F497007

General Info

Members Datasets Scaffolds Average Seq Length
2700 764 2640 120

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0835597|Ga0496102_0835597_75_485
Length 136
Sequence MPAIRRFGNLGKHSEYCNMARVKRGVTTRAKHKNILEQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRALWIQRINAAVREAGLTYSQFIHGAKLAGIELDRKAMADLAMNEGAVFASVISQAKAALG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2534681786 Brucella suis 92/29 Isolate Unclassified
7 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
8 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
9 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
10 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
11 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
12 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
15 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
16 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
17 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
18 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
19 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
20 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
21 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
22 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
23 2751185800 Brucella pituitosa AA2 Isolate Unclassified
24 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
25 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
26 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
27 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
28 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
29 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
30 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
31 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
32 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
33 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
34 2842694124 Methylopila sp. R-72369 Isolate Unclassified
35 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
36 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
37 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
38 2854911287 Brucella lupini LUP21 Isolate Unclassified
39 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
40 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
41 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
42 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
43 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
44 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
45 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
46 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
47 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
48 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
49 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
50 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
51 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
52 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
53 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
54 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
55 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
56 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
57 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
58 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
59 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
60 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
61 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
62 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
63 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
64 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
65 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
66 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
67 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
68 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
69 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
70 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
71 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
72 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
73 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
74 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
75 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
76 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
77 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
78 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
79 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
80 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
81 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
82 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
83 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
84 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
85 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
86 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
87 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
88 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
89 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
90 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
91 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
98 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
99 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
102 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
103 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
106 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
107 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
108 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
109 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
110 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
111 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
112 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
113 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
116 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
117 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
118 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
119 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
122 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
126 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
127 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
128 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
129 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
130 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
131 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
132 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
133 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
134 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
135 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
136 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
137 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
138 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
139 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
140 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
141 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
142 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
143 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
144 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
145 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
146 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
147 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
148 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
149 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
150 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
151 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
156 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
157 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
158 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
159 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
160 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
161 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
162 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
163 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
164 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
165 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
166 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
167 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
168 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
169 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
170 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
171 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
172 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
173 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
174 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
175 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
176 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
177 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
178 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
179 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
180 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
181 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
182 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
183 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
184 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
185 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
186 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
187 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
188 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
190 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
191 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
192 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
193 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
194 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
195 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
196 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
197 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
198 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
199 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
200 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
201 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
202 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
203 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
204 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
207 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
208 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
209 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
210 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
211 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
212 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
213 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
214 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
215 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
216 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
217 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
218 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
219 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
220 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
221 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
222 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
223 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
224 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
225 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
226 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
227 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
228 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
229 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
230 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
231 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
232 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
233 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
234 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
235 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
236 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
237 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
238 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
239 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
240 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
242 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
243 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
244 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
245 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
246 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
248 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
249 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
250 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
251 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
252 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
253 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
255 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
256 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
257 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
258 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
259 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
263 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
266 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
268 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
342 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
350 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
352 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
354 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
358 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
359 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
360 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
361 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
362 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
363 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
364 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
365 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
368 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
369 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
370 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
371 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
372 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
373 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
374 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
375 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
376 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
377 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
378 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
379 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
380 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
381 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
382 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
383 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
384 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
385 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
386 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
387 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
388 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
389 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
390 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
391 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
392 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
393 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
394 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
395 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
396 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
398 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
402 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
403 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
404 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
405 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
406 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
407 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
408 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
409 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
410 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
411 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
412 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
413 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
414 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
415 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
416 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
417 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
418 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
419 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
420 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
421 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
422 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
423 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
424 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
425 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
426 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
427 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
428 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
429 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
430 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
431 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
432 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
433 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
434 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
435 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
436 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
437 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
438 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
439 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
440 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
441 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
442 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
443 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
444 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
445 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
446 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
447 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
448 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
449 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
450 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
451 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
452 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
453 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
454 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
455 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
456 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
457 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
458 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
459 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
460 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
461 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
462 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
463 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
464 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
465 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
466 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
467 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
468 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
469 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
470 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
471 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
472 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
473 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
474 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
475 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
476 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
477 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
478 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
479 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
480 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
481 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
482 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
483 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
484 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
485 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
486 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
487 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
488 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
489 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
490 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
491 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
492 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
493 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
494 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
495 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
496 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
497 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
498 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
499 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
500 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
501 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
502 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
503 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
504 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
505 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
506 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
507 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
508 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
509 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
510 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
511 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
512 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
513 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
514 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
515 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
516 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
517 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
518 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
519 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
520 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
521 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
522 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
523 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
524 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
525 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
526 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
527 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
528 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
529 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
530 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
531 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
532 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
533 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
534 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
535 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
536 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
537 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
538 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
539 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
540 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
541 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
542 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
543 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
544 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
545 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
546 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
547 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
548 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
549 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
550 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
551 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
552 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
553 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
554 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
555 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
556 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
557 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
558 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
559 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
560 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
561 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
562 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
563 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
564 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
565 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
566 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
567 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
568 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
569 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
570 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
571 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
572 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
573 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
574 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
575 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
576 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
577 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
578 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
579 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
580 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
581 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
582 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
583 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
584 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
585 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
586 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
587 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
588 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
589 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
590 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
591 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
592 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
593 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
594 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
595 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
596 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
597 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
598 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
599 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
600 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
601 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
602 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
603 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
604 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
605 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
613 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
614 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
615 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
617 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
618 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
620 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
621 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
625 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
627 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
628 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
629 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
630 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
631 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
632 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
633 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
634 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
635 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
