga0495625_0006868	Ga0495625_0006868_3475_3780	101
1989	3300046660	Ga0495625_0039878	Ga0495625_0039878_1123_1428	101
1990	3300046660	Ga0495625_0340532	Ga0495625_0340532_109_414	101
1991	3300046660	Ga0495625_0710714	Ga0495625_0710714_134_439	101
1992	3300046660	Ga0495625_0772937	Ga0495625_0772937_148_453	101
1993	3300046663	Ga0495635_0073555	Ga0495635_0073555_150_455	101
1994	3300046663	Ga0495635_0412158	Ga0495635_0412158_364_669	101
1995	3300046663	Ga0495635_0754799	Ga0495635_0754799_71_376	101
1996	3300046664	Ga0495659_0146199	Ga0495659_0146199_175_480	101
1997	3300046674	Ga0495588_0504878	Ga0495588_0504878_217_522	101
1998	3300046675	Ga0495657_0099043	Ga0495657_0099043_716_1021	101
1999	3300046679	Ga0495623_0189415	Ga0495623_0189415_627_932	101
2000	3300046681	Ga0495647_0085698	Ga0495647_0085698_758_1063	101
2001	3300046681	Ga0495647_0124789	Ga0495647_0124789_229_534	101
2002	3300046681	Ga0495647_0218435	Ga0495647_0218435_488_793	101
2003	3300046681	Ga0495647_0313460	Ga0495647_0313460_316_621	101
2004	3300046681	Ga0495647_0501229	Ga0495647_0501229_96_401	101
2005	3300046683	Ga0495658_0085813	Ga0495658_0085813_1469_1774	101
2006	3300046683	Ga0495658_0105468	Ga0495658_0105468_309_614	101
2007	3300046683	Ga0495658_0134744	Ga0495658_0134744_631_936	101
2008	3300046683	Ga0495658_0312758	Ga0495658_0312758_128_433	101
2009	3300046684	Ga0495669_0084855	Ga0495669_0084855_939_1244	101
2010	3300046684	Ga0495669_0106577	Ga0495669_0106577_676_981	101
2011	3300046689	Ga0495613_0091108	Ga0495613_0091108_1417_1722	101
2012	3300046689	Ga0495613_0647344	Ga0495613_0647344_55_360	101
2013	3300046690	Ga0495624_0466516	Ga0495624_0466516_13_318	101
2014	3300046691	Ga0495670_0361131	Ga0495670_0361131_53_358	101
2015	3300046691	Ga0495670_0483316	Ga0495670_0483316_225_530	101
2016	3300046692	Ga0495671_0186235	Ga0495671_0186235_459_764	101
2017	3300046694	Ga0495649_0000961	Ga0495649_0000961_16096_16401	101
2018	3300046694	Ga0495649_0006057	Ga0495649_0006057_5389_5694	101
2019	3300046794	Ga0495589_0004694	Ga0495589_0004694_6502_6807	101
2020	3300046794	Ga0495589_0074447	Ga0495589_0074447_1032_1337	101
2021	3300046810	Ga0495660_0151509	Ga0495660_0151509_584_889	101
2022	3300046810	Ga0495660_0403761	Ga0495660_0403761_205_510	101
2023	3300047315	Ga0495581_0291649	Ga0495581_0291649_132_437	101
2024	3300047315	Ga0495581_0754856	Ga0495581_0754856_140_445	101
2025	3300047317	Ga0495604_0658881	Ga0495604_0658881_62_367	101
2026	3300047318	Ga0495636_0078088	Ga0495636_0078088_192_497	101
2027	3300047320	Ga0495672_0429913	Ga0495672_0429913_128_433	101
2028	3300047321	Ga0495676_0010234	Ga0495676_0010234_6526_6831	101
2029	3300047321	Ga0495676_0556838	Ga0495676_0556838_369_674	101
2030	3300047322	Ga0495680_0264442	Ga0495680_0264442_460_765	101
2031	3300047322	Ga0495680_0889342	Ga0495680_0889342_153_458	101
2032	3300047323	Ga0495683_0124071	Ga0495683_0124071_220_525	101
2033	3300047443	Ga0495687_036928	Ga0495687_036928_1512_1817	101
2034	3300047445	Ga0495677_0169910	Ga0495677_0169910_254_559	101
2035	3300047446	Ga0495679_076308	Ga0495679_076308_629_934	101
2036	3300047447	Ga0495685_088317	Ga0495685_088317_536_841	101
2037	3300047447	Ga0495685_287289	Ga0495685_287289_19_324	101
2038	3300047469	Ga0495673_0135384	Ga0495673_0135384_466_771	101
2039	3300047470	Ga0495681_0173444	Ga0495681_0173444_329_634	101
2040	3300047471	Ga0495684_0188245	Ga0495684_0188245_749_1054	101
2041	3300047472	Ga0495686_0004619	Ga0495686_0004619_9958_10263	101
2042	3300047472	Ga0495686_0039632	Ga0495686_0039632_696_1001	101
2043	3300047472	Ga0495686_0066900	Ga0495686_0066900_882_1187	101
2044	3300047472	Ga0495686_0067186	Ga0495686_0067186_1231_1536	101
2045	3300047673	Ga0495593_0038039	Ga0495593_0038039_759_1064	101
2046	3300047673	Ga0495593_0172300	Ga0495593_0172300_369_674	101
2047	3300048088	Ga0495602_0185169	Ga0495602_0185169_127_432	101
2048	3300048088	Ga0495602_1038412	Ga0495602_1038412_12_317	101
2049	3300048089	Ga0495614_0095045	Ga0495614_0095045_83_388	101
2050	3300048089	Ga0495614_0502354	Ga0495614_0502354_161_466	101
2051	3300048090	Ga0495615_0017661	Ga0495615_0017661_192_497	101
2052	3300048091	Ga0495626_0074338	Ga0495626_0074338_75_380	101
2053	3300048903	Ga0496100_0252057	Ga0496100_0252057_223_528	101
2054	3300048903	Ga0496100_0333732	Ga0496100_0333732_175_480	101
2055	3300048903	Ga0496100_0472643	Ga0496100_0472643_342_647	101
2056	3300048903	Ga0496100_1276362	Ga0496100_1276362_105_410	101
2057	3300048903	Ga0496100_1364919	Ga0496100_1364919_139_444	101
2058	3300048904	Ga0496101_0463082	Ga0496101_0463082_544_849	101
2059	3300048904	Ga0496101_0633712	Ga0496101_0633712_38_343	101
2060	3300048904	Ga0496101_0977528	Ga0496101_0977528_218_523	101
2061	3300048904	Ga0496101_1190889	Ga0496101_1190889_146_451	101
2062	3300048905	Ga0496102_0060302	Ga0496102_0060302_104_409	101
2063	3300048905	Ga0496102_0351251	Ga0496102_0351251_372_677	101
2064	3300048905	Ga0496102_1304750	Ga0496102_1304750_256_561	101
2065	3300048905	Ga0496102_1385053	Ga0496102_1385053_94_399	101
2066	3300048906	Ga0496103_0130430	Ga0496103_0130430_1226_1531	101
2067	3300048906	Ga0496103_0784048	Ga0496103_0784048_95_400	101
2068	3300048907	Ga0496104_0042754	Ga0496104_0042754_2749_3054	101
2069	3300048907	Ga0496104_0104722	Ga0496104_0104722_894_1199	101
2070	3300048907	Ga0496104_0445409	Ga0496104_0445409_278_583	101
2071	3300048907	Ga0496104_0716495	Ga0496104_0716495_309_614	101
2072	3300048907	Ga0496104_0872243	Ga0496104_0872243_369_674	101
2073	3300048908	Ga0496105_0277574	Ga0496105_0277574_326_631	101
2074	3300048908	Ga0496105_0289103	Ga0496105_0289103_24_329	101
2075	3300048908	Ga0496105_0987196	Ga0496105_0987196_206_511	101
2076	3300048909	Ga0496106_0113183	Ga0496106_0113183_79_384	101
2077	3300048909	Ga0496106_0173396	Ga0496106_0173396_434_739	101
2078	3300048909	Ga0496106_0275442	Ga0496106_0275442_773_1078	101
2079	3300048909	Ga0496106_0405347	Ga0496106_0405347_418_723	101
2080	3300048909	Ga0496106_0453539	Ga0496106_0453539_41_346	101
2081	3300048909	Ga0496106_0659469	Ga0496106_0659469_198_503	101
2082	3300048909	Ga0496106_0870911	Ga0496106_0870911_222_527	101
2083	3300048910	Ga0496107_0032434	Ga0496107_0032434_154_459	101
2084	3300048910	Ga0496107_0499242	Ga0496107_0499242_344_649	101
2085	3300048911	Ga0496108_0005999	Ga0496108_0005999_7798_8103	101
2086	3300048911	Ga0496108_0009350	Ga0496108_0009350_6841_7146	101
2087	3300048911	Ga0496108_0042133	Ga0496108_0042133_190_495	101
2088	3300048911	Ga0496108_0089279	Ga0496108_0089279_1488_1793	101
2089	3300048911	Ga0496108_0097580	Ga0496108_0097580_684_989	101
2090	3300048911	Ga0496108_0132496	Ga0496108_0132496_583_888	101
2091	3300048911	Ga0496108_0681315	Ga0496108_0681315_74_379	101
2092	3300048911	Ga0496108_1363297	Ga0496108_1363297_104_409	101
2093	3300048912	Ga0496109_0084426	Ga0496109_0084426_1562_1867	101
2094	3300048912	Ga0496109_0188205	Ga0496109_0188205_160_465	101
2095	3300048912	Ga0496109_0220464	Ga0496109_0220464_1241_1546	101
2096	3300048912	Ga0496109_0259357	Ga0496109_0259357_332_637	101
2097	3300048912	Ga0496109_0267867	Ga0496109_0267867_345_650	101
2098	3300048912	Ga0496109_0442069	Ga0496109_0442069_555_860	101
2099	3300048912	Ga0496109_0461604	Ga0496109_0461604_312_617	101
2100	3300048912	Ga0496109_1285147	Ga0496109_1285147_307_612	101
2101	3300048912	Ga0496109_1471351	Ga0496109_1471351_52_357	101
2102	3300048913	Ga0496110_0367167	Ga0496110_0367167_445_750	101
2103	3300048913	Ga0496110_0585154	Ga0496110_0585154_310_615	101
2104	3300048913	Ga0496110_0672888	Ga0496110_0672888_127_432	101
2105	3300048913	Ga0496110_1212241	Ga0496110_1212241_136_441	101
2106	3300048913	Ga0496110_1829231	Ga0496110_1829231_112_417	101
2107	3300048914	Ga0496111_0402807	Ga0496111_0402807_344_649	101
2108	3300048914	Ga0496111_0611350	Ga0496111_0611350_451_756	101
2109	3300048915	Ga0496112_0018422	Ga0496112_0018422_3326_3631	101
2110	3300048915	Ga0496112_0462843	Ga0496112_0462843_626_931	101
2111	3300048915	Ga0496112_0475015	Ga0496112_0475015_375_680	101
2112	3300048916	Ga0496113_0089439	Ga0496113_0089439_717_1022	101
2113	3300048916	Ga0496113_0211725	Ga0496113_0211725_486_791	101
2114	3300048916	Ga0496113_0215057	Ga0496113_0215057_602_907	101
2115	3300048916	Ga0496113_0310758	Ga0496113_0310758_853_1158	101
2116	3300048916	Ga0496113_0520577	Ga0496113_0520577_553_858	101
2117	3300048916	Ga0496113_1530567	Ga0496113_1530567_79_384	101
2118	3300048917	Ga0496114_0010053	Ga0496114_0010053_3507_3812	101
2119	3300048917	Ga0496114_0198844	Ga0496114_0198844_820_1125	101
2120	3300048917	Ga0496114_0360775	Ga0496114_0360775_405_710	101
2121	3300048917	Ga0496114_0414600	Ga0496114_0414600_525_830	101
2122	3300048917	Ga0496114_0929831	Ga0496114_0929831_109_414	101
2123	3300048918	Ga0496115_0030230	Ga0496115_0030230_3223_3528	101
2124	3300048918	Ga0496115_1370005	Ga0496115_1370005_205_510	101
2125	3300048920	Ga0496117_0269106	Ga0496117_0269106_371_676	101
2126	3300048924	Ga0496121_0042385	Ga0496121_0042385_1012_1317	101
2127	3300048925	Ga0496122_0439798	Ga0496122_0439798_241_546	101
2128	3300048927	Ga0496124_0001830	Ga0496124_0001830_21601_21906	101
2129	3300048927	Ga0496124_0030272	Ga0496124_0030272_1937_2242	101
2130	3300048927	Ga0496124_0506789	Ga0496124_0506789_274_579	101
2131	3300048928	Ga0496125_0013937	Ga0496125_0013937_1677_1982	101
2132	3300048928	Ga0496125_0090638	Ga0496125_0090638_1879_2184	101
2133	3300048928	Ga0496125_0413814	Ga0496125_0413814_386_691	101
2134	3300048928	Ga0496125_0579762	Ga0496125_0579762_34_339	101
2135	3300048929	Ga0496126_0684633	Ga0496126_0684633_14_319	101
2136	3300049127	Ga0501306_000061	Ga0501306_000061_2018_2323	101
2137	3300049127	Ga0501306_001000	Ga0501306_001000_1663_1968	101
2138	3300049127	Ga0501306_001910	Ga0501306_001910_1099_1404	101
2139	3300049127	Ga0501306_002632	Ga0501306_002632_902_1207	101
2140	3300049127	Ga0501306_004240	Ga0501306_004240_1263_1568	101
2141	3300049127	Ga0501306_008288	Ga0501306_008288_617_922	101
2142	3300049127	Ga0501306_010649	Ga0501306_010649_763_1068	101
2143	3300049127	Ga0501306_021776	Ga0501306_021776_508_813	101
2144	3300049127	Ga0501306_034908	Ga0501306_034908_390_695	101
2145	3300049127	Ga0501306_090060	Ga0501306_090060_101_406	101
2146	3300049128	Ga0501308_000386	Ga0501308_000386_1367_1672	101
2147	3300049128	Ga0501308_001895	Ga0501308_001895_590_895	101
2148	3300049128	Ga0501308_004481	Ga0501308_004481_409_714	101
2149	3300049128	Ga0501308_004862	Ga0501308_004862_73_378	101
2150	3300049128	Ga0501308_005770	Ga0501308_005770_83_388	101
2151	3300049128	Ga0501308_008299	Ga0501308_008299_792_1097	101
2152	3300049128	Ga0501308_061660	Ga0501308_061660_83_388	101
2153	3300049128	Ga0501308_071466	Ga0501308_071466_175_480	101
2154	3300049128	Ga0501308_079555	Ga0501308_079555_149_454	101
2155	3300049129	Ga0501309_000014	Ga0501309_000014_6164_6469	101
2156	3300049129	Ga0501309_001211	Ga0501309_001211_604_909	101
2157	3300049129	Ga0501309_018080	Ga0501309_018080_600_905	101
2158	3300049129	Ga0501309_027708	Ga0501309_027708_97_402	101
2159	3300049129	Ga0501309_031747	Ga0501309_031747_178_483	101
2160	3300049130	Ga0501310_000059	Ga0501310_000059_7146_7451	101
2161	3300049130	Ga0501310_002023	Ga0501310_002023_1528_1833	101
2162	3300049130	Ga0501310_004096	Ga0501310_004096_90_395	101
2163	3300049130	Ga0501310_005085	Ga0501310_005085_674_979	101
2164	3300049130	Ga0501310_006346	Ga0501310_006346_311_616	101
2165	3300049130	Ga0501310_009745	Ga0501310_009745_407_712	101
2166	3300049130	Ga0501310_010559	Ga0501310_010559_709_1014	101
2167	3300049130	Ga0501310_011089	Ga0501310_011089_26_331	101
2168	3300049130	Ga0501310_011540	Ga0501310_011540_95_400	101
2169	3300049131	Ga0501341_08841	Ga0501341_08841_273_578	101
2170	3300049160	Ga0501304_000014	Ga0501304_000014_1567_1872	101
2171	3300049160	Ga0501304_000512	Ga0501304_000512_1577_1882	101
2172	3300049160	Ga0501304_001736	Ga0501304_001736_449_754	101
2173	3300049160	Ga0501304_008754	Ga0501304_008754_83_388	101
2174	3300049160	Ga0501304_009642	Ga0501304_009642_448_753	101
2175	3300049160	Ga0501304_020524	Ga0501304_020524_309_614	101
2176	3300049160	Ga0501304_023767	Ga0501304_023767_291_596	101
2177	3300049161	Ga0501305_000004	Ga0501305_000004_5263_5568	101
2178	3300049161	Ga0501305_000819	Ga0501305_000819_464_769	101
2179	3300049161	Ga0501305_002640	Ga0501305_002640_550_855	101