636 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
637 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
638 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
639 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
640 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
641 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
642 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
643 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
644 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
645 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
646 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
647 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
648 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
649 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
650 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
653 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
654 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
655 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
656 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
657 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
658 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
659 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
660 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
661 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
662 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
663 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
664 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
665 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
666 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
667 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
668 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
669 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
670 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
671 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
672 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
673 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
674 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
675 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
676 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
677 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
678 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
679 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
680 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
681 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
682 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
683 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
684 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
685 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
686 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
687 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
688 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
689 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
690 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
691 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
692 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
693 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
694 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
695 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
696 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
697 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
698 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
699 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
700 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
701 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
702 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
703 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
704 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
705 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
706 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
707 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
708 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
709 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
710 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
711 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
712 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
713 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
714 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
715 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
716 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
717 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
718 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
719 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
726 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
731 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
732 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
733 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
734 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
735 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
736 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
737 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
738 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
739 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
740 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
741 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
742 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
743 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
744 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
745 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
746 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
747 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
748 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
749 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
750 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
751 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
752 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
753 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
754 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
755 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
756 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
757 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
758 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
759 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
760 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
761 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
762 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
763 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
764 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93
Metatranscriptomes 4.78
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 11.04
Nodule 0.37
Rhizoplane 4.96
Rhizosphere 77.33
Stem 0
Stem Tuber 0
Unclassified 6.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC48362_g1 2010549000 Bacteria 781
2 SwRhRL2b_contig_1023452 2162886007 Bacteria 3999
3 SwRhRL2b_contig_1878598 2162886007 Bacteria 25068
4 SwRhRL2b_contig_2614068 2162886007 Bacteria 5430
5 SwRhRL2b_contig_2761788 2162886007 Bacteria 890
6 ARcpr5oldR_c006461 3300000041 Bacteria 1001
7 ARcpr5yngRDRAFT_c006253 3300000043 Bacteria 1078
8 ARCol0yngRDRAFT_1004808 3300000652 Bacteria 977
9 JGI24736J21556_1000036 3300001904 Bacteria 22294
10 JGI24736J21556_1000841 3300001904 Bacteria 5661
11 JGI24736J21556_1012983 3300001904 Bacteria 1346
12 JGI24741J21665_1000048 3300001915 Bacteria 29528
13 JGI24741J21665_1003961 3300001915 Bacteria 3389
14 JGI24752J21851_1010676 3300001976 Bacteria 1198
15 JGI24740J21852_10029072 3300001979 Bacteria 1819
16 JGI24740J21852_10042206 3300001979 Bacteria 1368
17 JGI24740J21852_10054054 3300001979 Bacteria 1136
18 JGI24740J21852_10113049 3300001979 Bacteria 684
19 JGI24740J21852_10169404 3300001979 Bacteria 542
20 JGI24739J22299_10005112 3300001989 Bacteria 4995
21 JGI24739J22299_10017766 3300001989 Bacteria 2563
22 JGI24739J22299_10042319 3300001989 Bacteria 1511
23 JGI24739J22299_10092022 3300001989 Bacteria 922
24 JGI24739J22299_10218492 3300001989 Bacteria 558
25 JGI24737J22298_10010158 3300001990 Bacteria 3115
26 JGI24737J22298_10013520 3300001990 Bacteria 2656
27 JGI24737J22298_10016354 3300001990 Bacteria 2395
28 JGI24737J22298_10028620 3300001990 Bacteria 1750
29 JGI24737J22298_10257098 3300001990 Bacteria 516
30 JGI24743J22301_10031593 3300001991 Bacteria 1043
31 JGI24750J21931_1005276 3300002070 Bacteria 1587
32 JGI24748J21848_1020079 3300002074 Bacteria 804
33 JGI24738J21930_10007334 3300002075 Bacteria 2549
34 JGI24738J21930_10025901 3300002075 Bacteria 1205
35 JGI24738J21930_10051879 3300002075 Bacteria 837
36 JGI24744J21845_10038391 3300002077 Bacteria 901
37 JGI24035J26624_1007994 3300002126 Bacteria 1033
38 JGI24034J26672_10005335 3300002239 Bacteria 1840
39 JGI24034J26672_10034443 3300002239 Bacteria 835
40 JGI24751J29686_10000476 3300002459 Bacteria 11948
41 JGI24751J29686_10014858 3300002459 Bacteria 1606
42 JGI24751J29686_10094936 3300002459 Bacteria 621
43 JGI25157J39369_1022777 3300002741 Bacteria 739
44 JGI25150J39212_1000067 3300002774 Bacteria 63491
45 JGI25150J39212_1034377 3300002774 Bacteria 682
46 JGI25151J46595_10024018 3300003187 Bacteria 2500
47 JGI25153J46596_10000073 3300003215 Bacteria 115166
48 JGI25153J46596_10000417 3300003215 Bacteria 27933
49 JGI25153J46596_10010562 3300003215 Bacteria 4164
50 rootH2_10089335 3300003320 Bacteria 3876
51 JGI26145J50221_1008080 3300003371 Bacteria 900
52 Ga0055525_1000119 3300003759 Bacteria 120272
53 Ga0055542_1000142 3300003762 Bacteria 89813
54 Ga0055542_1000783 3300003762 Bacteria 23812
55 Ga0055529_1000167 3300003763 Bacteria 90966
56 Ga0055537_1003859 3300003773 Bacteria 4479
57 Ga0055537_1007040 3300003773 Bacteria 2768
58 Ga0055524_1000154 3300003775 Bacteria 80540
59 Ga0055536_1009288 3300003781 Bacteria 4088
60 Ga0055536_1010360 3300003781 Bacteria 3713
61 Ga0055536_1014285 3300003781 Bacteria 2802
62 Ga0055536_1016129 3300003781 Bacteria 2515
63 Ga0055536_1056849 3300003781 Bacteria 828
64 Ga0055534_1040661 3300003784 Bacteria 685
65 Ga0055530_10000278 3300003791 Bacteria 46428
66 Ga0055530_10000919 3300003791 Bacteria 24154
67 Ga0055530_10008924 3300003791 Bacteria 3931
68 Ga0055530_10017727 3300003791 Bacteria 2218
69 Ga0055530_10098501 3300003791 Bacteria 590
70 Ga0055540_1004222 3300003792 Bacteria 6599
71 Ga0055531_10000094 3300003794 Bacteria 96266
72 Ga0055531_10000576 3300003794 Bacteria 32018
73 Ga0055531_10002471 3300003794 Bacteria 12332
74 Ga0055531_10019986 3300003794 Bacteria 2674
75 Ga0055531_10079625 3300003794 Bacteria 726
76 Ga0055531_10108249 3300003794 Bacteria 559
77 Ga0055543_1028437 3300004625 Bacteria 985
78 Ga0058859_11630952 3300004798 Bacteria 876
79 Ga0065165_1077226 3300005262 Bacteria 872
80 Ga0065165_1148841 3300005262 Bacteria 548
81 Ga0065714_10445013 3300005288 Bacteria 555
82 Ga0065704_10003962 3300005289 Bacteria 4806
83 Ga0065704_10070408 3300005289 Bacteria 26306
84 Ga0065704_10074213 3300005289 Bacteria 6443
85 Ga0065704_10075787 3300005289 Bacteria 5418
86 Ga0065704_10123182 3300005289 Bacteria 1738
87 Ga0065704_10337028 3300005289 Bacteria 829
88 Ga0065704_10404655 3300005289 Bacteria 748
89 Ga0065712_10077425 3300005290 Bacteria 3486
90 Ga0065715_10043060 3300005293 Bacteria 1216
91 Ga0065707_10089502 3300005295 Bacteria 4353
92 Ga0065707_10795077 3300005295 Bacteria 601
93 Ga0070658_10001088 3300005327 Bacteria 23167
94 Ga0070658_10001818 3300005327 Bacteria 17955
95 Ga0070658_10004556 3300005327 Bacteria 11266
96 Ga0070658_10121705 3300005327 Bacteria 2168
97 Ga0070658_10132051 3300005327 Bacteria 2081
98 Ga0070658_10157951 3300005327 Bacteria 1901
99 Ga0070658_10226029 3300005327 Bacteria 1584
100 Ga0070658_10345800 3300005327 Bacteria 1272
101 Ga0070658_10363440 3300005327 Bacteria 1240
102 Ga0070658_10441636 3300005327 Bacteria 1120
103 Ga0070658_10753753 3300005327 Bacteria 845
104 Ga0070658_10891125 3300005327 Bacteria 773
105 Ga0070676_10001859 3300005328 Bacteria 10744
106 Ga0070676_10186173 3300005328 Bacteria 1353
107 Ga0070676_10220314 3300005328 Bacteria 1253
108 Ga0070676_10320630 3300005328 Bacteria 1057
109 Ga0070676_10777837 3300005328 Bacteria 705
110 Ga0070683_100026014 3300005329 Bacteria 5263
111 Ga0070683_100027795 3300005329 Bacteria 5105
112 Ga0070683_100036618 3300005329 Bacteria 4490
113 Ga0070683_100915020 3300005329 Bacteria 841
114 Ga0070683_101024501 3300005329 Bacteria 793
115 Ga0070683_101072531 3300005329 Unclassified 774
116 Ga0070683_101298110 3300005329 Bacteria 699
117 Ga0070683_101876743 3300005329 Bacteria 576
118 Ga0070690_100001067 3300005330 Bacteria 14061
119 Ga0070690_100230956 3300005330 Bacteria 1301
120 Ga0070690_100634766 3300005330 Bacteria 814
121 Ga0070670_100001783 3300005331 Bacteria 17520
122 Ga0070670_100003330 3300005331 Bacteria 13297
123 Ga0070670_100034735 3300005331 Bacteria 4339
124 Ga0070670_100130100 3300005331 Bacteria 2173
125 Ga0070670_100191020 3300005331 Bacteria 1779
126 Ga0070670_100317880 3300005331 Bacteria 1364
127 Ga0070670_100595825 3300005331 Bacteria 989
128 Ga0070670_101389547 3300005331 Bacteria 644
129 Ga0068869_100047300 3300005334 Bacteria 3106
130 Ga0068869_100961881 3300005334 Bacteria 742
131 Ga0070666_10000476 3300005335 Bacteria 24221
132 Ga0070666_10002290 3300005335 Bacteria 11574
133 Ga0070666_10008159 3300005335 Bacteria 6488
134 Ga0070666_10112794 3300005335 Bacteria 1881
135 Ga0070666_10351601 3300005335 Bacteria 1055
136 Ga0070666_10921308 3300005335 Bacteria 646
137 Ga0070666_11289571 3300005335 Bacteria 545
138 Ga0070680_100015107 3300005336 Bacteria 6046
139 Ga0070680_100018879 3300005336 Bacteria 5453
140 Ga0070680_100714063 3300005336 Bacteria 863
141 Ga0070682_100003964 3300005337 Bacteria 8220
142 Ga0070682_100229299 3300005337 Bacteria 1327
143 Ga0070682_100246443 3300005337 Bacteria 1286
144 Ga0070682_100573061 3300005337 Bacteria 887
145 Ga0068868_100000006 3300005338 Bacteria 123358
146 Ga0068868_100002615 3300005338 Bacteria 12490
147 Ga0068868_100257110 3300005338 Bacteria 1472
148 Ga0070660_100000584 3300005339 Bacteria 24459
149 Ga0070660_100004220 3300005339 Bacteria 9921
150 Ga0070660_100095160 3300005339 Bacteria 2354
151 Ga0070660_100124465 3300005339 Bacteria 2059
152 Ga0070660_100242779 3300005339 Bacteria 1467
153 Ga0070660_100292811 3300005339 Bacteria 1333
154 Ga0070660_100404291 3300005339 Bacteria 1129
155 Ga0070660_100511463 3300005339 Bacteria 999
156 Ga0070660_100562380 3300005339 Bacteria 952
157 Ga0070660_100644777 3300005339 Bacteria 887
158 Ga0070689_100005611 3300005340 Bacteria 8587
159 Ga0070689_100060369 3300005340 Bacteria 2948
160 Ga0070689_100190728 3300005340 Bacteria 1669
161 Ga0070689_100698428 3300005340 Bacteria 886
162 Ga0070691_10000302 3300005341 Bacteria 17332
163 Ga0070691_10004772 3300005341 Bacteria 6168
164 Ga0070691_10305346 3300005341 Bacteria 870
165 Ga0070687_100000686 3300005343 Bacteria 11295
166 Ga0070687_100486630 3300005343 Bacteria 828
167 Ga0070661_100000507 3300005344 Bacteria 29896
168 Ga0070661_100000976 3300005344 Bacteria 20365
169 Ga0070661_100039616 3300005344 Bacteria 3434
170 Ga0070661_100078488 3300005344 Bacteria 2435
171 Ga0070661_100206559 3300005344 Bacteria 1502
172 Ga0070661_100244966 3300005344 Bacteria 1381
173 Ga0070661_100281820 3300005344 Bacteria 1289
174 Ga0070661_100384803 3300005344 Bacteria 1106
175 Ga0070661_100635173 3300005344 Bacteria 866
176 Ga0070661_101536523 3300005344 Bacteria 562
177 Ga0070692_10000534 3300005345 Bacteria 11810
178 Ga0070692_10152416 3300005345 Bacteria 1317
179 Ga0070668_100005413 3300005347 Bacteria 9476
180 Ga0070668_100010434 3300005347 Bacteria 6903
181 Ga0070668_100024692 3300005347 Bacteria 4555
182 Ga0070668_100042071 3300005347 Bacteria 3501
183 Ga0070668_100050967 3300005347 Bacteria 3188
184 Ga0070668_100131066 3300005347 Bacteria 2012
185 Ga0070668_100345243 3300005347 Bacteria 1258
186 Ga0070668_100699953 3300005347 Bacteria 894
187 Ga0070668_100834014 3300005347 Bacteria 821
188 Ga0070668_101004698 3300005347 Bacteria 750
189 Ga0070669_100000052 3300005353 Bacteria 114467
190 Ga0070669_100000074 3300005353 Bacteria 99054
191 Ga0070669_100000096 3300005353 Bacteria 86930
192 Ga0070669_100001148 3300005353 Bacteria 19338
193 Ga0070669_100001940 3300005353 Bacteria 14931
194 Ga0070669_100029003 3300005353 Bacteria 3988
195 Ga0070669_100043147 3300005353 Bacteria 3283
196 Ga0070669_100216629 3300005353 Bacteria 1513
197 Ga0070669_100331168 3300005353 Bacteria 1232
198 Ga0070669_100361280 3300005353 Bacteria 1181
199 Ga0070675_100001202 3300005354 Bacteria 18818
200 Ga0070675_100101930 3300005354 Bacteria 2418
201 Ga0070675_100214407 3300005354 Bacteria 1675
202 Ga0070675_100424323 3300005354 Bacteria 1189
203 Ga0070675_100568381 3300005354 Bacteria 1026
204 Ga0070675_100975029 3300005354 Bacteria 778
205 Ga0070671_100000005 3300005355 Bacteria 256547
206 Ga0070671_100000045 3300005355 Bacteria 85779
207 Ga0070671_100001052 3300005355 Bacteria 20342
208 Ga0070671_100001262 3300005355 Bacteria 18969
209 Ga0070671_100002546 3300005355 Bacteria 14125
210 Ga0070671_100361216 3300005355 Bacteria 1240
211 Ga0070671_101495182 3300005355 Bacteria 597
212 Ga0070674_100002525 3300005356 Bacteria 10131
213 Ga0070674_100016076 3300005356 Bacteria 4687
214 Ga0070674_100182352 3300005356 Bacteria 1609
215 Ga0070674_100624080 3300005356 Bacteria 913
216 Ga0070674_101329822 3300005356 Bacteria 641
217 Ga0070674_101386922 3300005356 Bacteria 629
218 Ga0070674_102221935 3300005356 Bacteria 501
219 Ga0070673_100000673 3300005364 Bacteria 18823
220 Ga0070673_100169382 3300005364 Bacteria 1863
221 Ga0070673_100212447 3300005364 Bacteria 1671
222 Ga0070673_100521796 3300005364 Bacteria 1076
223 Ga0070673_101275468 3300005364 Bacteria 689
224 Ga0070688_100004077 3300005365 Bacteria 7580
225 Ga0070688_100027433 3300005365 Bacteria 3393
226 Ga0070688_100102443 3300005365 Bacteria 1890
227 Ga0070688_100269781 3300005365 Bacteria 1219
228 Ga0070688_101374121 3300005365 Bacteria 572
229 Ga0070659_100000005 3300005366 Bacteria 259902
230 Ga0070659_100005781 3300005366 Bacteria 8905
231 Ga0070659_100006377 3300005366 Bacteria 8520
232 Ga0070659_100026584 3300005366 Bacteria 4454
233 Ga0070659_100163068 3300005366 Bacteria 1823
234 Ga0070659_100550632 3300005366 Bacteria 987
235 Ga0070659_101456372 3300005366 Bacteria 609
236 Ga0070667_100000126 3300005367 Bacteria 96729
237 Ga0070667_100000696 3300005367 Bacteria 32392
238 Ga0070667_100001801 3300005367 Bacteria 19071
239 Ga0070667_100045751 3300005367 Bacteria 3680
240 Ga0070667_100054770 3300005367 Bacteria 3368
241 Ga0070667_100092193 3300005367 Bacteria 2606
242 Ga0070667_100196352 3300005367 Bacteria 1789
243 Ga0070667_100210872 3300005367 Bacteria 1726
244 Ga0070667_100255166 3300005367 Bacteria 1569
245 Ga0070667_100279150 3300005367 Bacteria 1500
246 Ga0070667_100406367 3300005367 Bacteria 1240
247 Ga0070703_10017825 3300005406 Bacteria 2048
248 Ga0070709_10000225 3300005434 Bacteria 36698
249 Ga0070709_11183573 3300005434 Bacteria 614
250 Ga0070714_100010651 3300005435 Bacteria 7275
251 Ga0070714_100534842 3300005435 Bacteria 1121
252 Ga0070713_100013772 3300005436 Bacteria 5982
253 Ga0070713_100402863 3300005436 Bacteria 1278
254 Ga0070710_10516476 3300005437 Bacteria 820
255 Ga0070710_10672815 3300005437 Bacteria 728
256 Ga0070710_11248828 3300005437 Bacteria 551
257 Ga0070701_10000713 3300005438 Bacteria 11773
258 Ga0070701_10029761 3300005438 Bacteria 2696
259 Ga0070701_10313934 3300005438 Bacteria 968
260 Ga0070711_100000237 3300005439 Bacteria 28263
261 Ga0070711_100629191 3300005439 Bacteria 898
262 Ga0070711_101126626 3300005439 Bacteria 677
263 Ga0070705_100000934 3300005440 Bacteria 16371
264 Ga0070705_100116536 3300005440 Bacteria 1717
265 Ga0070705_100178976 3300005440 Bacteria 1435
266 Ga0070700_100008931 3300005441 Bacteria 5482
267 Ga0070700_100030356 3300005441 Bacteria 3230
268 Ga0070700_100035052 3300005441 Bacteria 3034
269 Ga0070700_100281035 3300005441 Bacteria 1207
270 Ga0070700_100422249 3300005441 Bacteria 1008
271 Ga0070700_100442035 3300005441 Bacteria 987
272 Ga0070700_100818039 3300005441 Bacteria 752
273 Ga0070694_100006630 3300005444 Bacteria 7036
274 Ga0070694_100725800 3300005444 Bacteria 810
275 Ga0070708_100052438 3300005445 Bacteria 3617
276 Ga0070708_101560542 3300005445 Bacteria 615
277 Ga0070663_100000497 3300005455 Bacteria 20743
278 Ga0070663_100020880 3300005455 Bacteria 4343
279 Ga0070663_100067038 3300005455 Bacteria 2602
280 Ga0070663_100073988 3300005455 Bacteria 2486
281 Ga0070663_100094287 3300005455 Bacteria 2222
282 Ga0070663_100221819 3300005455 Bacteria 1485
283 Ga0070663_100272767 3300005455 Bacteria 1345
284 Ga0070663_100454112 3300005455 Bacteria 1057
285 Ga0070678_100003959 3300005456 Bacteria 8327
286 Ga0070678_100143973 3300005456 Bacteria 1911
287 Ga0070678_100252705 3300005456 Bacteria 1479
288 Ga0070678_101236258 3300005456 Bacteria 693
289 Ga0070662_100002792 3300005457 Bacteria 10814
290 Ga0070662_100004743 3300005457 Bacteria 8616
291 Ga0070662_100215228 3300005457 Bacteria 1530
292 Ga0070662_100629863 3300005457 Bacteria 904
293 Ga0070662_100920695 3300005457 Bacteria 746
294 Ga0070681_10011638 3300005458 Bacteria 8710
295 Ga0070681_10035996 3300005458 Bacteria 4972
296 Ga0070681_10292766 3300005458 Bacteria 1538
297 Ga0070681_10369511 3300005458 Bacteria 1345
298 Ga0070681_10473062 3300005458 Bacteria 1166
299 Ga0070681_12004575 3300005458 Bacteria 507
300 Ga0068867_100033471 3300005459 Bacteria 3722
301 Ga0068867_100108248 3300005459 Bacteria 2131
302 Ga0068867_100129295 3300005459 Bacteria 1961
303 Ga0068867_100156147 3300005459 Bacteria 1796
304 Ga0068867_100308340 3300005459 Bacteria 1307
305 Ga0068867_101601851 3300005459 Bacteria 609
306 Ga0068867_101713003 3300005459 Bacteria 590
307 Ga0070685_10014056 3300005466 Bacteria 4234
308 Ga0070685_10078251 3300005466 Bacteria 1976
309 Ga0070685_11169043 3300005466 Bacteria 584
310 Ga0070707_100229142 3300005468 Bacteria 1809
311 Ga0070707_101308724 3300005468 Bacteria 691
312 Ga0070679_100009637 3300005530 Bacteria 9134
313 Ga0070679_100205823 3300005530 Bacteria 1932
314 Ga0070679_100304300 3300005530 Bacteria 1545
315 Ga0070679_100356781 3300005530 Bacteria 1409
316 Ga0070679_100460451 3300005530 Bacteria 1216
317 Ga0070679_100987862 3300005530 Bacteria 786
318 Ga0070684_100020003 3300005535 Bacteria 5549
319 Ga0070684_100154029 3300005535 Bacteria 2083
320 Ga0070684_100471018 3300005535 Bacteria 1162
321 Ga0070684_101214535 3300005535 Bacteria 709
322 Ga0070697_100004352 3300005536 Bacteria 10861
323 Ga0068853_100001129 3300005539 Bacteria 18917
324 Ga0068853_100002735 3300005539 Bacteria 13316
325 Ga0068853_100035403 3300005539 Bacteria 4241
326 Ga0068853_100103310 3300005539 Bacteria 2522
327 Ga0068853_100200594 3300005539 Bacteria 1815
328 Ga0068853_100280041 3300005539 Bacteria 1537
329 Ga0068853_100306321 3300005539 Bacteria 1469
330 Ga0068853_100636422 3300005539 Bacteria 1014
331 Ga0068853_100719926 3300005539 Bacteria 953
332 Ga0068853_102161994 3300005539 Bacteria 539
333 Ga0070672_100001428 3300005543 Bacteria 14759
334 Ga0070672_100132101 3300005543 Bacteria 2053
335 Ga0070672_100645023 3300005543 Bacteria 925
336 Ga0070686_100000180 3300005544 Bacteria 44847
337 Ga0070686_100000710 3300005544 Bacteria 19361
338 Ga0070686_100147930 3300005544 Bacteria 1642
339 Ga0070686_100340905 3300005544 Bacteria 1123
340 Ga0070686_100618113 3300005544 Bacteria 856
341 Ga0070686_100664360 3300005544 Bacteria 828
342 Ga0070695_100000578 3300005545 Bacteria 19309
343 Ga0070695_100002848 3300005545 Bacteria 10058
344 Ga0070696_100000325 3300005546 Bacteria 28995
345 Ga0070696_100024910 3300005546 Bacteria 4066
346 Ga0070696_100132064 3300005546 Bacteria 1817
347 Ga0070693_100012681 3300005547 Bacteria 4271
348 Ga0070693_100564453 3300005547 Bacteria 817
349 Ga0070665_100000079 3300005548 Bacteria 186925
350 Ga0070665_100000296 3300005548 Bacteria 78411
351 Ga0070665_100007214 3300005548 Bacteria 11295
352 Ga0070665_100016450 3300005548 Bacteria 7416
353 Ga0070665_100025820 3300005548 Bacteria 5916
354 Ga0070665_100035098 3300005548 Bacteria 5042
355 Ga0070665_100045038 3300005548 Bacteria 4430
356 Ga0070665_100096351 3300005548 Bacteria 2964
357 Ga0070665_100194694 3300005548 Bacteria 2028
358 Ga0070665_100520073 3300005548 Bacteria 1202
359 Ga0070665_100715964 3300005548 Bacteria 1014
360 Ga0070665_101355634 3300005548 Bacteria 721
361 Ga0070665_101645239 3300005548 Bacteria 650
362 Ga0070665_101718934 3300005548 Bacteria 634
363 Ga0070665_102014263 3300005548 Bacteria 582
364 Ga0070704_100011048 3300005549 Bacteria 5511
365 Ga0068855_100006792 3300005563 Bacteria 13880
366 Ga0068855_100013711 3300005563 Bacteria 9772
367 Ga0068855_100019332 3300005563 Bacteria 8185
368 Ga0068855_100022265 3300005563 Bacteria 7593
369 Ga0068855_100048203 3300005563 Bacteria 5030
370 Ga0068855_100149492 3300005563 Bacteria 2656
371 Ga0068855_100151509 3300005563 Bacteria 2637
372 Ga0068855_100252767 3300005563 Bacteria 1965
373 Ga0068855_100280798 3300005563 Bacteria 1849
374 Ga0068855_100300284 3300005563 Bacteria 1778
375 Ga0068855_100352292 3300005563 Bacteria 1621
376 Ga0068855_100563257 3300005563 Bacteria 1232
377 Ga0068855_101260806 3300005563 Bacteria 766
378 Ga0068855_101298053 3300005563 Bacteria 753
379 Ga0068855_101361997 3300005563 Bacteria 732
380 Ga0070664_100005810 3300005564 Bacteria 9952
381 Ga0070664_100052478 3300005564 Bacteria 3454
382 Ga0070664_100054332 3300005564 Bacteria 3397
383 Ga0070664_100241839 3300005564 Bacteria 1620
384 Ga0070664_100434352 3300005564 Bacteria 1204
385 Ga0070664_100930601 3300005564 Bacteria 815
386 Ga0070664_101394205 3300005564 Bacteria 662
387 Ga0068857_100002722 3300005577 Bacteria 14509
388 Ga0068857_100015261 3300005577 Bacteria 6705
389 Ga0068857_100033167 3300005577 Bacteria 4566
390 Ga0068857_100348275 3300005577 Bacteria 1371
391 Ga0068857_100405100 3300005577 Bacteria 1270
392 Ga0068857_100461560 3300005577 Bacteria 1189
393 Ga0068857_100630845 3300005577 Bacteria 1014
394 Ga0068857_100985947 3300005577 Bacteria 811
395 Ga0068857_101200472 3300005577 Bacteria 734
396 Ga0068857_101290001 3300005577 Bacteria 708
397 Ga0068857_101514112 3300005577 Bacteria 654
398 Ga0068857_101679906 3300005577 Bacteria 621
399 Ga0068854_100000389 3300005578 Bacteria 27589
400 Ga0068854_100028613 3300005578 Bacteria 3852
401 Ga0068854_100032623 3300005578 Bacteria 3625
402 Ga0068854_100035059 3300005578 Bacteria 3510
403 Ga0068854_100062705 3300005578 Bacteria 2696
404 Ga0068854_100133400 3300005578 Bacteria 1898
405 Ga0068854_100133726 3300005578 Bacteria 1896
406 Ga0068854_100192007 3300005578 Bacteria 1601
407 Ga0068854_100198525 3300005578 Bacteria 1576
408 Ga0068854_100631004 3300005578 Bacteria 918
409 Ga0068854_101544537 3300005578 Bacteria 603
410 Ga0068854_101583692 3300005578 Bacteria 596
411 Ga0068854_101854222 3300005578 Bacteria 554
412 Ga0068854_101972686 3300005578 Bacteria 537
413 Ga0068856_100001928 3300005614 Bacteria 21621
414 Ga0068856_100002574 3300005614 Bacteria 18686
415 Ga0068856_100022744 3300005614 Bacteria 6095
416 Ga0068856_100026525 3300005614 Bacteria 5649
417 Ga0068856_100147182 3300005614 Bacteria 2363
418 Ga0068856_100204231 3300005614 Bacteria 1990
419 Ga0068856_100289963 3300005614 Bacteria 1653
420 Ga0068856_100620084 3300005614 Bacteria 1102
421 Ga0068856_100957019 3300005614 Bacteria 875
422 Ga0068856_101117063 3300005614 Bacteria 805
423 Ga0068856_101135505 3300005614 Bacteria 798
424 Ga0070702_100000088 3300005615 Bacteria 27195
425 Ga0070702_100074831 3300005615 Bacteria 2010
426 Ga0068852_100014137 3300005616 Bacteria 6131
427 Ga0068852_100104161 3300005616 Bacteria 2567
428 Ga0068852_100225405 3300005616 Bacteria 1784
429 Ga0068852_100235764 3300005616 Bacteria 1746
430 Ga0068852_100327281 3300005616 Bacteria 1490
431 Ga0068852_100509361 3300005616 Bacteria 1199
432 Ga0068852_100521503 3300005616 Bacteria 1186
433 Ga0068852_100711923 3300005616 Bacteria 1014
434 Ga0068852_100712043 3300005616 Bacteria 1014
435 Ga0068852_101268045 3300005616 Bacteria 758
436 Ga0068859_100000162 3300005617 Bacteria 65033
437 Ga0068859_100002269 3300005617 Bacteria 19505
438 Ga0068859_100362355 3300005617 Bacteria 1545
439 Ga0068859_100556770 3300005617 Bacteria 1241
440 Ga0068859_100669333 3300005617 Bacteria 1129
441 Ga0068864_100002565 3300005618 Bacteria 14997
442 Ga0068864_100003629 3300005618 Bacteria 12763
443 Ga0068864_100004757 3300005618 Bacteria 11123
444 Ga0068864_100113697 3300005618 Bacteria 2413
445 Ga0068864_100882244 3300005618 Bacteria 883
446 Ga0068864_101043020 3300005618 Bacteria 812
447 Ga0068864_101245018 3300005618 Bacteria 743