2180	3300049161	Ga0501305_012826	Ga0501305_012826_555_860	101
2181	3300049161	Ga0501305_017017	Ga0501305_017017_132_437	101
2182	3300049161	Ga0501305_050112	Ga0501305_050112_331_636	101
2183	3300049161	Ga0501305_067210	Ga0501305_067210_227_532	101
2184	3300049161	Ga0501305_067211	Ga0501305_067211_227_532	101
2185	3300049161	Ga0501305_113880	Ga0501305_113880_145_450	101
2186	3300049162	Ga0501307_000029	Ga0501307_000029_1525_1830	101
2187	3300049162	Ga0501307_000963	Ga0501307_000963_602_907	101
2188	3300049162	Ga0501307_001704	Ga0501307_001704_514_819	101
2189	3300049162	Ga0501307_003905	Ga0501307_003905_728_1033	101
2190	3300049162	Ga0501307_004808	Ga0501307_004808_669_974	101
2191	3300049162	Ga0501307_015778	Ga0501307_015778_459_764	101
2192	3300049162	Ga0501307_044648	Ga0501307_044648_22_327	101
2193	3300049459	Ga0495678_114127	Ga0495678_114127_220_525	101
2194	3300049460	Ga0495682_0058348	Ga0495682_0058348_486_791	101
2195	3300049460	Ga0495682_0222752	Ga0495682_0222752_22_327	101
2196	3300049513	Ga0501290_008662	Ga0501290_008662_799_1104	101
2197	3300049513	Ga0501290_024194	Ga0501290_024194_72_377	101
2198	3300049514	Ga0501291_001472	Ga0501291_001472_1662_1967	101
2199	3300049514	Ga0501291_116080	Ga0501291_116080_70_375	101
2200	3300049515	Ga0501292_005043	Ga0501292_005043_903_1208	101
2201	3300049515	Ga0501292_061064	Ga0501292_061064_303_608	101
2202	3300049516	Ga0501293_004264	Ga0501293_004264_114_419	101
2203	3300049517	Ga0501294_003852	Ga0501294_003852_474_779	101
2204	3300049517	Ga0501294_020684	Ga0501294_020684_41_346	101
2205	3300049518	Ga0501295_181222	Ga0501295_181222_38_343	101
2206	3300049521	Ga0501298_091097	Ga0501298_091097_255_560	101
2207	3300049522	Ga0501299_065889	Ga0501299_065889_179_484	101
2208	3300049523	Ga0501300_000354	Ga0501300_000354_204_509	101
2209	3300049523	Ga0501300_037689	Ga0501300_037689_56_361	101
2210	3300049526	Ga0501303_012181	Ga0501303_012181_396_701	101
2211	3300049527	Ga0501311_000038	Ga0501311_000038_3305_3610	101
2212	3300049527	Ga0501311_004807	Ga0501311_004807_504_809	101
2213	3300049527	Ga0501311_020049	Ga0501311_020049_207_512	101
2214	3300049527	Ga0501311_030615	Ga0501311_030615_56_361	101
2215	3300049527	Ga0501311_038497	Ga0501311_038497_357_662	101
2216	3300049527	Ga0501311_079369	Ga0501311_079369_23_328	101
2217	3300049528	Ga0501312_000016	Ga0501312_000016_7860_8165	101
2218	3300049528	Ga0501312_002743	Ga0501312_002743_95_400	101
2219	3300049528	Ga0501312_003126	Ga0501312_003126_446_751	101
2220	3300049528	Ga0501312_023589	Ga0501312_023589_189_494	101
2221	3300049528	Ga0501312_025631	Ga0501312_025631_95_400	101
2222	3300049528	Ga0501312_030444	Ga0501312_030444_418_723	101
2223	3300049528	Ga0501312_034796	Ga0501312_034796_410_715	101
2224	3300049528	Ga0501312_037564	Ga0501312_037564_429_734	101
2225	3300049528	Ga0501312_039210	Ga0501312_039210_290_595	101
2226	3300049528	Ga0501312_098174	Ga0501312_098174_177_482	101
2227	3300049529	Ga0501313_002333	Ga0501313_002333_982_1287	101
2228	3300049529	Ga0501313_003194	Ga0501313_003194_651_956	101
2229	3300049529	Ga0501313_004401	Ga0501313_004401_803_1108	101
2230	3300049529	Ga0501313_012245	Ga0501313_012245_514_819	101
2231	3300049529	Ga0501313_012722	Ga0501313_012722_36_341	101
2232	3300049529	Ga0501313_016733	Ga0501313_016733_60_365	101
2233	3300049530	Ga0501314_000017	Ga0501314_000017_6994_7299	101
2234	3300049530	Ga0501314_000291	Ga0501314_000291_635_940	101
2235	3300049530	Ga0501314_002757	Ga0501314_002757_1041_1346	101
2236	3300049530	Ga0501314_003125	Ga0501314_003125_72_377	101
2237	3300049530	Ga0501314_012188	Ga0501314_012188_484_789	101
2238	3300049530	Ga0501314_045989	Ga0501314_045989_88_393	101
2239	3300049530	Ga0501314_047758	Ga0501314_047758_82_387	101
2240	3300049531	Ga0501315_000346	Ga0501315_000346_2154_2459	101
2241	3300049531	Ga0501315_003778	Ga0501315_003778_132_437	101
2242	3300049531	Ga0501315_004450	Ga0501315_004450_670_975	101
2243	3300049531	Ga0501315_011517	Ga0501315_011517_347_652	101
2244	3300049531	Ga0501315_019718	Ga0501315_019718_204_509	101
2245	3300049531	Ga0501315_020831	Ga0501315_020831_132_437	101
2246	3300049531	Ga0501315_021446	Ga0501315_021446_55_360	101
2247	3300049531	Ga0501315_029896	Ga0501315_029896_103_408	101
2248	3300049532	Ga0501316_000872	Ga0501316_000872_873_1178	101
2249	3300049532	Ga0501316_001021	Ga0501316_001021_1537_1842	101
2250	3300049532	Ga0501316_027141	Ga0501316_027141_310_615	101
2251	3300049532	Ga0501316_074638	Ga0501316_074638_150_455	101
2252	3300049533	Ga0501317_000290	Ga0501317_000290_2562_2867	101
2253	3300049533	Ga0501317_004064	Ga0501317_004064_352_657	101
2254	3300049533	Ga0501317_005768	Ga0501317_005768_608_913	101
2255	3300049533	Ga0501317_008980	Ga0501317_008980_274_579	101
2256	3300049533	Ga0501317_026465	Ga0501317_026465_233_538	101
2257	3300049533	Ga0501317_035748	Ga0501317_035748_420_725	101
2258	3300049533	Ga0501317_064768	Ga0501317_064768_43_348	101
2259	3300049534	Ga0501318_000131	Ga0501318_000131_1295_1600	101
2260	3300049534	Ga0501318_000548	Ga0501318_000548_745_1050	101
2261	3300049534	Ga0501318_000712	Ga0501318_000712_881_1186	101
2262	3300049534	Ga0501318_000842	Ga0501318_000842_1741_2046	101
2263	3300049534	Ga0501318_008820	Ga0501318_008820_423_728	101
2264	3300049534	Ga0501318_024472	Ga0501318_024472_389_694	101
2265	3300049534	Ga0501318_076796	Ga0501318_076796_36_341	101
2266	3300049535	Ga0501319_001099	Ga0501319_001099_31_336	101
2267	3300049535	Ga0501319_006366	Ga0501319_006366_252_557	101
2268	3300049535	Ga0501319_015690	Ga0501319_015690_31_336	101
2269	3300049535	Ga0501319_020124	Ga0501319_020124_29_334	101
2270	3300049536	Ga0501320_000131	Ga0501320_000131_1578_1883	101
2271	3300049536	Ga0501320_000368	Ga0501320_000368_123_428	101
2272	3300049536	Ga0501320_001178	Ga0501320_001178_66_371	101
2273	3300049536	Ga0501320_002176	Ga0501320_002176_504_809	101
2274	3300049536	Ga0501320_007324	Ga0501320_007324_77_382	101
2275	3300049536	Ga0501320_011109	Ga0501320_011109_253_558	101
2276	3300049536	Ga0501320_012754	Ga0501320_012754_461_766	101
2277	3300049536	Ga0501320_047658	Ga0501320_047658_230_535	101
2278	3300049537	Ga0501321_000120	Ga0501321_000120_2503_2808	101
2279	3300049537	Ga0501321_001939	Ga0501321_001939_718_1023	101
2280	3300049537	Ga0501321_003376	Ga0501321_003376_577_882	101
2281	3300049537	Ga0501321_015469	Ga0501321_015469_140_445	101
2282	3300049538	Ga0501322_000402	Ga0501322_000402_590_895	101
2283	3300049538	Ga0501322_001921	Ga0501322_001921_454_759	101
2284	3300049538	Ga0501322_003039	Ga0501322_003039_615_920	101
2285	3300049538	Ga0501322_004500	Ga0501322_004500_267_572	101
2286	3300049538	Ga0501322_009218	Ga0501322_009218_90_395	101
2287	3300049538	Ga0501322_011890	Ga0501322_011890_312_617	101
2288	3300049539	Ga0501323_000187	Ga0501323_000187_396_701	101
2289	3300049539	Ga0501323_000789	Ga0501323_000789_92_397	101
2290	3300049539	Ga0501323_006346	Ga0501323_006346_86_391	101
2291	3300049539	Ga0501323_008999	Ga0501323_008999_418_723	101
2292	3300049539	Ga0501323_024201	Ga0501323_024201_77_382	101
2293	3300049539	Ga0501323_068888	Ga0501323_068888_29_334	101
2294	3300049539	Ga0501323_072213	Ga0501323_072213_128_433	101
2295	3300049540	Ga0501324_000221	Ga0501324_000221_305_610	101
2296	3300049541	Ga0501325_000034	Ga0501325_000034_1429_1734	101
2297	3300049541	Ga0501325_005902	Ga0501325_005902_412_717	101
2298	3300049541	Ga0501325_021461	Ga0501325_021461_99_404	101
2299	3300049541	Ga0501325_043809	Ga0501325_043809_220_525	101
2300	3300049543	Ga0501327_05188	Ga0501327_05188_128_433	101
2301	3300049545	Ga0501329_01093	Ga0501329_01093_228_533	101
2302	3300049547	Ga0501331_04395	Ga0501331_04395_369_674	101
2303	3300049547	Ga0501331_05271	Ga0501331_05271_190_495	101
2304	3300049549	Ga0501333_004818	Ga0501333_004818_447_752	101
2305	3300049551	Ga0501335_001771	Ga0501335_001771_575_880	101
2306	3300049552	Ga0501336_003790	Ga0501336_003790_428_733	101
2307	3300049552	Ga0501336_027491	Ga0501336_027491_29_334	101
2308	3300049554	Ga0501338_08820	Ga0501338_08820_254_559	101
2309	3300049556	Ga0501340_001368	Ga0501340_001368_575_880	101
2310	3300049556	Ga0501340_005147	Ga0501340_005147_403_708	101
2311	3300049556	Ga0501340_024199	Ga0501340_024199_172_477	101
2312	3300049569	Ga0501032_0396197	Ga0501032_0396197_516_821	101
2313	3300049578	Ga0501042_0241064	Ga0501042_0241064_747_1052	101
2314	3300049579	Ga0501043_0000090	Ga0501043_0000090_73308_73613	101
2315	3300049580	Ga0501046_0000126	Ga0501046_0000126_73306_73611	101
2316	3300049581	Ga0501047_0000160	Ga0501047_0000160_7724_8029	101
2317	3300049582	Ga0501048_0003429	Ga0501048_0003429_10281_10586	101
2318	3300049582	Ga0501048_1393230	Ga0501048_1393230_37_342	101
2319	3300049583	Ga0501067_0101508	Ga0501067_0101508_75_380	101
2320	3300049589	Ga0501073_0691400	Ga0501073_0691400_68_373	101
2321	3300049592	Ga0501076_1311449	Ga0501076_1311449_31_336	101
2322	3300049649	Ga0501198_000043	Ga0501198_000043_36627_36932	101
2323	3300049650	Ga0501199_015399	Ga0501199_015399_103_408	101
2324	3300049651	Ga0501201_004715	Ga0501201_004715_909_1214	101
2325	3300049652	Ga0501202_000808	Ga0501202_000808_3138_3443	101
2326	3300049652	Ga0501202_068297	Ga0501202_068297_157_462	101
2327	3300049653	Ga0501206_009648	Ga0501206_009648_126_431	101
2328	3300049653	Ga0501206_011506	Ga0501206_011506_100_405	101
2329	3300049653	Ga0501206_056624	Ga0501206_056624_180_485	101
2330	3300049654	Ga0501207_026079	Ga0501207_026079_568_873	101
2331	3300049654	Ga0501207_059914	Ga0501207_059914_98_403	101
2332	3300049655	Ga0501208_025836	Ga0501208_025836_133_438	101
2333	3300049657	Ga0501210_008848	Ga0501210_008848_119_424	101
2334	3300049658	Ga0501211_000022	Ga0501211_000022_4315_4620	101
2335	3300049660	Ga0501216_119832	Ga0501216_119832_21_326	101
2336	3300049661	Ga0501217_050216	Ga0501217_050216_169_474	101
2337	3300049662	Ga0501222_000051	Ga0501222_000051_7239_7544	101
2338	3300049662	Ga0501222_002187	Ga0501222_002187_2140_2445	101
2339	3300049662	Ga0501222_012076	Ga0501222_012076_666_971	101
2340	3300049663	Ga0501223_007701	Ga0501223_007701_260_565	101
2341	3300049665	Ga0501227_003969	Ga0501227_003969_267_572	101
2342	3300049669	Ga0501235_001228	Ga0501235_001228_1502_1807	101
2343	3300049669	Ga0501235_018958	Ga0501235_018958_98_403	101
2344	3300049670	Ga0501236_044001	Ga0501236_044001_188_493	101
2345	3300049670	Ga0501236_045218	Ga0501236_045218_40_345	101
2346	3300049677	Ga0501247_056126	Ga0501247_056126_147_452	101
2347	3300049679	Ga0501249_003813	Ga0501249_003813_1344_1649	101
2348	3300049681	Ga0501251_026457	Ga0501251_026457_255_560	101
2349	3300049682	Ga0501252_007150	Ga0501252_007150_773_1078	101
2350	3300049683	Ga0501253_000109	Ga0501253_000109_5574_5879	101
2351	3300049686	Ga0501257_072238	Ga0501257_072238_397_702	101
2352	3300049686	Ga0501257_146633	Ga0501257_146633_179_484	101
2353	3300049687	Ga0501258_000137	Ga0501258_000137_2693_2998	101
2354	3300049690	Ga0501261_094887	Ga0501261_094887_215_520	101
2355	3300049704	Ga0501221_001094	Ga0501221_001094_1634_1939	101
2356	3300049705	Ga0501225_0006245	Ga0501225_0006245_203_508	101
2357	3300049705	Ga0501225_0268577	Ga0501225_0268577_162_467	101
2358	3300049706	Ga0501229_001006	Ga0501229_001006_1254_1559	101
2359	3300049706	Ga0501229_046104	Ga0501229_046104_307_612	101
2360	3300049708	Ga0501245_081691	Ga0501245_081691_269_574	101
2361	3300049758	Ga0501241_041689	Ga0501241_041689_85_390	101
2362	3300049759	Ga0501262_000590	Ga0501262_000590_1061_1366	101
2363	3300049759	Ga0501262_012757	Ga0501262_012757_164_469	101
2364	3300049761	Ga0501264_023177	Ga0501264_023177_119_424	101
2365	3300049761	Ga0501264_038383	Ga0501264_038383_190_495	101
2366	3300049763	Ga0501266_028852	Ga0501266_028852_169_474	101
2367	3300049764	Ga0501267_000666	Ga0501267_000666_1903_2208	101
2368	3300049765	Ga0501268_001964	Ga0501268_001964_706_1011	101
2369	3300049766	Ga0501269_001030	Ga0501269_001030_866_1171	101
2370	3300049769	Ga0501272_000140	Ga0501272_000140_673_978	101
2371	3300049771	Ga0501274_054769	Ga0501274_054769_34_339	101
2372	3300049775	Ga0501279_052894	Ga0501279_052894_143_448	101
2373	3300049776	Ga0501280_039085	Ga0501280_039085_298_603	101
2374	3300049776	Ga0501280_054761	Ga0501280_054761_218_523	101
2375	3300049777	Ga0501281_09341	Ga0501281_09341_325_630	101