448 Ga0068866_10008498 3300005718 Bacteria 4331
449 Ga0068866_10032331 3300005718 Bacteria 2529
450 Ga0068861_100000952 3300005719 Bacteria 17599
451 Ga0068861_100001387 3300005719 Bacteria 15217
452 Ga0068861_100007263 3300005719 Bacteria 7592
453 Ga0068861_100199975 3300005719 Bacteria 1677
454 Ga0068861_100203136 3300005719 Bacteria 1665
455 Ga0068861_100425121 3300005719 Bacteria 1185
456 Ga0068861_100734483 3300005719 Bacteria 921
457 Ga0068861_101179441 3300005719 Bacteria 739
458 Ga0068861_102574236 3300005719 Bacteria 512
459 Ga0068851_10040441 3300005834 Bacteria 2343
460 Ga0068851_10081837 3300005834 Bacteria 1687
461 Ga0068870_10057602 3300005840 Bacteria 2078
462 Ga0068863_100000103 3300005841 Bacteria 91380
463 Ga0068863_100000470 3300005841 Bacteria 41201
464 Ga0068863_100004418 3300005841 Bacteria 13866
465 Ga0068863_100005989 3300005841 Bacteria 11923
466 Ga0068863_100032893 3300005841 Bacteria 4941
467 Ga0068863_100037604 3300005841 Bacteria 4608
468 Ga0068863_100082631 3300005841 Bacteria 3044
469 Ga0068863_100586385 3300005841 Bacteria 1103
470 Ga0068863_100778089 3300005841 Bacteria 954
471 Ga0068858_100000240 3300005842 Bacteria 59201
472 Ga0068858_100002072 3300005842 Bacteria 20404
473 Ga0068858_100002314 3300005842 Bacteria 19259
474 Ga0068858_100004410 3300005842 Bacteria 13808
475 Ga0068858_100048093 3300005842 Bacteria 3953
476 Ga0068858_100069876 3300005842 Bacteria 3255
477 Ga0068858_100090763 3300005842 Bacteria 2843
478 Ga0068858_100131895 3300005842 Bacteria 2343
479 Ga0068858_100140077 3300005842 Bacteria 2270
480 Ga0068858_100167885 3300005842 Bacteria 2068
481 Ga0068858_100268179 3300005842 Bacteria 1624
482 Ga0068858_101354931 3300005842 Bacteria 701
483 Ga0068858_101426778 3300005842 Bacteria 682
484 Ga0068860_100000093 3300005843 Bacteria 150034
485 Ga0068860_100003367 3300005843 Bacteria 16456
486 Ga0068860_100004581 3300005843 Bacteria 14112
487 Ga0068860_100005041 3300005843 Bacteria 13445
488 Ga0068860_100013991 3300005843 Bacteria 7870
489 Ga0068860_100022991 3300005843 Bacteria 6029
490 Ga0068860_100084995 3300005843 Bacteria 3010
491 Ga0068860_100113883 3300005843 Bacteria 2586
492 Ga0068860_100527067 3300005843 Bacteria 1182
493 Ga0068860_100540490 3300005843 Bacteria 1167
494 Ga0068860_100776527 3300005843 Bacteria 971
495 Ga0068860_100900779 3300005843 Bacteria 901
496 Ga0068862_100001170 3300005844 Bacteria 24721
497 Ga0068862_100001387 3300005844 Bacteria 22482
498 Ga0068862_100004889 3300005844 Bacteria 11286
499 Ga0068862_100030244 3300005844 Bacteria 4564
500 Ga0068862_100064939 3300005844 Bacteria 3143
501 Ga0068862_100083636 3300005844 Bacteria 2771
502 Ga0068862_100119545 3300005844 Bacteria 2321
503 Ga0068862_100177531 3300005844 Bacteria 1910
504 Ga0068862_100223523 3300005844 Bacteria 1705
505 Ga0068862_100286699 3300005844 Bacteria 1511
506 Ga0068862_100305585 3300005844 Bacteria 1464
507 Ga0068862_100605152 3300005844 Bacteria 1053
508 Ga0068862_101160773 3300005844 Bacteria 769
509 Ga0081455_10001416 3300005937 Bacteria 29700
510 Ga0081455_10006703 3300005937 Bacteria 12304
511 Ga0081455_10198838 3300005937 Bacteria 1502
512 Ga0081538_10201233 3300005981 Bacteria 818
513 Ga0081540_1088598 3300005983 Bacteria 1368
514 Ga0081540_1106603 3300005983 Bacteria 1194
515 Ga0081539_10187932 3300005985 Bacteria 964
516 Ga0081539_10462094 3300005985 Bacteria 526
517 Ga0070717_11593547 3300006028 Bacteria 592
518 Ga0075365_10014968 3300006038 Bacteria 4679
519 Ga0075365_10017980 3300006038 Bacteria 4338
520 Ga0075365_10031317 3300006038 Bacteria 3411
521 Ga0075365_10502787 3300006038 Bacteria 857
522 Ga0075365_10511976 3300006038 Bacteria 848
523 Ga0075365_10611234 3300006038 Bacteria 771
524 Ga0075365_11075421 3300006038 Bacteria 566
525 Ga0075368_10001183 3300006042 Bacteria 8227
526 Ga0075368_10001519 3300006042 Bacteria 7432
527 Ga0075368_10008487 3300006042 Bacteria 3661
528 Ga0075368_10034408 3300006042 Bacteria 1974
529 Ga0075368_10168999 3300006042 Bacteria 918
530 Ga0075368_10573514 3300006042 Bacteria 509
531 Ga0075363_100000096 3300006048 Bacteria 19488
532 Ga0075363_100025336 3300006048 Bacteria 3024
533 Ga0075363_100097619 3300006048 Bacteria 1623
534 Ga0075363_100320506 3300006048 Bacteria 902
535 Ga0075363_100565137 3300006048 Bacteria 679
536 Ga0075363_100596728 3300006048 Bacteria 661
537 Ga0075364_10005322 3300006051 Bacteria 7468
538 Ga0075364_10008502 3300006051 Bacteria 6139
539 Ga0075364_10010176 3300006051 Bacteria 5672
540 Ga0075364_10079128 3300006051 Bacteria 2172
541 Ga0075364_10217649 3300006051 Bacteria 1295
542 Ga0075364_10433331 3300006051 Bacteria 898
543 Ga0075364_10773171 3300006051 Bacteria 655
544 Ga0075364_10804910 3300006051 Bacteria 641
545 Ga0075432_10073267 3300006058 Bacteria 1233
546 Ga0075432_10129092 3300006058 Bacteria 956
547 Ga0070715_10000291 3300006163 Bacteria 12275
548 Ga0070716_100001118 3300006173 Bacteria 11820
549 Ga0070716_101229369 3300006173 Bacteria 603
550 Ga0070716_101551373 3300006173 Bacteria 543
551 Ga0070712_100001476 3300006175 Bacteria 14336
552 Ga0070712_100383962 3300006175 Bacteria 1157
553 Ga0070712_100608373 3300006175 Bacteria 925
554 Ga0075362_10000046 3300006177 Bacteria 42578
555 Ga0075362_10000497 3300006177 Bacteria 11481
556 Ga0075362_10035176 3300006177 Bacteria 2186
557 Ga0075362_10138488 3300006177 Bacteria 1162
558 Ga0075362_10177958 3300006177 Bacteria 1030
559 Ga0075362_10179116 3300006177 Bacteria 1026
560 Ga0075367_10001647 3300006178 Bacteria 9723
561 Ga0075367_10021430 3300006178 Bacteria 3611
562 Ga0075367_10027526 3300006178 Bacteria 3235
563 Ga0075367_10030522 3300006178 Bacteria 3091
564 Ga0075367_10319971 3300006178 Bacteria 977
565 Ga0075367_10946747 3300006178 Bacteria 549
566 Ga0075369_10015892 3300006186 Bacteria 3029
567 Ga0075369_10016540 3300006186 Bacteria 2978
568 Ga0075369_10021076 3300006186 Bacteria 2674
569 Ga0075369_10039066 3300006186 Bacteria 2026
570 Ga0075369_10048256 3300006186 Bacteria 1837
571 Ga0075369_10342322 3300006186 Bacteria 701
572 Ga0075366_10000241 3300006195 Bacteria 24314
573 Ga0075366_10001502 3300006195 Bacteria 11639
574 Ga0075366_10037075 3300006195 Bacteria 2877
575 Ga0075366_10043580 3300006195 Bacteria 2658
576 Ga0075366_10068362 3300006195 Bacteria 2114
577 Ga0075366_10097395 3300006195 Bacteria 1764
578 Ga0075366_10279790 3300006195 Bacteria 1020
579 Ga0075366_10498372 3300006195 Bacteria 753
580 Ga0097621_100028733 3300006237 Bacteria 4386
581 Ga0097621_100049047 3300006237 Bacteria 3429
582 Ga0097621_100272760 3300006237 Bacteria 1487
583 Ga0097621_100358242 3300006237 Bacteria 1299
584 Ga0097621_102080544 3300006237 Bacteria 543
585 Ga0075370_10000321 3300006353 Bacteria 17276
586 Ga0075370_10000552 3300006353 Bacteria 14338
587 Ga0075370_10007347 3300006353 Bacteria 5607
588 Ga0075370_10030291 3300006353 Bacteria 3018
589 Ga0075370_10033069 3300006353 Bacteria 2893
590 Ga0075370_10048234 3300006353 Bacteria 2413
591 Ga0075370_10062810 3300006353 Bacteria 2117
592 Ga0075370_10076731 3300006353 Bacteria 1917
593 Ga0075370_10104865 3300006353 Bacteria 1638
594 Ga0075370_10134495 3300006353 Bacteria 1444
595 Ga0075370_10449126 3300006353 Bacteria 776
596 Ga0075370_10483391 3300006353 Bacteria 746
597 Ga0068871_100104063 3300006358 Bacteria 2381
598 Ga0068871_100186874 3300006358 Bacteria 1783
599 Ga0068871_100205579 3300006358 Bacteria 1701
600 Ga0068871_100317687 3300006358 Bacteria 1370
601 Ga0068871_101231305 3300006358 Bacteria 703
602 Ga0075428_100081367 3300006844 Bacteria 3534
603 Ga0075428_100164917 3300006844 Bacteria 2404
604 Ga0075428_100797818 3300006844 Bacteria 1004
605 Ga0075428_101155925 3300006844 Unclassified 817
606 Ga0075430_100072586 3300006846 Bacteria 2886
607 Ga0075430_100854469 3300006846 Bacteria 750
608 Ga0075431_100021252 3300006847 Bacteria 6633
609 Ga0075431_100646685 3300006847 Bacteria 1038
610 Ga0075431_101111348 3300006847 Unclassified 755
611 Ga0075433_10006318 3300006852 Bacteria 9360
612 Ga0075433_10317467 3300006852 Bacteria 1379
613 Ga0075434_100436550 3300006871 Bacteria 1330
614 Ga0075434_100489892 3300006871 Bacteria 1250
615 Ga0075429_100011000 3300006880 Bacteria 7829
616 Ga0075429_100170206 3300006880 Bacteria 1908
617 Ga0068865_100000212 3300006881 Bacteria 32489
618 Ga0068865_100038165 3300006881 Bacteria 3249
619 Ga0068865_100328907 3300006881 Bacteria 1232
620 Ga0075436_100005000 3300006914 Bacteria 9107
621 Ga0097620_100000162 3300006931 Bacteria 65033
622 Ga0097620_100002269 3300006931 Bacteria 19505
623 Ga0097620_100362395 3300006931 Bacteria 1545
624 Ga0097620_100556807 3300006931 Bacteria 1241
625 Ga0097620_100669344 3300006931 Bacteria 1129
626 Ga0079104_1016558 3300006946 Bacteria 2151
627 Ga0079104_1056291 3300006946 Bacteria 860
628 Ga0079104_1109781 3300006946 Bacteria 547
629 Ga0099826_10195975 3300006948 Bacteria 1110
630 Ga0075435_100036066 3300007076 Bacteria 3928
631 Ga0075435_100039582 3300007076 Bacteria 3762
632 Ga0075435_102023647 3300007076 Bacteria 506
633 Ga0105251_10000534 3300009011 Bacteria 35913
634 Ga0105251_10031794 3300009011 Bacteria 2637
635 Ga0105251_10070853 3300009011 Bacteria 1623
636 Ga0105251_10100684 3300009011 Bacteria 1321
637 Ga0105251_10234748 3300009011 Bacteria 826
638 Ga0105251_10476000 3300009011 Bacteria 581
639 Ga0105250_10012839 3300009092 Bacteria 3451
640 Ga0105250_10031842 3300009092 Bacteria 2118
641 Ga0105250_10055977 3300009092 Bacteria 1583
642 Ga0105250_10056543 3300009092 Bacteria 1574
643 Ga0105250_10204992 3300009092 Bacteria 832
644 Ga0105240_10010783 3300009093 Bacteria 12808
645 Ga0105240_10011600 3300009093 Bacteria 12261
646 Ga0105240_10033337 3300009093 Bacteria 6655
647 Ga0105240_10037140 3300009093 Bacteria 6261
648 Ga0105240_10172559 3300009093 Bacteria 2559
649 Ga0105240_10193654 3300009093 Bacteria 2389
650 Ga0105240_10208565 3300009093 Bacteria 2285
651 Ga0105240_10280501 3300009093 Bacteria 1914
652 Ga0105240_10436407 3300009093 Bacteria 1468
653 Ga0105240_11169015 3300009093 Bacteria 816
654 Ga0105240_11177219 3300009093 Bacteria 813
655 Ga0105240_11846607 3300009093 Bacteria 629
656 Ga0105240_12000063 3300009093 Bacteria 602
657 Ga0111539_10046885 3300009094 Bacteria 5168
658 Ga0111539_10542321 3300009094 Bacteria 1355
659 Ga0111539_10763422 3300009094 Bacteria 1125
660 Ga0111539_11859565 3300009094 Bacteria 698
661 Ga0111539_12061013 3300009094 Bacteria 662
662 Ga0105245_10000107 3300009098 Bacteria 80101
663 Ga0105245_10000318 3300009098 Bacteria 45618
664 Ga0105245_10004915 3300009098 Bacteria 11760
665 Ga0105245_10158902 3300009098 Bacteria 2143
666 Ga0105245_10208349 3300009098 Bacteria 1881
667 Ga0105245_10508226 3300009098 Bacteria 1222
668 Ga0105245_12234787 3300009098 Bacteria 601
669 Ga0105247_10000925 3300009101 Bacteria 22094
670 Ga0105247_10001548 3300009101 Bacteria 16396
671 Ga0105247_10001892 3300009101 Bacteria 14614
672 Ga0105247_10024382 3300009101 Bacteria 3645
673 Ga0105247_10089889 3300009101 Bacteria 1948
674 Ga0105247_10150437 3300009101 Bacteria 1533
675 Ga0105247_10425180 3300009101 Bacteria 952
676 Ga0114129_10269746 3300009147 Bacteria 2277
677 Ga0114129_10278187 3300009147 Bacteria 2237
678 Ga0114129_12775333 3300009147 Bacteria 583
679 Ga0114129_12775800 3300009147 Bacteria 583
680 Ga0105243_10000944 3300009148 Bacteria 27244
681 Ga0105243_10001886 3300009148 Bacteria 17865
682 Ga0105243_10022283 3300009148 Bacteria 4813
683 Ga0105243_10194387 3300009148 Bacteria 1775
684 Ga0105243_10428990 3300009148 Bacteria 1235
685 Ga0105243_10440144 3300009148 Bacteria 1220
686 Ga0105243_12506502 3300009148 Bacteria 555
687 Ga0105241_10002673 3300009174 Bacteria 13358
688 Ga0105241_10029901 3300009174 Bacteria 4067
689 Ga0105241_10123227 3300009174 Bacteria 2090
690 Ga0105241_10406239 3300009174 Bacteria 1196
691 Ga0105241_10831370 3300009174 Bacteria 853
692 Ga0105241_10840621 3300009174 Bacteria 848
693 Ga0105241_11549111 3300009174 Bacteria 639
694 Ga0105241_12068996 3300009174 Bacteria 562
695 Ga0105241_12107003 3300009174 Bacteria 557
696 Ga0105242_10030348 3300009176 Bacteria 4316
697 Ga0105242_10096840 3300009176 Bacteria 2494
698 Ga0105242_10102404 3300009176 Bacteria 2428
699 Ga0105242_10155865 3300009176 Bacteria 1995
700 Ga0105242_10177452 3300009176 Bacteria 1877
701 Ga0105242_10205409 3300009176 Bacteria 1752
702 Ga0105248_10010654 3300009177 Bacteria 10141
703 Ga0105248_10014164 3300009177 Bacteria 8779
704 Ga0105248_10040085 3300009177 Bacteria 5249
705 Ga0105248_10115172 3300009177 Bacteria 3032
706 Ga0105248_10210904 3300009177 Bacteria 2188
707 Ga0105248_10251683 3300009177 Bacteria 1988
708 Ga0105248_10372767 3300009177 Bacteria 1607
709 Ga0105248_10411651 3300009177 Bacteria 1522
710 Ga0105248_10427522 3300009177 Bacteria 1491
711 Ga0105248_10570189 3300009177 Bacteria 1277
712 Ga0105248_10577791 3300009177 Bacteria 1268
713 Ga0105248_10694502 3300009177 Bacteria 1148
714 Ga0105248_11441774 3300009177 Bacteria 779
715 Ga0105248_12202955 3300009177 Bacteria 627
716 Ga0105237_10276377 3300009545 Bacteria 1682
717 Ga0105237_10321660 3300009545 Bacteria 1551
718 Ga0105237_10497074 3300009545 Bacteria 1226
719 Ga0105237_10531298 3300009545 Bacteria 1183
720 Ga0105237_10555384 3300009545 Bacteria 1155
721 Ga0105237_11116429 3300009545 Bacteria 795
722 Ga0105238_10003956 3300009551 Bacteria 14705
723 Ga0105238_10069194 3300009551 Bacteria 3530
724 Ga0105238_10681721 3300009551 Bacteria 1039
725 Ga0105238_10714458 3300009551 Bacteria 1014
726 Ga0105238_11153412 3300009551 Bacteria 798
727 Ga0105238_11168907 3300009551 Bacteria 793
728 Ga0105238_11385148 3300009551 Bacteria 730
729 Ga0105238_11992100 3300009551 Bacteria 614
730 Ga0105249_10001629 3300009553 Bacteria 19666
731 Ga0105249_10002562 3300009553 Bacteria 15732
732 Ga0105249_10035761 3300009553 Bacteria 4504
733 Ga0105249_10054363 3300009553 Bacteria 3661
734 Ga0105249_10295522 3300009553 Bacteria 1623
735 Ga0105249_10316735 3300009553 Bacteria 1570
736 Ga0105249_12278545 3300009553 Bacteria 614
737 Ga0105249_12456644 3300009553 Bacteria 594
738 Ga0105239_10002915 3300010375 Bacteria 21370
739 Ga0105239_10031698 3300010375 Bacteria 5809
740 Ga0105239_10059516 3300010375 Bacteria 4192
741 Ga0105239_10141412 3300010375 Bacteria 2682
742 Ga0105239_10561942 3300010375 Bacteria 1300
743 Ga0105239_10903803 3300010375 Bacteria 1013
744 Ga0105239_11128643 3300010375 Bacteria 903
745 Ga0105239_12306236 3300010375 Bacteria 626
746 Ga0105246_10001471 3300011119 Bacteria 13986
747 Ga0105246_10004041 3300011119 Bacteria 8911
748 Ga0105246_10427618 3300011119 Bacteria 1107
749 Ga0105246_10624096 3300011119 Bacteria 935
750 Ga0105246_11081648 3300011119 Bacteria 731
751 Ga0105246_11296518 3300011119 Bacteria 675
752 Ga0157322_1020236 3300012490 Bacteria 635
753 Ga0157347_1013462 3300012502 Bacteria 894
754 Ga0157327_1020044 3300012512 Bacteria 746
755 Ga0157326_1028903 3300012513 Bacteria 724
756 Ga0157373_10005865 3300013100 Bacteria 9190
757 Ga0157373_10008328 3300013100 Bacteria 7704
758 Ga0157373_10024910 3300013100 Bacteria 4332
759 Ga0157373_10098658 3300013100 Bacteria 2056
760 Ga0157373_10160202 3300013100 Bacteria 1583
761 Ga0157373_10185021 3300013100 Bacteria 1467
762 Ga0157373_10245679 3300013100 Bacteria 1265
763 Ga0157373_10383688 3300013100 Bacteria 1005
764 Ga0157373_10532665 3300013100 Bacteria 850
765 Ga0157373_10736905 3300013100 Bacteria 724
766 Ga0157371_10000062 3300013102 Bacteria 169669
767 Ga0157371_10003718 3300013102 Bacteria 13677
768 Ga0157371_10008946 3300013102 Bacteria 7925
769 Ga0157371_10036317 3300013102 Bacteria 3529
770 Ga0157371_10045817 3300013102 Bacteria 3111
771 Ga0157371_10097128 3300013102 Bacteria 2088
772 Ga0157371_10154772 3300013102 Bacteria 1636
773 Ga0157371_10227238 3300013102 Bacteria 1341
774 Ga0157371_10247635 3300013102 Bacteria 1283
775 Ga0157371_10256002 3300013102 Bacteria 1261
776 Ga0157371_10363897 3300013102 Bacteria 1054
777 Ga0157371_10365486 3300013102 Bacteria 1052
778 Ga0157371_11184456 3300013102 Bacteria 588
779 Ga0157370_10003643 3300013104 Bacteria 18008
780 Ga0157370_10043858 3300013104 Bacteria 4302
781 Ga0157370_10140416 3300013104 Bacteria 2251
782 Ga0157370_10187429 3300013104 Bacteria 1920
783 Ga0157370_10282834 3300013104 Bacteria 1532
784 Ga0157370_10283619 3300013104 Bacteria 1530
785 Ga0157370_10484582 3300013104 Bacteria 1136
786 Ga0157370_10525805 3300013104 Bacteria 1085
787 Ga0157370_10650499 3300013104 Bacteria 963
788 Ga0157370_10683278 3300013104 Bacteria 937
789 Ga0157370_11051939 3300013104 Bacteria 736
790 Ga0157370_11523973 3300013104 Bacteria 601
791 Ga0157369_10000043 3300013105 Bacteria 180713
792 Ga0157369_10001048 3300013105 Bacteria 34926
793 Ga0157369_10011006 3300013105 Bacteria 10295
794 Ga0157369_10047977 3300013105 Bacteria 4635
795 Ga0157369_10105295 3300013105 Bacteria 3003
796 Ga0157369_10130301 3300013105 Bacteria 2666
797 Ga0157369_10259506 3300013105 Bacteria 1812
798 Ga0157369_10646473 3300013105 Bacteria 1091
799 Ga0157369_10736481 3300013105 Bacteria 1014
800 Ga0157369_10737756 3300013105 Bacteria 1014
801 Ga0157369_11052570 3300013105 Bacteria 832
802 Ga0157369_11755479 3300013105 Bacteria 630
803 Ga0157369_12662165 3300013105 Bacteria 504
804 Ga0157374_10004151 3300013296 Bacteria 12161
805 Ga0157374_10008229 3300013296 Bacteria 8910
806 Ga0157374_10077068 3300013296 Bacteria 3154
807 Ga0157374_10155442 3300013296 Bacteria 2225
808 Ga0157374_10245465 3300013296 Bacteria 1761
809 Ga0157378_10012986 3300013297 Bacteria 7285
810 Ga0157378_10015354 3300013297 Bacteria 6707
811 Ga0157378_10105700 3300013297 Bacteria 2574
812 Ga0157378_10106116 3300013297 Bacteria 2569
813 Ga0157378_10648012 3300013297 Bacteria 1072
814 Ga0157378_11337921 3300013297 Bacteria 758
815 Ga0157378_13243432 3300013297 Bacteria 505
816 Ga0163162_10000823 3300013306 Bacteria 28858
817 Ga0163162_10006344 3300013306 Bacteria 11451
818 Ga0163162_10007216 3300013306 Bacteria 10788
819 Ga0163162_10023724 3300013306 Bacteria 6054
820 Ga0163162_10111614 3300013306 Bacteria 2832
821 Ga0163162_10146476 3300013306 Bacteria 2478
822 Ga0163162_10267452 3300013306 Bacteria 1841
823 Ga0163162_10331280 3300013306 Bacteria 1655
824 Ga0163162_10572536 3300013306 Bacteria 1257
825 Ga0163162_10939429 3300013306 Bacteria 976
826 Ga0163162_11336930 3300013306 Bacteria 815
827 Ga0163162_11633696 3300013306 Bacteria 735
828 Ga0163162_12003456 3300013306 Bacteria 663
829 Ga0163162_12172311 3300013306 Bacteria 637
830 Ga0163162_13197198 3300013306 Bacteria 526
831 Ga0157372_10002837 3300013307 Bacteria 18732
832 Ga0157372_10025453 3300013307 Bacteria 6434
833 Ga0157372_10039997 3300013307 Bacteria 5178
834 Ga0157372_10141581 3300013307 Bacteria 2771
835 Ga0157372_10415389 3300013307 Bacteria 1568
836 Ga0157372_10778361 3300013307 Bacteria 1112
837 Ga0157372_10919623 3300013307 Bacteria 1014
838 Ga0157372_11166798 3300013307 Bacteria 890
839 Ga0157375_10001015 3300013308 Bacteria 24304
840 Ga0157375_10106173 3300013308 Bacteria 2900
841 Ga0157375_10114281 3300013308 Bacteria 2801
842 Ga0157375_10242307 3300013308 Bacteria 1963
843 Ga0157375_10262279 3300013308 Bacteria 1889
844 Ga0157375_10269885 3300013308 Bacteria 1863
845 Ga0157375_10314419 3300013308 Bacteria 1731
846 Ga0157375_10721260 3300013308 Bacteria 1150
847 Ga0157375_11235593 3300013308 Bacteria 877
848 Ga0157375_11363990 3300013308 Bacteria 835
849 Ga0163163_10004874 3300014325 Bacteria 11536
850 Ga0163163_10095231 3300014325 Bacteria 2997
851 Ga0163163_10098327 3300014325 Bacteria 2947
852 Ga0163163_10411813 3300014325 Bacteria 1410
853 Ga0163163_10422424 3300014325 Bacteria 1392
854 Ga0163163_10727617 3300014325 Bacteria 1056
855 Ga0163163_10936956 3300014325 Bacteria 929
856 Ga0163163_11212785 3300014325 Bacteria 817
857 Ga0163163_11817517 3300014325 Bacteria 670
858 Ga0163163_12792931 3300014325 Bacteria 545
859 Ga0157380_10016517 3300014326 Bacteria 5444
860 Ga0157380_10039666 3300014326 Bacteria 3664
861 Ga0157380_10101524 3300014326 Bacteria 2397
862 Ga0157380_10270474 3300014326 Bacteria 1549
863 Ga0157380_10785256 3300014326 Bacteria 968
864 Ga0157380_10830803 3300014326 Bacteria 944
865 Ga0157380_11081820 3300014326 Bacteria 840
866 Ga0182008_10034454 3300014497 Bacteria 2538
867 Ga0182008_10265103 3300014497 Bacteria 889
868 Ga0182008_10292256 3300014497 Bacteria 851
869 Ga0157377_10001125 3300014745 Bacteria 11329
870 Ga0157377_10019427 3300014745 Bacteria 3550
871 Ga0157377_11527519 3300014745 Bacteria 532
872 Ga0157379_10008925 3300014968 Bacteria 8742
873 Ga0157379_10010069 3300014968 Bacteria 8240
874 Ga0157379_10500846 3300014968 Bacteria 1126
875 Ga0157379_10755116 3300014968 Bacteria 916
876 Ga0157379_11463918 3300014968 Bacteria 663
877 Ga0157376_10001406 3300014969 Bacteria 15824
878 Ga0157376_10025105 3300014969 Bacteria 4690
879 Ga0157376_10040093 3300014969 Bacteria 3825
880 Ga0157376_11372001 3300014969 Bacteria 738
881 Ga0157376_12417710 3300014969 Bacteria 565
882 Ga0183363_1010 3300015690 Bacteria 108191
883 Ga0163161_10003384 3300017792 Bacteria 11194
884 Ga0163161_10006732 3300017792 Bacteria 7945
885 Ga0163161_10009585 3300017792 Bacteria 6695
886 Ga0163161_10228318 3300017792 Bacteria 1444
887 Ga0163161_10485376 3300017792 Bacteria 1004
888 Ga0163161_10599458 3300017792 Bacteria 908
889 Ga0163161_10671694 3300017792 Bacteria 860
890 Ga0163161_10866013 3300017792 Bacteria 763
891 Ga0163161_11106532 3300017792 Bacteria 681
892 Ga0163161_11184614 3300017792 Bacteria 660
893 Ga0163161_11619609 3300017792 Bacteria 571
894 Ga0184598_117135 3300019182 Bacteria 828
895 Ga0206356_10714324 3300020070 Bacteria 727
896 Ga0206356_11133344 3300020070 Bacteria 951
897 Ga0206355_1484588 3300020076 Bacteria 584
898 Ga0206351_10987137 3300020077 Bacteria 676
899 Ga0206352_10149205 3300020078 Bacteria 676
900 Ga0206354_10229996 3300020081 Bacteria 1213
901 Ga0206354_11017406 3300020081 Bacteria 729
902 Ga0154015_1061162 3300020610 Bacteria 689
903 Ga0213873_10032494 3300021358 Bacteria 1304
904 Ga0213872_10334032 3300021361 Bacteria 624
905 Ga0213874_10044093 3300021377 Bacteria 1346
906 Ga0213874_10380212 3300021377 Bacteria 546
907 Ga0213876_10000232 3300021384 Bacteria 54674
908 Ga0213876_10021404 3300021384 Bacteria 3419
909 Ga0213876_10562904 3300021384 Bacteria 606
910 Ga0213871_10061314 3300021441 Bacteria 1048
911 Ga0224712_10176773 3300022467 Bacteria 960
912 Ga0224712_10306085 3300022467 Bacteria 744
913 Ga0209147_101180 3300025229 Bacteria 10615
914 Ga0209437_100050 3300025233 Bacteria 394010
915 Ga0207425_1000005 3300025245 Bacteria 900502
916 Ga0209026_1007893 3300025250 Bacteria 2305
917 Ga0209129_1001455 3300025258 Bacteria 13206
918 Ga0209233_1000037 3300025261 Bacteria 554620
919 Ga0209565_1000007 3300025263 Bacteria 784361
920 Ga0209565_1000850 3300025263 Bacteria 17233
921 Ga0209455_1005872 3300025272 Bacteria 3714
922 Ga0209455_1024602 3300025272 Bacteria 1109
923 Ga0209455_1025055 3300025272 Bacteria 1092
924 Ga0209673_1007333 3300025273 Bacteria 5109
925 Ga0209673_1008711 3300025273 Bacteria 4485
926 Ga0207673_1001765 3300025290 Bacteria 2399
927 Ga0209675_1000169 3300025291 Bacteria 78355
928 Ga0209675_1016124 3300025291 Bacteria 2188
929 Ga0209676_1000256 3300025292 Bacteria 112819
930 Ga0209676_1000651 3300025292 Bacteria 49756
931 Ga0209676_1000807 3300025292 Bacteria 41068
932 Ga0209676_1001585 3300025292 Bacteria 20263
933 Ga0209676_1012139 3300025292 Bacteria 3414
934 Ga0209676_1022177 3300025292 Bacteria 2110
935 Ga0209025_1000477 3300025294 Bacteria 77692
936 Ga0209025_1016458 3300025294 Bacteria 4361
937 Ga0209025_1035205 3300025294 Bacteria 2267
938 Ga0209564_1001268 3300025295 Bacteria 27785
939 Ga0209758_1000002 3300025297 Bacteria 1400310
940 Ga0209758_1020798 3300025297 Bacteria 3087
941 Ga0209758_1073008 3300025297 Bacteria 1071
942 Ga0209050_1000001 3300025298 Bacteria 3563507
943 Ga0209050_1000071 3300025298 Bacteria 295478
944 Ga0209050_1000213 3300025298 Bacteria 129359
945 Ga0209050_1000310 3300025298 Bacteria 99292
946 Ga0209050_1000937 3300025298 Bacteria 38116
947 Ga0209050_1012711 3300025298 Bacteria 3828
948 Ga0209050_1022136 3300025298 Bacteria 2288
949 Ga0209050_1023898 3300025298 Bacteria 2133
950 Ga0209050_1027937 3300025298 Bacteria 1844
951 Ga0209256_1000008 3300025299 Bacteria 975723
952 Ga0209051_1001344 3300025303 Bacteria 21373
953 Ga0209257_1000027 3300025304 Bacteria 703541
954 Ga0209257_1000113 3300025304 Bacteria 233523
955 Ga0209257_1000379 3300025304 Bacteria 88845
956 Ga0209257_1002330 3300025304 Bacteria 19148
957 Ga0209257_1002535 3300025304 Bacteria 17892
958 Ga0209257_1008172 3300025304 Bacteria 6056
959 Ga0209257_1073908 3300025304 Bacteria 891
960 Ga0207697_10003130 3300025315 Bacteria 8262
961 Ga0207697_10049627 3300025315 Bacteria 1733
962 Ga0207697_10495982 3300025315 Bacteria 539
963 Ga0207656_10015606 3300025321 Bacteria 2942
964 Ga0207656_10053971 3300025321 Bacteria 1746
965 Ga0207696_1009621 3300025711 Bacteria 3595
966 Ga0207696_1032104 3300025711 Bacteria 1583
967 Ga0207696_1181536 3300025711 Bacteria 556
968 Ga0207696_1182462 3300025711 Bacteria 554
969 Ga0207713_1002133 3300025735 Bacteria 14743
970 Ga0207713_1027808 3300025735 Bacteria 2561
971 Ga0207653_10009975 3300025885 Bacteria 2962
972 Ga0207682_10489826 3300025893 Bacteria 582
973 Ga0207692_10498065 3300025898 Bacteria 773
974 Ga0207642_10023025 3300025899 Bacteria 2482
975 Ga0207642_11127734 3300025899 Bacteria 508
976 Ga0207710_10001500 3300025900 Bacteria 11557
977 Ga0207710_10009894 3300025900 Bacteria 4008
978 Ga0207710_10052376 3300025900 Bacteria 1835
979 Ga0207710_10087066 3300025900 Bacteria 1456
980 Ga0207710_10186876 3300025900 Bacteria 1019
981 Ga0207710_10353504 3300025900 Bacteria 749
982 Ga0207710_10611203 3300025900 Bacteria 570
983 Ga0207688_10000228 3300025901 Bacteria 25406
984 Ga0207688_10306066 3300025901 Bacteria 972
985 Ga0207680_10003876 3300025903 Bacteria 7053
986 Ga0207680_10015591 3300025903 Bacteria 3970
987 Ga0207680_10034344 3300025903 Bacteria 2901
988 Ga0207680_10266087 3300025903 Bacteria 1188
989 Ga0207680_11061657 3300025903 Bacteria 579
990 Ga0207647_10015010 3300025904 Bacteria 5325
991 Ga0207647_10074284 3300025904 Bacteria 2048
992 Ga0207647_10188502 3300025904 Bacteria 1196
993 Ga0207647_10257697 3300025904 Bacteria 999
994 Ga0207685_10022529 3300025905 Bacteria 2131
995 Ga0207699_10006725 3300025906 Bacteria 5582
996 Ga0207645_10005056 3300025907 Bacteria 9664
997 Ga0207645_10157581 3300025907 Bacteria 1484
998 Ga0207645_10491243 3300025907 Bacteria 831
999 Ga0207643_10562209 3300025908 Bacteria 732
1000 Ga0207705_10000033 3300025909 Bacteria 223997
1001 Ga0207705_10000037 3300025909 Bacteria 197951
1002 Ga0207705_10001756 3300025909 Bacteria 17138
1003 Ga0207705_10101733 3300025909 Bacteria 2114
1004 Ga0207705_10198026 3300025909 Bacteria 1521
1005 Ga0207705_10257550 3300025909 Bacteria 1332
1006 Ga0207705_10286787 3300025909 Bacteria 1261
1007 Ga0207705_10305783 3300025909 Bacteria 1220
1008 Ga0207705_10372330 3300025909 Bacteria 1103
1009 Ga0207705_10515727 3300025909 Bacteria 929
1010 Ga0207684_11523488 3300025910 Bacteria 543
1011 Ga0207684_11701422 3300025910 Bacteria 508
1012 Ga0207654_10205025 3300025911 Bacteria 1301
1013 Ga0207654_10403323 3300025911 Bacteria 951
1014 Ga0207654_10565528 3300025911 Bacteria 809
1015 Ga0207654_10949379 3300025911 Bacteria 624
1016 Ga0207707_10032620 3300025912 Bacteria 4558
1017 Ga0207707_10093782 3300025912 Bacteria 2622
1018 Ga0207707_10229056 3300025912 Bacteria 1617
1019 Ga0207707_10431688 3300025912 Bacteria 1128
1020 Ga0207707_11558563 3300025912 Bacteria 522
1021 Ga0207695_10001285 3300025913 Bacteria 42674
1022 Ga0207695_10002063 3300025913 Bacteria 30645
1023 Ga0207695_10003382 3300025913 Bacteria 22540
1024 Ga0207695_10041989 3300025913 Bacteria 4890
1025 Ga0207695_10063442 3300025913 Bacteria 3809
1026 Ga0207695_10090796 3300025913 Bacteria 3069
1027 Ga0207695_10114464 3300025913 Bacteria 2672
1028 Ga0207695_10229651 3300025913 Bacteria 1761
1029 Ga0207695_10271816 3300025913 Bacteria 1590
1030 Ga0207695_10425775 3300025913 Bacteria 1211
1031 Ga0207695_11008826 3300025913 Bacteria 712
1032 Ga0207671_10022726 3300025914 Bacteria 4738
1033 Ga0207671_10123662 3300025914 Bacteria 1979
1034 Ga0207693_10000892 3300025915 Bacteria 26789
1035 Ga0207693_10190416 3300025915 Bacteria 1614
1036 Ga0207693_10702145 3300025915 Bacteria 783
1037 Ga0207693_10905594 3300025915 Bacteria 677
1038 Ga0207693_11129049 3300025915 Bacteria 594
1039 Ga0207663_10000847 3300025916 Bacteria 13892
1040 Ga0207663_10311044 3300025916 Bacteria 1181
1041 Ga0207663_10582076 3300025916 Bacteria 878
1042 Ga0207663_11241778 3300025916 Bacteria 600
1043 Ga0207660_10016689 3300025917 Bacteria 4866
1044 Ga0207660_10019569 3300025917 Bacteria 4526
1045 Ga0207660_10126937 3300025917 Bacteria 1938
1046 Ga0207660_10263836 3300025917 Bacteria 1363