2376	3300049778	Ga0501282_013783	Ga0501282_013783_240_545	101
2377	3300049823	Ga0501044_0057237	Ga0501044_0057237_2614_2919	101
2378	3300049824	Ga0501045_0000882	Ga0501045_0000882_2205_2510	101
2379	3300049853	Ga0501226_002381	Ga0501226_002381_1236_1541	101
2380	3300050489	nmdc:mga03683_107312_c1	nmdc:mga03683_107312_c1_411_716	101
2381	3300050489	nmdc:mga03683_113966_c1	nmdc:mga03683_113966_c1_486_791	101
2382	3300050489	nmdc:mga03683_130671_c1	nmdc:mga03683_130671_c1_623_928	101
2383	3300050489	nmdc:mga03683_13626_c1	nmdc:mga03683_13626_c1_1408_1713	101
2384	3300050489	nmdc:mga03683_137878_c1	nmdc:mga03683_137878_c1_663_968	101
2385	3300050489	nmdc:mga03683_18745_c1	nmdc:mga03683_18745_c1_1848_2153	101
2386	3300050489	nmdc:mga03683_305393_c1	nmdc:mga03683_305393_c1_336_641	101
2387	3300050489	nmdc:mga03683_340428_c1	nmdc:mga03683_340428_c1_300_605	101
2388	3300050489	nmdc:mga03683_38113_c1	nmdc:mga03683_38113_c1_147_452	101
2389	3300050489	nmdc:mga03683_40005_c1	nmdc:mga03683_40005_c1_1537_1842	101
2390	3300050489	nmdc:mga03683_408709_c1	nmdc:mga03683_408709_c1_35_340	101
2391	3300050489	nmdc:mga03683_60917_c2	nmdc:mga03683_60917_c2_289_594	101
2392	3300050489	nmdc:mga03683_65613_c1	nmdc:mga03683_65613_c1_1144_1449	101
2393	3300050489	nmdc:mga03683_703292_c1	nmdc:mga03683_703292_c1_126_431	101
2394	3300050490	nmdc:mga03n38_134111_c1	nmdc:mga03n38_134111_c1_633_938	101
2395	3300050490	nmdc:mga03n38_141615_c1	nmdc:mga03n38_141615_c1_644_949	101
2396	3300050490	nmdc:mga03n38_264042_c1	nmdc:mga03n38_264042_c1_249_554	101
2397	3300050490	nmdc:mga03n38_282162_c1	nmdc:mga03n38_282162_c1_290_595	101
2398	3300050490	nmdc:mga03n38_374893_c1	nmdc:mga03n38_374893_c1_284_589	101
2399	3300050490	nmdc:mga03n38_4317_c1	nmdc:mga03n38_4317_c1_1438_1743	101
2400	3300050490	nmdc:mga03n38_4851_c1	nmdc:mga03n38_4851_c1_2010_2315	101
2401	3300050490	nmdc:mga03n38_581661_c1	nmdc:mga03n38_581661_c1_16_321	101
2402	3300050490	nmdc:mga03n38_96135_c1	nmdc:mga03n38_96135_c1_964_1269	101
2403	3300050491	nmdc:mga00v17_113515_c1	nmdc:mga00v17_113515_c1_1261_1566	101
2404	3300050491	nmdc:mga00v17_13392_c1	nmdc:mga00v17_13392_c1_2305_2610	101
2405	3300050491	nmdc:mga00v17_17620_c1	nmdc:mga00v17_17620_c1_3133_3438	101
2406	3300050491	nmdc:mga00v17_198473_c1	nmdc:mga00v17_198473_c1_873_1178	101
2407	3300050491	nmdc:mga00v17_533261_c1	nmdc:mga00v17_533261_c1_218_523	101
2408	3300050491	nmdc:mga00v17_839825_c1	nmdc:mga00v17_839825_c1_85_390	101
2409	3300050492	nmdc:mga0yw44_22084_c1	nmdc:mga0yw44_22084_c1_1314_1619	101
2410	3300050492	nmdc:mga0yw44_283449_c1	nmdc:mga0yw44_283449_c1_776_1081	101
2411	3300050492	nmdc:mga0yw44_486323_c1	nmdc:mga0yw44_486323_c1_255_560	101
2412	3300050493	nmdc:mga0k408_1021_c1	nmdc:mga0k408_1021_c1_8818_9123	101
2413	3300050493	nmdc:mga0k408_12806_c1	nmdc:mga0k408_12806_c1_2055_2360	101
2414	3300050493	nmdc:mga0k408_13979_c1	nmdc:mga0k408_13979_c1_2088_2393	101
2415	3300050493	nmdc:mga0k408_144341_c1	nmdc:mga0k408_144341_c1_357_662	101
2416	3300050493	nmdc:mga0k408_145503_c1	nmdc:mga0k408_145503_c1_535_840	101
2417	3300050493	nmdc:mga0k408_149455_c1	nmdc:mga0k408_149455_c1_150_455	101
2418	3300050493	nmdc:mga0k408_153520_c1	nmdc:mga0k408_153520_c1_129_434	101
2419	3300050493	nmdc:mga0k408_17134_c1	nmdc:mga0k408_17134_c1_1617_1922	101
2420	3300050493	nmdc:mga0k408_219_c1	nmdc:mga0k408_219_c1_7822_8127	101
2421	3300050493	nmdc:mga0k408_22144_c1	nmdc:mga0k408_22144_c1_996_1301	101
2422	3300050493	nmdc:mga0k408_23422_c1	nmdc:mga0k408_23422_c1_2538_2843	101
2423	3300050493	nmdc:mga0k408_23786_c1	nmdc:mga0k408_23786_c1_811_1116	101
2424	3300050493	nmdc:mga0k408_255163_c1	nmdc:mga0k408_255163_c1_157_462	101
2425	3300050493	nmdc:mga0k408_28249_c1	nmdc:mga0k408_28249_c1_228_533	101
2426	3300050493	nmdc:mga0k408_283141_c1	nmdc:mga0k408_283141_c1_42_347	101
2427	3300050493	nmdc:mga0k408_318491_c1	nmdc:mga0k408_318491_c1_130_435	101
2428	3300050493	nmdc:mga0k408_325174_c1	nmdc:mga0k408_325174_c1_23_328	101
2429	3300050493	nmdc:mga0k408_34347_c1	nmdc:mga0k408_34347_c1_1390_1695	101
2430	3300050493	nmdc:mga0k408_389586_c1	nmdc:mga0k408_389586_c1_55_360	101
2431	3300050493	nmdc:mga0k408_407607_c1	nmdc:mga0k408_407607_c1_219_524	101
2432	3300050493	nmdc:mga0k408_46982_c1	nmdc:mga0k408_46982_c1_1319_1624	101
2433	3300050493	nmdc:mga0k408_485423_c1	nmdc:mga0k408_485423_c1_151_456	101
2434	3300050493	nmdc:mga0k408_49108_c1	nmdc:mga0k408_49108_c1_1130_1435	101
2435	3300050493	nmdc:mga0k408_52239_c1	nmdc:mga0k408_52239_c1_55_360	101
2436	3300050493	nmdc:mga0k408_576153_c1	nmdc:mga0k408_576153_c1_175_480	101
2437	3300050493	nmdc:mga0k408_59597_c1	nmdc:mga0k408_59597_c1_1075_1380	101
2438	3300050493	nmdc:mga0k408_6946_c1	nmdc:mga0k408_6946_c1_4557_4862	101
2439	3300050493	nmdc:mga0k408_715878_c1	nmdc:mga0k408_715878_c1_209_514	101
2440	3300050493	nmdc:mga0k408_7194_c1	nmdc:mga0k408_7194_c1_3147_3452	101
2441	3300050493	nmdc:mga0k408_887151_c1	nmdc:mga0k408_887151_c1_51_356	101
2442	3300050494	nmdc:mga06z11_11386_c1	nmdc:mga06z11_11386_c1_3325_3630	101
2443	3300050494	nmdc:mga06z11_1936_c1	nmdc:mga06z11_1936_c1_3540_3845	101
2444	3300050494	nmdc:mga06z11_267106_c1	nmdc:mga06z11_267106_c1_266_571	101
2445	3300050494	nmdc:mga06z11_3023_c1	nmdc:mga06z11_3023_c1_2554_2859	101
2446	3300050494	nmdc:mga06z11_31530_c1	nmdc:mga06z11_31530_c1_903_1208	101
2447	3300050494	nmdc:mga06z11_49595_c1	nmdc:mga06z11_49595_c1_338_643	101
2448	3300050494	nmdc:mga06z11_766715_c1	nmdc:mga06z11_766715_c1_268_573	101
2449	3300050494	nmdc:mga06z11_888211_c1	nmdc:mga06z11_888211_c1_136_441	101
2450	3300050495	nmdc:mga04h51_124738_c1	nmdc:mga04h51_124738_c1_316_621	101
2451	3300050495	nmdc:mga04h51_127546_c1	nmdc:mga04h51_127546_c1_230_535	101
2452	3300050495	nmdc:mga04h51_174528_c1	nmdc:mga04h51_174528_c1_251_556	101
2453	3300050495	nmdc:mga04h51_278768_c1	nmdc:mga04h51_278768_c1_345_650	101
2454	3300050496	nmdc:mga07m45_13904_c1	nmdc:mga07m45_13904_c1_3925_4230	101
2455	3300050496	nmdc:mga07m45_15127_c1	nmdc:mga07m45_15127_c1_3205_3510	101
2456	3300050496	nmdc:mga07m45_173746_c1	nmdc:mga07m45_173746_c1_787_1092	101
2457	3300050496	nmdc:mga07m45_248853_c1	nmdc:mga07m45_248853_c1_406_711	101
2458	3300050496	nmdc:mga07m45_2931_c1	nmdc:mga07m45_2931_c1_1555_1860	101
2459	3300050496	nmdc:mga07m45_333439_c1	nmdc:mga07m45_333439_c1_446_751	101
2460	3300050496	nmdc:mga07m45_380028_c1	nmdc:mga07m45_380028_c1_305_610	101
2461	3300050496	nmdc:mga07m45_386083_c1	nmdc:mga07m45_386083_c1_289_594	101
2462	3300050496	nmdc:mga07m45_398_c1	nmdc:mga07m45_398_c1_3751_4056	101
2463	3300050496	nmdc:mga07m45_401346_c1	nmdc:mga07m45_401346_c1_61_366	101
2464	3300050496	nmdc:mga07m45_535287_c1	nmdc:mga07m45_535287_c1_94_399	101
2465	3300050496	nmdc:mga07m45_670_c1	nmdc:mga07m45_670_c1_5848_6153	101
2466	3300050496	nmdc:mga07m45_6867_c1	nmdc:mga07m45_6867_c1_1375_1680	101
2467	3300050496	nmdc:mga07m45_69529_c1	nmdc:mga07m45_69529_c1_54_359	101
2468	3300050496	nmdc:mga07m45_71727_c1	nmdc:mga07m45_71727_c1_1426_1731	101
2469	3300050496	nmdc:mga07m45_74068_c1	nmdc:mga07m45_74068_c1_1465_1770	101
2470	3300050496	nmdc:mga07m45_74708_c1	nmdc:mga07m45_74708_c1_169_474	101
2471	3300050507	nmdc:mga05p37_217522_c1	nmdc:mga05p37_217522_c1_1546_1851	101
2472	3300050508	nmdc:mga09592_38477_c1	nmdc:mga09592_38477_c1_720_1025	101
2473	3300050509	nmdc:mga0qj67_972254_c1	nmdc:mga0qj67_972254_c1_179_484	101
2474	3300050512	nmdc:mga0n895_412583_c1	nmdc:mga0n895_412583_c1_486_791	101
2475	3300050513	nmdc:mga0rr50_369987_c1	nmdc:mga0rr50_369987_c1_628_933	101
2476	3300050513	nmdc:mga0rr50_423398_c1	nmdc:mga0rr50_423398_c1_38_343	101
2477	3300050516	nmdc:mga0sz30_159984_c1	nmdc:mga0sz30_159984_c1_457_762	101
2478	3300050516	nmdc:mga0sz30_172155_c1	nmdc:mga0sz30_172155_c1_138_443	101
2479	3300050516	nmdc:mga0sz30_396728_c1	nmdc:mga0sz30_396728_c1_255_560	101
2480	3300050516	nmdc:mga0sz30_3989_c1	nmdc:mga0sz30_3989_c1_2543_2848	101
2481	3300050516	nmdc:mga0sz30_7140_c1	nmdc:mga0sz30_7140_c1_2210_2515	101
2482	3300053078	Ga0495612_0100041	Ga0495612_0100041_810_1115	101
2483	3300053078	Ga0495612_0132131	Ga0495612_0132131_702_1007	101
2484	3300053080	Ga0500635_0000036	Ga0500635_0000036_55790_56095	101
2485	3300053080	Ga0500635_0116347	Ga0500635_0116347_99_404	101
2486	3300053084	Ga0495595_0288249	Ga0495595_0288249_68_373	101
2487	3300053084	Ga0495595_0329422	Ga0495595_0329422_424_729	101
2488	3300053085	Ga0495619_0076699	Ga0495619_0076699_1164_1469	101
2489	3300053085	Ga0495619_0264261	Ga0495619_0264261_137_442	101
2490	3300053085	Ga0495619_0598312	Ga0495619_0598312_147_452	101
2491	3300053086	Ga0500578_0000292	Ga0500578_0000292_61524_61829	101
2492	3300053086	Ga0500578_0079895	Ga0500578_0079895_1629_1934	101
2493	3300053086	Ga0500578_0234096	Ga0500578_0234096_379_684	101
2494	3300053087	Ga0500643_048658	Ga0500643_048658_82_387	101
2495	3300053088	Ga0500644_0003475	Ga0500644_0003475_1995_2300	101
2496	3300053090	Ga0500646_0014216	Ga0500646_0014216_568_873	101
2497	3300053090	Ga0500646_0053402	Ga0500646_0053402_116_454	101
2498	3300053090	Ga0500646_0123475	Ga0500646_0123475_424_729	101
2499	3300053090	Ga0500646_0192798	Ga0500646_0192798_41_346	101
2500	3300053091	Ga0500647_0344943	Ga0500647_0344943_249_554	101
2501	3300053092	Ga0500583_0174143	Ga0500583_0174143_328_633	101
2502	3300053092	Ga0500583_0437592	Ga0500583_0437592_283_588	101
2503	3300053093	Ga0500651_0000274	Ga0500651_0000274_14140_14445	101
2504	3300053093	Ga0500651_0129786	Ga0500651_0129786_76_381	101
2505	3300053093	Ga0500651_0169517	Ga0500651_0169517_272_577	101
2506	3300053093	Ga0500651_0199263	Ga0500651_0199263_418_723	101
2507	3300053093	Ga0500651_0567225	Ga0500651_0567225_134_439	101
2508	3300053094	Ga0500566_0489662	Ga0500566_0489662_91_396	101
2509	3300053096	Ga0500641_0103989	Ga0500641_0103989_884_1189	101
2510	3300053098	Ga0500650_0150156	Ga0500650_0150156_261_566	101
2511	3300053098	Ga0500650_0261559	Ga0500650_0261559_335_640	101
2512	3300053098	Ga0500650_0385441	Ga0500650_0385441_107_412	101
2513	3300053105	Ga0500557_070242	Ga0500557_070242_442_747	101
2514	3300053108	Ga0500562_019007	Ga0500562_019007_1138_1443	101
2515	3300053108	Ga0500562_081775	Ga0500562_081775_444_749	101
2516	3300053109	Ga0500569_001743	Ga0500569_001743_3258_3563	101
2517	3300053117	Ga0500593_000235	Ga0500593_000235_17201_17506	101
2518	3300053117	Ga0500593_079766	Ga0500593_079766_816_1121	101
2519	3300053118	Ga0500594_0013014	Ga0500594_0013014_528_833	101
2520	3300053118	Ga0500594_0061291	Ga0500594_0061291_714_1019	101
2521	3300053121	Ga0500607_155896	Ga0500607_155896_237_542	101
2522	3300053122	Ga0500608_137024	Ga0500608_137024_343_648	101
2523	3300053126	Ga0500621_263949	Ga0500621_263949_190_495	101
2524	3300053127	Ga0500623_140348	Ga0500623_140348_390_695	101
2525	3300053129	Ga0500628_006199	Ga0500628_006199_547_852	101
2526	3300053129	Ga0500628_052264	Ga0500628_052264_156_461	101
2527	3300053130	Ga0500642_0002530	Ga0500642_0002530_557_862	101
2528	3300053131	Ga0500652_000400	Ga0500652_000400_8816_9121	101
2529	3300053131	Ga0500652_118135	Ga0500652_118135_305_610	101
2530	3300053131	Ga0500652_343050	Ga0500652_343050_118_423	101
2531	3300053133	Ga0500655_072343	Ga0500655_072343_278_583	101
2532	3300053133	Ga0500655_090443	Ga0500655_090443_16_321	101
2533	3300053134	Ga0500658_0190721	Ga0500658_0190721_502_807	101
2534	3300053134	Ga0500658_0276932	Ga0500658_0276932_283_588	101
2535	3300053136	Ga0500559_0003187	Ga0500559_0003187_131_436	101
2536	3300053138	Ga0500564_123671	Ga0500564_123671_658_963	101
2537	3300053138	Ga0500564_150120	Ga0500564_150120_537_842	101
2538	3300053138	Ga0500564_358607	Ga0500564_358607_114_419	101
2539	3300053139	Ga0500568_0013644	Ga0500568_0013644_2829_3134	101
2540	3300053139	Ga0500568_0015583	Ga0500568_0015583_2895_3200	101
2541	3300053139	Ga0500568_0079576	Ga0500568_0079576_792_1097	101
2542	3300053140	Ga0500573_0400656	Ga0500573_0400656_39_344	101
2543	3300053142	Ga0500577_0017376	Ga0500577_0017376_1731_2036	101
2544	3300053142	Ga0500577_0517424	Ga0500577_0517424_169_474	101
2545	3300053143	Ga0500579_229208	Ga0500579_229208_47_352	101
2546	3300053146	Ga0500588_0096304	Ga0500588_0096304_67_372	101
2547	3300053147	Ga0500589_138916	Ga0500589_138916_305_610	101