1047 Ga0207660_10470764 3300025917 Bacteria 1017
1048 Ga0207660_10939625 3300025917 Bacteria 706
1049 Ga0207660_10959431 3300025917 Bacteria 698
1050 Ga0207662_10025150 3300025918 Bacteria 3428
1051 Ga0207657_10000227 3300025919 Bacteria 58998
1052 Ga0207657_10000695 3300025919 Bacteria 35770
1053 Ga0207657_10001202 3300025919 Bacteria 27550
1054 Ga0207657_10053790 3300025919 Bacteria 3485
1055 Ga0207657_10167794 3300025919 Bacteria 1780
1056 Ga0207657_10309432 3300025919 Bacteria 1251
1057 Ga0207649_10001202 3300025920 Bacteria 15623
1058 Ga0207649_10002320 3300025920 Bacteria 10689
1059 Ga0207649_10012168 3300025920 Bacteria 4764
1060 Ga0207649_10187528 3300025920 Bacteria 1452
1061 Ga0207649_10921635 3300025920 Bacteria 686
1062 Ga0207649_11334309 3300025920 Bacteria 567
1063 Ga0207652_10000474 3300025921 Bacteria 41182
1064 Ga0207652_10003357 3300025921 Bacteria 13223
1065 Ga0207652_10078695 3300025921 Bacteria 2879
1066 Ga0207652_10421608 3300025921 Bacteria 1204
1067 Ga0207652_10571168 3300025921 Bacteria 1015
1068 Ga0207681_10000030 3300025923 Bacteria 173766
1069 Ga0207681_10000120 3300025923 Bacteria 66235
1070 Ga0207681_10000188 3300025923 Bacteria 50361
1071 Ga0207681_10000261 3300025923 Bacteria 40384
1072 Ga0207681_10015620 3300025923 Bacteria 4737
1073 Ga0207681_10116214 3300025923 Bacteria 1954
1074 Ga0207681_10121656 3300025923 Bacteria 1915
1075 Ga0207681_10188480 3300025923 Bacteria 1576
1076 Ga0207681_10191146 3300025923 Bacteria 1566
1077 Ga0207681_10701429 3300025923 Bacteria 841
1078 Ga0207681_10753446 3300025923 Bacteria 812
1079 Ga0207694_10032047 3300025924 Bacteria 4021
1080 Ga0207694_10205261 3300025924 Bacteria 1604
1081 Ga0207694_10756678 3300025924 Bacteria 820
1082 Ga0207694_11085333 3300025924 Bacteria 677
1083 Ga0207694_11687627 3300025924 Bacteria 533
1084 Ga0207650_10007097 3300025925 Bacteria 7630
1085 Ga0207650_10022682 3300025925 Bacteria 4446
1086 Ga0207650_10034458 3300025925 Bacteria 3672
1087 Ga0207650_10091393 3300025925 Bacteria 2326
1088 Ga0207650_10165351 3300025925 Bacteria 1755
1089 Ga0207650_10293222 3300025925 Bacteria 1327
1090 Ga0207650_10330158 3300025925 Bacteria 1251
1091 Ga0207650_10503856 3300025925 Bacteria 1012
1092 Ga0207659_10007934 3300025926 Bacteria 6565
1093 Ga0207659_10037022 3300025926 Bacteria 3385
1094 Ga0207659_11366318 3300025926 Bacteria 608
1095 Ga0207687_10000239 3300025927 Bacteria 37602
1096 Ga0207687_10000398 3300025927 Bacteria 29475
1097 Ga0207687_10021033 3300025927 Bacteria 4332
1098 Ga0207687_10032848 3300025927 Bacteria 3517
1099 Ga0207687_10053051 3300025927 Bacteria 2831
1100 Ga0207687_10109163 3300025927 Bacteria 2050
1101 Ga0207687_11230628 3300025927 Bacteria 643
1102 Ga0207700_10391087 3300025928 Bacteria 1217
1103 Ga0207664_10033627 3300025929 Bacteria 3941
1104 Ga0207664_10377153 3300025929 Bacteria 1259
1105 Ga0207664_11123777 3300025929 Bacteria 702
1106 Ga0207644_10000008 3300025931 Bacteria 354219
1107 Ga0207644_10000017 3300025931 Bacteria 177818
1108 Ga0207644_10000275 3300025931 Bacteria 34149
1109 Ga0207644_10000758 3300025931 Bacteria 20469
1110 Ga0207644_10014424 3300025931 Bacteria 5285
1111 Ga0207644_10038642 3300025931 Bacteria 3364
1112 Ga0207644_10101281 3300025931 Bacteria 2164
1113 Ga0207644_10524958 3300025931 Bacteria 978
1114 Ga0207644_10587733 3300025931 Bacteria 924
1115 Ga0207644_11147826 3300025931 Bacteria 653
1116 Ga0207690_10000002 3300025932 Bacteria 807473
1117 Ga0207690_10000033 3300025932 Bacteria 149705
1118 Ga0207690_10000791 3300025932 Bacteria 20392
1119 Ga0207690_10000978 3300025932 Bacteria 18314
1120 Ga0207690_10007053 3300025932 Bacteria 6669
1121 Ga0207690_10231150 3300025932 Bacteria 1420
1122 Ga0207706_10001092 3300025933 Bacteria 27557
1123 Ga0207706_10002029 3300025933 Bacteria 19849
1124 Ga0207706_10020532 3300025933 Bacteria 5937
1125 Ga0207706_10139104 3300025933 Bacteria 2136
1126 Ga0207706_10256104 3300025933 Bacteria 1528
1127 Ga0207706_10349971 3300025933 Bacteria 1285
1128 Ga0207706_10509923 3300025933 Bacteria 1038
1129 Ga0207706_10784238 3300025933 Bacteria 810
1130 Ga0207686_10002670 3300025934 Bacteria 9680
1131 Ga0207686_10062631 3300025934 Bacteria 2363
1132 Ga0207686_10146674 3300025934 Bacteria 1638
1133 Ga0207686_11494933 3300025934 Bacteria 557
1134 Ga0207709_10009544 3300025935 Bacteria 5341
1135 Ga0207709_10180597 3300025935 Bacteria 1490
1136 Ga0207709_10748070 3300025935 Bacteria 786
1137 Ga0207709_10966756 3300025935 Bacteria 695
1138 Ga0207709_11047834 3300025935 Bacteria 668
1139 Ga0207670_10005805 3300025936 Bacteria 6814
1140 Ga0207670_10344537 3300025936 Bacteria 1178
1141 Ga0207670_10598185 3300025936 Bacteria 905
1142 Ga0207670_11424369 3300025936 Bacteria 588
1143 Ga0207669_10003850 3300025937 Bacteria 6540
1144 Ga0207669_10116677 3300025937 Bacteria 1802
1145 Ga0207669_10194822 3300025937 Bacteria 1465
1146 Ga0207669_10793850 3300025937 Bacteria 785
1147 Ga0207669_11479566 3300025937 Bacteria 579
1148 Ga0207704_10017213 3300025938 Bacteria 3740
1149 Ga0207704_10034319 3300025938 Bacteria 2894
1150 Ga0207704_10414271 3300025938 Bacteria 1067
1151 Ga0207665_10000425 3300025939 Bacteria 29075
1152 Ga0207665_11129404 3300025939 Bacteria 625
1153 Ga0207691_10002632 3300025940 Bacteria 17529
1154 Ga0207691_10216626 3300025940 Bacteria 1661
1155 Ga0207691_10407224 3300025940 Bacteria 1160
1156 Ga0207691_10918344 3300025940 Bacteria 732
1157 Ga0207711_10000424 3300025941 Bacteria 44295
1158 Ga0207711_10009142 3300025941 Bacteria 8276
1159 Ga0207711_10024579 3300025941 Bacteria 5051
1160 Ga0207711_10028129 3300025941 Bacteria 4728
1161 Ga0207711_10079894 3300025941 Bacteria 2855
1162 Ga0207711_10107428 3300025941 Bacteria 2478
1163 Ga0207711_10126112 3300025941 Bacteria 2290
1164 Ga0207711_10136431 3300025941 Bacteria 2204
1165 Ga0207711_10297055 3300025941 Bacteria 1489
1166 Ga0207711_10430961 3300025941 Bacteria 1227
1167 Ga0207711_10443263 3300025941 Bacteria 1208
1168 Ga0207711_11911995 3300025941 Bacteria 536
1169 Ga0207689_10154385 3300025942 Bacteria 1892
1170 Ga0207689_10972965 3300025942 Bacteria 716
1171 Ga0207661_10166015 3300025944 Bacteria 1918
1172 Ga0207661_10225868 3300025944 Bacteria 1656
1173 Ga0207661_10329297 3300025944 Bacteria 1374
1174 Ga0207661_11041435 3300025944 Bacteria 754
1175 Ga0207661_11169481 3300025944 Bacteria 708
1176 Ga0207679_10004122 3300025945 Bacteria 9026
1177 Ga0207679_10062647 3300025945 Bacteria 2772
1178 Ga0207679_10141829 3300025945 Bacteria 1943
1179 Ga0207679_10198386 3300025945 Bacteria 1675
1180 Ga0207679_10311780 3300025945 Bacteria 1360
1181 Ga0207679_11095037 3300025945 Bacteria 731
1182 Ga0207679_11674967 3300025945 Bacteria 582
1183 Ga0207667_10004469 3300025949 Bacteria 17115
1184 Ga0207667_10007100 3300025949 Bacteria 13519
1185 Ga0207667_10009657 3300025949 Bacteria 11349
1186 Ga0207667_10028735 3300025949 Bacteria 6037
1187 Ga0207667_10064744 3300025949 Bacteria 3815
1188 Ga0207667_10084062 3300025949 Bacteria 3295
1189 Ga0207667_10133914 3300025949 Bacteria 2552
1190 Ga0207667_10160095 3300025949 Bacteria 2316
1191 Ga0207667_10283960 3300025949 Bacteria 1691
1192 Ga0207667_10504900 3300025949 Bacteria 1226
1193 Ga0207651_10005591 3300025960 Bacteria 6474
1194 Ga0207651_10738092 3300025960 Bacteria 870
1195 Ga0207651_10827572 3300025960 Bacteria 822
1196 Ga0207651_11099308 3300025960 Bacteria 712
1197 Ga0207712_10003733 3300025961 Bacteria 9614
1198 Ga0207712_10011358 3300025961 Bacteria 5674
1199 Ga0207712_10068985 3300025961 Bacteria 2535
1200 Ga0207712_10108368 3300025961 Bacteria 2078
1201 Ga0207712_10523654 3300025961 Bacteria 1016
1202 Ga0207712_10691242 3300025961 Bacteria 890
1203 Ga0207712_10734217 3300025961 Bacteria 864
1204 Ga0207668_10000033 3300025972 Bacteria 121080
1205 Ga0207668_10000403 3300025972 Bacteria 27203
1206 Ga0207668_10000620 3300025972 Bacteria 22083
1207 Ga0207668_10004688 3300025972 Bacteria 8043
1208 Ga0207668_10005395 3300025972 Bacteria 7527
1209 Ga0207668_10013122 3300025972 Bacteria 5092
1210 Ga0207668_10064519 3300025972 Bacteria 2588
1211 Ga0207668_10177129 3300025972 Bacteria 1678
1212 Ga0207668_10298211 3300025972 Bacteria 1329
1213 Ga0207668_10372637 3300025972 Bacteria 1199
1214 Ga0207668_10407814 3300025972 Bacteria 1150
1215 Ga0207668_10521861 3300025972 Bacteria 1025
1216 Ga0207668_10815345 3300025972 Bacteria 827
1217 Ga0207668_11184631 3300025972 Bacteria 686
1218 Ga0207640_10001288 3300025981 Bacteria 13632
1219 Ga0207640_10002534 3300025981 Bacteria 9792
1220 Ga0207640_10004079 3300025981 Bacteria 7893
1221 Ga0207640_10020742 3300025981 Bacteria 3905
1222 Ga0207640_10033791 3300025981 Bacteria 3185
1223 Ga0207640_10064291 3300025981 Bacteria 2442
1224 Ga0207640_10099354 3300025981 Bacteria 2037
1225 Ga0207640_11211206 3300025981 Bacteria 672
1226 Ga0207640_11415498 3300025981 Bacteria 623
1227 Ga0207658_10000737 3300025986 Bacteria 28241
1228 Ga0207658_10001017 3300025986 Bacteria 22871
1229 Ga0207658_10001740 3300025986 Bacteria 16408
1230 Ga0207658_10004840 3300025986 Bacteria 9306
1231 Ga0207658_10020333 3300025986 Bacteria 4596
1232 Ga0207658_10034101 3300025986 Bacteria 3635
1233 Ga0207658_10065651 3300025986 Bacteria 2727
1234 Ga0207658_10485692 3300025986 Bacteria 1098
1235 Ga0207658_10665284 3300025986 Bacteria 939
1236 Ga0207658_10899019 3300025986 Bacteria 806
1237 Ga0207658_11027688 3300025986 Bacteria 752
1238 Ga0207658_11291393 3300025986 Bacteria 667
1239 Ga0207677_10000043 3300026023 Bacteria 110161
1240 Ga0207677_10004385 3300026023 Bacteria 7562
1241 Ga0207677_10244171 3300026023 Bacteria 1454
1242 Ga0207677_10507965 3300026023 Bacteria 1043
1243 Ga0207677_10564414 3300026023 Bacteria 994
1244 Ga0207703_10000079 3300026035 Bacteria 112451
1245 Ga0207703_10003192 3300026035 Bacteria 13798
1246 Ga0207703_10003477 3300026035 Bacteria 13183
1247 Ga0207703_10008313 3300026035 Bacteria 8198
1248 Ga0207703_10019595 3300026035 Bacteria 5286
1249 Ga0207703_10043560 3300026035 Bacteria 3603
1250 Ga0207703_10044815 3300026035 Bacteria 3556
1251 Ga0207703_10285304 3300026035 Bacteria 1501
1252 Ga0207703_10287847 3300026035 Bacteria 1494
1253 Ga0207703_10438240 3300026035 Bacteria 1218
1254 Ga0207703_10452911 3300026035 Bacteria 1199
1255 Ga0207703_10534317 3300026035 Bacteria 1104
1256 Ga0207703_10728259 3300026035 Bacteria 944
1257 Ga0207703_11537737 3300026035 Bacteria 640
1258 Ga0207639_10002795 3300026041 Bacteria 11720
1259 Ga0207639_10016083 3300026041 Bacteria 5285
1260 Ga0207639_10037841 3300026041 Bacteria 3586
1261 Ga0207639_10362187 3300026041 Bacteria 1298
1262 Ga0207639_10787614 3300026041 Bacteria 885
1263 Ga0207639_11080696 3300026041 Bacteria 752
1264 Ga0207678_10000884 3300026067 Bacteria 27549
1265 Ga0207678_10001466 3300026067 Bacteria 21650
1266 Ga0207678_10034999 3300026067 Bacteria 4373
1267 Ga0207678_10134765 3300026067 Bacteria 2107
1268 Ga0207678_10272004 3300026067 Bacteria 1453
1269 Ga0207678_10787375 3300026067 Bacteria 839
1270 Ga0207678_11443500 3300026067 Bacteria 608
1271 Ga0207678_11454183 3300026067 Bacteria 605
1272 Ga0207708_10000785 3300026075 Bacteria 23946
1273 Ga0207708_10075845 3300026075 Bacteria 2578
1274 Ga0207708_10145397 3300026075 Bacteria 1863
1275 Ga0207708_10367232 3300026075 Bacteria 1184
1276 Ga0207708_10452388 3300026075 Bacteria 1070
1277 Ga0207708_11127932 3300026075 Bacteria 684
1278 Ga0207702_10001194 3300026078 Bacteria 26369
1279 Ga0207702_10012659 3300026078 Bacteria 7021
1280 Ga0207702_10014307 3300026078 Bacteria 6588
1281 Ga0207702_10033715 3300026078 Bacteria 4278
1282 Ga0207702_10051771 3300026078 Bacteria 3472
1283 Ga0207702_10058096 3300026078 Bacteria 3291
1284 Ga0207702_10123220 3300026078 Bacteria 2323
1285 Ga0207641_10000034 3300026088 Bacteria 217752
1286 Ga0207641_10000113 3300026088 Bacteria 119188
1287 Ga0207641_10001192 3300026088 Bacteria 26082
1288 Ga0207641_10005506 3300026088 Bacteria 10795
1289 Ga0207641_10040794 3300026088 Bacteria 3888
1290 Ga0207641_10092440 3300026088 Bacteria 2650
1291 Ga0207641_10132678 3300026088 Bacteria 2238
1292 Ga0207641_11189814 3300026088 Bacteria 762
1293 Ga0207641_11495290 3300026088 Bacteria 677
1294 Ga0207641_11594920 3300026088 Bacteria 654
1295 Ga0207648_10019921 3300026089 Bacteria 6054
1296 Ga0207648_10046864 3300026089 Bacteria 3790
1297 Ga0207648_10059376 3300026089 Bacteria 3336
1298 Ga0207648_10201266 3300026089 Bacteria 1766
1299 Ga0207676_10000103 3300026095 Bacteria 76865
1300 Ga0207676_10003461 3300026095 Bacteria 11169
1301 Ga0207676_10023358 3300026095 Bacteria 4561
1302 Ga0207676_10037206 3300026095 Bacteria 3707
1303 Ga0207676_10187021 3300026095 Bacteria 1819
1304 Ga0207676_10411528 3300026095 Bacteria 1266
1305 Ga0207676_10503127 3300026095 Bacteria 1151
1306 Ga0207676_10784422 3300026095 Bacteria 929
1307 Ga0207676_11201633 3300026095 Bacteria 751
1308 Ga0207674_10004708 3300026116 Bacteria 16359
1309 Ga0207674_10008209 3300026116 Bacteria 12100
1310 Ga0207674_10018149 3300026116 Bacteria 7655
1311 Ga0207674_10022498 3300026116 Bacteria 6767
1312 Ga0207674_10344010 3300026116 Bacteria 1442
1313 Ga0207674_10364107 3300026116 Bacteria 1398
1314 Ga0207674_10689739 3300026116 Bacteria 986
1315 Ga0207674_11311459 3300026116 Bacteria 693
1316 Ga0207674_11692586 3300026116 Bacteria 601
1317 Ga0207675_100000221 3300026118 Bacteria 53325
1318 Ga0207675_100000933 3300026118 Bacteria 29221
1319 Ga0207675_100032035 3300026118 Bacteria 4897
1320 Ga0207675_100048571 3300026118 Bacteria 3961
1321 Ga0207675_100551440 3300026118 Bacteria 1152
1322 Ga0207675_100927386 3300026118 Bacteria 888
1323 Ga0207675_101438004 3300026118 Bacteria 710
1324 Ga0207683_10000861 3300026121 Bacteria 27809
1325 Ga0207683_10457651 3300026121 Bacteria 1177
1326 Ga0207683_10468017 3300026121 Bacteria 1163
1327 Ga0207683_10704558 3300026121 Bacteria 936
1328 Ga0207683_10889630 3300026121 Bacteria 827
1329 Ga0207698_10023240 3300026142 Bacteria 4327
1330 Ga0207698_10042867 3300026142 Bacteria 3385
1331 Ga0207698_10493207 3300026142 Bacteria 1190
1332 Ga0207698_10498066 3300026142 Bacteria 1185
1333 Ga0207698_10534432 3300026142 Bacteria 1146
1334 Ga0207698_10538591 3300026142 Bacteria 1142
1335 Ga0207698_10731586 3300026142 Bacteria 987
1336 Ga0207698_10829874 3300026142 Bacteria 928
1337 Ga0207698_10917793 3300026142 Bacteria 883
1338 Ga0207698_11378092 3300026142 Bacteria 720
1339 Ga0209281_1035841 3300027111 Bacteria 860
1340 Ga0209281_1062390 3300027111 Bacteria 565
1341 Ga0209371_1057678 3300027312 Bacteria 723
1342 Ga0209969_1066951 3300027360 Bacteria 569
1343 Ga0209981_1009685 3300027378 Bacteria 1320
1344 Ga0209996_1056539 3300027395 Bacteria 599
1345 Ga0210000_1081151 3300027462 Bacteria 532
1346 Ga0209999_1005300 3300027543 Bacteria 2320
1347 Ga0209999_1067543 3300027543 Bacteria 684
1348 Ga0209983_1008334 3300027665 Bacteria 2119
1349 Ga0209983_1069405 3300027665 Bacteria 784
1350 Ga0209282_1254740 3300027666 Bacteria 772
1351 Ga0209998_10130355 3300027717 Bacteria 638
1352 Ga0209813_10000014 3300027866 Bacteria 87712
1353 Ga0209813_10000230 3300027866 Bacteria 17157
1354 Ga0209813_10006694 3300027866 Bacteria 2854
1355 Ga0209813_10008755 3300027866 Bacteria 2567
1356 Ga0209813_10020418 3300027866 Bacteria 1854
1357 Ga0209813_10077130 3300027866 Bacteria 1095
1358 Ga0209974_10007355 3300027876 Bacteria 3793
1359 Ga0209974_10013244 3300027876 Bacteria 2748
1360 Ga0209974_10312524 3300027876 Bacteria 603
1361 Ga0207428_10033106 3300027907 Bacteria 4247
1362 Ga0207428_10232679 3300027907 Bacteria 1379
1363 Ga0207428_10247950 3300027907 Bacteria 1329
1364 Ga0207428_10378638 3300027907 Bacteria 1038
1365 Ga0268266_10000002 3300028379 Bacteria 3059047
1366 Ga0268266_10000175 3300028379 Bacteria 115897
1367 Ga0268266_10002211 3300028379 Bacteria 21259
1368 Ga0268266_10002389 3300028379 Bacteria 20264
1369 Ga0268266_10003113 3300028379 Bacteria 16889
1370 Ga0268266_10029371 3300028379 Bacteria 4674
1371 Ga0268266_10067263 3300028379 Bacteria 3101
1372 Ga0268266_10068435 3300028379 Bacteria 3074
1373 Ga0268266_10110749 3300028379 Bacteria 2432
1374 Ga0268266_10130141 3300028379 Bacteria 2250
1375 Ga0268266_10139743 3300028379 Bacteria 2173
1376 Ga0268266_10314309 3300028379 Bacteria 1464
1377 Ga0268266_11339979 3300028379 Bacteria 691
1378 Ga0268266_11475120 3300028379 Bacteria 656
1379 Ga0268265_10000074 3300028380 Bacteria 127599
1380 Ga0268265_10006282 3300028380 Bacteria 8047
1381 Ga0268265_10012220 3300028380 Bacteria 5814
1382 Ga0268265_10023312 3300028380 Bacteria 4362
1383 Ga0268265_10035883 3300028380 Bacteria 3627
1384 Ga0268265_10140009 3300028380 Bacteria 2024
1385 Ga0268265_10178490 3300028380 Bacteria 1822
1386 Ga0268265_10401274 3300028380 Bacteria 1267
1387 Ga0268265_10627317 3300028380 Bacteria 1030
1388 Ga0268265_10925105 3300028380 Bacteria 857
1389 Ga0268265_11531053 3300028380 Bacteria 671
1390 Ga0268264_10000067 3300028381 Bacteria 284445
1391 Ga0268264_10000215 3300028381 Bacteria 113994
1392 Ga0268264_10013477 3300028381 Bacteria 6732
1393 Ga0268264_10015091 3300028381 Bacteria 6336
1394 Ga0268264_10024453 3300028381 Bacteria 4931
1395 Ga0268264_10039933 3300028381 Bacteria 3877
1396 Ga0268264_10068596 3300028381 Bacteria 2997
1397 Ga0268264_10191637 3300028381 Bacteria 1864
1398 Ga0268264_10333039 3300028381 Bacteria 1439
1399 Ga0268264_10664297 3300028381 Bacteria 1032
1400 Ga0268264_10732494 3300028381 Bacteria 984
1401 Ga0268264_10753907 3300028381 Bacteria 970
1402 Ga0268264_11707721 3300028381 Bacteria 640
1403 Ga0268264_12052361 3300028381 Bacteria 581
1404 Ga0265326_10024973 3300028558 Bacteria 1704
1405 Ga0265334_10044496 3300028573 Bacteria 1724
1406 Ga0307517_10097484 3300028786 Bacteria 2347
1407 Ga0307517_10143392 3300028786 Bacteria 1667
1408 Ga0265338_10010218 3300028800 Bacteria 11057
1409 Ga0265338_10011065 3300028800 Bacteria 10463
1410 Ga0268256_1064671 3300030500 Bacteria 723
1411 Ga0316177_1186482 3300030731 Bacteria 1480
1412 Ga0314311_1038512 3300030733 Bacteria 2891
1413 Ga0316182_1427119 3300030745 Bacteria 796
1414 Ga0265762_1040596 3300030760 Bacteria 910
1415 Ga0265766_1007313 3300030863 Bacteria 740
1416 Ga0265325_10072483 3300031241 Bacteria 1726
1417 Ga0265340_10060998 3300031247 Bacteria 1805
1418 Ga0265340_10503640 3300031247 Bacteria 533
1419 Ga0265339_10147493 3300031249 Bacteria 1192
1420 Ga0265331_10006566 3300031250 Bacteria 6858
1421 Ga0265327_10000454 3300031251 Bacteria 73503
1422 Ga0265327_10016302 3300031251 Bacteria 4727
1423 Ga0307513_10013182 3300031456 Bacteria 10155
1424 Ga0307513_10133646 3300031456 Bacteria 2421
1425 Ga0307513_10483897 3300031456 Bacteria 957
1426 Ga0307513_10640871 3300031456 Bacteria 770
1427 Ga0307513_10660788 3300031456 Bacteria 752
1428 Ga0307408_100004861 3300031548 Bacteria 9050
1429 Ga0307408_100049461 3300031548 Bacteria 3019
1430 Ga0307408_100205359 3300031548 Bacteria 1597
1431 Ga0307408_100345626 3300031548 Bacteria 1260
1432 Ga0307408_100531713 3300031548 Bacteria 1034
1433 Ga0265313_10022615 3300031595 Bacteria 3405
1434 Ga0307508_10000011 3300031616 Bacteria 248001
1435 Ga0307508_10217158 3300031616 Bacteria 1512
1436 Ga0316575_10083397 3300031665 Bacteria 1290
1437 Ga0316575_10169027 3300031665 Bacteria 906
1438 Ga0316579_10007369 3300031691 Bacteria 4542
1439 Ga0316579_10016916 3300031691 Bacteria 3193
1440 Ga0265314_10128194 3300031711 Bacteria 1586
1441 Ga0265314_10293885 3300031711 Bacteria 914
1442 Ga0265314_10526871 3300031711 Bacteria 618
1443 Ga0265342_10299559 3300031712 Bacteria 847
1444 Ga0316576_10403734 3300031727 Bacteria 1012
1445 Ga0316576_10504923 3300031727 Bacteria 889
1446 Ga0316576_10746205 3300031727 Bacteria 707
1447 Ga0316576_11027791 3300031727 Bacteria 586
1448 Ga0316578_10081398 3300031728 Bacteria 1926
1449 Ga0307516_10264534 3300031730 Bacteria 1409
1450 Ga0307516_10307958 3300031730 Bacteria 1258
1451 Ga0307405_10000196 3300031731 Bacteria 22239
1452 Ga0307405_10010011 3300031731 Bacteria 4889
1453 Ga0307405_10022461 3300031731 Bacteria 3567
1454 Ga0307405_10041042 3300031731 Bacteria 2806
1455 Ga0307405_10111030 3300031731 Bacteria 1857
1456 Ga0307405_10318671 3300031731 Bacteria 1187
1457 Ga0307405_10464827 3300031731 Bacteria 1006
1458 Ga0307405_10847687 3300031731 Bacteria 769
1459 Ga0307405_10964875 3300031731 Bacteria 725
1460 Ga0307405_11859349 3300031731 Bacteria 536
1461 Ga0316577_10044978 3300031733 Bacteria 2468
1462 Ga0316577_10264495 3300031733 Bacteria 973
1463 Ga0307413_10078911 3300031824 Bacteria 2102
1464 Ga0307413_10089977 3300031824 Bacteria 1996
1465 Ga0307413_10150544 3300031824 Bacteria 1621
1466 Ga0307413_10230820 3300031824 Bacteria 1359
1467 Ga0307413_10274293 3300031824 Bacteria 1264
1468 Ga0307413_10379746 3300031824 Bacteria 1100
1469 Ga0307413_10413584 3300031824 Bacteria 1060
1470 Ga0307413_10578605 3300031824 Bacteria 915
1471 Ga0307413_10733319 3300031824 Bacteria 824
1472 Ga0307413_11031583 3300031824 Bacteria 707
1473 Ga0307413_12063674 3300031824 Bacteria 515
1474 Ga0307410_10009373 3300031852 Bacteria 5488
1475 Ga0307410_10011923 3300031852 Bacteria 4997
1476 Ga0307410_10015917 3300031852 Bacteria 4471
1477 Ga0307410_10303638 3300031852 Bacteria 1260
1478 Ga0307410_10380611 3300031852 Bacteria 1135
1479 Ga0307410_10406987 3300031852 Bacteria 1100
1480 Ga0307410_10595253 3300031852 Bacteria 922
1481 Ga0307410_10640323 3300031852 Bacteria 891
1482 Ga0307410_11592286 3300031852 Bacteria 577
1483 Ga0307410_12142697 3300031852 Bacteria 500
1484 Ga0307406_10001425 3300031901 Bacteria 13250
1485 Ga0307406_10051708 3300031901 Bacteria 2610
1486 Ga0307406_10083387 3300031901 Bacteria 2131
1487 Ga0307406_10146427 3300031901 Bacteria 1679
1488 Ga0307406_10258244 3300031901 Bacteria 1316
1489 Ga0307406_10495425 3300031901 Bacteria 989
1490 Ga0307406_10804140 3300031901 Bacteria 794
1491 Ga0307407_10132995 3300031903 Bacteria 1594
1492 Ga0307407_10321829 3300031903 Bacteria 1085
1493 Ga0307407_10464876 3300031903 Bacteria 921
1494 Ga0307407_10481382 3300031903 Bacteria 906
1495 Ga0307407_10575746 3300031903 Bacteria 835
1496 Ga0307407_10942369 3300031903 Bacteria 664
1497 Ga0307412_10016048 3300031911 Bacteria 4451
1498 Ga0307412_10020098 3300031911 Bacteria 4058
1499 Ga0307412_10024329 3300031911 Bacteria 3738
1500 Ga0307412_10029631 3300031911 Bacteria 3437
1501 Ga0307412_10060113 3300031911 Bacteria 2549
1502 Ga0307412_10085252 3300031911 Bacteria 2195
1503 Ga0307412_10212445 3300031911 Bacteria 1477
1504 Ga0307412_10496938 3300031911 Bacteria 1015
1505 Ga0307412_10499734 3300031911 Bacteria 1012
1506 Ga0307412_10500432 3300031911 Bacteria 1011
1507 Ga0307412_10501543 3300031911 Bacteria 1010
1508 Ga0307412_10673017 3300031911 Bacteria 885
1509 Ga0307409_100010502 3300031995 Bacteria 5763
1510 Ga0307409_100049412 3300031995 Bacteria 3207
1511 Ga0307409_100121708 3300031995 Bacteria 2211
1512 Ga0307409_100253909 3300031995 Bacteria 1609
1513 Ga0307409_100483059 3300031995 Bacteria 1202
1514 Ga0307409_100498590 3300031995 Bacteria 1185
1515 Ga0307409_101042606 3300031995 Bacteria 837
1516 Ga0307409_101184418 3300031995 Bacteria 787
1517 Ga0307409_101743755 3300031995 Bacteria 652
1518 Ga0307409_101823183 3300031995 Bacteria 637
1519 Ga0307409_102434774 3300031995 Bacteria 552
1520 Ga0307416_100029861 3300032002 Bacteria 4080
1521 Ga0307416_100101817 3300032002 Bacteria 2502
1522 Ga0307416_100116550 3300032002 Bacteria 2368
1523 Ga0307416_100313124 3300032002 Bacteria 1567
1524 Ga0307416_100439929 3300032002 Bacteria 1354
1525 Ga0307416_100870387 3300032002 Bacteria 1000
1526 Ga0307416_101362775 3300032002 Bacteria 815
1527 Ga0307416_101746545 3300032002 Bacteria 726
1528 Ga0307416_101867127 3300032002 Bacteria 704
1529 Ga0307416_102513524 3300032002 Bacteria 613
1530 Ga0307414_10000371 3300032004 Bacteria 24637
1531 Ga0307414_10004614 3300032004 Bacteria 7494
1532 Ga0307414_10008100 3300032004 Bacteria 5937
1533 Ga0307414_10027055 3300032004 Bacteria 3700
1534 Ga0307414_10035772 3300032004 Bacteria 3308
1535 Ga0307414_10069418 3300032004 Bacteria 2533
1536 Ga0307414_10087115 3300032004 Bacteria 2306
1537 Ga0307414_10096364 3300032004 Bacteria 2213
1538 Ga0307414_10104259 3300032004 Bacteria 2141
1539 Ga0307414_10148592 3300032004 Bacteria 1845
1540 Ga0307414_10183494 3300032004 Bacteria 1685
1541 Ga0307414_10192892 3300032004 Bacteria 1650
1542 Ga0307414_10226868 3300032004 Bacteria 1537
1543 Ga0307414_10386670 3300032004 Bacteria 1211
1544 Ga0307414_10529256 3300032004 Bacteria 1047
1545 Ga0307414_10717603 3300032004 Bacteria 906
1546 Ga0307414_11388803 3300032004 Bacteria 652
1547 Ga0307414_12036146 3300032004 Bacteria 536
1548 Ga0307414_12092507 3300032004 Bacteria 528
1549 Ga0307411_10029626 3300032005 Bacteria 3346
1550 Ga0307411_10037350 3300032005 Bacteria 3053
1551 Ga0307411_10072538 3300032005 Bacteria 2338
1552 Ga0307411_10133316 3300032005 Bacteria 1819
1553 Ga0307411_10191465 3300032005 Bacteria 1562
1554 Ga0307411_10511312 3300032005 Bacteria 1017
1555 Ga0307411_10582115 3300032005 Bacteria 960
1556 Ga0307411_10665199 3300032005 Bacteria 903
1557 Ga0307411_10759396 3300032005 Bacteria 850
1558 Ga0307411_11016560 3300032005 Bacteria 743
1559 Ga0307411_12118556 3300032005 Bacteria 526
1560 Ga0307415_100191609 3300032126 Bacteria 1614
1561 Ga0307415_100211944 3300032126 Bacteria 1546
1562 Ga0307415_100499301 3300032126 Bacteria 1063
1563 Ga0307415_100501856 3300032126 Bacteria 1061
1564 Ga0307415_100524571 3300032126 Bacteria 1040
1565 Ga0307415_101203147 3300032126 Bacteria 714
1566 Ga0307415_101279797 3300032126 Bacteria 694
1567 Ga0307415_101749277 3300032126 Bacteria 600
1568 Ga0316580_10117988 3300032139 Bacteria 812
1569 Ga0316593_10033954 3300032168 Bacteria 1672
1570 Ga0307510_10155235 3300033180 Bacteria 1897
1571 Ga0316592_1054171 3300033524 Bacteria 897
1572 Ga0316588_1049789 3300033528 Bacteria 1014
1573 Ga0316588_1121282 3300033528 Bacteria 662
1574 Ga0316596_1021836 3300033541 Bacteria 1634
1575 Ga0316596_1081013 3300033541 Bacteria 873
1576 Ga0373948_0006065 3300034817 Bacteria 1983
1577 Ga0373938_0090470 3300034957 Bacteria 756
1578 Ga0373928_0026493 3300035084 Bacteria 1256
1579 Ga0373929_0027435 3300035085 Bacteria 1196
1580 Ga0373929_0042826 3300035085 Bacteria 1011
1581 Ga0373929_0096835 3300035085 Bacteria 739
1582 Ga0373929_0247468 3300035085 Bacteria 516
1583 Ga0373940_0003431 3300035088 Bacteria 3237
1584 Ga0373951_0150911 3300035091 Bacteria 651
1585 Ga0373952_0031133 3300035092 Bacteria 1185
1586 Ga0373923_0342435 3300035111 Bacteria 713
1587 Ga0373932_0180066 3300035112 Bacteria 741
1588 Ga0373939_0005439 3300035114 Bacteria 3034
1589 Ga0373939_0391762 3300035114 Bacteria 574
1590 Ga0373939_0424902 3300035114 Bacteria 555
1591 Ga0373941_0000122 3300035115 Bacteria 13384
1592 Ga0373941_0012044 3300035115 Bacteria 2251
1593 Ga0373941_0186789 3300035115 Bacteria 781
1594 Ga0373956_0581413 3300035119 Bacteria 535
1595 Ga0373957_0273689 3300035120 Bacteria 713
1596 Ga0373960_0005313 3300035121 Bacteria 2978
1597 Ga0373960_0111217 3300035121 Bacteria 899
1598 Ga0373960_0287076 3300035121 Bacteria 608
1599 Ga0373942_0058443 3300035207 Bacteria 1099
1600 Ga0373961_0006874 3300035241 Bacteria 2737
1601 Ga0373962_0019956 3300035242 Bacteria 1756
1602 Ga0373962_0146685 3300035242 Bacteria 770
1603 Ga0316574_0037577 3300035398 Bacteria 2970
1604 Ga0316574_0322702 3300035398 Bacteria 980
1605 Ga0373924_0404487 3300035410 Bacteria 610
1606 Ga0373931_0005809 3300035691 Bacteria 5740
1607 Ga0373931_0007458 3300035691 Bacteria 5153
1608 Ga0373931_0017420 3300035691 Bacteria 3553
1609 Ga0373931_0034633 3300035691 Bacteria 2622
1610 Ga0373931_0462120 3300035691 Bacteria 813
1611 Ga0373931_0975101 3300035691 Bacteria 573
1612 Ga0373931_0986633 3300035691 Bacteria 569
1613 Ga0373935_0793286 3300035692 Bacteria 699
1614 Ga0373927_0279401 3300035695 Bacteria 1098
1615 Ga0373927_0613566 3300035695 Bacteria 719
1616 Ga0373933_0335654 3300035724 Bacteria 981
1617 Ga0373947_0421765 3300035725 Bacteria 902
1618 Ga0373947_0708922 3300035725 Bacteria 687
1619 Ga0373947_1029478 3300035725 Bacteria 562
1620 Ga0373937_0756978 3300036401 Bacteria 919
1621 Ga0373937_0767158 3300036401 Bacteria 912
1622 Ga0373937_1269106 3300036401 Bacteria 685
1623 Ga0316582_0014084 3300036647 Bacteria 4528
1624 Ga0316584_0012127 3300036712 Bacteria 6073
1625 Ga0316584_0075207 3300036712 Bacteria 2532
1626 Ga0316584_0124021 3300036712 Bacteria 1929
1627 Ga0316584_0354608 3300036712 Bacteria 1053
1628 Ga0395899_0004516 3300037312 Bacteria 10849
1629 Ga0395899_0009175 3300037312 Bacteria 7595
1630 Ga0395899_0058394 3300037312 Bacteria 2845
1631 Ga0395899_0065715 3300037312 Bacteria 2665
1632 Ga0395899_0092715 3300037312 Bacteria 2187
1633 Ga0395900_0001724 3300037418 Bacteria 25250
1634 Ga0395900_0038265 3300037418 Bacteria 4944
1635 Ga0395900_0085349 3300037418 Bacteria 3244
1636 Ga0395900_0088445 3300037418 Bacteria 3184
1637 Ga0395900_0301128 3300037418 Bacteria 1589