2548	3300053148	Ga0500590_019884	Ga0500590_019884_293_598	101
2549	3300053151	Ga0500604_0203201	Ga0500604_0203201_283_588	101
2550	3300053153	Ga0500616_0096791	Ga0500616_0096791_856_1161	101
2551	3300053154	Ga0500619_000012	Ga0500619_000012_49641_49946	101
2552	3300053156	Ga0500622_0000198	Ga0500622_0000198_37009_37314	101
2553	3300053156	Ga0500622_0000978	Ga0500622_0000978_3463_3768	101
2554	3300053156	Ga0500622_0001316	Ga0500622_0001316_12009_12314	101
2555	3300053158	Ga0500627_0127318	Ga0500627_0127318_334_639	101
2556	3300053158	Ga0500627_0420048	Ga0500627_0420048_65_370	101
2557	3300053160	Ga0500633_0204488	Ga0500633_0204488_255_560	101
2558	3300053160	Ga0500633_0219524	Ga0500633_0219524_324_629	101
2559	3300053162	Ga0500638_200485	Ga0500638_200485_522_827	101
2560	3300053177	Ga0500636_0125261	Ga0500636_0125261_206_511	101
2561	3300053177	Ga0500636_0259833	Ga0500636_0259833_275_580	101
2562	3300053177	Ga0500636_0362004	Ga0500636_0362004_66_371	101
2563	3300053724	Ga0500570_133500	Ga0500570_133500_481_786	101
2564	3300053724	Ga0500570_160073	Ga0500570_160073_184_489	101
2565	3300053730	Ga0500645_030754	Ga0500645_030754_588_893	101
2566	3300053730	Ga0500645_051755	Ga0500645_051755_881_1186	101
2567	3300053739	Ga0500587_000541	Ga0500587_000541_2934_3239	101
2568	3300053739	Ga0500587_006132	Ga0500587_006132_1069_1374	101
2569	3300055283	Ga0500661_007894	Ga0500661_007894_126_431	101
2570	3300055283	Ga0500661_081846	Ga0500661_081846_201_506	101
2571	3300059421	Ga0590071_001831	Ga0590071_001831_3303_3608	101
2572	3300059421	Ga0590071_038065	Ga0590071_038065_123_428	101
2573	3300059423	Ga0590074_018003	Ga0590074_018003_47_352	101
2574	3300059424	Ga0590075_011325	Ga0590075_011325_1204_1509	101
2575	3300059426	Ga0590077_044190	Ga0590077_044190_559_864	101
2576	3300059477	Ga0587084_000147	Ga0587084_000147_2820_3125	101
2577	3300059477	Ga0587084_007162	Ga0587084_007162_334_639	101
2578	3300059477	Ga0587084_008054	Ga0587084_008054_894_1199	101
2579	3300059477	Ga0587084_031229	Ga0587084_031229_227_532	101
2580	3300059477	Ga0587084_045471	Ga0587084_045471_115_420	101
2581	3300059478	Ga0587093_000068	Ga0587093_000068_1425_1730	101
2582	3300059478	Ga0587093_012311	Ga0587093_012311_430_735	101
2583	3300059478	Ga0587093_012919	Ga0587093_012919_41_346	101
2584	3300059478	Ga0587093_015159	Ga0587093_015159_592_897	101
2585	3300059478	Ga0587093_024862	Ga0587093_024862_342_647	101
2586	3300059478	Ga0587093_029806	Ga0587093_029806_181_486	101
2587	3300059490	Ga0587066_004510	Ga0587066_004510_1339_1644	101
2588	3300059491	Ga0587070_002116	Ga0587070_002116_703_1008	101
2589	3300059491	Ga0587070_006831	Ga0587070_006831_826_1131	101
2590	3300059491	Ga0587070_031617	Ga0587070_031617_446_751	101
2591	3300059491	Ga0587070_081479	Ga0587070_081479_199_504	101
2592	3300059492	Ga0587073_0000528	Ga0587073_0000528_1813_2118	101
2593	3300059492	Ga0587073_0008893	Ga0587073_0008893_72_377	101
2594	3300059492	Ga0587073_0012121	Ga0587073_0012121_1066_1371	101
2595	3300059493	Ga0587077_000950	Ga0587077_000950_1480_1785	101
2596	3300059493	Ga0587077_001041	Ga0587077_001041_750_1055	101
2597	3300059493	Ga0587077_009175	Ga0587077_009175_119_424	101
2598	3300059493	Ga0587077_129044	Ga0587077_129044_199_504	101
2599	3300059503	Ga0587080_004865	Ga0587080_004865_221_526	101
2600	3300059503	Ga0587080_014447	Ga0587080_014447_330_635	101
2601	3300059504	Ga0587082_002352	Ga0587082_002352_1479_1784	101
2602	3300059505	Ga0587083_0000260	Ga0587083_0000260_2645_2950	101
2603	3300059505	Ga0587083_0012252	Ga0587083_0012252_534_839	101
2604	3300059505	Ga0587083_0040117	Ga0587083_0040117_370_675	101
2605	3300059505	Ga0587083_0191195	Ga0587083_0191195_57_362	101
2606	3300059505	Ga0587083_0259322	Ga0587083_0259322_145_450	101
2607	3300059505	Ga0587083_0266027	Ga0587083_0266027_157_462	101
2608	3300059506	Ga0587085_015499	Ga0587085_015499_500_805	101
2609	3300059506	Ga0587085_056964	Ga0587085_056964_124_429	101
2610	3300059506	Ga0587085_058469	Ga0587085_058469_76_381	101
2611	3300059506	Ga0587085_133075	Ga0587085_133075_178_483	101
2612	3300059507	Ga0587086_008906	Ga0587086_008906_334_639	101
2613	3300059507	Ga0587086_064159	Ga0587086_064159_238_543	101
2614	3300059507	Ga0587086_090797	Ga0587086_090797_66_371	101
2615	3300059508	Ga0587088_000741	Ga0587088_000741_1176_1481	101
2616	3300059508	Ga0587088_006778	Ga0587088_006778_169_474	101
2617	3300059508	Ga0587088_195602	Ga0587088_195602_174_479	101
2618	3300059509	Ga0587089_018404	Ga0587089_018404_302_607	101
2619	3300059509	Ga0587089_020539	Ga0587089_020539_532_837	101
2620	3300059510	Ga0587090_000971	Ga0587090_000971_1835_2140	101
2621	3300059510	Ga0587090_049944	Ga0587090_049944_76_381	101
2622	3300059510	Ga0587090_091394	Ga0587090_091394_199_504	101
2623	3300059510	Ga0587090_125515	Ga0587090_125515_181_486	101
2624	3300059511	Ga0587091_039562	Ga0587091_039562_544_849	101
2625	3300059512	Ga0587092_003731	Ga0587092_003731_1161_1466	101
2626	3300059512	Ga0587092_013128	Ga0587092_013128_685_990	101
2627	3300059512	Ga0587092_073250	Ga0587092_073250_256_561	101
2628	3300059512	Ga0587092_096409	Ga0587092_096409_200_505	101
2629	3300059513	Ga0587094_003475	Ga0587094_003475_259_564	101
2630	3300059513	Ga0587094_010050	Ga0587094_010050_547_852	101
2631	3300059513	Ga0587094_028199	Ga0587094_028199_500_805	101
2632	3300059513	Ga0587094_069464	Ga0587094_069464_72_377	101
2633	3300059603	Ga0587097_02529	Ga0587097_02529_21_326	101
2634	3300059604	Ga0587098_035784	Ga0587098_035784_200_505	101
2635	3300059604	Ga0587098_054348	Ga0587098_054348_203_508	101
2636	3300059605	Ga0587106_001662	Ga0587106_001662_248_553	101
2637	3300059606	Ga0587121_02582	Ga0587121_02582_221_526	101
2638	3300059607	Ga0587125_000700	Ga0587125_000700_353_658	101
2639	3300059608	Ga0587129_000468	Ga0587129_000468_1376_1681	101
2640	3300059622	Ga0587099_000652	Ga0587099_000652_342_647	101
2641	3300059623	Ga0587101_000448	Ga0587101_000448_1069_1374	101
2642	3300059623	Ga0587101_001008	Ga0587101_001008_1397_1702	101
2643	3300059623	Ga0587101_004157	Ga0587101_004157_388_693	101
2644	3300059623	Ga0587101_010971	Ga0587101_010971_429_734	101
2645	3300059623	Ga0587101_026212	Ga0587101_026212_339_644	101