1638 Ga0395900_0386171 3300037418 Bacteria 1367
1639 Ga0395900_0499091 3300037418 Bacteria 1167
1640 Ga0395898_0157878 3300037466 Bacteria 2169
1641 Ga0395898_0221767 3300037466 Bacteria 1803
1642 Ga0395898_0534956 3300037466 Bacteria 1113
1643 Ga0395905_0000608 3300037471 Bacteria 47958
1644 Ga0395905_0001310 3300037471 Bacteria 30585
1645 Ga0395905_0068245 3300037471 Bacteria 3331
1646 Ga0395905_1239144 3300037471 Bacteria 650
1647 Ga0395905_1491671 3300037471 Bacteria 580
1648 Ga0316581_0042912 3300037588 Bacteria 1380
1649 Ga0316581_0049060 3300037588 Bacteria 1292
1650 Ga0436364_0084899 3300037853 Bacteria 904
1651 Ga0436364_0222939 3300037853 Bacteria 956
1652 Ga0436364_1178388 3300037853 Bacteria 790
1653 Ga0436364_1497021 3300037853 Bacteria 586
1654 Ga0436364_1558455 3300037853 Bacteria 3181
1655 Ga0395901_0077970 3300038443 Bacteria 3458
1656 Ga0395901_0124118 3300038443 Bacteria 2713
1657 Ga0395901_0189909 3300038443 Bacteria 2154
1658 Ga0395901_0217858 3300038443 Bacteria 1996
1659 Ga0395901_0354199 3300038443 Bacteria 1514
1660 Ga0242420_003405 3300038996 Bacteria 2348
1661 Ga0400483_067380 3300039062 Bacteria 3443
1662 Ga0400483_068661 3300039062 Bacteria 1414
1663 Ga0400483_173078 3300039062 Bacteria 2102
1664 Ga0400483_180542 3300039062 Bacteria 1549
1665 Ga0400483_204874 3300039062 Bacteria 1569
1666 Ga0436365_0105609 3300039437 Bacteria 6219
1667 Ga0436365_0331130 3300039437 Bacteria 1043
1668 Ga0436365_0614931 3300039437 Bacteria 537
1669 Ga0436365_0926226 3300039437 Bacteria 665
1670 Ga0436365_1426025 3300039437 Bacteria 31887
1671 Ga0436365_1472042 3300039437 Bacteria 506
1672 Ga0436365_1924518 3300039437 Bacteria 7094
1673 Ga0436360_0160866 3300039438 Bacteria 1398
1674 Ga0436360_0343032 3300039438 Bacteria 551
1675 Ga0436360_0349025 3300039438 Bacteria 1682
1676 Ga0436360_0374078 3300039438 Bacteria 1879
1677 Ga0436360_1022661 3300039438 Bacteria 552
1678 Ga0436360_1036016 3300039438 Bacteria 3942
1679 Ga0436361_0696162 3300039447 Bacteria 4324
1680 Ga0436361_0738968 3300039447 Bacteria 605
1681 Ga0436361_0777262 3300039447 Bacteria 2722
1682 Ga0436361_1026066 3300039447 Bacteria 738
1683 Ga0436363_0381568 3300039450 Bacteria 1460
1684 Ga0436363_0564773 3300039450 Bacteria 526
1685 Ga0436363_1349972 3300039450 Bacteria 5207
1686 Ga0436363_1573256 3300039450 Bacteria 882
1687 Ga0436363_1597741 3300039450 Bacteria 870
1688 Ga0436362_0064393 3300039453 Bacteria 507
1689 Ga0436362_0215979 3300039453 Bacteria 754
1690 Ga0436362_0526587 3300039453 Bacteria 649
1691 Ga0436362_0535229 3300039453 Bacteria 540
1692 Ga0436362_0567947 3300039453 Bacteria 817
1693 Ga0436362_0634200 3300039453 Bacteria 922
1694 Ga0436362_0835643 3300039453 Bacteria 802
1695 Ga0436362_1034769 3300039453 Bacteria 1538
1696 Ga0436362_1285925 3300039453 Bacteria 714
1697 Ga0439436_0064552 3300041404 Bacteria 1023
1698 Ga0439439_0005078 3300041406 Bacteria 2992
1699 Ga0439447_059227 3300041407 Bacteria 903
1700 Ga0439461_0010778 3300041410 Bacteria 1684
1701 Ga0439466_0019806 3300041411 Bacteria 2405
1702 Ga0439465_0001868 3300041413 Bacteria 6883
1703 Ga0439465_0003473 3300041413 Bacteria 5139
1704 Ga0451789_0509383 3300041443 Bacteria 541
1705 Ga0451789_0762327 3300041443 Bacteria 1424
1706 Ga0451790_26137 3300041444 Bacteria 617
1707 Ga0451792_07864 3300041445 Bacteria 679
1708 Ga0451794_20066 3300041446 Bacteria 807
1709 Ga0451794_34299 3300041446 Bacteria 654
1710 Ga0451791_1586556 3300041451 Bacteria 865
1711 Ga0451791_1679327 3300041451 Bacteria 653
1712 Ga0451793_0354107 3300041452 Bacteria 828
1713 Ga0451793_0668171 3300041452 Bacteria 571
1714 Ga0451797_1467030 3300041453 Bacteria 1188
1715 Ga0451801_34670 3300041455 Bacteria 848
1716 Ga0451798_0032465 3300041458 Bacteria 571
1717 Ga0451798_0965105 3300041458 Bacteria 614
1718 Ga0451800_1517120 3300041459 Bacteria 687
1719 Ga0451802_0200424 3300041460 Bacteria 651
1720 Ga0451802_0604284 3300041460 Bacteria 538
1721 Ga0451802_1735810 3300041460 Bacteria 612
1722 Ga0451806_501791 3300041462 Bacteria 806
1723 Ga0451804_0497676 3300041463 Bacteria 658
1724 Ga0451804_0831235 3300041463 Bacteria 930
1725 Ga0451807_0346685 3300041486 Bacteria 1035
1726 Ga0451807_1013799 3300041486 Bacteria 504
1727 Ga0451833_0170114 3300041491 Bacteria 748
1728 Ga0451835_0912455 3300041492 Bacteria 727
1729 Ga0451841_0666561 3300041498 Bacteria 1353
1730 Ga0451841_0761262 3300041498 Bacteria 630
1731 Ga0451841_1387938 3300041498 Bacteria 941
1732 Ga0451845_0989282 3300041501 Bacteria 575
1733 Ga0451849_0506178 3300041505 Bacteria 916
1734 Ga0451849_1361625 3300041505 Bacteria 518
1735 Ga0451851_1228336 3300041507 Bacteria 632
1736 Ga0451843_1470911 3300041509 Bacteria 679
1737 Ga0451855_0483205 3300041511 Bacteria 535
1738 Ga0451855_1086033 3300041511 Bacteria 742
1739 Ga0451853_0214658 3300041512 Bacteria 544
1740 Ga0451853_2334469 3300041512 Bacteria 771
1741 Ga0451853_3229958 3300041512 Bacteria 1671
1742 Ga0439431_0000104 3300041997 Bacteria 14348
1743 Ga0439431_0003546 3300041997 Bacteria 3442
1744 Ga0439442_000783 3300042002 Bacteria 6617
1745 Ga0439443_030922 3300042003 Bacteria 882
1746 Ga0439445_0001513 3300042004 Bacteria 5051
1747 Ga0439445_0025857 3300042004 Bacteria 1499
1748 Ga0439445_0093162 3300042004 Bacteria 850
1749 Ga0439432_001274 3300042006 Bacteria 9538
1750 Ga0439432_018010 3300042006 Bacteria 2364
1751 Ga0439452_022629 3300042010 Bacteria 1624
1752 Ga0439457_005922 3300042014 Bacteria 3026
1753 Ga0439462_0000844 3300042015 Bacteria 6416
1754 Ga0439462_0002785 3300042015 Bacteria 4113
1755 Ga0439462_0012289 3300042015 Bacteria 2186
1756 Ga0450912_022816 3300042116 Bacteria 614
1757 Ga0450923_025883 3300042125 Bacteria 1172
1758 Ga0450888_078432 3300042126 Bacteria 505
1759 Ga0450898_033574 3300042134 Bacteria 950
1760 Ga0450889_000023 3300042144 Bacteria 13616
1761 Ga0439446_0145781 3300042156 Bacteria 776
1762 Ga0450909_009470 3300042185 Bacteria 1422
1763 Ga0439434_0005357 3300042435 Bacteria 3755
1764 Ga0439434_0098487 3300042435 Bacteria 940
1765 Ga0439435_0009252 3300042436 Bacteria 2307
1766 Ga0439435_0193719 3300042436 Bacteria 668
1767 Ga0439459_0050109 3300042438 Bacteria 914
1768 Ga0439459_0053607 3300042438 Bacteria 893
1769 Ga0451577_1620962 3300042876 Bacteria 570
1770 Ga0466969_0010778 3300044656 Bacteria 4842
1771 Ga0466969_0091069 3300044656 Bacteria 1445
1772 Ga0466965_0545941 3300044683 Bacteria 654
1773 Ga0466966_0000021 3300044684 Bacteria 116714
1774 Ga0466966_0001996 3300044684 Bacteria 13224
1775 Ga0466966_0003640 3300044684 Bacteria 10171
1776 Ga0466966_0738248 3300044684 Bacteria 593
1777 Ga0466961_0008264 3300044693 Bacteria 6630
1778 Ga0466963_0016990 3300044694 Bacteria 4532
1779 Ga0466963_0254291 3300044694 Bacteria 1233
1780 Ga0466964_0460823 3300044706 Bacteria 676
1781 Ga0453684_0000018 3300044712 Bacteria 921850
1782 Ga0453684_0299680 3300044712 Bacteria 1827
1783 Ga0453684_0658612 3300044712 Bacteria 1142
1784 Ga0453684_2537308 3300044712 Bacteria 505
1785 Ga0466971_0000846 3300044719 Bacteria 12460
1786 Ga0466971_0147659 3300044719 Bacteria 1097
1787 Ga0466970_0006718 3300044765 Bacteria 5756
1788 Ga0466970_0521680 3300044765 Bacteria 685
1789 Ga0466957_0002162 3300044842 Bacteria 10524
1790 Ga0466957_0826159 3300044842 Bacteria 659
1791 Ga0466959_0006500 3300045049 Bacteria 8102
1792 Ga0466959_0013668 3300045049 Bacteria 5890
1793 Ga0466959_0038377 3300045049 Bacteria 3539
1794 Ga0466959_0240105 3300045049 Bacteria 1252
1795 Ga0451576_0000024 3300045051 Bacteria 470499
1796 Ga0451576_0001525 3300045051 Bacteria 38988
1797 Ga0451576_0015898 3300045051 Bacteria 8320
1798 Ga0451576_0049961 3300045051 Bacteria 4388
1799 Ga0451576_0104195 3300045051 Bacteria 2951
1800 Ga0451576_1337580 3300045051 Bacteria 746
1801 Ga0451576_2738626 3300045051 Bacteria 502
1802 Ga0466958_0009405 3300045836 Bacteria 5446
1803 Ga0466958_0110375 3300045836 Bacteria 1717
1804 Ga0466967_0825658 3300045976 Bacteria 921
1805 Ga0495617_005172 3300046452 Bacteria 4658
1806 Ga0495627_000295 3300046453 Bacteria 49392
1807 Ga0495627_000507 3300046453 Bacteria 32459
1808 Ga0495627_000928 3300046453 Bacteria 20202
1809 Ga0495627_017826 3300046453 Bacteria 2405
1810 Ga0495627_110900 3300046453 Bacteria 779
1811 Ga0495629_0452251 3300046459 Bacteria 869
1812 Ga0495638_0000207 3300046460 Bacteria 83805
1813 Ga0495638_0143540 3300046460 Bacteria 1391
1814 Ga0495638_0151305 3300046460 Bacteria 1346
1815 Ga0495638_0158058 3300046460 Bacteria 1310
1816 Ga0495638_0351577 3300046460 Bacteria 778
1817 Ga0495638_0408671 3300046460 Bacteria 703
1818 Ga0495641_0500518 3300046461 Bacteria 554
1819 Ga0495651_0217711 3300046462 Bacteria 1324
1820 Ga0495650_0004608 3300046471 Bacteria 9356
1821 Ga0495650_0047173 3300046471 Bacteria 1803
1822 Ga0495650_0303078 3300046471 Bacteria 534
1823 Ga0495580_0035969 3300046472 Bacteria 3559
1824 Ga0495580_0617920 3300046472 Bacteria 715
1825 Ga0495582_0198735 3300046473 Bacteria 1145
1826 Ga0495605_0088630 3300046474 Bacteria 1437
1827 Ga0495639_0266775 3300046475 Bacteria 849
1828 Ga0495639_0267650 3300046475 Bacteria 848
1829 Ga0495639_0431714 3300046475 Bacteria 668
1830 Ga0495664_0412313 3300046477 Bacteria 811
1831 Ga0495584_0056669 3300046491 Bacteria 1972
1832 Ga0495585_0119990 3300046492 Bacteria 1391
1833 Ga0495594_0126085 3300046499 Bacteria 1449
1834 Ga0495596_0000153 3300046500 Bacteria 47822
1835 Ga0495596_0000154 3300046500 Bacteria 47820
1836 Ga0495596_0201578 3300046500 Bacteria 773
1837 Ga0495607_0009022 3300046501 Bacteria 6780
1838 Ga0495583_0085714 3300046506 Bacteria 1363
1839 Ga0495583_0183298 3300046506 Bacteria 856
1840 Ga0495606_0009651 3300046507 Bacteria 8129
1841 Ga0495606_0169262 3300046507 Bacteria 1269
1842 Ga0495610_0000015 3300046512 Bacteria 391489
1843 Ga0495610_0000102 3300046512 Bacteria 98985
1844 Ga0495610_0001230 3300046512 Bacteria 23022
1845 Ga0495610_0001618 3300046512 Bacteria 19803
1846 Ga0495610_0048245 3300046512 Bacteria 2091
1847 Ga0495610_0143157 3300046512 Bacteria 1027
1848 Ga0495610_0173077 3300046512 Bacteria 904
1849 Ga0495610_0350328 3300046512 Bacteria 556
1850 Ga0495618_0448869 3300046514 Bacteria 783
1851 Ga0495620_0007378 3300046515 Bacteria 5977
1852 Ga0495620_0158030 3300046515 Bacteria 882
1853 Ga0495630_0523333 3300046517 Bacteria 909
1854 Ga0495631_0026605 3300046518 Bacteria 2654
1855 Ga0495631_0369642 3300046518 Bacteria 610
1856 Ga0495632_0000013 3300046519 Bacteria 247879
1857 Ga0495632_0004141 3300046519 Bacteria 9961
1858 Ga0495632_0142646 3300046519 Bacteria 1110
1859 Ga0495632_0144521 3300046519 Bacteria 1102
1860 Ga0495637_0000336 3300046520 Bacteria 36345
1861 Ga0495637_0002839 3300046520 Bacteria 9394
1862 Ga0495637_0092301 3300046520 Bacteria 1193
1863 Ga0495643_0000010 3300046522 Bacteria 341431
1864 Ga0495643_0000080 3300046522 Bacteria 161872
1865 Ga0495643_0001635 3300046522 Bacteria 19778
1866 Ga0495643_0005120 3300046522 Bacteria 8965
1867 Ga0495643_0018560 3300046522 Bacteria 4039
1868 Ga0495643_0039818 3300046522 Bacteria 2569
1869 Ga0495643_0145927 3300046522 Bacteria 1176
1870 Ga0495644_0198558 3300046523 Bacteria 773
1871 Ga0495648_0018736 3300046524 Bacteria 4887
1872 Ga0495648_0045425 3300046524 Bacteria 2732
1873 Ga0495663_0000004 3300046525 Bacteria 355166
1874 Ga0495663_0063329 3300046525 Bacteria 1166
1875 Ga0495663_0133121 3300046525 Bacteria 840
1876 Ga0495642_0058469 3300046528 Bacteria 1596
1877 Ga0495652_0275174 3300046529 Bacteria 1235
1878 Ga0495654_0038375 3300046530 Bacteria 2396
1879 Ga0495654_0272704 3300046530 Bacteria 698
1880 Ga0495665_0047755 3300046531 Bacteria 2271
1881 Ga0495640_0155677 3300046533 Bacteria 1467
1882 Ga0495586_0042387 3300046535 Bacteria 2451
1883 Ga0495586_0700630 3300046535 Bacteria 585
1884 Ga0495587_0093132 3300046536 Bacteria 1740
1885 Ga0495598_0013519 3300046537 Bacteria 2025
1886 Ga0495609_0001714 3300046538 Bacteria 14212
1887 Ga0495609_0014892 3300046538 Bacteria 3649
1888 Ga0495621_0066212 3300046539 Bacteria 1321
1889 Ga0495621_0465570 3300046539 Bacteria 542
1890 Ga0495597_0001366 3300046542 Bacteria 17637
1891 Ga0495622_0002718 3300046557 Bacteria 8469
1892 Ga0495633_0000092 3300046558 Bacteria 121446
1893 Ga0495633_0001239 3300046558 Bacteria 20410
1894 Ga0495633_0009946 3300046558 Bacteria 5222
1895 Ga0495633_0042220 3300046558 Bacteria 2167
1896 Ga0495667_0192194 3300046559 Bacteria 1308
1897 Ga0495656_0508253 3300046615 Bacteria 639
1898 Ga0495668_0000087 3300046616 Bacteria 151819
1899 Ga0495668_0056696 3300046616 Bacteria 2162
1900 Ga0495668_0060236 3300046616 Bacteria 2094
1901 Ga0495668_0168756 3300046616 Bacteria 1199
1902 Ga0495668_0268427 3300046616 Bacteria 934
1903 Ga0495668_0423788 3300046616 Bacteria 732
1904 Ga0495668_0442675 3300046616 Bacteria 715
1905 Ga0495668_0660372 3300046616 Bacteria 578
1906 Ga0495634_0209916 3300046642 Bacteria 1206
1907 Ga0495625_0000275 3300046660 Bacteria 80062
1908 Ga0495625_0001182 3300046660 Bacteria 33512
1909 Ga0495625_0137896 3300046660 Bacteria 1647
1910 Ga0495625_0151972 3300046660 Bacteria 1556
1911 Ga0495625_0371219 3300046660 Bacteria 900
1912 Ga0495625_0502195 3300046660 Bacteria 741
1913 Ga0495635_0109018 3300046663 Bacteria 1892
1914 Ga0495661_0039270 3300046665 Bacteria 2942
1915 Ga0495657_0257287 3300046675 Bacteria 1050
1916 Ga0495669_0276085 3300046684 Bacteria 808
1917 Ga0495613_0181570 3300046689 Bacteria 1490
1918 Ga0495670_0000010 3300046691 Bacteria 174071
1919 Ga0495670_0019654 3300046691 Bacteria 3329
1920 Ga0495671_0000014 3300046692 Bacteria 341431
1921 Ga0495649_0277269 3300046694 Bacteria 857
1922 Ga0495600_0464772 3300046809 Bacteria 781
1923 Ga0495604_0234463 3300047317 Bacteria 1258
1924 Ga0495674_0215529 3300047319 Bacteria 1589
1925 Ga0495672_0000949 3300047320 Bacteria 30213
1926 Ga0495672_0105363 3300047320 Bacteria 1522
1927 Ga0495676_0980730 3300047321 Bacteria 540
1928 Ga0495683_0171932 3300047323 Bacteria 995
1929 Ga0495683_0329538 3300047323 Bacteria 649
1930 Ga0495687_070086 3300047443 Bacteria 1409
1931 Ga0495675_0511700 3300047444 Bacteria 688
1932 Ga0495673_0143742 3300047469 Bacteria 928
1933 Ga0495673_0170489 3300047469 Bacteria 830
1934 Ga0495681_0000046 3300047470 Bacteria 111547
1935 Ga0495681_0000062 3300047470 Bacteria 99851
1936 Ga0495681_0024722 3300047470 Bacteria 3155
1937 Ga0495681_0111775 3300047470 Bacteria 1182
1938 Ga0495681_0207630 3300047470 Bacteria 791
1939 Ga0495681_0241178 3300047470 Bacteria 717
1940 Ga0495686_0000354 3300047472 Bacteria 75066
1941 Ga0495686_0006459 3300047472 Bacteria 8969
1942 Ga0495686_0017144 3300047472 Bacteria 4889
1943 Ga0495686_0023999 3300047472 Bacteria 4011
1944 Ga0495686_0214633 3300047472 Bacteria 1097
1945 Ga0495593_0132220 3300047673 Bacteria 1266
1946 Ga0495602_0544390 3300048088 Bacteria 805
1947 Ga0495602_0601516 3300048088 Bacteria 756
1948 Ga0495614_0330860 3300048089 Bacteria 708
1949 Ga0495615_0000114 3300048090 Bacteria 20560
1950 Ga0495626_0000459 3300048091 Bacteria 41540
1951 Ga0496100_0000708 3300048903 Bacteria 15932
1952 Ga0496100_0012625 3300048903 Bacteria 4848
1953 Ga0496100_0088978 3300048903 Bacteria 2102
1954 Ga0496100_0738193 3300048903 Bacteria 769
1955 Ga0496100_0739231 3300048903 Bacteria 769
1956 Ga0496100_0784641 3300048903 Bacteria 746
1957 Ga0496100_1222405 3300048903 Bacteria 593
1958 Ga0496101_0003342 3300048904 Bacteria 9992
1959 Ga0496101_0006157 3300048904 Bacteria 7705
1960 Ga0496101_0072704 3300048904 Bacteria 2524
1961 Ga0496101_0171874 3300048904 Bacteria 1666
1962 Ga0496101_0172161 3300048904 Bacteria 1664
1963 Ga0496101_0269458 3300048904 Bacteria 1329
1964 Ga0496101_0699349 3300048904 Bacteria 800
1965 Ga0496102_0002803 3300048905 Bacteria 14861
1966 Ga0496102_0150254 3300048905 Bacteria 2188
1967 Ga0496102_0246461 3300048905 Bacteria 1684
1968 Ga0496102_0263736 3300048905 Bacteria 1624
1969 Ga0496102_0456756 3300048905 Bacteria 1198
1970 Ga0496102_0792194 3300048905 Bacteria 870
1971 Ga0496102_0835597 3300048905 Bacteria 843
1972 Ga0496103_0001927 3300048906 Bacteria 13444
1973 Ga0496103_0025181 3300048906 Bacteria 3595
1974 Ga0496103_0031156 3300048906 Bacteria 3248
1975 Ga0496103_0032759 3300048906 Bacteria 3173
1976 Ga0496103_0166053 3300048906 Bacteria 1416
1977 Ga0496103_0209714 3300048906 Bacteria 1253
1978 Ga0496104_0000521 3300048907 Bacteria 32903
1979 Ga0496104_0034766 3300048907 Bacteria 4700
1980 Ga0496104_0045446 3300048907 Bacteria 4130
1981 Ga0496104_0075540 3300048907 Bacteria 3208
1982 Ga0496104_0081421 3300048907 Bacteria 3087
1983 Ga0496104_0105804 3300048907 Bacteria 2696
1984 Ga0496104_0123318 3300048907 Bacteria 2487
1985 Ga0496104_0384608 3300048907 Bacteria 1316
1986 Ga0496104_0620043 3300048907 Bacteria 991
1987 Ga0496104_1507275 3300048907 Bacteria 575
1988 Ga0496105_0000224 3300048908 Bacteria 38048
1989 Ga0496105_0004218 3300048908 Bacteria 10799
1990 Ga0496105_0017714 3300048908 Bacteria 5715
1991 Ga0496105_0023279 3300048908 Bacteria 5022
1992 Ga0496105_0045068 3300048908 Bacteria 3639
1993 Ga0496105_0073984 3300048908 Bacteria 2814
1994 Ga0496105_0245083 3300048908 Bacteria 1453
1995 Ga0496105_0535018 3300048908 Bacteria 916
1996 Ga0496105_0890584 3300048908 Bacteria 671
1997 Ga0496106_0000171 3300048909 Bacteria 47281
1998 Ga0496106_0001491 3300048909 Bacteria 17594
1999 Ga0496106_0016755 3300048909 Bacteria 5422
2000 Ga0496106_0247417 3300048909 Bacteria 1425
2001 Ga0496106_0387377 3300048909 Bacteria 1123
2002 Ga0496106_0400803 3300048909 Bacteria 1103
2003 Ga0496106_0865491 3300048909 Bacteria 715
2004 Ga0496106_0912581 3300048909 Bacteria 693
2005 Ga0496106_1001594 3300048909 Bacteria 657
2006 Ga0496107_0002333 3300048910 Bacteria 12249
2007 Ga0496107_0006109 3300048910 Bacteria 8275
2008 Ga0496108_0000270 3300048911 Bacteria 44669
2009 Ga0496108_0010399 3300048911 Bacteria 7557
2010 Ga0496108_0011935 3300048911 Bacteria 7068
2011 Ga0496108_0040196 3300048911 Bacteria 3897
2012 Ga0496108_0053300 3300048911 Bacteria 3392
2013 Ga0496108_0317759 3300048911 Bacteria 1357
2014 Ga0496109_0003581 3300048912 Bacteria 12965
2015 Ga0496109_0005918 3300048912 Bacteria 10260
2016 Ga0496109_0018512 3300048912 Bacteria 6117
2017 Ga0496109_0019052 3300048912 Bacteria 6044
2018 Ga0496109_0124323 3300048912 Bacteria 2404
2019 Ga0496109_0131795 3300048912 Bacteria 2333
2020 Ga0496109_0240083 3300048912 Bacteria 1705
2021 Ga0496110_0000727 3300048913 Bacteria 22766
2022 Ga0496110_0035372 3300048913 Bacteria 4333
2023 Ga0496110_0060694 3300048913 Bacteria 3335
2024 Ga0496110_0135456 3300048913 Bacteria 2225
2025 Ga0496110_0158134 3300048913 Bacteria 2053
2026 Ga0496110_0216349 3300048913 Bacteria 1742
2027 Ga0496110_0249281 3300048913 Bacteria 1616
2028 Ga0496110_0271362 3300048913 Bacteria 1544
2029 Ga0496110_0582163 3300048913 Bacteria 1016
2030 Ga0496110_1481549 3300048913 Bacteria 588
2031 Ga0496111_0002340 3300048914 Bacteria 11422
2032 Ga0496111_0008968 3300048914 Bacteria 6652
2033 Ga0496111_0027330 3300048914 Bacteria 4035
2034 Ga0496111_0392728 3300048914 Bacteria 1025
2035 Ga0496111_0483177 3300048914 Bacteria 912
2036 Ga0496111_0785082 3300048914 Bacteria 690
2037 Ga0496111_1174580 3300048914 Bacteria 545
2038 Ga0496111_1248166 3300048914 Bacteria 525
2039 Ga0496112_0006537 3300048915 Bacteria 10251
2040 Ga0496112_0010740 3300048915 Bacteria 8326
2041 Ga0496112_0015294 3300048915 Bacteria 7155
2042 Ga0496112_0079683 3300048915 Bacteria 3240
2043 Ga0496112_0138104 3300048915 Bacteria 2407
2044 Ga0496112_0172444 3300048915 Bacteria 2128
2045 Ga0496112_0293746 3300048915 Bacteria 1571
2046 Ga0496112_0458278 3300048915 Bacteria 1212
2047 Ga0496113_0002327 3300048916 Bacteria 10980
2048 Ga0496113_0002792 3300048916 Bacteria 10271
2049 Ga0496113_0011945 3300048916 Bacteria 5820
2050 Ga0496113_0018160 3300048916 Bacteria 4895
2051 Ga0496113_0051757 3300048916 Bacteria 3065
2052 Ga0496113_0182228 3300048916 Bacteria 1665
2053 Ga0496113_0185350 3300048916 Bacteria 1650
2054 Ga0496114_0012238 3300048917 Bacteria 6865
2055 Ga0496114_0049077 3300048917 Bacteria 3511
2056 Ga0496114_1063801 3300048917 Bacteria 693
2057 Ga0496115_0000325 3300048918 Bacteria 40655
2058 Ga0496115_0022580 3300048918 Bacteria 4877
2059 Ga0496115_0126838 3300048918 Bacteria 2102
2060 Ga0496115_0272478 3300048918 Bacteria 1390
2061 Ga0496116_0000045 3300048919 Bacteria 324307
2062 Ga0496116_0048305 3300048919 Bacteria 2857
2063 Ga0496116_0085482 3300048919 Bacteria 1938
2064 Ga0496116_0208824 3300048919 Bacteria 1014
2065 Ga0496117_0015681 3300048920 Bacteria 6438
2066 Ga0496117_0043619 3300048920 Bacteria 3258
2067 Ga0496117_0182822 3300048920 Bacteria 1203
2068 Ga0496117_0455486 3300048920 Bacteria 631
2069 Ga0496118_0001632 3300048921 Bacteria 33061
2070 Ga0496118_0079231 3300048921 Bacteria 2319
2071 Ga0496118_0167629 3300048921 Bacteria 1347
2072 Ga0496118_0200944 3300048921 Bacteria 1181
2073 Ga0496118_0210434 3300048921 Bacteria 1141
2074 Ga0496118_0441539 3300048921 Bacteria 663
2075 Ga0496118_0453005 3300048921 Bacteria 651
2076 Ga0496118_0514098 3300048921 Bacteria 592
2077 Ga0496119_0009439 3300048922 Bacteria 8374
2078 Ga0496119_0012109 3300048922 Bacteria 7044
2079 Ga0496119_0307964 3300048922 Bacteria 779
2080 Ga0496119_0313285 3300048922 Bacteria 770
2081 Ga0496120_0096375 3300048923 Bacteria 1571
2082 Ga0496120_0240170 3300048923 Bacteria 855
2083 Ga0496120_0391774 3300048923 Bacteria 615
2084 Ga0496121_0000017 3300048924 Bacteria 546415
2085 Ga0496121_0000128 3300048924 Bacteria 168457
2086 Ga0496121_0001842 3300048924 Bacteria 34183
2087 Ga0496121_0003936 3300048924 Bacteria 20562
2088 Ga0496121_0014449 3300048924 Bacteria 8378
2089 Ga0496121_0016508 3300048924 Bacteria 7619
2090 Ga0496121_0017871 3300048924 Bacteria 7198
2091 Ga0496121_0027742 3300048924 Bacteria 5292
2092 Ga0496121_0185075 3300048924 Bacteria 1499
2093 Ga0496121_0190824 3300048924 Bacteria 1469
2094 Ga0496121_0268463 3300048924 Bacteria 1174
2095 Ga0496121_0325408 3300048924 Bacteria 1033
2096 Ga0496121_0372495 3300048924 Bacteria 944
2097 Ga0496121_0394494 3300048924 Bacteria 908
2098 Ga0496122_0003264 3300048925 Bacteria 21512
2099 Ga0496122_0012455 3300048925 Bacteria 8464
2100 Ga0496122_0084726 3300048925 Bacteria 2190
2101 Ga0496122_0157005 3300048925 Bacteria 1394
2102 Ga0496122_0234297 3300048925 Bacteria 1041
2103 Ga0496122_0311926 3300048925 Bacteria 841
2104 Ga0496122_0507230 3300048925 Bacteria 584
2105 Ga0496123_0002307 3300048926 Bacteria 23963
2106 Ga0496123_0002815 3300048926 Bacteria 20643
2107 Ga0496123_0059229 3300048926 Bacteria 2478
2108 Ga0496123_0065788 3300048926 Bacteria 2301
2109 Ga0496123_0067431 3300048926 Bacteria 2260
2110 Ga0496123_0113838 3300048926 Bacteria 1539
2111 Ga0496123_0259082 3300048926 Bacteria 853
2112 Ga0496124_0010966 3300048927 Bacteria 9111
2113 Ga0496124_0019874 3300048927 Bacteria 6231
2114 Ga0496124_0020151 3300048927 Bacteria 6173
2115 Ga0496124_0021231 3300048927 Bacteria 5986
2116 Ga0496124_0037039 3300048927 Bacteria 4246
2117 Ga0496124_0089650 3300048927 Bacteria 2510
2118 Ga0496124_0145848 3300048927 Bacteria 1862
2119 Ga0496124_0367649 3300048927 Bacteria 1011
2120 Ga0496125_0009436 3300048928 Bacteria 10020
2121 Ga0496125_0012308 3300048928 Bacteria 8499
2122 Ga0496125_0013394 3300048928 Bacteria 8065
2123 Ga0496125_0021356 3300048928 Bacteria 6041
2124 Ga0496125_0042770 3300048928 Bacteria 3853
2125 Ga0496125_0069740 3300048928 Bacteria 2755
2126 Ga0496125_0333205 3300048928 Bacteria 914
2127 Ga0496125_0544777 3300048928 Bacteria 644
2128 Ga0496125_0564098 3300048928 Bacteria 628
2129 Ga0496125_0753732 3300048928 Bacteria 510
2130 Ga0496126_0000365 3300048929 Bacteria 93461
2131 Ga0496126_0000568 3300048929 Bacteria 70707
2132 Ga0496126_0031442 3300048929 Bacteria 5016
2133 Ga0496126_0042950 3300048929 Bacteria 4173
2134 Ga0496126_0047416 3300048929 Bacteria 3933
2135 Ga0496126_0065970 3300048929 Bacteria 3237
2136 Ga0496126_0154602 3300048929 Bacteria 1964
2137 Ga0496126_1351587 3300048929 Bacteria 516
2138 Ga0495678_010130 3300049459 Bacteria 4598
2139 Ga0495678_128165 3300049459 Bacteria 844
2140 Ga0495682_0163019 3300049460 Bacteria 794
2141 Ga0501311_034984 3300049527 Bacteria 742
2142 Ga0501311_073298 3300049527 Bacteria 571
2143 Ga0501313_066165 3300049529 Bacteria 518
2144 Ga0501314_013551 3300049530 Bacteria 791
2145 Ga0501314_021872 3300049530 Bacteria 670
2146 Ga0501317_048036 3300049533 Bacteria 670
2147 Ga0501322_009290 3300049538 Bacteria 743
2148 Ga0501334_11529 3300049550 Bacteria 648
2149 Ga0501335_024020 3300049551 Bacteria 663
2150 Ga0501031_0173637 3300049568 Bacteria 1408
2151 Ga0501031_0338726 3300049568 Bacteria 974
2152 Ga0501032_0017922 3300049569 Bacteria 4968
2153 Ga0501032_0040485 3300049569 Bacteria 3168
2154 Ga0501032_0144429 3300049569 Bacteria 1566
2155 Ga0501032_0200349 3300049569 Bacteria 1303
2156 Ga0501032_0532459 3300049569 Bacteria 749
2157 Ga0501032_0666305 3300049569 Bacteria 660
2158 Ga0501032_0992583 3300049569 Bacteria 527
2159 Ga0501033_0007968 3300049570 Bacteria 8205
2160 Ga0501033_0016714 3300049570 Bacteria 5549
2161 Ga0501033_0076879 3300049570 Bacteria 2450
2162 Ga0501033_0178915 3300049570 Bacteria 1521
2163 Ga0501033_0413660 3300049570 Bacteria 939
2164 Ga0501033_0459338 3300049570 Bacteria 884
2165 Ga0501034_0000089 3300049571 Bacteria 165644
2166 Ga0501034_0002186 3300049571 Bacteria 24191
2167 Ga0501034_0007572 3300049571 Bacteria 11554
2168 Ga0501034_0009998 3300049571 Bacteria 9911
2169 Ga0501034_0056473 3300049571 Bacteria 3950
2170 Ga0501034_0118260 3300049571 Bacteria 2637
2171 Ga0501034_0256658 3300049571 Bacteria 1691
2172 Ga0501034_0284235 3300049571 Bacteria 1593
2173 Ga0501034_0310532 3300049571 Bacteria 1511
2174 Ga0501034_0388576 3300049571 Bacteria 1319
2175 Ga0501034_0887119 3300049571 Bacteria 780
2176 Ga0501036_0002470 3300049572 Bacteria 14485
2177 Ga0501036_0003258 3300049572 Bacteria 12948
2178 Ga0501036_0028055 3300049572 Bacteria 4758
2179 Ga0501036_0100626 3300049572 Bacteria 2445
2180 Ga0501036_0100890 3300049572 Bacteria 2441
2181 Ga0501036_0161118 3300049572 Bacteria 1891
2182 Ga0501037_0009229 3300049573 Bacteria 7231
2183 Ga0501037_0148798 3300049573 Bacteria 1674
2184 Ga0501037_0166470 3300049573 Bacteria 1569
2185 Ga0501037_0217469 3300049573 Bacteria 1345
2186 Ga0501037_0259870 3300049573 Bacteria 1213
2187 Ga0501037_0515667 3300049573 Bacteria 810
2188 Ga0501038_0087146 3300049574 Bacteria 2622
2189 Ga0501038_0114232 3300049574 Bacteria 2233
2190 Ga0501038_0436995 3300049574 Bacteria 1008
2191 Ga0501038_0680091 3300049574 Bacteria 773
2192 Ga0501038_1364301 3300049574 Bacteria 510
2193 Ga0501039_0065472 3300049575 Bacteria 2819
2194 Ga0501039_0116878 3300049575 Bacteria 2088
2195 Ga0501039_0442683 3300049575 Bacteria 1020
2196 Ga0501039_0601038 3300049575 Bacteria 862
2197 Ga0501040_0010428 3300049576 Bacteria 6076
2198 Ga0501040_0104758 3300049576 Bacteria 1976
2199 Ga0501040_0307954 3300049576 Bacteria 1132
2200 Ga0501040_1086431 3300049576 Bacteria 580
2201 Ga0501041_0169978 3300049577 Bacteria 1364
2202 Ga0501042_0104688 3300049578 Bacteria 2036
2203 Ga0501042_0633232 3300049578 Bacteria 778
2204 Ga0501042_0639191 3300049578 Bacteria 773
2205 Ga0501042_0710384 3300049578 Bacteria 731
2206 Ga0501043_0206640 3300049579 Bacteria 1522
2207 Ga0501043_0245024 3300049579 Bacteria 1381
2208 Ga0501043_0323972 3300049579 Bacteria 1174
2209 Ga0501043_0397103 3300049579 Bacteria 1042
2210 Ga0501043_0599375 3300049579 Bacteria 814
2211 Ga0501043_0770683 3300049579 Bacteria 698
2212 Ga0501043_1140725 3300049579 Bacteria 549
2213 Ga0501046_0000058 3300049580 Bacteria 127462
2214 Ga0501046_0025198 3300049580 Bacteria 4870
2215 Ga0501046_0064915 3300049580 Bacteria 2849
2216 Ga0501046_0068840 3300049580 Bacteria 2754
2217 Ga0501046_0112332 3300049580 Bacteria 2080
2218 Ga0501046_0313040 3300049580 Bacteria 1145
2219 Ga0501046_0457290 3300049580 Unclassified 917
2220 Ga0501046_0583279 3300049580 Bacteria 794
2221 Ga0501046_0759272 3300049580 Bacteria 681
2222 Ga0501046_1219056 3300049580 Bacteria 516
2223 Ga0501047_0000097 3300049581 Bacteria 107310
2224 Ga0501047_0026712 3300049581 Bacteria 5557
2225 Ga0501047_0033769 3300049581 Bacteria 4938
2226 Ga0501047_0066831 3300049581 Bacteria 3466
2227 Ga0501047_0258739 3300049581 Bacteria 1588
2228 Ga0501047_0431512 3300049581 Bacteria 1148
2229 Ga0501047_0465574 3300049581 Bacteria 1092
2230 Ga0501047_0495578 3300049581 Bacteria 1048
2231 Ga0501047_0615752 3300049581 Bacteria 906
2232 Ga0501047_0657915 3300049581 Bacteria 867
2233 Ga0501047_0822508 3300049581 Bacteria 743
2234 Ga0501047_0863175 3300049581 Bacteria 719
2235 Ga0501048_0001777 3300049582 Bacteria 16389
2236 Ga0501048_0094504 3300049582 Bacteria 2109
2237 Ga0501048_0121964 3300049582 Bacteria 1842
2238 Ga0501048_0172033 3300049582 Bacteria 1534
2239 Ga0501048_0510115 3300049582 Bacteria 862
2240 Ga0501048_0597836 3300049582 Bacteria 792