2646	3300059624	Ga0587109_006245	Ga0587109_006245_1325_1630	101
2647	3300059624	Ga0587109_008034	Ga0587109_008034_339_644	101
2648	3300059624	Ga0587109_056099	Ga0587109_056099_71_376	101
2649	3300059624	Ga0587109_122734	Ga0587109_122734_232_537	101
2650	3300059625	Ga0587113_008074	Ga0587113_008074_66_371	101
2651	3300059626	Ga0587115_001117	Ga0587115_001117_1406_1711	101
2652	3300059627	Ga0587117_063472	Ga0587117_063472_76_381	101
2653	3300059627	Ga0587117_093858	Ga0587117_093858_184_489	101
2654	3300059628	Ga0587122_005247	Ga0587122_005247_307_612	101
2655	3300059629	Ga0587127_000506	Ga0587127_000506_1484_1789	101
2656	3300059630	Ga0587128_001730	Ga0587128_001730_1483_1788	101
2657	3300059639	Ga0587062_000400	Ga0587062_000400_1572_1877	101
2658	3300059639	Ga0587062_027267	Ga0587062_027267_26_331	101
2659	3300059639	Ga0587062_028098	Ga0587062_028098_445_750	101
2660	3300059639	Ga0587062_091595	Ga0587062_091595_200_505	101
2661	3300059640	Ga0587067_002743	Ga0587067_002743_342_647	101
2662	3300059641	Ga0587068_001309	Ga0587068_001309_998_1303	101
2663	3300059641	Ga0587068_029396	Ga0587068_029396_72_377	101
2664	3300059641	Ga0587068_053393	Ga0587068_053393_57_362	101
2665	3300059641	Ga0587068_083374	Ga0587068_083374_136_441	101
2666	3300059641	Ga0587068_092276	Ga0587068_092276_208_513	101
2667	3300059642	Ga0587069_045331	Ga0587069_045331_294_599	101
2668	3300059642	Ga0587069_066565	Ga0587069_066565_208_513	101
2669	3300059643	Ga0587072_001392	Ga0587072_001392_1189_1494	101
2670	3300059643	Ga0587072_008796	Ga0587072_008796_1226_1531	101
2671	3300059643	Ga0587072_047141	Ga0587072_047141_319_624	101
2672	3300059643	Ga0587072_155637	Ga0587072_155637_113_418	101
2673	3300059644	Ga0587075_006388	Ga0587075_006388_203_508	101
2674	3300059645	Ga0587076_002043	Ga0587076_002043_1485_1790	101
2675	3300059645	Ga0587076_002122	Ga0587076_002122_1039_1344	101
2676	3300059645	Ga0587076_044132	Ga0587076_044132_342_647	101
2677	3300059645	Ga0587076_191621	Ga0587076_191621_145_450	101
2678	3300059646	Ga0587078_001557	Ga0587078_001557_445_750	101
2679	3300059646	Ga0587078_045221	Ga0587078_045221_33_338	101
2680	3300059647	Ga0587079_003155	Ga0587079_003155_333_638	101
2681	3300059647	Ga0587079_068918	Ga0587079_068918_200_505	101
2682	3300059648	Ga0587100_000850	Ga0587100_000850_995_1300	101
2683	3300059649	Ga0587102_000785	Ga0587102_000785_203_508	101
2684	3300059650	Ga0587104_001238	Ga0587104_001238_578_883	101
2685	3300059651	Ga0587105_000221	Ga0587105_000221_1402_1707	101
2686	3300059652	Ga0587107_000989	Ga0587107_000989_1483_1788	101
2687	3300059653	Ga0587108_001930	Ga0587108_001930_870_1175	101
2688	3300059654	Ga0587110_002686	Ga0587110_002686_224_529	101
2689	3300059655	Ga0587114_002480	Ga0587114_002480_1284_1589	101
2690	3300059656	Ga0587116_04474	Ga0587116_04474_136_441	101
2691	3300059657	Ga0587118_00289	Ga0587118_00289_763_1068	101
2692	3300059658	Ga0587119_011551	Ga0587119_011551_76_381	101
2693	3300059658	Ga0587119_011607	Ga0587119_011607_577_882	101
2694	3300059658	Ga0587119_063465	Ga0587119_063465_194_499	101
2695	3300059659	Ga0587120_003884	Ga0587120_003884_449_754	101
2696	3300059660	Ga0587124_001322	Ga0587124_001322_574_879	101
2697	3300059660	Ga0587124_004370	Ga0587124_004370_133_438	101
2698	3300059660	Ga0587124_024795	Ga0587124_024795_301_606	101
2699	3300060247	Ga0587096_00044	Ga0587096_00044_1477_1782	101
2700	3300060344	Ga0587071_000529	Ga0587071_000529_2045_2350	101
2701	3300060344	Ga0587071_055691	Ga0587071_055691_239_544	101
2702	3300060344	Ga0587071_105901	Ga0587071_105901_326_631	101
2703	3300060344	Ga0587071_188855	Ga0587071_188855_174_479	101
2704	3300060346	Ga0587111_0000186	Ga0587111_0000186_1426_1731	101
2705	3300060346	Ga0587111_0000227	Ga0587111_0000227_2897_3202	101
2706	3300060346	Ga0587111_0000325	Ga0587111_0000325_689_994	101
2707	3300060346	Ga0587111_0028503	Ga0587111_0028503_754_1059	101
2708	3300061719	Ga0466962_0000718	Ga0466962_0000718_6680_6985	101
2709	3300061719	Ga0466962_0014522	Ga0466962_0014522_1603_1908	101
2710	3300061719	Ga0466962_0019514	Ga0466962_0019514_612_917	101
2711	3300061719	Ga0466962_0222415	Ga0466962_0222415_391_696	101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

65

118

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1ya0-assembly2.cif.gz_B	crystal structure of the n-terminal domain of human smg7	0.7982	14	49
3mdk-assembly1.cif.gz_A	structure of stringent starvation protein a (sspa) from pseudomonas putida	0.7369	12	50
6nf8-assembly1.cif.gz_N	structure of human mitochondrial translation initiation factor 3 bound to the small ribosomal subunit -class i	0.735	8	101
7nql-assembly1.cif.gz_AN	55s mammalian mitochondrial ribosome with ict1 and p site trnamet	0.7332	8	101
7pnu-assembly1.cif.gz_K	assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa inward conformation	0.7319	8	101

ID	Description	Score	Start	End	Superfamily
af_Q6YZ04_1_129_1.20.140.40	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein	0.8074	13	50	1.20.140.40
af_A0A0R0EYR1_8_152_1.25.10.10	Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant	0.7977	24	55	1.25.10.10
af_B2RYT4_28_118_1.10.287.1480	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;	0.7777	8	91	1.10.287.1480
2qzgA01	Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Ta0600-like	0.7646	17	49	1.20.1440.50
af_M1FQJ9_1_90_1.10.287.1480	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;	0.7527	7	91	1.10.287.1480

ID	Description	Score	Start	End	GO Terms
AF-A0A498MQB2-F1-model_v4	Calcyclin-binding protein	0.9718	9	63	GO:0005634 GO:0005737 GO:0007507 GO:0015631 GO:0031625 GO:0044548
AF-A0A085DTT5-F1-model_v4	deleted	0.9511	6	64
AF-A0A085DTT5-F1-model_v4	deleted	0.9357	6	64
AF-A0A1D1XID5-F1-model_v4	Ribosomal protein S14, mitochondrial	0.9334	7	56	GO:0005739 GO:0005840 GO:1990904
AF-A0A4U9WMD4-F1-model_v4	30S ribosomal protein S14	0.9221	1	56	GO:0005840

Feature Viewer

pLDDT	pTM	Quality
84.78	0.55	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F497015

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

65

118

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map