2241 Ga0501048_0847012 3300049582 Bacteria 657
2242 Ga0501048_0998715 3300049582 Bacteria 602
2243 Ga0501067_0010136 3300049583 Bacteria 5212
2244 Ga0501067_0067680 3300049583 Bacteria 1977
2245 Ga0501067_0168573 3300049583 Bacteria 1220
2246 Ga0501067_0268333 3300049583 Bacteria 950
2247 Ga0501067_0668564 3300049583 Bacteria 583
2248 Ga0501068_0019141 3300049584 Bacteria 3971
2249 Ga0501068_0177162 3300049584 Bacteria 1347
2250 Ga0501068_0374610 3300049584 Bacteria 916
2251 Ga0501068_0565874 3300049584 Bacteria 739
2252 Ga0501069_0003384 3300049585 Bacteria 8188
2253 Ga0501069_0011661 3300049585 Bacteria 4660
2254 Ga0501069_0021339 3300049585 Bacteria 3513
2255 Ga0501069_0060396 3300049585 Bacteria 2116
2256 Ga0501069_0063967 3300049585 Bacteria 2055
2257 Ga0501069_0295308 3300049585 Bacteria 950
2258 Ga0501069_0777613 3300049585 Bacteria 580
2259 Ga0501070_0008856 3300049586 Bacteria 8506
2260 Ga0501070_0030273 3300049586 Bacteria 4535
2261 Ga0501070_0094098 3300049586 Bacteria 2479
2262 Ga0501070_0178014 3300049586 Bacteria 1750
2263 Ga0501070_0333171 3300049586 Bacteria 1233
2264 Ga0501070_0488029 3300049586 Bacteria 990
2265 Ga0501070_0781897 3300049586 Bacteria 751
2266 Ga0501070_1212261 3300049586 Bacteria 579
2267 Ga0501071_0013639 3300049587 Bacteria 5541
2268 Ga0501071_0244426 3300049587 Bacteria 1353
2269 Ga0501071_0446407 3300049587 Bacteria 990
2270 Ga0501072_0041181 3300049588 Bacteria 3627
2271 Ga0501072_0042687 3300049588 Bacteria 3562
2272 Ga0501072_0261799 3300049588 Bacteria 1376
2273 Ga0501072_0330079 3300049588 Bacteria 1212
2274 Ga0501072_0344974 3300049588 Bacteria 1182
2275 Ga0501072_0394663 3300049588 Bacteria 1097
2276 Ga0501072_0438394 3300049588 Bacteria 1035
2277 Ga0501072_1407628 3300049588 Bacteria 539
2278 Ga0501072_1562280 3300049588 Bacteria 509
2279 Ga0501073_0104971 3300049589 Bacteria 1961
2280 Ga0501073_0162062 3300049589 Bacteria 1549
2281 Ga0501073_0260852 3300049589 Bacteria 1196
2282 Ga0501073_0344055 3300049589 Bacteria 1029
2283 Ga0501073_0395722 3300049589 Bacteria 954
2284 Ga0501073_0601853 3300049589 Bacteria 759
2285 Ga0501073_1066095 3300049589 Bacteria 556
2286 Ga0501074_0005920 3300049590 Bacteria 8816
2287 Ga0501074_0088240 3300049590 Bacteria 2221
2288 Ga0501074_0090189 3300049590 Bacteria 2195
2289 Ga0501074_0095446 3300049590 Bacteria 2130
2290 Ga0501074_0233823 3300049590 Bacteria 1308
2291 Ga0501074_0328918 3300049590 Bacteria 1085
2292 Ga0501074_0407258 3300049590 Bacteria 964
2293 Ga0501074_0637862 3300049590 Bacteria 753
2294 Ga0501075_0050918 3300049591 Bacteria 3113
2295 Ga0501075_0332423 3300049591 Bacteria 1158
2296 Ga0501075_0715526 3300049591 Bacteria 762
2297 Ga0501075_1008779 3300049591 Bacteria 632
2298 Ga0501076_0013557 3300049592 Bacteria 6111
2299 Ga0501076_0024210 3300049592 Bacteria 4690
2300 Ga0501076_0079146 3300049592 Bacteria 2638
2301 Ga0501076_0614010 3300049592 Bacteria 897
2302 Ga0501077_0002811 3300049593 Bacteria 10442
2303 Ga0501077_0041128 3300049593 Bacteria 2943
2304 Ga0501077_0097383 3300049593 Bacteria 1864
2305 Ga0501077_0154000 3300049593 Bacteria 1459
2306 Ga0501077_0370705 3300049593 Bacteria 914
2307 Ga0501077_0864776 3300049593 Bacteria 581
2308 Ga0501224_002711 3300049664 Bacteria 2437
2309 Ga0501227_190098 3300049665 Bacteria 579
2310 Ga0501248_007378 3300049678 Bacteria 918
2311 Ga0501249_012622 3300049679 Bacteria 1787
2312 Ga0501253_058522 3300049683 Bacteria 825
2313 Ga0501257_149816 3300049686 Bacteria 643
2314 Ga0501079_0113836 3300049741 Bacteria 2103
2315 Ga0501079_0204732 3300049741 Bacteria 1541
2316 Ga0501079_0296612 3300049741 Bacteria 1264
2317 Ga0501079_0346874 3300049741 Bacteria 1163
2318 Ga0501079_0836975 3300049741 Bacteria 724
2319 Ga0501080_0000045 3300049742 Bacteria 79211
2320 Ga0501080_0025689 3300049742 Bacteria 5470
2321 Ga0501080_0026650 3300049742 Bacteria 5370
2322 Ga0501080_0115490 3300049742 Bacteria 2489
2323 Ga0501080_1031409 3300049742 Bacteria 712
2324 Ga0501080_1353415 3300049742 Bacteria 608
2325 Ga0501081_0081250 3300049743 Bacteria 2270
2326 Ga0501081_0088169 3300049743 Bacteria 2179
2327 Ga0501081_0187943 3300049743 Bacteria 1495
2328 Ga0501081_0366046 3300049743 Bacteria 1064
2329 Ga0501083_0008419 3300049744 Bacteria 7290
2330 Ga0501083_0015459 3300049744 Bacteria 5345
2331 Ga0501083_0126870 3300049744 Bacteria 1673
2332 Ga0501083_0221159 3300049744 Bacteria 1233
2333 Ga0501083_0401085 3300049744 Bacteria 892
2334 Ga0501083_0591541 3300049744 Bacteria 722
2335 Ga0501083_0780607 3300049744 Bacteria 622
2336 Ga0501241_016730 3300049758 Bacteria 1338
2337 Ga0501282_027800 3300049778 Bacteria 639
2338 Ga0501035_0001208 3300049822 Bacteria 26922
2339 Ga0501035_0081680 3300049822 Bacteria 2852
2340 Ga0501035_0331216 3300049822 Bacteria 1277
2341 Ga0501035_0673981 3300049822 Bacteria 836
2342 Ga0501044_0002552 3300049823 Bacteria 20740
2343 Ga0501044_0010970 3300049823 Bacteria 9835
2344 Ga0501044_0012045 3300049823 Bacteria 9365
2345 Ga0501044_0115709 3300049823 Bacteria 2687
2346 Ga0501044_0137965 3300049823 Bacteria 2428
2347 Ga0501044_0151534 3300049823 Bacteria 2301
2348 Ga0501044_0425008 3300049823 Bacteria 1238
2349 Ga0501044_0628645 3300049823 Bacteria 964
2350 Ga0501044_0631558 3300049823 Bacteria 961
2351 Ga0501044_0764053 3300049823 Bacteria 848
2352 Ga0501044_0938970 3300049823 Bacteria 738
2353 Ga0501044_0989905 3300049823 Bacteria 713
2354 Ga0501044_1502438 3300049823 Bacteria 539
2355 Ga0501044_1554325 3300049823 Bacteria 526
2356 Ga0501045_0016406 3300049824 Bacteria 5259
2357 Ga0501045_0964239 3300049824 Bacteria 626
2358 nmdc:mga03683_189888_c1 3300050489 Bacteria 940
2359 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
2360 nmdc:mga03683_308774_c1 3300050489 Bacteria 743
2361 nmdc:mga03683_51312_c1 3300050489 Bacteria 1721
2362 nmdc:mga03683_543904_c1 3300050489 Bacteria 565
2363 nmdc:mga03683_61_c1 3300050489 Bacteria 41527
2364 nmdc:mga03683_88534_c1 3300050489 Bacteria 1347
2365 nmdc:mga03n38_131721_c1 3300050490 Bacteria 1240
2366 nmdc:mga03n38_1829_c1 3300050490 Bacteria 6336
2367 nmdc:mga03n38_227884_c1 3300050490 Bacteria 976
2368 nmdc:mga03n38_287541_c1 3300050490 Bacteria 879
2369 nmdc:mga03n38_372525_c1 3300050490 Bacteria 781
2370 nmdc:mga03n38_526_c1 3300050490 Bacteria 9692
2371 nmdc:mga00v17_1044520_c1 3300050491 Bacteria 513
2372 nmdc:mga00v17_1089555_c1 3300050491 Bacteria 500
2373 nmdc:mga00v17_1572_c1 3300050491 Bacteria 11922
2374 nmdc:mga00v17_179731_c1 3300050491 Bacteria 1365
2375 nmdc:mga00v17_26014_c1 3300050491 Bacteria 3406
2376 nmdc:mga00v17_40398_c1 3300050491 Bacteria 2798
2377 nmdc:mga00v17_992721_c1 3300050491 Bacteria 529
2378 nmdc:mga0yw44_19458_c1 3300050492 Bacteria 3745
2379 nmdc:mga0yw44_202483_c1 3300050492 Bacteria 1311
2380 nmdc:mga0yw44_620001_c1 3300050492 Bacteria 735
2381 nmdc:mga0k408_12410_c1 3300050493 Bacteria 4657
2382 nmdc:mga0k408_174625_c1 3300050493 Bacteria 1281
2383 nmdc:mga0k408_240791_c1 3300050493 Bacteria 1080
2384 nmdc:mga0k408_258052_c1 3300050493 Bacteria 1041
2385 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
2386 nmdc:mga0k408_3799_c1 3300050493 Bacteria 8002
2387 nmdc:mga0k408_597285_c1 3300050493 Bacteria 651
2388 nmdc:mga0k408_635812_c1 3300050493 Bacteria 628
2389 nmdc:mga06z11_332_c1 3300050494 Bacteria 17928
2390 nmdc:mga06z11_3726_c1 3300050494 Bacteria 5921
2391 nmdc:mga06z11_38986_c1 3300050494 Bacteria 2363
2392 nmdc:mga06z11_39210_c1 3300050494 Bacteria 2356
2393 nmdc:mga06z11_40485_c1 3300050494 Bacteria 2326
2394 nmdc:mga06z11_47_c1 3300050494 Bacteria 51206
2395 nmdc:mga06z11_49020_c1 3300050494 Bacteria 2153
2396 nmdc:mga06z11_88737_c1 3300050494 Bacteria 1675
2397 nmdc:mga04h51_14887_c1 3300050495 Bacteria 2232
2398 nmdc:mga04h51_182_c1 3300050495 Bacteria 17567
2399 nmdc:mga04h51_187_c1 3300050495 Bacteria 17156
2400 nmdc:mga04h51_4410_c1 3300050495 Bacteria 3500
2401 nmdc:mga07m45_108019_c1 3300050496 Bacteria 1601
2402 nmdc:mga07m45_1364_c1 3300050496 Bacteria 11133
2403 nmdc:mga07m45_151799_c1 3300050496 Bacteria 1344
2404 nmdc:mga07m45_152392_c1 3300050496 Bacteria 1341
2405 nmdc:mga07m45_191370_c1 3300050496 Bacteria 1190
2406 nmdc:mga07m45_20437_c1 3300050496 Bacteria 3595
2407 nmdc:mga07m45_23094_c1 3300050496 Bacteria 3398
2408 nmdc:mga07m45_26_c1 3300050496 Bacteria 94168
2409 nmdc:mga07m45_283946_c1 3300050496 Bacteria 963
2410 nmdc:mga07m45_55881_c1 3300050496 Bacteria 2231
2411 nmdc:mga05p37_1758866_c1 3300050507 Bacteria 601
2412 nmdc:mga05p37_742319_c1 3300050507 Unclassified 1083
2413 nmdc:mga05p37_949199_c1 3300050507 Bacteria 921
2414 nmdc:mga09592_230970_c1 3300050508 Bacteria 1603
2415 nmdc:mga09592_29697_c1 3300050508 Bacteria 4546
2416 nmdc:mga0qj67_186566_c1 3300050509 Bacteria 1685
2417 nmdc:mga0qj67_27585_c1 3300050509 Bacteria 4403
2418 nmdc:mga0qj67_813960_c1 3300050509 Bacteria 739
2419 nmdc:mga0qj67_990138_c1 3300050509 Unclassified 660
2420 nmdc:mga06r32_5167_c1 3300050510 Bacteria 11729
2421 nmdc:mga08y16_55896_c1 3300050511 Bacteria 4124
2422 nmdc:mga0n895_404601_c1 3300050512 Bacteria 1380
2423 nmdc:mga0n895_457599_c1 3300050512 Bacteria 1288
2424 nmdc:mga0rr50_1285414_c1 3300050513 Bacteria 621
2425 nmdc:mga0rr50_201409_c1 3300050513 Bacteria 1636
2426 nmdc:mga0rr50_813484_c1 3300050513 Bacteria 797
2427 nmdc:mga08x19_16664_c1 3300050514 Bacteria 4485
2428 nmdc:mga0a205_298312_c1 3300050515 Bacteria 1485
2429 nmdc:mga0a205_44519_c1 3300050515 Bacteria 4279
2430 nmdc:mga0a205_871553_c1 3300050515 Bacteria 747
2431 nmdc:mga0sz30_1158_c1 3300050516 Bacteria 9448
2432 nmdc:mga0sz30_156233_c1 3300050516 Bacteria 1010
2433 nmdc:mga0sz30_196701_c2 3300050516 Bacteria 514
2434 nmdc:mga0sz30_219875_c1 3300050516 Bacteria 844
2435 nmdc:mga0sz30_3200_c1 3300050516 Bacteria 3029
2436 nmdc:mga0sz30_44210_c1 3300050516 Bacteria 1876
2437 Ga0495601_0050386 3300053077 Bacteria 2626
2438 Ga0495612_0271102 3300053078 Bacteria 757
2439 Ga0495619_0143229 3300053085 Bacteria 1647
2440 Ga0500578_0179768 3300053086 Bacteria 1304
2441 Ga0500643_000005 3300053087 Bacteria 539775
2442 Ga0500643_011852 3300053087 Bacteria 3155
2443 Ga0500643_045660 3300053087 Bacteria 1268
2444 Ga0500647_0092474 3300053091 Bacteria 1447
2445 Ga0500647_0192714 3300053091 Bacteria 929
2446 Ga0500583_0316102 3300053092 Bacteria 762
2447 Ga0500651_0014119 3300053093 Bacteria 4882
2448 Ga0500651_0162496 3300053093 Bacteria 1335
2449 Ga0500651_0327603 3300053093 Bacteria 873
2450 Ga0500566_0000259 3300053094 Bacteria 28513
2451 Ga0500641_0000659 3300053096 Bacteria 12423
2452 Ga0500641_0006777 3300053096 Bacteria 4075
2453 Ga0500641_0009270 3300053096 Bacteria 3536
2454 Ga0500641_0294615 3300053096 Bacteria 668
2455 Ga0500555_070730 3300053103 Bacteria 921
2456 Ga0500562_000398 3300053108 Bacteria 10551
2457 Ga0500562_015570 3300053108 Bacteria 1952
2458 Ga0500562_035044 3300053108 Bacteria 1329
2459 Ga0500562_077438 3300053108 Bacteria 899
2460 Ga0500569_005008 3300053109 Bacteria 2824
2461 Ga0500572_084547 3300053111 Bacteria 998
2462 Ga0500572_103445 3300053111 Bacteria 912
2463 Ga0500592_008128 3300053116 Bacteria 1663
2464 Ga0500592_054953 3300053116 Bacteria 649
2465 Ga0500594_0027842 3300053118 Bacteria 1466
2466 Ga0500594_0029841 3300053118 Bacteria 1428
2467 Ga0500594_0053854 3300053118 Bacteria 1141
2468 Ga0500595_002712 3300053119 Bacteria 8578
2469 Ga0500595_007699 3300053119 Bacteria 4453
2470 Ga0500595_008471 3300053119 Bacteria 4196
2471 Ga0500595_013870 3300053119 Bacteria 3074
2472 Ga0500595_120560 3300053119 Bacteria 741
2473 Ga0500597_181793 3300053120 Bacteria 891
2474 Ga0500607_000060 3300053121 Bacteria 77770
2475 Ga0500607_000152 3300053121 Bacteria 59345
2476 Ga0500608_000074 3300053122 Bacteria 42636
2477 Ga0500608_002556 3300053122 Bacteria 6646
2478 Ga0500614_010872 3300053123 Bacteria 1960
2479 Ga0500614_143692 3300053123 Bacteria 715
2480 Ga0500618_002141 3300053125 Bacteria 7758
2481 Ga0500618_010860 3300053125 Bacteria 2431
2482 Ga0500626_064675 3300053128 Bacteria 1633
2483 Ga0500652_000198 3300053131 Bacteria 23141
2484 Ga0500652_156648 3300053131 Bacteria 943
2485 Ga0500658_0001309 3300053134 Bacteria 10078
2486 Ga0500658_0049193 3300053134 Bacteria 1717
2487 Ga0500658_0088968 3300053134 Bacteria 1332
2488 Ga0500559_0003528 3300053136 Bacteria 7662
2489 Ga0500559_0009475 3300053136 Bacteria 4213
2490 Ga0500564_214222 3300053138 Bacteria 783
2491 Ga0500568_0006304 3300053139 Bacteria 5974
2492 Ga0500568_0060966 3300053139 Bacteria 1460
2493 Ga0500568_0342059 3300053139 Bacteria 542
2494 Ga0500573_0000010 3300053140 Bacteria 210704
2495 Ga0500573_0058350 3300053140 Bacteria 2213
2496 Ga0500577_0173127 3300053142 Bacteria 924
2497 Ga0500588_0041045 3300053146 Bacteria 1394
2498 Ga0500588_0270775 3300053146 Bacteria 640
2499 Ga0500590_001355 3300053148 Bacteria 9974
2500 Ga0500590_067276 3300053148 Bacteria 1788
2501 Ga0500590_090953 3300053148 Bacteria 1482
2502 Ga0500604_0018944 3300053151 Bacteria 1923
2503 Ga0500604_0100552 3300053151 Bacteria 953
2504 Ga0500604_0125217 3300053151 Bacteria 861
2505 Ga0500604_0208186 3300053151 Bacteria 673
2506 Ga0500616_0001865 3300053153 Bacteria 19033
2507 Ga0500616_0005539 3300053153 Bacteria 8555
2508 Ga0500616_0134187 3300053153 Bacteria 1166
2509 Ga0500616_0209444 3300053153 Bacteria 858
2510 Ga0500619_027359 3300053154 Bacteria 1707
2511 Ga0500620_057430 3300053155 Bacteria 1318
2512 Ga0500622_0012682 3300053156 Bacteria 4560
2513 Ga0500622_0334066 3300053156 Bacteria 634
2514 Ga0500624_000005 3300053157 Bacteria 187122
2515 Ga0500627_0000009 3300053158 Bacteria 153203
2516 Ga0500627_0056561 3300053158 Bacteria 1719
2517 Ga0500638_143809 3300053162 Bacteria 1068
2518 Ga0500638_152825 3300053162 Bacteria 1025
2519 Ga0500636_0308214 3300053177 Bacteria 776
2520 Ga0500567_003234 3300053723 Bacteria 7213
2521 Ga0500625_000004 3300053729 Bacteria 245905
2522 Ga0500645_003136 3300053730 Bacteria 6883
2523 Ga0500645_075751 3300053730 Bacteria 963
2524 Ga0500656_075007 3300053732 Bacteria 526
2525 Ga0500552_044069 3300053733 Bacteria 736
2526 Ga0500552_096926 3300053733 Bacteria 557
2527 Ga0500596_001392 3300053735 Bacteria 4888
2528 Ga0501084_0005823 3300054114 Bacteria 10144
2529 Ga0501084_0310208 3300054114 Bacteria 1332
2530 Ga0501084_0679721 3300054114 Bacteria 868
2531 Ga0587084_010598 3300059477 Bacteria 1211
2532 Ga0587084_033847 3300059477 Bacteria 837
2533 Ga0587093_029285 3300059478 Bacteria 784
2534 Ga0587070_044808 3300059491 Bacteria 861
2535 Ga0587070_069660 3300059491 Bacteria 747
2536 Ga0587070_086986 3300059491 Bacteria 696
2537 Ga0587070_090623 3300059491 Bacteria 687
2538 Ga0587073_0144873 3300059492 Bacteria 666
2539 Ga0587077_094062 3300059493 Bacteria 709
2540 Ga0587077_118346 3300059493 Bacteria 658
2541 Ga0587077_137970 3300059493 Bacteria 625
2542 Ga0587082_063565 3300059504 Bacteria 733
2543 Ga0587082_070831 3300059504 Bacteria 708
2544 Ga0587082_083955 3300059504 Bacteria 668
2545 Ga0587083_0128226 3300059505 Bacteria 663
2546 Ga0587085_112733 3300059506 Bacteria 588
2547 Ga0587086_023832 3300059507 Bacteria 856
2548 Ga0587086_037199 3300059507 Bacteria 739
2549 Ga0587086_052061 3300059507 Bacteria 662
2550 Ga0587088_005977 3300059508 Bacteria 1623
2551 Ga0587088_184216 3300059508 Bacteria 525
2552 Ga0587089_031636 3300059509 Bacteria 783
2553 Ga0587090_044225 3300059510 Bacteria 795
2554 Ga0587090_054494 3300059510 Bacteria 742
2555 Ga0587090_059379 3300059510 Bacteria 722
2556 Ga0587090_075884 3300059510 Bacteria 665
2557 Ga0587091_008973 3300059511 Bacteria 1493
2558 Ga0587091_031859 3300059511 Bacteria 994
2559 Ga0587091_054643 3300059511 Bacteria 830
2560 Ga0587091_058928 3300059511 Bacteria 810
2561 Ga0587091_099441 3300059511 Bacteria 680
2562 Ga0587091_104615 3300059511 Bacteria 668
2563 Ga0587091_109358 3300059511 Bacteria 658
2564 Ga0587092_079574 3300059512 Bacteria 645
2565 Ga0587092_120063 3300059512 Bacteria 561
2566 Ga0587094_030473 3300059513 Bacteria 834
2567 Ga0587098_014190 3300059604 Bacteria 937
2568 Ga0587106_003817 3300059605 Bacteria 1614
2569 Ga0587106_064527 3300059605 Bacteria 680
2570 Ga0587125_013380 3300059607 Bacteria 886
2571 Ga0587129_007039 3300059608 Bacteria 808
2572 Ga0587101_063203 3300059623 Bacteria 666
2573 Ga0587109_053459 3300059624 Bacteria 834
2574 Ga0587109_111546 3300059624 Bacteria 640
2575 Ga0587115_027471 3300059626 Bacteria 828
2576 Ga0587115_028126 3300059626 Bacteria 822
2577 Ga0587115_049365 3300059626 Bacteria 679
2578 Ga0587115_053735 3300059626 Bacteria 660
2579 Ga0587128_021056 3300059630 Bacteria 1002
2580 Ga0587128_051545 3300059630 Bacteria 753
2581 Ga0587128_060599 3300059630 Bacteria 714
2582 Ga0587128_061801 3300059630 Bacteria 709
2583 Ga0587128_156556 3300059630 Bacteria 522
2584 Ga0587062_022984 3300059639 Bacteria 900
2585 Ga0587062_029906 3300059639 Bacteria 828
2586 Ga0587062_051120 3300059639 Bacteria 700
2587 Ga0587062_057944 3300059639 Bacteria 672
2588 Ga0587068_045621 3300059641 Bacteria 806
2589 Ga0587068_055079 3300059641 Bacteria 753
2590 Ga0587068_077127 3300059641 Bacteria 667
2591 Ga0587072_020475 3300059643 Bacteria 1166
2592 Ga0587072_110335 3300059643 Bacteria 627
2593 Ga0587072_174039 3300059643 Bacteria 533
2594 Ga0587075_050672 3300059644 Bacteria 724
2595 Ga0587076_042906 3300059645 Bacteria 852
2596 Ga0587076_070182 3300059645 Bacteria 726
2597 Ga0587076_074743 3300059645 Bacteria 711
2598 Ga0587076_091031 3300059645 Bacteria 667
2599 Ga0587078_006441 3300059646 Bacteria 1277
2600 Ga0587078_021911 3300059646 Bacteria 813
2601 Ga0587078_038780 3300059646 Bacteria 667
2602 Ga0587100_005937 3300059648 Bacteria 925
2603 Ga0587100_017547 3300059648 Bacteria 672
2604 Ga0587100_018158 3300059648 Bacteria 665
2605 Ga0587104_011260 3300059650 Bacteria 665
2606 Ga0587107_069451 3300059652 Bacteria 640
2607 Ga0587107_094970 3300059652 Bacteria 582
2608 Ga0587107_129916 3300059652 Bacteria 528
2609 Ga0587108_008472 3300059653 Bacteria 834
2610 Ga0587110_028280 3300059654 Bacteria 672
2611 Ga0587110_062436 3300059654 Bacteria 518
2612 Ga0587114_033008 3300059655 Bacteria 802
2613 Ga0587114_080971 3300059655 Bacteria 604
2614 Ga0587119_039732 3300059658 Bacteria 671
2615 Ga0587124_009500 3300059660 Bacteria 853
2616 Ga0587124_017999 3300059660 Bacteria 701
2617 Ga0587124_029616 3300059660 Bacteria 599
2618 Ga0587071_087886 3300060344 Bacteria 702
2619 Ga0587071_180495 3300060344 Bacteria 542
2620 Ga0587111_0018494 3300060346 Bacteria 1312
2621 Ga0587111_0085023 3300060346 Bacteria 763
2622 Ga0587111_0105828 3300060346 Bacteria 707
2623 Ga0587111_0113064 3300060346 Bacteria 690
2624 Ga0587111_0130291 3300060346 Bacteria 657
2625 Ga0587111_0234668 3300060346 Bacteria 536
2626 Ga0501082_0006851 3300060353 Bacteria 9854
2627 Ga0501082_0011708 3300060353 Bacteria 7541
2628 Ga0501082_0027632 3300060353 Bacteria 4883
2629 Ga0501082_0062346 3300060353 Bacteria 3209
2630 Ga0501082_0242864 3300060353 Bacteria 1567
2631 Ga0501082_0400503 3300060353 Bacteria 1198
2632 Ga0501082_0557627 3300060353 Bacteria 1002
2633 Ga0501082_0680804 3300060353 Bacteria 900
2634 Ga0501082_1357103 3300060353 Bacteria 621
2635 Ga0501082_1389094 3300060353 Bacteria 613
2636 Ga0466962_0002938 3300061719 Bacteria 8127
2637 Ga0466962_0359011 3300061719 Bacteria 726
2638 Ga0530510_0013825 3300061734 Bacteria 5683
2639 Ga0530510_0233374 3300061734 Bacteria 1369
2640 Ga0530510_0515857 3300061734 Bacteria 906

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_1212261 Ga0501070_1212261_270_560 96
2 3300049589 Ga0501073_0601853 Ga0501073_0601853_272_562 96
3 3300053151 Ga0500604_0018944 Ga0500604_0018944_218_622 101
4 3300059660 Ga0587124_029616 Ga0587124_029616_176_580 105
5 3300025921 Ga0207652_10421608 Ga0207652_104216082 107
6 3300031824 Ga0307413_10150544 Ga0307413_101505443 108
7 3300039447 Ga0436361_1026066 Ga0436361_1026066_106_465 110
8 3300035085 Ga0373929_0096835 Ga0373929_0096835_15_350 111
9 3300046522 Ga0495643_0145927 Ga0495643_0145927_343_720 111
10 3300046616 Ga0495668_0268427 Ga0495668_0268427_388_723 111
11 3300049582 Ga0501048_0998715 Ga0501048_0998715_202_537 111
12 3300050496 nmdc:mga07m45_55881_c1 nmdc:mga07m45_55881_c1_1695_2030 111
13 3300053103 Ga0500555_070730 Ga0500555_070730_471_806 111
14 3300053121 Ga0500607_000152 Ga0500607_000152_2243_2578 111
15 3300053136 Ga0500559_0009475 Ga0500559_0009475_2224_2559 111
16 3300053148 Ga0500590_067276 Ga0500590_067276_1118_1453 111
17 3300053153 Ga0500616_0005539 Ga0500616_0005539_7725_8102 111
18 3300053730 Ga0500645_003136 Ga0500645_003136_2017_2352 111
19 3300005343 Ga0070687_100486630 Ga0070687_1004866302 112
20 3300009098 Ga0105245_10000107 Ga0105245_1000010746 112
21 3300013297 Ga0157378_10648012 Ga0157378_106480122 112
22 3300014969 Ga0157376_10025105 Ga0157376_100251055 112
23 3300025927 Ga0207687_10000239 Ga0207687_1000023910 112
24 3300026116 Ga0207674_11311459 Ga0207674_113114591 112
25 3300031731 Ga0307405_10318671 Ga0307405_103186712 112
26 3300035242 Ga0373962_0146685 Ga0373962_0146685_147_485 112
27 3300046615 Ga0495656_0508253 Ga0495656_0508253_20_358 112
28 3300046616 Ga0495668_0660372 Ga0495668_0660372_17_355 112
29 3300048929 Ga0496126_1351587 Ga0496126_1351587_161_499 112
30 3300049527 Ga0501311_073298 Ga0501311_073298_20_358 112
31 3300049665 Ga0501227_190098 Ga0501227_190098_107_445 112
32 3300050490 nmdc:mga03n38_372525_c1 nmdc:mga03n38_372525_c1_20_358 112
33 3300032126 Ga0307415_100501856 Ga0307415_1005018562 113
34 3300039437 Ga0436365_0614931 Ga0436365_0614931_19_360 113
35 iso_pu_bacteria 2523231067 2523466826 113
36 iso_pu_bacteria 2738543031 2739348732 113
37 iso_pu_bacteria 2917554339 2917556263 113
38 iso_pu_bacteria 2928526807 2928528094 113
39 3300006880 Ga0075429_100170206 Ga0075429_1001702063 114
40 3300027360 Ga0209969_1066951 Ga0209969_10669512 114
41 3300050508 nmdc:mga09592_230970_c1 nmdc:mga09592_230970_c1_617_961 114
42 3300060353 Ga0501082_0557627 Ga0501082_0557627_529_873 114
43 3300005468 Ga0070707_101308724 Ga0070707_1013087241 115
44 3300006847 Ga0075431_100646685 Ga0075431_1006466852 115
45 3300039453 Ga0436362_0567947 Ga0436362_0567947_395_742 115
46 3300044712 Ga0453684_0000018 Ga0453684_0000018_895814_896161 115
47 iso_pu_bacteria 2643221588 2643950964 115
48 iso_pu_bacteria 2818991438 2819551281 115
49 iso_pu_bacteria 2882806704 2882809453 115
50 iso_pu_bacteria 2895880812 2895881213 115
51 iso_pu_bacteria 2896184354 2896186028 115
52 iso_pu_bacteria 2896253425 2896255969 115
53 iso_pu_bacteria 2929199973 2929201313 115
54 iso_pu_bacteria 8055909800 8055910080 115
55 3300005327 Ga0070658_10363440 Ga0070658_103634401 116
56 3300005339 Ga0070660_100095160 Ga0070660_1000951604 116
57 3300005458 Ga0070681_10292766 Ga0070681_102927662 116
58 3300005530 Ga0070679_100356781 Ga0070679_1003567812 116
59 3300005563 Ga0068855_100048203 Ga0068855_1000482032 116
60 3300005577 Ga0068857_100405100 Ga0068857_1004051003 116
61 3300009093 Ga0105240_10208565 Ga0105240_102085654 116
62 3300013104 Ga0157370_10043858 Ga0157370_100438582 116
63 3300025909 Ga0207705_10286787 Ga0207705_102867872 116
64 3300025912 Ga0207707_10229056 Ga0207707_102290562 116
65 3300025913 Ga0207695_10271816 Ga0207695_102718164 116
66 3300025919 Ga0207657_10167794 Ga0207657_101677944 116
67 3300025949 Ga0207667_10504900 Ga0207667_105049003 116
68 3300041460 Ga0451802_0200424 Ga0451802_0200424_221_571 116
69 3300046453 Ga0495627_110900 Ga0495627_110900_95_445 116
70 3300046507 Ga0495606_0169262 Ga0495606_0169262_256_606 116
71 3300048089 Ga0495614_0330860 Ga0495614_0330860_113_463 116
72 3300059626 Ga0587115_053735 Ga0587115_053735_81_431 116
73 iso_pu_bacteria 2510917021 2511130605 116
74 iso_pu_bacteria 2512564014 2512644639 116
75 iso_pu_bacteria 2534681786 2535485560 116
76 iso_pu_bacteria 2643221541 2643729395 116
77 iso_pu_bacteria 2643221560 2643819107 116
78 iso_pu_bacteria 2643221563 2643835024 116
79 iso_pu_bacteria 2643221606 2644045871 116
80 iso_pu_bacteria 2643221608 2644055951 116
81 iso_pu_bacteria 2643221671 2644393448 116
82 iso_pu_bacteria 2667528174 2671114049 116
83 iso_pu_bacteria 2738541275 2738710655 116
84 iso_pu_bacteria 2738541301 2738849080 116
85 iso_pu_bacteria 2738541304 2738864809 116
86 iso_pu_bacteria 2738543022 2739297327 116
87 iso_pu_bacteria 2738543033 2739359005 116
88 iso_pu_bacteria 2739367664 2739650577 116
89 iso_pu_bacteria 2739367865 2740029050 116
90 iso_pu_bacteria 2751185800 2753360572 116
91 iso_pu_bacteria 2758568016 2758643012 116
92 iso_pu_bacteria 2775507255 2778125516 116
93 iso_pu_bacteria 2808606401 2809063343 116
94 iso_pu_bacteria 2808606404 2809079221 116
95 iso_pu_bacteria 2808606405 2809083405 116
96 iso_pu_bacteria 2830075706 2830075727 116
97 iso_pu_bacteria 2838029111 2838029685 116
98 iso_pu_bacteria 2842475841 2842475885 116
99 iso_pu_bacteria 2842502639 2842503213 116
100 iso_pu_bacteria 2842694124 2842696171 116
101 iso_pu_bacteria 2848297114 2848298627 116
102 iso_pu_bacteria 2852653556 2852653613 116
103 iso_pu_bacteria 2852680915 2852683110 116
104 iso_pu_bacteria 2854911287 2854913761 116
105 iso_pu_bacteria 2880518877 2880520613 116
106 iso_pu_bacteria 2919138771 2919143208 116
107 iso_pu_bacteria 2919408235 2919408408 116
108 iso_pu_bacteria 2919709256 2919712071 116
109 iso_pu_bacteria 2928027323 2928029438 116
110 iso_pu_bacteria 2928100450 2928100756 116
111 iso_pu_bacteria 2928959182 2928960819 116
112 iso_pu_bacteria 2946787523 2946789913 116
113 iso_pu_bacteria 2984555340 2984556636 116
114 iso_pu_bacteria 2984564862 2984565191 116
115 iso_pu_bacteria 2990265787 2990265818 116
116 iso_pu_bacteria 2993356040 2993356267 116
117 iso_pu_bacteria 2993693658 2993696391 116
118 iso_pu_bacteria 8045864390 8045868605 116
119 iso_pu_bacteria 8054302542 8054305463 116
120 iso_pu_bacteria 8057101203 8057105458 116
121 3300005459 Ga0068867_100308340 Ga0068867_1003083402 117
122 3300005548 Ga0070665_100194694 Ga0070665_1001946943 117
123 3300005548 Ga0070665_100715964 Ga0070665_1007159641 117
124 3300006048 Ga0075363_100320506 Ga0075363_1003205061 117
125 3300006186 Ga0075369_10342322 Ga0075369_103423221 117
126 3300014968 Ga0157379_10755116 Ga0157379_107551162 117
127 3300028379 Ga0268266_10139743 Ga0268266_101397432 117
128 3300041505 Ga0451849_0506178 Ga0451849_0506178_512_865 117
129 3300050490 nmdc:mga03n38_287541_c1 nmdc:mga03n38_287541_c1_68_421 117
130 3300050516 nmdc:mga0sz30_219875_c1 nmdc:mga0sz30_219875_c1_37_390 117
131 3300001979 JGI24740J21852_10169404 JGI24740J21852_101694042 118
132 3300002459 JGI24751J29686_10014858 JGI24751J29686_100148583 118
133 3300002459 JGI24751J29686_10094936 JGI24751J29686_100949361 118
134 3300002741 JGI25157J39369_1022777 JGI25157J39369_10227771 118
135 3300005329 Ga0070683_101072531 Ga0070683_1010725312 118
136 3300005335 Ga0070666_10351601 Ga0070666_103516013 118
137 3300005335 Ga0070666_10921308 Ga0070666_109213081 118
138 3300005336 Ga0070680_100015107 Ga0070680_1000151074 118
139 3300005347 Ga0070668_100005413 Ga0070668_1000054138 118
140 3300005347 Ga0070668_101004698 Ga0070668_1010046981 118
141 3300005353 Ga0070669_100216629 Ga0070669_1002166293 118
142 3300005367 Ga0070667_100054770 Ga0070667_1000547704 118
143 3300005367 Ga0070667_100092193 Ga0070667_1000921933 118
144 3300005435 Ga0070714_100534842 Ga0070714_1005348421 118
145 3300005458 Ga0070681_10473062 Ga0070681_104730622 118
146 3300005548 Ga0070665_100025820 Ga0070665_1000258207 118
147 3300005563 Ga0068855_100149492 Ga0068855_1001494924 118
148 3300005563 Ga0068855_100151509 Ga0068855_1001515092 118
149 3300005563 Ga0068855_100352292 Ga0068855_1003522923 118
150 3300005577 Ga0068857_101514112 Ga0068857_1015141122 118
151 3300005616 Ga0068852_100104161 Ga0068852_1001041613 118
152 3300005618 Ga0068864_100002565 Ga0068864_1000025658 118
153 3300005618 Ga0068864_100113697 Ga0068864_1001136974 118
154 3300005719 Ga0068861_101179441 Ga0068861_1011794412 118
155 3300005841 Ga0068863_100000103 Ga0068863_1000001038 118
156 3300005841 Ga0068863_100000470 Ga0068863_1000004709 118
157 3300005842 Ga0068858_100000240 Ga0068858_10000024049 118
158 3300005842 Ga0068858_100090763 Ga0068858_1000907634 118
159 3300005842 Ga0068858_100268179 Ga0068858_1002681792 118
160 3300005843 Ga0068860_100000093 Ga0068860_10000009310 118
161 3300005843 Ga0068860_100540490 Ga0068860_1005404902 118
162 3300005844 Ga0068862_100064939 Ga0068862_1000649392 118
163 3300005844 Ga0068862_100083636 Ga0068862_1000836364 118
164 3300005844 Ga0068862_100177531 Ga0068862_1001775311 118
165 3300005844 Ga0068862_100223523 Ga0068862_1002235232 118
166 3300005937 Ga0081455_10006703 Ga0081455_100067032 118
167 3300005985 Ga0081539_10187932 Ga0081539_101879321 118
168 3300006042 Ga0075368_10573514 Ga0075368_105735141 118
169 3300006173 Ga0070716_101229369 Ga0070716_1012293691 118
170 3300006195 Ga0075366_10068362 Ga0075366_100683624 118
171 3300006195 Ga0075366_10279790 Ga0075366_102797902 118
172 3300006195 Ga0075366_10498372 Ga0075366_104983722 118
173 3300006353 Ga0075370_10000552 Ga0075370_1000055211 118
174 3300006353 Ga0075370_10007347 Ga0075370_100073474 118
175 3300006353 Ga0075370_10062810 Ga0075370_100628105 118
176 3300006358 Ga0068871_101231305 Ga0068871_1012313052 118
177 3300006844 Ga0075428_101155925 Ga0075428_1011559252 118
178 3300006847 Ga0075431_101111348 Ga0075431_1011113482 118
179 3300006881 Ga0068865_100038165 Ga0068865_1000381654 118
180 3300006946 Ga0079104_1016558 Ga0079104_10165583 118
181 3300006946 Ga0079104_1056291 Ga0079104_10562912 118
182 3300009092 Ga0105250_10055977 Ga0105250_100559772 118
183 3300009093 Ga0105240_10033337 Ga0105240_100333374 118
184 3300009093 Ga0105240_10172559 Ga0105240_101725593 118
185 3300009148 Ga0105243_10428990 Ga0105243_104289902 118
186 3300009148 Ga0105243_12506502 Ga0105243_125065021 118
187 3300009177 Ga0105248_10040085 Ga0105248_100400852 118
188 3300009177 Ga0105248_10411651 Ga0105248_104116512 118
189 3300009177 Ga0105248_10427522 Ga0105248_104275222 118
190 3300009177 Ga0105248_10694502 Ga0105248_106945022 118
191 3300009553 Ga0105249_10295522 Ga0105249_102955222 118
192 3300009553 Ga0105249_12456644 Ga0105249_124566442 118
193 3300010375 Ga0105239_10141412 Ga0105239_101414122 118
194 3300010375 Ga0105239_11128643 Ga0105239_111286431 118
195 3300013102 Ga0157371_10045817 Ga0157371_100458175 118
196 3300013104 Ga0157370_11051939 Ga0157370_110519392 118
197 3300013105 Ga0157369_10130301 Ga0157369_101303012 118
198 3300013306 Ga0163162_10572536 Ga0163162_105725362 118
199 3300013307 Ga0157372_10039997 Ga0157372_100399972 118
200 3300013308 Ga0157375_11363990 Ga0157375_113639902 118
201 3300014325 Ga0163163_10095231 Ga0163163_100952312 118
202 3300014325 Ga0163163_11817517 Ga0163163_118175172 118
203 3300021377 Ga0213874_10044093 Ga0213874_100440932 118
204 3300021384 Ga0213876_10000232 Ga0213876_1000023212 118
205 3300021441 Ga0213871_10061314 Ga0213871_100613142 118
206 3300025250 Ga0209026_1007893 Ga0209026_10078931 118
207 3300025272 Ga0209455_1024602 Ga0209455_10246022 118
208 3300025711 Ga0207696_1032104 Ga0207696_10321042 118
209 3300025900 Ga0207710_10353504 Ga0207710_103535041 118
210 3300025903 Ga0207680_10266087 Ga0207680_102660872 118
211 3300025912 Ga0207707_10431688 Ga0207707_104316882 118
212 3300025913 Ga0207695_10001285 Ga0207695_1000128531 118
213 3300025913 Ga0207695_10041989 Ga0207695_100419893 118
214 3300025917 Ga0207660_10263836 Ga0207660_102638363 118
215 3300025923 Ga0207681_10191146 Ga0207681_101911463 118
216 3300025925 Ga0207650_10293222 Ga0207650_102932222 118
217 3300025927 Ga0207687_11230628 Ga0207687_112306282 118
218 3300025931 Ga0207644_10587733 Ga0207644_105877332 118
219 3300025933 Ga0207706_10256104 Ga0207706_102561042 118
220 3300025938 Ga0207704_10034319 Ga0207704_100343192 118
221 3300025941 Ga0207711_10000424 Ga0207711_100004249 118
222 3300025941 Ga0207711_10079894 Ga0207711_100798942 118
223 3300025941 Ga0207711_10126112 Ga0207711_101261123 118
224 3300025941 Ga0207711_10430961 Ga0207711_104309613 118
225 3300025942 Ga0207689_10972965 Ga0207689_109729652 118
226 3300025949 Ga0207667_10028735 Ga0207667_100287354 118
227 3300025961 Ga0207712_10734217 Ga0207712_107342172 118
228 3300025972 Ga0207668_10000033 Ga0207668_1000003350 118
229 3300025972 Ga0207668_10407814 Ga0207668_104078142 118
230 3300025972 Ga0207668_10521861 Ga0207668_105218612 118
231 3300025972 Ga0207668_11184631 Ga0207668_111846312 118
232 3300025986 Ga0207658_10034101 Ga0207658_100341014 118
233 3300026035 Ga0207703_10000079 Ga0207703_100000799 118
234 3300026035 Ga0207703_10044815 Ga0207703_100448153 118
235 3300026035 Ga0207703_10728259 Ga0207703_107282591 118
236 3300026067 Ga0207678_10787375 Ga0207678_107873752 118
237 3300026067 Ga0207678_11454183 Ga0207678_114541831 118
238 3300026088 Ga0207641_10000034 Ga0207641_100000349 118
239 3300026088 Ga0207641_10000113 Ga0207641_100001138 118
240 3300026088 Ga0207641_11495290 Ga0207641_114952902 118
241 3300026095 Ga0207676_10000103 Ga0207676_1000010366 118
242 3300026095 Ga0207676_10023358 Ga0207676_100233584 118
243 3300026095 Ga0207676_11201633 Ga0207676_112016331 118
244 3300026118 Ga0207675_100927386 Ga0207675_1009273862 118
245 3300026121 Ga0207683_10889630 Ga0207683_108896301 118
246 3300026142 Ga0207698_10731586 Ga0207698_107315862 118
247 3300027111 Ga0209281_1035841 Ga0209281_10358411 118
248 3300027378 Ga0209981_1009685 Ga0209981_10096852 118
249 3300027543 Ga0209999_1005300 Ga0209999_10053003 118
250 3300027717 Ga0209998_10130355 Ga0209998_101303552 118
251 3300028379 Ga0268266_10002389 Ga0268266_1000238926 118
252 3300028379 Ga0268266_10110749 Ga0268266_101107492 118
253 3300028380 Ga0268265_10140009 Ga0268265_101400094 118
254 3300028380 Ga0268265_10401274 Ga0268265_104012742 118
255 3300028380 Ga0268265_10925105 Ga0268265_109251052 118
256 3300028381 Ga0268264_10000067 Ga0268264_10000067282 118
257 3300028381 Ga0268264_10333039 Ga0268264_103330391 118
258 3300028558 Ga0265326_10024973 Ga0265326_100249731 118
259 3300028573 Ga0265334_10044496 Ga0265334_100444963 118
260 3300028800 Ga0265338_10010218 Ga0265338_100102182 118
261 3300028800 Ga0265338_10011065 Ga0265338_1001106512 118
262 3300031241 Ga0265325_10072483 Ga0265325_100724832 118
263 3300031247 Ga0265340_10060998 Ga0265340_100609982 118
264 3300031247 Ga0265340_10503640 Ga0265340_105036402 118
265 3300031249 Ga0265339_10147493 Ga0265339_101474932 118
266 3300031250 Ga0265331_10006566 Ga0265331_100065666 118
267 3300031251 Ga0265327_10000454 Ga0265327_1000045465 118
268 3300031251 Ga0265327_10016302 Ga0265327_100163023 118
269 3300031456 Ga0307513_10013182 Ga0307513_100131822 118
270 3300031595 Ga0265313_10022615 Ga0265313_100226155 118
271 3300031616 Ga0307508_10217158 Ga0307508_102171582 118
272 3300031665 Ga0316575_10083397 Ga0316575_100833972 118
273 3300031691 Ga0316579_10016916 Ga0316579_100169163 118
274 3300031711 Ga0265314_10128194 Ga0265314_101281943 118
275 3300031711 Ga0265314_10293885 Ga0265314_102938852 118
276 3300031727 Ga0316576_10403734 Ga0316576_104037342 118
277 3300031727 Ga0316576_10504923 Ga0316576_105049231 118
278 3300031727 Ga0316576_10746205 Ga0316576_107462051 118
279 3300031727 Ga0316576_11027791 Ga0316576_110277912 118
280 3300031728 Ga0316578_10081398 Ga0316578_100813984 118
281 3300031730 Ga0307516_10307958 Ga0307516_103079583 118
282 3300031733 Ga0316577_10044978 Ga0316577_100449782 118
283 3300031995 Ga0307409_101743755 Ga0307409_1017437552 118
284 3300032139 Ga0316580_10117988 Ga0316580_101179882 118
285 3300032168 Ga0316593_10033954 Ga0316593_100339542 118
286 3300033180 Ga0307510_10155235 Ga0307510_101552352 118
287 3300033524 Ga0316592_1054171 Ga0316592_10541711 118
288 3300033528 Ga0316588_1049789 Ga0316588_10497892 118
289 3300035091 Ga0373951_0150911 Ga0373951_0150911_267_623 118
290 3300035119 Ga0373956_0581413 Ga0373956_0581413_43_399 118
291 3300035242 Ga0373962_0019956 Ga0373962_0019956_493_849 118
292 3300035398 Ga0316574_0037577 Ga0316574_0037577_1369_1725 118
293 3300035691 Ga0373931_0007458 Ga0373931_0007458_3728_4084 118
294 3300035695 Ga0373927_0613566 Ga0373927_0613566_29_385 118
295 3300035724 Ga0373933_0335654 Ga0373933_0335654_360_716 118
296 3300036401 Ga0373937_0767158 Ga0373937_0767158_149_505 118
297 3300036401 Ga0373937_1269106 Ga0373937_1269106_95_451 118
298 3300036712 Ga0316584_0124021 Ga0316584_0124021_1041_1397 118
299 3300037588 Ga0316581_0049060 Ga0316581_0049060_110_466 118
300 3300037853 Ga0436364_1178388 Ga0436364_1178388_59_415 118
301 3300037853 Ga0436364_1558455 Ga0436364_1558455_28_384 118
302 3300039062 Ga0400483_068661 Ga0400483_068661_756_1118 118
303 3300039062 Ga0400483_173078 Ga0400483_173078_1366_1728 118
304 3300039062 Ga0400483_180542 Ga0400483_180542_172_534 118
305 3300039437 Ga0436365_0105609 Ga0436365_0105609_164_520 118
306 3300039437 Ga0436365_1426025 Ga0436365_1426025_21107_21463 118
307 3300039437 Ga0436365_1472042 Ga0436365_1472042_133_489 118
308 3300039438 Ga0436360_0160866 Ga0436360_0160866_401_757 118
309 3300039447 Ga0436361_0738968 Ga0436361_0738968_171_527 118
310 3300039450 Ga0436363_0381568 Ga0436363_0381568_731_1087 118
311 3300039450 Ga0436363_0564773 Ga0436363_0564773_84_440 118
312 3300039453 Ga0436362_0064393 Ga0436362_0064393_124_480 118
313 3300041463 Ga0451804_0831235 Ga0451804_0831235_50_406 118
314 3300041498 Ga0451841_1387938 Ga0451841_1387938_76_432 118
315 3300041505 Ga0451849_1361625 Ga0451849_1361625_143_499 118
316 3300041512 Ga0451853_0214658 Ga0451853_0214658_99_455 118
317 3300045051 Ga0451576_0104195 Ga0451576_0104195_1255_1617 118
318 3300045051 Ga0451576_1337580 Ga0451576_1337580_332_694 118
319 3300046459 Ga0495629_0452251 Ga0495629_0452251_490_846 118
320 3300046473 Ga0495582_0198735 Ga0495582_0198735_645_1001 118
321 3300046475 Ga0495639_0431714 Ga0495639_0431714_202_558 118
322 3300046515 Ga0495620_0158030 Ga0495620_0158030_412_768 118
323 3300046522 Ga0495643_0018560 Ga0495643_0018560_431_787 118
324 3300046538 Ga0495609_0014892 Ga0495609_0014892_929_1285 118
325 3300046542 Ga0495597_0001366 Ga0495597_0001366_13345_13701 118
326 3300046557 Ga0495622_0002718 Ga0495622_0002718_989_1345 118
327 3300046616 Ga0495668_0060236 Ga0495668_0060236_1395_1751 118
328 3300046660 Ga0495625_0502195 Ga0495625_0502195_236_592 118
329 3300046691 Ga0495670_0019654 Ga0495670_0019654_1703_2059 118
330 3300047320 Ga0495672_0000949 Ga0495672_0000949_13059_13415 118
331 3300047320 Ga0495672_0105363 Ga0495672_0105363_205_561 118
332 3300047321 Ga0495676_0980730 Ga0495676_0980730_94_450 118
333 3300047443 Ga0495687_070086 Ga0495687_070086_575_931 118
334 3300047673 Ga0495593_0132220 Ga0495593_0132220_287_643 118
335 3300048088 Ga0495602_0544390 Ga0495602_0544390_287_643 118
336 3300048903 Ga0496100_0739231 Ga0496100_0739231_51_407 118
337 3300048904 Ga0496101_0699349 Ga0496101_0699349_382_738 118
338 3300048905 Ga0496102_0835597 Ga0496102_0835597_75_485 118
339 3300048906 Ga0496103_0166053 Ga0496103_0166053_990_1400 118
340 3300048907 Ga0496104_0105804 Ga0496104_0105804_1678_2088 118
341 3300048907 Ga0496104_1507275 Ga0496104_1507275_164_520 118
342 3300048908 Ga0496105_0000224 Ga0496105_0000224_29670_30080 118
343 3300048909 Ga0496106_0247417 Ga0496106_0247417_686_1042 118
344 3300048913 Ga0496110_1481549 Ga0496110_1481549_139_495 118
345 3300048915 Ga0496112_0079683 Ga0496112_0079683_820_1176 118
346 3300048917 Ga0496114_1063801 Ga0496114_1063801_77_433 118
347 3300048920 Ga0496117_0182822 Ga0496117_0182822_495_851 118
348 3300048921 Ga0496118_0441539 Ga0496118_0441539_222_632 118
349 3300048923 Ga0496120_0391774 Ga0496120_0391774_146_556 118
350 3300048924 Ga0496121_0001842 Ga0496121_0001842_11238_11594 118
351 3300048924 Ga0496121_0372495 Ga0496121_0372495_358_714 118
352 3300049530 Ga0501314_013551 Ga0501314_013551_408_773 118
353 3300049569 Ga0501032_0040485 Ga0501032_0040485_495_851 118
354 3300049570 Ga0501033_0007968 Ga0501033_0007968_924_1280 118
355 3300049571 Ga0501034_0002186 Ga0501034_0002186_12930_13286 118
356 3300049573 Ga0501037_0009229 Ga0501037_0009229_6111_6467 118
357 3300049579 Ga0501043_0599375 Ga0501043_0599375_89_445 118
358 3300049580 Ga0501046_0457290 Ga0501046_0457290_78_476 118
359 3300049581 Ga0501047_0026712 Ga0501047_0026712_241_597 118
360 3300049581 Ga0501047_0033769 Ga0501047_0033769_111_467 118
361 3300049581 Ga0501047_0657915 Ga0501047_0657915_15_371 118
362 3300049581 Ga0501047_0822508 Ga0501047_0822508_338_694 118
363 3300049581 Ga0501047_0863175 Ga0501047_0863175_110_466 118
364 3300049582 Ga0501048_0121964 Ga0501048_0121964_1169_1525 118
365 3300049582 Ga0501048_0510115 Ga0501048_0510115_356_712 118
366 3300049583 Ga0501067_0668564 Ga0501067_0668564_176_532 118
367 3300049588 Ga0501072_0042687 Ga0501072_0042687_3158_3514 118
368 3300049588 Ga0501072_0438394 Ga0501072_0438394_250_612 118
369 3300049588 Ga0501072_1407628 Ga0501072_1407628_71_433 118
370 3300049588 Ga0501072_1562280 Ga0501072_1562280_63_425 118
371 3300049590 Ga0501074_0088240 Ga0501074_0088240_1368_1724 118
372 3300049742 Ga0501080_0025689 Ga0501080_0025689_420_776 118
373 3300049744 Ga0501083_0008419 Ga0501083_0008419_1280_1636 118
374 3300049823 Ga0501044_0002552 Ga0501044_0002552_5646_6002 118
375 3300049823 Ga0501044_0764053 Ga0501044_0764053_51_407 118
376 3300049823 Ga0501044_0989905 Ga0501044_0989905_139_495 118
377 3300050493 nmdc:mga0k408_240791_c1 nmdc:mga0k408_240791_c1_10_366 118
378 3300050493 nmdc:mga0k408_258052_c1 nmdc:mga0k408_258052_c1_576_932 118
379 3300050493 nmdc:mga0k408_597285_c1 nmdc:mga0k408_597285_c1_259_615 118
380 3300050496 nmdc:mga07m45_1364_c1 nmdc:mga07m45_1364_c1_6188_6544 118
381 3300050496 nmdc:mga07m45_152392_c1 nmdc:mga07m45_152392_c1_217_573 118
382 3300050507 nmdc:mga05p37_742319_c1 nmdc:mga05p37_742319_c1_277_636 118
383 3300050509 nmdc:mga0qj67_990138_c1 nmdc:mga0qj67_990138_c1_283_642 118
384 3300053086 Ga0500578_0179768 Ga0500578_0179768_144_500 118
385 3300053087 Ga0500643_011852 Ga0500643_011852_46_402 118
386 3300053092 Ga0500583_0316102 Ga0500583_0316102_143_499 118
387 3300053093 Ga0500651_0014119 Ga0500651_0014119_4297_4653 118
388 3300053096 Ga0500641_0000659 Ga0500641_0000659_3089_3445 118
389 3300053109 Ga0500569_005008 Ga0500569_005008_404_760 118
390 3300053119 Ga0500595_002712 Ga0500595_002712_6942_7298 118
391 3300053119 Ga0500595_008471 Ga0500595_008471_230_586 118
392 3300053119 Ga0500595_120560 Ga0500595_120560_105_461 118
393 3300053122 Ga0500608_002556 Ga0500608_002556_284_640 118
394 3300053123 Ga0500614_010872 Ga0500614_010872_143_499 118
395 3300053136 Ga0500559_0003528 Ga0500559_0003528_5516_5872 118
396 3300053142 Ga0500577_0173127 Ga0500577_0173127_143_499 118
397 3300053148 Ga0500590_090953 Ga0500590_090953_984_1340 118
398 3300053154 Ga0500619_027359 Ga0500619_027359_864_1220 118
399 3300053155 Ga0500620_057430 Ga0500620_057430_519_875 118
400 3300053156 Ga0500622_0012682 Ga0500622_0012682_188_544 118
401 3300053162 Ga0500638_143809 Ga0500638_143809_109_465 118
402 3300053730 Ga0500645_075751 Ga0500645_075751_180_536 118
403 3300053732 Ga0500656_075007 Ga0500656_075007_148_504 118
404 3300053733 Ga0500552_096926 Ga0500552_096926_126_482 118
405 3300053735 Ga0500596_001392 Ga0500596_001392_523_879 118
406 3300054114 Ga0501084_0310208 Ga0501084_0310208_703_1059 118
407 3300059509 Ga0587089_031636 Ga0587089_031636_302_658 118
408 3300059512 Ga0587092_120063 Ga0587092_120063_22_378 118
409 3300059605 Ga0587106_003817 Ga0587106_003817_1180_1539 118
410 3300059605 Ga0587106_064527 Ga0587106_064527_26_382 118
411 3300059645 Ga0587076_042906 Ga0587076_042906_423_779 118
412 3300060353 Ga0501082_0027632 Ga0501082_0027632_1222_1578 118
413 2162886007 SwRhRL2b_contig_1878598 SwRhRL2b_0397.00008170 119
414 2162886007 SwRhRL2b_contig_2761788 SwRhRL2b_0196.00007380 119
415 3300001904 JGI24736J21556_1000841 JGI24736J21556_10008413 119
416 3300001979 JGI24740J21852_10054054 JGI24740J21852_100540542 119
417 3300001979 JGI24740J21852_10113049 JGI24740J21852_101130492 119
418 3300001989 JGI24739J22299_10017766 JGI24739J22299_100177664 119
419 3300001990 JGI24737J22298_10016354 JGI24737J22298_100163543 119
420 3300001990 JGI24737J22298_10028620 JGI24737J22298_100286203 119
421 3300001991 JGI24743J22301_10031593 JGI24743J22301_100315932 119
422 3300002070 JGI24750J21931_1005276 JGI24750J21931_10052762 119
423 3300002077 JGI24744J21845_10038391 JGI24744J21845_100383912 119
424 3300003371 JGI26145J50221_1008080 JGI26145J50221_10080801 119
425 3300003781 Ga0055536_1010360 Ga0055536_10103603 119
426 3300003791 Ga0055530_10008924 Ga0055530_100089244 119
427 3300003791 Ga0055530_10098501 Ga0055530_100985011 119
428 3300004798 Ga0058859_11630952 Ga0058859_116309522 119
429 3300005289 Ga0065704_10070408 Ga0065704_1007040815 119
430 3300005289 Ga0065704_10074213 Ga0065704_100742133 119
431 3300005289 Ga0065704_10123182 Ga0065704_101231822 119
432 3300005290 Ga0065712_10077425 Ga0065712_100774254 119
433 3300005295 Ga0065707_10089502 Ga0065707_100895023 119
434 3300005327 Ga0070658_10004556 Ga0070658_100045562 119
435 3300005327 Ga0070658_10132051 Ga0070658_101320512 119
436 3300005327 Ga0070658_10345800 Ga0070658_103458002 119
437 3300005327 Ga0070658_10441636 Ga0070658_104416362 119
438 3300005328 Ga0070676_10001859 Ga0070676_1000185910 119
439 3300005329 Ga0070683_100027795 Ga0070683_1000277954 119
440 3300005329 Ga0070683_100036618 Ga0070683_1000366185 119
441 3300005329 Ga0070683_101024501 Ga0070683_1010245012 119
442 3300005329 Ga0070683_101876743 Ga0070683_1018767431 119
443 3300005330 Ga0070690_100001067 Ga0070690_1000010679 119
444 3300005330 Ga0070690_100230956 Ga0070690_1002309561 119
445 3300005330 Ga0070690_100634766 Ga0070690_1006347661 119
446 3300005331 Ga0070670_100001783 Ga0070670_1000017837 119
447 3300005331 Ga0070670_100034735 Ga0070670_1000347353 119
448 3300005334 Ga0068869_100047300 Ga0068869_1000473004 119
449 3300005335 Ga0070666_10002290 Ga0070666_100022908 119
450 3300005335 Ga0070666_10112794 Ga0070666_101127942 119
451 3300005336 Ga0070680_100018879 Ga0070680_1000188795 119
452 3300005336 Ga0070680_100714063 Ga0070680_1007140632 119
453 3300005337 Ga0070682_100003964 Ga0070682_1000039644 119
454 3300005337 Ga0070682_100229299 Ga0070682_1002292992 119
455 3300005337 Ga0070682_100246443 Ga0070682_1002464432 119
456 3300005338 Ga0068868_100002615 Ga0068868_10000261514 119
457 3300005339 Ga0070660_100000584 Ga0070660_1000005848 119
458 3300005339 Ga0070660_100004220 Ga0070660_10000422010 119
459 3300005339 Ga0070660_100242779 Ga0070660_1002427793 119
460 3300005340 Ga0070689_100005611 Ga0070689_1000056118 119
461 3300005340 Ga0070689_100060369 Ga0070689_1000603693 119
462 3300005340 Ga0070689_100698428 Ga0070689_1006984282 119
463 3300005341 Ga0070691_10000302 Ga0070691_100003023 119
464 3300005341 Ga0070691_10305346 Ga0070691_103053461 119
465 3300005343 Ga0070687_100000686 Ga0070687_1000006864 119
466 3300005344 Ga0070661_100000507 Ga0070661_10000050732 119
467 3300005344 Ga0070661_100000976 Ga0070661_10000097622 119
468 3300005344 Ga0070661_100206559 Ga0070661_1002065592 119
469 3300005344 Ga0070661_100244966 Ga0070661_1002449662 119
470 3300005344 Ga0070661_100281820 Ga0070661_1002818202 119
471 3300005345 Ga0070692_10000534 Ga0070692_100005344 119
472 3300005347 Ga0070668_100024692 Ga0070668_1000246923 119
473 3300005347 Ga0070668_100699953 Ga0070668_1006999531 119
474 3300005347 Ga0070668_100834014 Ga0070668_1008340141 119
475 3300005353 Ga0070669_100001148 Ga0070669_10000114812 119
476 3300005353 Ga0070669_100001940 Ga0070669_1000019406 119
477 3300005353 Ga0070669_100361280 Ga0070669_1003612801 119
478 3300005354 Ga0070675_100001202 Ga0070675_1000012029 119
479 3300005354 Ga0070675_100101930 Ga0070675_1001019303 119
480 3300005355 Ga0070671_100001052 Ga0070671_1000010525 119
481 3300005355 Ga0070671_100001262 Ga0070671_10000126211 119
482 3300005355 Ga0070671_100361216 Ga0070671_1003612162 119
483 3300005356 Ga0070674_100016076 Ga0070674_1000160763 119
484 3300005356 Ga0070674_100182352 Ga0070674_1001823522 119
485 3300005356 Ga0070674_102221935 Ga0070674_1022219351 119
486 3300005364 Ga0070673_100000673 Ga0070673_10000067315 119
487 3300005364 Ga0070673_100169382 Ga0070673_1001693824 119
488 3300005365 Ga0070688_100004077 Ga0070688_1000040774 119
489 3300005365 Ga0070688_100027433 Ga0070688_1000274333 119
490 3300005365 Ga0070688_100102443 Ga0070688_1001024432 119
491 3300005366 Ga0070659_100005781 Ga0070659_1000057813 119
492 3300005366 Ga0070659_100006377 Ga0070659_1000063778 119
493 3300005366 Ga0070659_100026584 Ga0070659_1000265844 119
494 3300005366 Ga0070659_100550632 Ga0070659_1005506321 119
495 3300005366 Ga0070659_101456372 Ga0070659_1014563721 119
496 3300005367 Ga0070667_100001801 Ga0070667_10000180115 119
497 3300005367 Ga0070667_100045751 Ga0070667_1000457513 119
498 3300005367 Ga0070667_100279150 Ga0070667_1002791502 119
499 3300005367 Ga0070667_100406367 Ga0070667_1004063671 119
500 3300005406 Ga0070703_10017825 Ga0070703_100178252 119
501 3300005434 Ga0070709_10000225 Ga0070709_1000022540 119
502 3300005435 Ga0070714_100010651 Ga0070714_1000106517 119
503 3300005436 Ga0070713_100013772 Ga0070713_1000137722 119
504 3300005437 Ga0070710_10516476 Ga0070710_105164762 119
505 3300005437 Ga0070710_10672815 Ga0070710_106728151 119
506 3300005438 Ga0070701_10000713 Ga0070701_100007133 119
507 3300005438 Ga0070701_10029761 Ga0070701_100297613 119
508 3300005438 Ga0070701_10313934 Ga0070701_103139342 119
509 3300005439 Ga0070711_100000237 Ga0070711_1000002378 119
510 3300005439 Ga0070711_100629191 Ga0070711_1006291912 119
511 3300005439 Ga0070711_101126626 Ga0070711_1011266262 119
512 3300005440 Ga0070705_100000934 Ga0070705_1000009343 119
513 3300005440 Ga0070705_100116536 Ga0070705_1001165364 119
514 3300005440 Ga0070705_100178976 Ga0070705_1001789763 119
515 3300005441 Ga0070700_100008931 Ga0070700_1000089313 119
516 3300005441 Ga0070700_100030356 Ga0070700_1000303562 119
517 3300005441 Ga0070700_100281035 Ga0070700_1002810353 119
518 3300005441 Ga0070700_100442035 Ga0070700_1004420352 119
519 3300005441 Ga0070700_100818039 Ga0070700_1008180392 119
520 3300005444 Ga0070694_100006630 Ga0070694_1000066303 119
521 3300005455 Ga0070663_100000497 Ga0070663_10000049712 119
522 3300005455 Ga0070663_100067038 Ga0070663_1000670383 119
523 3300005455 Ga0070663_100094287 Ga0070663_1000942873 119
524 3300005455 Ga0070663_100221819 Ga0070663_1002218192 119
525 3300005455 Ga0070663_100454112 Ga0070663_1004541122 119
526 3300005456 Ga0070678_100003959 Ga0070678_1000039592 119
527 3300005456 Ga0070678_100143973 Ga0070678_1001439733 119
528 3300005456 Ga0070678_100252705 Ga0070678_1002527052 119
529 3300005456 Ga0070678_101236258 Ga0070678_1012362581 119
530 3300005457 Ga0070662_100002792 Ga0070662_1000027922 119
531 3300005457 Ga0070662_100004743 Ga0070662_1000047437 119
532 3300005457 Ga0070662_100629863 Ga0070662_1006298632 119
533 3300005457 Ga0070662_100920695 Ga0070662_1009206951 119
534 3300005458 Ga0070681_10011638 Ga0070681_100116384 119
535 3300005458 Ga0070681_10035996 Ga0070681_100359964 119
536 3300005459 Ga0068867_100033471 Ga0068867_1000334713 119
537 3300005459 Ga0068867_100129295 Ga0068867_1001292952 119
538 3300005459 Ga0068867_100156147 Ga0068867_1001561472 119
539 3300005459 Ga0068867_101713003 Ga0068867_1017130032 119
540 3300005466 Ga0070685_10014056 Ga0070685_100140564 119
541 3300005466 Ga0070685_10078251 Ga0070685_100782512 119
542 3300005468 Ga0070707_100229142 Ga0070707_1002291423 119
543 3300005530 Ga0070679_100205823 Ga0070679_1002058232 119
544 3300005530 Ga0070679_100304300 Ga0070679_1003043003 119
545 3300005535 Ga0070684_100020003 Ga0070684_1000200033 119
546 3300005535 Ga0070684_100471018 Ga0070684_1004710182 119
547 3300005536 Ga0070697_100004352 Ga0070697_1000043525 119
548 3300005539 Ga0068853_100001129 Ga0068853_10000112915 119
549 3300005539 Ga0068853_100002735 Ga0068853_1000027353 119
550 3300005539 Ga0068853_100200594 Ga0068853_1002005943 119
551 3300005539 Ga0068853_100719926 Ga0068853_1007199262 119
552 3300005543 Ga0070672_100001428 Ga0070672_1000014283 119
553 3300005543 Ga0070672_100645023 Ga0070672_1006450231 119
554 3300005544 Ga0070686_100000710 Ga0070686_10000071012 119
555 3300005544 Ga0070686_100340905 Ga0070686_1003409052 119
556 3300005544 Ga0070686_100618113 Ga0070686_1006181132 119
557 3300005544 Ga0070686_100664360 Ga0070686_1006643602 119
558 3300005545 Ga0070695_100000578 Ga0070695_1000005783 119
559 3300005546 Ga0070696_100024910 Ga0070696_1000249104 119
560 3300005547 Ga0070693_100012681 Ga0070693_1000126813 119
561 3300005547 Ga0070693_100564453 Ga0070693_1005644532 119
562 3300005548 Ga0070665_100000079 Ga0070665_100000079134 119
563 3300005548 Ga0070665_100000296 Ga0070665_10000029641 119
564 3300005548 Ga0070665_100016450 Ga0070665_1000164502 119
565 3300005548 Ga0070665_100045038 Ga0070665_1000450383 119
566 3300005548 Ga0070665_101355634 Ga0070665_1013556342 119
567 3300005549 Ga0070704_100011048 Ga0070704_1000110486 119
568 3300005563 Ga0068855_100006792 Ga0068855_1000067923 119
569 3300005563 Ga0068855_100022265 Ga0068855_1000222655 119
570 3300005563 Ga0068855_100252767 Ga0068855_1002527673 119
571 3300005563 Ga0068855_100280798 Ga0068855_1002807983 119
572 3300005563 Ga0068855_100300284 Ga0068855_1003002842 119
573 3300005563 Ga0068855_100563257 Ga0068855_1005632572 119
574 3300005564 Ga0070664_100005810 Ga0070664_1000058107 119
575 3300005564 Ga0070664_100434352 Ga0070664_1004343523 119
576 3300005564 Ga0070664_100930601 Ga0070664_1009306012 119
577 3300005577 Ga0068857_100002722 Ga0068857_1000027228 119
578 3300005577 Ga0068857_100015261 Ga0068857_1000152614 119
579 3300005577 Ga0068857_100033167 Ga0068857_1000331672 119
580 3300005577 Ga0068857_101290001 Ga0068857_1012900012 119
581 3300005578 Ga0068854_100000389 Ga0068854_1000003897 119
582 3300005578 Ga0068854_100028613 Ga0068854_1000286133 119
583 3300005578 Ga0068854_100035059 Ga0068854_1000350594 119
584 3300005578 Ga0068854_100062705 Ga0068854_1000627055 119
585 3300005578 Ga0068854_100198525 Ga0068854_1001985254 119
586 3300005578 Ga0068854_100631004 Ga0068854_1006310042 119
587 3300005614 Ga0068856_100001928 Ga0068856_1000019283 119
588 3300005614 Ga0068856_100002574 Ga0068856_1000025744 119
589 3300005614 Ga0068856_100204231 Ga0068856_1002042313 119
590 3300005614 Ga0068856_100620084 Ga0068856_1006200842 119
591 3300005614 Ga0068856_100957019 Ga0068856_1009570192 119
592 3300005614 Ga0068856_101117063 Ga0068856_1011170632 119
593 3300005615 Ga0070702_100000088 Ga0070702_10000008822 119
594 3300005615 Ga0070702_100074831 Ga0070702_1000748313 119
595 3300005616 Ga0068852_100014137 Ga0068852_1000141373 119
596 3300005616 Ga0068852_100225405 Ga0068852_1002254053 119
597 3300005616 Ga0068852_100327281 Ga0068852_1003272812 119
598 3300005617 Ga0068859_100002269 Ga0068859_10000226910 119
599 3300005618 Ga0068864_100003629 Ga0068864_10000362911 119
600 3300005718 Ga0068866_10008498 Ga0068866_100084983 119
601 3300005718 Ga0068866_10032331 Ga0068866_100323313 119
602 3300005719 Ga0068861_100000952 Ga0068861_1000009529 119
603 3300005719 Ga0068861_100734483 Ga0068861_1007344831 119
604 3300005834 Ga0068851_10040441 Ga0068851_100404413 119
605 3300005841 Ga0068863_100005989 Ga0068863_1000059896 119
606 3300005841 Ga0068863_100082631 Ga0068863_1000826311 119
607 3300005842 Ga0068858_100002072 Ga0068858_10000207217 119
608 3300005842 Ga0068858_100048093 Ga0068858_1000480934 119
609 3300005842 Ga0068858_100131895 Ga0068858_1001318954 119
610 3300005842 Ga0068858_100140077 Ga0068858_1001400772 119
611 3300005842 Ga0068858_100167885 Ga0068858_1001678853 119
612 3300005843 Ga0068860_100003367 Ga0068860_1000033677 119
613 3300005843 Ga0068860_100005041 Ga0068860_1000050413 119
614 3300005843 Ga0068860_100022991 Ga0068860_1000229918 119
615 3300005843 Ga0068860_100527067 Ga0068860_1005270671 119
616 3300005844 Ga0068862_100001170 Ga0068862_1000011704 119
617 3300005844 Ga0068862_100004889 Ga0068862_1000048892 119
618 3300005844 Ga0068862_100286699 Ga0068862_1002866992 119
619 3300005844 Ga0068862_100305585 Ga0068862_1003055852 119
620 3300005844 Ga0068862_100605152 Ga0068862_1006051522 119
621 3300005937 Ga0081455_10001416 Ga0081455_1000141612 119
622 3300005937 Ga0081455_10198838 Ga0081455_101988383 119
623 3300006038 Ga0075365_10502787 Ga0075365_105027871 119
624 3300006038 Ga0075365_10511976 Ga0075365_105119762 119
625 3300006048 Ga0075363_100000096 Ga0075363_10000009611 119
626 3300006051 Ga0075364_10010176 Ga0075364_100101764 119
627 3300006051 Ga0075364_10217649 Ga0075364_102176492 119
628 3300006051 Ga0075364_10804910 Ga0075364_108049102 119
629 3300006058 Ga0075432_10073267 Ga0075432_100732672 119
630 3300006058 Ga0075432_10129092 Ga0075432_101290923 119
631 3300006163 Ga0070715_10000291 Ga0070715_100002917 119
632 3300006173 Ga0070716_100001118 Ga0070716_1000011182 119
633 3300006173 Ga0070716_101551373 Ga0070716_1015513731 119
634 3300006175 Ga0070712_100001476 Ga0070712_10000147615 119
635 3300006175 Ga0070712_100383962 Ga0070712_1003839622 119
636 3300006177 Ga0075362_10000046 Ga0075362_1000004628 119
637 3300006177 Ga0075362_10035176 Ga0075362_100351762 119
638 3300006178 Ga0075367_10030522 Ga0075367_100305223 119
639 3300006178 Ga0075367_10319971 Ga0075367_103199712 119
640 3300006186 Ga0075369_10015892 Ga0075369_100158923 119
641 3300006195 Ga0075366_10000241 Ga0075366_1000024114 119
642 3300006195 Ga0075366_10001502 Ga0075366_100015029 119
643 3300006195 Ga0075366_10037075 Ga0075366_100370754 119
644 3300006237 Ga0097621_100028733 Ga0097621_1000287335 119
645 3300006237 Ga0097621_100272760 Ga0097621_1002727603 119
646 3300006353 Ga0075370_10000321 Ga0075370_100003215 119
647 3300006353 Ga0075370_10030291 Ga0075370_100302913 119
648 3300006353 Ga0075370_10048234 Ga0075370_100482344 119
649 3300006353 Ga0075370_10449126 Ga0075370_104491262 119
650 3300006358 Ga0068871_100186874 Ga0068871_1001868741 119
651 3300006844 Ga0075428_100081367 Ga0075428_1000813675 119
652 3300006844 Ga0075428_100797818 Ga0075428_1007978182 119
653 3300006846 Ga0075430_100072586 Ga0075430_1000725862 119
654 3300006846 Ga0075430_100854469 Ga0075430_1008544692 119
655 3300006847 Ga0075431_100021252 Ga0075431_1000212523 119
656 3300006852 Ga0075433_10006318 Ga0075433_100063184 119
657 3300006871 Ga0075434_100489892 Ga0075434_1004898922 119
658 3300006880 Ga0075429_100011000 Ga0075429_1000110004 119
659 3300006881 Ga0068865_100000212 Ga0068865_10000021213 119
660 3300006914 Ga0075436_100005000 Ga0075436_1000050004 119
661 3300006931 Ga0097620_100002269 Ga0097620_10000226910 119
662 3300007076 Ga0075435_100036066 Ga0075435_1000360662 119
663 3300007076 Ga0075435_100039582 Ga0075435_1000395826 119
664 3300009011 Ga0105251_10000534 Ga0105251_100005348 119
665 3300009011 Ga0105251_10234748 Ga0105251_102347482 119
666 3300009092 Ga0105250_10056543 Ga0105250_100565434 119
667 3300009092 Ga0105250_10204992 Ga0105250_102049921 119
668 3300009093 Ga0105240_10010783 Ga0105240_1001078315 119
669 3300009093 Ga0105240_10037140 Ga0105240_100371402 119
670 3300009093 Ga0105240_10280501 Ga0105240_102805012 119
671 3300009093 Ga0105240_11169015 Ga0105240_111690151 119
672 3300009094 Ga0111539_10542321 Ga0111539_105423212 119
673 3300009094 Ga0111539_11859565 Ga0111539_118595651 119
674 3300009094 Ga0111539_12061013 Ga0111539_120610132 119
675 3300009098 Ga0105245_10004915 Ga0105245_100049152 119
676 3300009098 Ga0105245_12234787 Ga0105245_122347872 119
677 3300009101 Ga0105247_10000925 Ga0105247_1000092518 119
678 3300009101 Ga0105247_10001892 Ga0105247_100018922 119
679 3300009101 Ga0105247_10024382 Ga0105247_100243824 119
680 3300009147 Ga0114129_10269746 Ga0114129_102697462 119
681 3300009147 Ga0114129_10278187 Ga0114129_102781873 119
682 3300009148 Ga0105243_10000944 Ga0105243_100009447 119
683 3300009148 Ga0105243_10022283 Ga0105243_100222832 119
684 3300009174 Ga0105241_10002673 Ga0105241_100026738 119
685 3300009174 Ga0105241_12107003 Ga0105241_121070031 119
686 3300009176 Ga0105242_10030348 Ga0105242_100303483 119
687 3300009176 Ga0105242_10096840 Ga0105242_100968404 119
688 3300009176 Ga0105242_10205409 Ga0105242_102054093 119
689 3300009177 Ga0105248_10010654 Ga0105248_100106543 119
690 3300009177 Ga0105248_10014164 Ga0105248_100141644 119
691 3300009177 Ga0105248_10570189 Ga0105248_105701892 119
692 3300009177 Ga0105248_10577791 Ga0105248_105777912 119
693 3300009551 Ga0105238_10003956 Ga0105238_1000395617 119
694 3300009551 Ga0105238_11153412 Ga0105238_111534121 119
695 3300009551 Ga0105238_11168907 Ga0105238_111689072 119
696 3300009553 Ga0105249_10001629 Ga0105249_1000162916 119
697 3300009553 Ga0105249_10054363 Ga0105249_100543633 119
698 3300010375 Ga0105239_10002915 Ga0105239_1000291517 119
699 3300010375 Ga0105239_10031698 Ga0105239_100316983 119
700 3300010375 Ga0105239_10561942 Ga0105239_105619422 119
701 3300011119 Ga0105246_10004041 Ga0105246_100040418 119
702 3300011119 Ga0105246_10624096 Ga0105246_106240962 119
703 3300013100 Ga0157373_10005865 Ga0157373_1000586511 119
704 3300013100 Ga0157373_10008328 Ga0157373_100083287 119
705 3300013100 Ga0157373_10024910 Ga0157373_100249105 119
706 3300013100 Ga0157373_10245679 Ga0157373_102456792 119
707 3300013100 Ga0157373_10532665 Ga0157373_105326652 119
708 3300013100 Ga0157373_10736905 Ga0157373_107369052 119
709 3300013102 Ga0157371_10003718 Ga0157371_100037185 119
710 3300013102 Ga0157371_10008946 Ga0157371_100089468 119
711 3300013102 Ga0157371_10036317 Ga0157371_100363174 119
712 3300013102 Ga0157371_10097128 Ga0157371_100971284 119
713 3300013102 Ga0157371_10227238 Ga0157371_102272382 119
714 3300013102 Ga0157371_10247635 Ga0157371_102476351 119
715 3300013102 Ga0157371_10256002 Ga0157371_102560022 119
716 3300013102 Ga0157371_10365486 Ga0157371_103654862 119
717 3300013102 Ga0157371_11184456 Ga0157371_111844562 119
718 3300013104 Ga0157370_10003643 Ga0157370_1000364316 119
719 3300013104 Ga0157370_10140416 Ga0157370_101404164 119
720 3300013104 Ga0157370_10283619 Ga0157370_102836192 119
721 3300013104 Ga0157370_10484582 Ga0157370_104845822 119
722 3300013104 Ga0157370_10525805 Ga0157370_105258053 119
723 3300013104 Ga0157370_10650499 Ga0157370_106504992 119
724 3300013104 Ga0157370_11523973 Ga0157370_115239732 119
725 3300013105 Ga0157369_10000043 Ga0157369_1000004353 119
726 3300013105 Ga0157369_10001048 Ga0157369_1000104816 119
727 3300013105 Ga0157369_10011006 Ga0157369_1001100610 119
728 3300013105 Ga0157369_10047977 Ga0157369_100479774 119
729 3300013105 Ga0157369_10259506 Ga0157369_102595062 119
730 3300013105 Ga0157369_10646473 Ga0157369_106464732 119
731 3300013105 Ga0157369_10737756 Ga0157369_107377562 119
732 3300013105 Ga0157369_11052570 Ga0157369_110525701 119
733 3300013105 Ga0157369_11755479 Ga0157369_117554792 119
734 3300013105 Ga0157369_12662165 Ga0157369_126621651 119
735 3300013296 Ga0157374_10004151 Ga0157374_100041518 119
736 3300013296 Ga0157374_10008229 Ga0157374_100082295 119
737 3300013296 Ga0157374_10245465 Ga0157374_102454653 119
738 3300013297 Ga0157378_10012986 Ga0157378_100129865 119
739 3300013297 Ga0157378_10015354 Ga0157378_100153543 119
740 3300013297 Ga0157378_10106116 Ga0157378_101061163 119
741 3300013306 Ga0163162_10007216 Ga0163162_100072168 119
742 3300013306 Ga0163162_10023724 Ga0163162_100237242 119
743 3300013306 Ga0163162_10267452 Ga0163162_102674523 119
744 3300013306 Ga0163162_11633696 Ga0163162_116336962 119
745 3300013306 Ga0163162_13197198 Ga0163162_131971982 119
746 3300013307 Ga0157372_10002837 Ga0157372_100028376 119
747 3300013307 Ga0157372_10025453 Ga0157372_100254534 119
748 3300013307 Ga0157372_10141581 Ga0157372_101415814 119
749 3300013307 Ga0157372_10415389 Ga0157372_104153892 119
750 3300013307 Ga0157372_11166798 Ga0157372_111667981 119
751 3300013308 Ga0157375_10001015 Ga0157375_1000101526 119
752 3300013308 Ga0157375_10114281 Ga0157375_101142814 119
753 3300013308 Ga0157375_10262279 Ga0157375_102622794 119
754 3300013308 Ga0157375_11235593 Ga0157375_112355933 119
755 3300014325 Ga0163163_10004874 Ga0163163_100048747 119
756 3300014325 Ga0163163_10411813 Ga0163163_104118132 119
757 3300014325 Ga0163163_11212785 Ga0163163_112127852 119
758 3300014325 Ga0163163_12792931 Ga0163163_127929312 119
759 3300014326 Ga0157380_10016517 Ga0157380_100165172 119
760 3300014326 Ga0157380_10039666 Ga0157380_100396664 119
761 3300014326 Ga0157380_10830803 Ga0157380_108308032 119
762 3300014497 Ga0182008_10265103 Ga0182008_102651032 119
763 3300014745 Ga0157377_10001125 Ga0157377_100011258 119
764 3300014745 Ga0157377_10019427 Ga0157377_100194274 119
765 3300014968 Ga0157379_10008925 Ga0157379_100089257 119
766 3300014968 Ga0157379_10010069 Ga0157379_100100693 119
767 3300014969 Ga0157376_10001406 Ga0157376_1000140610 119
768 3300014969 Ga0157376_10040093 Ga0157376_100400934 119
769 3300014969 Ga0157376_11372001 Ga0157376_113720012 119
770 3300017792 Ga0163161_10006732 Ga0163161_100067322 119
771 3300017792 Ga0163161_10009585 Ga0163161_100095856 119
772 3300017792 Ga0163161_10671694 Ga0163161_106716941 119
773 3300017792 Ga0163161_10866013 Ga0163161_108660131 119
774 3300020070 Ga0206356_11133344 Ga0206356_111333442 119
775 3300020076 Ga0206355_1484588 Ga0206355_14845882 119
776 3300020078 Ga0206352_10149205 Ga0206352_101492052 119
777 3300020081 Ga0206354_10229996 Ga0206354_102299962 119
778 3300020610 Ga0154015_1061162 Ga0154015_10611622 119
779 3300021358 Ga0213873_10032494 Ga0213873_100324943 119
780 3300021377 Ga0213874_10380212 Ga0213874_103802121 119
781 3300022467 Ga0224712_10176773 Ga0224712_101767731 119
782 3300022467 Ga0224712_10306085 Ga0224712_103060852 119
783 3300025292 Ga0209676_1000256 Ga0209676_100025627 119
784 3300025298 Ga0209050_1000937 Ga0209050_100093710 119
785 3300025298 Ga0209050_1012711 Ga0209050_10127113 119
786 3300025321 Ga0207656_10053971 Ga0207656_100539712 119
787 3300025711 Ga0207696_1181536 Ga0207696_11815361 119
788 3300025735 Ga0207713_1002133 Ga0207713_10021338 119
789 3300025885 Ga0207653_10009975 Ga0207653_100099752 119
790 3300025898 Ga0207692_10498065 Ga0207692_104980652 119
791 3300025899 Ga0207642_10023025 Ga0207642_100230252 119
792 3300025900 Ga0207710_10009894 Ga0207710_100098944 119
793 3300025900 Ga0207710_10052376 Ga0207710_100523762 119
794 3300025901 Ga0207688_10000228 Ga0207688_1000022813 119
795 3300025901 Ga0207688_10306066 Ga0207688_103060662 119
796 3300025903 Ga0207680_10015591 Ga0207680_100155913 119
797 3300025903 Ga0207680_10034344 Ga0207680_100343443 119
798 3300025904 Ga0207647_10074284 Ga0207647_100742842 119
799 3300025904 Ga0207647_10188502 Ga0207647_101885022 119
800 3300025905 Ga0207685_10022529 Ga0207685_100225294 119
801 3300025906 Ga0207699_10006725 Ga0207699_100067253 119
802 3300025907 Ga0207645_10005056 Ga0207645_1000505610 119
803 3300025908 Ga0207643_10562209 Ga0207643_105622092 119
804 3300025909 Ga0207705_10000033 Ga0207705_10000033129 119
805 3300025909 Ga0207705_10101733 Ga0207705_101017333 119
806 3300025909 Ga0207705_10198026 Ga0207705_101980263 119
807 3300025909 Ga0207705_10257550 Ga0207705_102575502 119
808 3300025910 Ga0207684_11523488 Ga0207684_115234882 119
809 3300025910 Ga0207684_11701422 Ga0207684_117014222 119
810 3300025911 Ga0207654_10403323 Ga0207654_104033232 119
811 3300025912 Ga0207707_10032620 Ga0207707_100326206 119
812 3300025912 Ga0207707_10093782 Ga0207707_100937824 119
813 3300025912 Ga0207707_11558563 Ga0207707_115585631 119
814 3300025913 Ga0207695_10002063 Ga0207695_1000206335 119
815 3300025913 Ga0207695_10003382 Ga0207695_100033826 119
816 3300025913 Ga0207695_10114464 Ga0207695_101144642 119
817 3300025913 Ga0207695_10229651 Ga0207695_102296511 119
818 3300025914 Ga0207671_10022726 Ga0207671_100227262 119
819 3300025915 Ga0207693_10000892 Ga0207693_100008927 119
820 3300025915 Ga0207693_10190416 Ga0207693_101904163 119
821 3300025915 Ga0207693_10702145 Ga0207693_107021452 119
822 3300025915 Ga0207693_11129049 Ga0207693_111290492 119
823 3300025916 Ga0207663_10000847 Ga0207663_1000084711 119
824 3300025916 Ga0207663_10311044 Ga0207663_103110442 119
825 3300025916 Ga0207663_10582076 Ga0207663_105820762 119
826 3300025916 Ga0207663_11241778 Ga0207663_112417782 119
827 3300025917 Ga0207660_10016689 Ga0207660_100166892 119
828 3300025917 Ga0207660_10019569 Ga0207660_100195693 119
829 3300025917 Ga0207660_10126937 Ga0207660_101269373 119
830 3300025917 Ga0207660_10470764 Ga0207660_104707641 119
831 3300025918 Ga0207662_10025150 Ga0207662_100251503 119
832 3300025919 Ga0207657_10000227 Ga0207657_1000022746 119
833 3300025919 Ga0207657_10001202 Ga0207657_1000120228 119
834 3300025919 Ga0207657_10309432 Ga0207657_103094322 119
835 3300025920 Ga0207649_10001202 Ga0207649_100012028 119
836 3300025920 Ga0207649_10002320 Ga0207649_100023208 119
837 3300025920 Ga0207649_10012168 Ga0207649_100121682 119
838 3300025920 Ga0207649_10187528 Ga0207649_101875282 119
839 3300025921 Ga0207652_10003357 Ga0207652_100033578 119
840 3300025921 Ga0207652_10571168 Ga0207652_105711682 119
841 3300025923 Ga0207681_10000261 Ga0207681_1000026112 119
842 3300025923 Ga0207681_10015620 Ga0207681_100156202 119
843 3300025923 Ga0207681_10188480 Ga0207681_101884803 119
844 3300025923 Ga0207681_10753446 Ga0207681_107534462 119
845 3300025924 Ga0207694_10756678 Ga0207694_107566782 119
846 3300025924 Ga0207694_11085333 Ga0207694_110853332 119
847 3300025925 Ga0207650_10022682 Ga0207650_100226823 119
848 3300025925 Ga0207650_10091393 Ga0207650_100913933 119
849 3300025926 Ga0207659_10007934 Ga0207659_100079343 119
850 3300025927 Ga0207687_10021033 Ga0207687_100210335 119
851 3300025928 Ga0207700_10391087 Ga0207700_103910872 119
852 3300025929 Ga0207664_10033627 Ga0207664_100336272 119
853 3300025929 Ga0207664_10377153 Ga0207664_103771531 119
854 3300025929 Ga0207664_11123777 Ga0207664_111237772 119
855 3300025931 Ga0207644_10000275 Ga0207644_100002757 119
856 3300025931 Ga0207644_10014424 Ga0207644_100144244 119
857 3300025931 Ga0207644_10524958 Ga0207644_105249582 119
858 3300025931 Ga0207644_11147826 Ga0207644_111478261 119
859 3300025932 Ga0207690_10000791 Ga0207690_1000079115 119
860 3300025932 Ga0207690_10000978 Ga0207690_100009783 119
861 3300025932 Ga0207690_10007053 Ga0207690_100070533 119
862 3300025933 Ga0207706_10001092 Ga0207706_100010927 119
863 3300025933 Ga0207706_10002029 Ga0207706_1000202914 119
864 3300025933 Ga0207706_10349971 Ga0207706_103499712 119
865 3300025933 Ga0207706_10784238 Ga0207706_107842382 119
866 3300025934 Ga0207686_10002670 Ga0207686_100026702 119
867 3300025934 Ga0207686_10062631 Ga0207686_100626313 119
868 3300025934 Ga0207686_10146674 Ga0207686_101466742 119
869 3300025935 Ga0207709_10009544 Ga0207709_100095445 119
870 3300025935 Ga0207709_10748070 Ga0207709_107480702 119
871 3300025935 Ga0207709_10966756 Ga0207709_109667562 119
872 3300025936 Ga0207670_10005805 Ga0207670_100058058 119
873 3300025936 Ga0207670_10598185 Ga0207670_105981851 119
874 3300025937 Ga0207669_10003850 Ga0207669_100038503 119
875 3300025937 Ga0207669_10116677 Ga0207669_101166773 119
876 3300025937 Ga0207669_10793850 Ga0207669_107938501 119
877 3300025937 Ga0207669_11479566 Ga0207669_114795661 119
878 3300025938 Ga0207704_10017213 Ga0207704_100172133 119
879 3300025939 Ga0207665_10000425 Ga0207665_1000042510 119
880 3300025939 Ga0207665_11129404 Ga0207665_111294041 119
881 3300025940 Ga0207691_10002632 Ga0207691_100026324 119
882 3300025940 Ga0207691_10216626 Ga0207691_102166262 119
883 3300025940 Ga0207691_10918344 Ga0207691_109183441 119
884 3300025941 Ga0207711_10009142 Ga0207711_100091427 119
885 3300025941 Ga0207711_10024579 Ga0207711_100245793 119
886 3300025941 Ga0207711_10136431 Ga0207711_101364313 119
887 3300025941 Ga0207711_11911995 Ga0207711_119119951 119
888 3300025942 Ga0207689_10154385 Ga0207689_101543852 119
889 3300025944 Ga0207661_10166015 Ga0207661_101660151 119
890 3300025944 Ga0207661_10225868 Ga0207661_102258684 119
891 3300025945 Ga0207679_10004122 Ga0207679_100041224 119
892 3300025945 Ga0207679_10141829 Ga0207679_101418293 119
893 3300025945 Ga0207679_10198386 Ga0207679_101983862 119
894 3300025945 Ga0207679_10311780 Ga0207679_103117801 119
895 3300025945 Ga0207679_11095037 Ga0207679_110950371 119
896 3300025949 Ga0207667_10007100 Ga0207667_100071006 119
897 3300025949 Ga0207667_10009657 Ga0207667_100096573 119
898 3300025949 Ga0207667_10064744 Ga0207667_100647444 119
899 3300025949 Ga0207667_10084062 Ga0207667_100840625 119
900 3300025949 Ga0207667_10160095 Ga0207667_101600953 119
901 3300025960 Ga0207651_10005591 Ga0207651_100055914 119
902 3300025960 Ga0207651_10738092 Ga0207651_107380921 119
903 3300025961 Ga0207712_10011358 Ga0207712_100113584 119
904 3300025961 Ga0207712_10108368 Ga0207712_101083682 119
905 3300025972 Ga0207668_10005395 Ga0207668_100053957 119
906 3300025972 Ga0207668_10177129 Ga0207668_101771291 119
907 3300025972 Ga0207668_10815345 Ga0207668_108153452 119
908 3300025981 Ga0207640_10001288 Ga0207640_100012886 119
909 3300025981 Ga0207640_10002534 Ga0207640_100025347 119
910 3300025981 Ga0207640_10004079 Ga0207640_100040795 119
911 3300025981 Ga0207640_10020742 Ga0207640_100207423 119
912 3300025981 Ga0207640_11211206 Ga0207640_112112061 119
913 3300025986 Ga0207658_10004840 Ga0207658_100048408 119
914 3300025986 Ga0207658_10020333 Ga0207658_100203333 119
915 3300025986 Ga0207658_10665284 Ga0207658_106652843 119
916 3300025986 Ga0207658_11291393 Ga0207658_112913932 119
917 3300026023 Ga0207677_10004385 Ga0207677_100043858 119
918 3300026023 Ga0207677_10244171 Ga0207677_102441711 119
919 3300026023 Ga0207677_10564414 Ga0207677_105644142 119
920 3300026035 Ga0207703_10019595 Ga0207703_100195952 119
921 3300026035 Ga0207703_10043560 Ga0207703_100435604 119
922 3300026035 Ga0207703_10285304 Ga0207703_102853042 119
923 3300026035 Ga0207703_10287847 Ga0207703_102878472 119
924 3300026035 Ga0207703_10534317 Ga0207703_105343172 119
925 3300026041 Ga0207639_10002795 Ga0207639_100027954 119
926 3300026041 Ga0207639_10037841 Ga0207639_100378412 119
927 3300026041 Ga0207639_10787614 Ga0207639_107876142 119
928 3300026041 Ga0207639_11080696 Ga0207639_110806962 119
929 3300026067 Ga0207678_10000884 Ga0207678_1000088428 119
930 3300026067 Ga0207678_10034999 Ga0207678_100349995 119
931 3300026067 Ga0207678_10134765 Ga0207678_101347652 119
932 3300026067 Ga0207678_10272004 Ga0207678_102720042 119
933 3300026067 Ga0207678_11443500 Ga0207678_114435001 119
934 3300026075 Ga0207708_10000785 Ga0207708_1000078522 119
935 3300026075 Ga0207708_10145397 Ga0207708_101453972 119
936 3300026075 Ga0207708_11127932 Ga0207708_111279322 119
937 3300026078 Ga0207702_10012659 Ga0207702_100126595 119
938 3300026078 Ga0207702_10014307 Ga0207702_100143077 119
939 3300026078 Ga0207702_10033715 Ga0207702_100337153 119
940 3300026078 Ga0207702_10051771 Ga0207702_100517713 119
941 3300026078 Ga0207702_10058096 Ga0207702_100580962 119
942 3300026088 Ga0207641_10001192 Ga0207641_100011925 119
943 3300026088 Ga0207641_10040794 Ga0207641_100407942 119
944 3300026089 Ga0207648_10019921 Ga0207648_100199213 119
945 3300026089 Ga0207648_10046864 Ga0207648_100468645 119
946 3300026089 Ga0207648_10059376 Ga0207648_100593764 119
947 3300026095 Ga0207676_10037206 Ga0207676_100372063 119
948 3300026095 Ga0207676_10187021 Ga0207676_101870212 119
949 3300026095 Ga0207676_10784422 Ga0207676_107844221 119
950 3300026116 Ga0207674_10004708 Ga0207674_100047087 119
951 3300026116 Ga0207674_10008209 Ga0207674_100082097 119
952 3300026116 Ga0207674_10022498 Ga0207674_100224986 119
953 3300026118 Ga0207675_100000933 Ga0207675_10000093313 119
954 3300026118 Ga0207675_101438004 Ga0207675_1014380041 119
955 3300026121 Ga0207683_10000861 Ga0207683_1000086128 119
956 3300026121 Ga0207683_10457651 Ga0207683_104576512 119
957 3300026121 Ga0207683_10704558 Ga0207683_107045582 119
958 3300026142 Ga0207698_10023240 Ga0207698_100232406 119
959 3300026142 Ga0207698_10042867 Ga0207698_100428675 119
960 3300027312 Ga0209371_1057678 Ga0209371_10576781 119
961 3300027395 Ga0209996_1056539 Ga0209996_10565392 119
962 3300027543 Ga0209999_1067543 Ga0209999_10675431 119
963 3300027665 Ga0209983_1008334 Ga0209983_10083342 119
964 3300027665 Ga0209983_1069405 Ga0209983_10694051 119
965 3300027876 Ga0209974_10007355 Ga0209974_100073554 119
966 3300027876 Ga0209974_10013244 Ga0209974_100132443 119
967 3300027876 Ga0209974_10312524 Ga0209974_103125241 119
968 3300027907 Ga0207428_10033106 Ga0207428_100331061 119
969 3300027907 Ga0207428_10378638 Ga0207428_103786382 119
970 3300028379 Ga0268266_10000175 Ga0268266_1000017524 119
971 3300028379 Ga0268266_10002211 Ga0268266_1000221116 119
972 3300028379 Ga0268266_10067263 Ga0268266_100672633 119
973 3300028379 Ga0268266_10068435 Ga0268266_100684352 119
974 3300028379 Ga0268266_11339979 Ga0268266_113399792 119
975 3300028380 Ga0268265_10006282 Ga0268265_100062825 119
976 3300028380 Ga0268265_10012220 Ga0268265_100122205 119
977 3300028380 Ga0268265_10627317 Ga0268265_106273172 119
978 3300028381 Ga0268264_10013477 Ga0268264_100134774 119
979 3300028381 Ga0268264_10039933 Ga0268264_100399336 119
980 3300028381 Ga0268264_10191637 Ga0268264_101916373 119
981 3300030500 Ga0268256_1064671 Ga0268256_10646712 119
982 3300031691 Ga0316579_10007369 Ga0316579_100073691 119
983 3300031731 Ga0307405_10000196 Ga0307405_1000019610 119
984 3300031731 Ga0307405_10964875 Ga0307405_109648752 119
985 3300031731 Ga0307405_11859349 Ga0307405_118593491 119
986 3300031733 Ga0316577_10264495 Ga0316577_102644952 119
987 3300031824 Ga0307413_10274293 Ga0307413_102742933 119
988 3300031824 Ga0307413_10413584 Ga0307413_104135842 119
989 3300031824 Ga0307413_10733319 Ga0307413_107333192 119
990 3300031824 Ga0307413_11031583 Ga0307413_110315832 119
991 3300031852 Ga0307410_11592286 Ga0307410_115922862 119
992 3300031852 Ga0307410_12142697 Ga0307410_121426972 119
993 3300031901 Ga0307406_10146427 Ga0307406_101464273 119
994 3300031901 Ga0307406_10804140 Ga0307406_108041402 119
995 3300031903 Ga0307407_10464876 Ga0307407_104648762 119
996 3300031911 Ga0307412_10016048 Ga0307412_100160483 119
997 3300031911 Ga0307412_10499734 Ga0307412_104997342 119
998 3300031995 Ga0307409_100253909 Ga0307409_1002539092 119
999 3300032002 Ga0307416_100870387 Ga0307416_1008703872 119
1000 3300032004 Ga0307414_10104259 Ga0307414_101042593 119
1001 3300032004 Ga0307414_10148592 Ga0307414_101485921 119
1002 3300032004 Ga0307414_10183494 Ga0307414_101834941 119
1003 3300032004 Ga0307414_10386670 Ga0307414_103866702 119
1004 3300032004 Ga0307414_12036146 Ga0307414_120361461 119
1005 3300032004 Ga0307414_12092507 Ga0307414_120925071 119
1006 3300032005 Ga0307411_10133316 Ga0307411_101333162 119
1007 3300032005 Ga0307411_10191465 Ga0307411_101914653 119
1008 3300032005 Ga0307411_10582115 Ga0307411_105821152 119
1009 3300032005 Ga0307411_10759396 Ga0307411_107593962 119
1010 3300032005 Ga0307411_12118556 Ga0307411_121185561 119
1011 3300032126 Ga0307415_101203147 Ga0307415_1012031471 119
1012 3300033528 Ga0316588_1121282 Ga0316588_11212822 119
1013 3300033541 Ga0316596_1021836 Ga0316596_10218364 119
1014 3300033541 Ga0316596_1081013 Ga0316596_10810131 119
1015 3300034817 Ga0373948_0006065 Ga0373948_0006065_1094_1453 119
1016 3300034957 Ga0373938_0090470 Ga0373938_0090470_118_477 119
1017 3300035084 Ga0373928_0026493 Ga0373928_0026493_270_635 119
1018 3300035085 Ga0373929_0042826 Ga0373929_0042826_23_382 119
1019 3300035085 Ga0373929_0247468 Ga0373929_0247468_85_444 119
1020 3300035088 Ga0373940_0003431 Ga0373940_0003431_277_636 119
1021 3300035092 Ga0373952_0031133 Ga0373952_0031133_515_874 119
1022 3300035112 Ga0373932_0180066 Ga0373932_0180066_23_382 119
1023 3300035114 Ga0373939_0005439 Ga0373939_0005439_1823_2182 119
1024 3300035114 Ga0373939_0391762 Ga0373939_0391762_80_439 119
1025 3300035115 Ga0373941_0000122 Ga0373941_0000122_4619_4978 119
1026 3300035115 Ga0373941_0012044 Ga0373941_0012044_892_1251 119
1027 3300035121 Ga0373960_0005313 Ga0373960_0005313_614_973 119
1028 3300035121 Ga0373960_0111217 Ga0373960_0111217_528_887 119
1029 3300035121 Ga0373960_0287076 Ga0373960_0287076_59_418 119
1030 3300035207 Ga0373942_0058443 Ga0373942_0058443_509_868 119
1031 3300035241 Ga0373961_0006874 Ga0373961_0006874_1378_1737 119
1032 3300035398 Ga0316574_0322702 Ga0316574_0322702_422_781 119
1033 3300035691 Ga0373931_0005809 Ga0373931_0005809_4109_4474 119
1034 3300035691 Ga0373931_0017420 Ga0373931_0017420_1872_2231 119
1035 3300035691 Ga0373931_0034633 Ga0373931_0034633_1826_2185 119
1036 3300035691 Ga0373931_0986633 Ga0373931_0986633_68_427 119
1037 3300035725 Ga0373947_0421765 Ga0373947_0421765_416_775 119
1038 3300036647 Ga0316582_0014084 Ga0316582_0014084_1387_1746 119
1039 3300036712 Ga0316584_0012127 Ga0316584_0012127_20_379 119
1040 3300036712 Ga0316584_0075207 Ga0316584_0075207_1399_1758 119
1041 3300036712 Ga0316584_0354608 Ga0316584_0354608_62_421 119
1042 3300037312 Ga0395899_0004516 Ga0395899_0004516_439_798 119
1043 3300037312 Ga0395899_0009175 Ga0395899_0009175_5989_6348 119
1044 3300037312 Ga0395899_0065715 Ga0395899_0065715_2237_2596 119
1045 3300037312 Ga0395899_0092715 Ga0395899_0092715_1237_1596 119
1046 3300037418 Ga0395900_0001724 Ga0395900_0001724_22419_22778 119
1047 3300037418 Ga0395900_0038265 Ga0395900_0038265_2996_3355 119
1048 3300037418 Ga0395900_0085349 Ga0395900_0085349_2247_2606 119
1049 3300037418 Ga0395900_0301128 Ga0395900_0301128_898_1257 119
1050 3300037418 Ga0395900_0386171 Ga0395900_0386171_123_482 119
1051 3300037418 Ga0395900_0499091 Ga0395900_0499091_508_867 119
1052 3300037466 Ga0395898_0157878 Ga0395898_0157878_116_475 119
1053 3300037466 Ga0395898_0221767 Ga0395898_0221767_305_664 119
1054 3300037471 Ga0395905_0001310 Ga0395905_0001310_9830_10189 119
1055 3300037471 Ga0395905_0068245 Ga0395905_0068245_2285_2644 119
1056 3300037588 Ga0316581_0042912 Ga0316581_0042912_208_567 119
1057 3300037853 Ga0436364_1497021 Ga0436364_1497021_97_459 119
1058 3300038443 Ga0395901_0124118 Ga0395901_0124118_2025_2384 119
1059 3300038443 Ga0395901_0189909 Ga0395901_0189909_262_621 119
1060 3300038443 Ga0395901_0354199 Ga0395901_0354199_1047_1406 119
1061 3300038996 Ga0242420_003405 Ga0242420_003405_1129_1488 119
1062 3300039062 Ga0400483_067380 Ga0400483_067380_1074_1439 119
1063 3300039062 Ga0400483_204874 Ga0400483_204874_342_707 119
1064 3300039437 Ga0436365_0926226 Ga0436365_0926226_227_586 119
1065 3300039450 Ga0436363_1573256 Ga0436363_1573256_319_678 119
1066 3300039453 Ga0436362_0526587 Ga0436362_0526587_84_443 119
1067 3300039453 Ga0436362_1034769 Ga0436362_1034769_699_1061 119
1068 3300041443 Ga0451789_0509383 Ga0451789_0509383_132_491 119
1069 3300041446 Ga0451794_20066 Ga0451794_20066_82_441 119
1070 3300041446 Ga0451794_34299 Ga0451794_34299_273_632 119
1071 3300041451 Ga0451791_1679327 Ga0451791_1679327_170_529 119
1072 3300041452 Ga0451793_0354107 Ga0451793_0354107_290_649 119
1073 3300041452 Ga0451793_0668171 Ga0451793_0668171_191_550 119
1074 3300041460 Ga0451802_1735810 Ga0451802_1735810_176_535 119
1075 3300041498 Ga0451841_0761262 Ga0451841_0761262_49_408 119
1076 3300041511 Ga0451855_1086033 Ga0451855_1086033_86_445 119
1077 3300041512 Ga0451853_3229958 Ga0451853_3229958_500_859 119
1078 3300042015 Ga0439462_0002785 Ga0439462_0002785_3421_3780 119
1079 3300042134 Ga0450898_033574 Ga0450898_033574_444_803 119
1080 3300042156 Ga0439446_0145781 Ga0439446_0145781_79_438 119
1081 3300042438 Ga0439459_0053607 Ga0439459_0053607_243_602 119
1082 3300044656 Ga0466969_0010778 Ga0466969_0010778_4133_4492 119
1083 3300044684 Ga0466966_0000021 Ga0466966_0000021_74358_74717 119
1084 3300044684 Ga0466966_0001996 Ga0466966_0001996_7767_8126 119
1085 3300044684 Ga0466966_0738248 Ga0466966_0738248_215_574 119
1086 3300044693 Ga0466961_0008264 Ga0466961_0008264_3793_4152 119
1087 3300044694 Ga0466963_0016990 Ga0466963_0016990_4083_4442 119
1088 3300044706 Ga0466964_0460823 Ga0466964_0460823_168_527 119
1089 3300044712 Ga0453684_0299680 Ga0453684_0299680_875_1234 119
1090 3300044712 Ga0453684_0658612 Ga0453684_0658612_327_686 119
1091 3300044712 Ga0453684_2537308 Ga0453684_2537308_99_458 119
1092 3300044719 Ga0466971_0000846 Ga0466971_0000846_3789_4148 119
1093 3300044765 Ga0466970_0006718 Ga0466970_0006718_4945_5304 119
1094 3300044842 Ga0466957_0002162 Ga0466957_0002162_224_583 119
1095 3300045049 Ga0466959_0006500 Ga0466959_0006500_3577_3936 119
1096 3300045049 Ga0466959_0038377 Ga0466959_0038377_225_584 119
1097 3300045051 Ga0451576_0000024 Ga0451576_0000024_318907_319266 119
1098 3300045051 Ga0451576_0001525 Ga0451576_0001525_14681_15043 119
1099 3300045051 Ga0451576_0015898 Ga0451576_0015898_6105_6470 119
1100 3300045051 Ga0451576_0049961 Ga0451576_0049961_955_1320 119
1101 3300045051 Ga0451576_2738626 Ga0451576_2738626_14_373 119
1102 3300045836 Ga0466958_0009405 Ga0466958_0009405_1135_1494 119
1103 3300046460 Ga0495638_0351577 Ga0495638_0351577_155_514 119
1104 3300046461 Ga0495641_0500518 Ga0495641_0500518_62_421 119
1105 3300046472 Ga0495580_0035969 Ga0495580_0035969_1908_2273 119
1106 3300046475 Ga0495639_0266775 Ga0495639_0266775_14_373 119
1107 3300046499 Ga0495594_0126085 Ga0495594_0126085_629_994 119
1108 3300046512 Ga0495610_0001230 Ga0495610_0001230_5620_5979 119
1109 3300046512 Ga0495610_0143157 Ga0495610_0143157_126_485 119
1110 3300046517 Ga0495630_0523333 Ga0495630_0523333_275_634 119
1111 3300046522 Ga0495643_0000080 Ga0495643_0000080_157696_158055 119
1112 3300046522 Ga0495643_0039818 Ga0495643_0039818_385_744 119
1113 3300046523 Ga0495644_0198558 Ga0495644_0198558_140_499 119
1114 3300046531 Ga0495665_0047755 Ga0495665_0047755_1484_1849 119
1115 3300046533 Ga0495640_0155677 Ga0495640_0155677_336_695 119
1116 3300046535 Ga0495586_0042387 Ga0495586_0042387_19_384 119
1117 3300046535 Ga0495586_0700630 Ga0495586_0700630_18_377 119
1118 3300046539 Ga0495621_0066212 Ga0495621_0066212_398_757 119
1119 3300046616 Ga0495668_0168756 Ga0495668_0168756_690_1049 119
1120 3300046616 Ga0495668_0442675 Ga0495668_0442675_84_443 119
1121 3300046642 Ga0495634_0209916 Ga0495634_0209916_272_631 119
1122 3300046660 Ga0495625_0151972 Ga0495625_0151972_125_484 119
1123 3300046684 Ga0495669_0276085 Ga0495669_0276085_132_491 119
1124 3300046689 Ga0495613_0181570 Ga0495613_0181570_498_863 119
1125 3300047319 Ga0495674_0215529 Ga0495674_0215529_253_612 119
1126 3300048903 Ga0496100_0000708 Ga0496100_0000708_10759_11118 119
1127 3300048903 Ga0496100_0088978 Ga0496100_0088978_1246_1605 119
1128 3300048903 Ga0496100_0784641 Ga0496100_0784641_46_405 119
1129 3300048903 Ga0496100_1222405 Ga0496100_1222405_141_500 119
1130 3300048904 Ga0496101_0003342 Ga0496101_0003342_9016_9375 119
1131 3300048904 Ga0496101_0006157 Ga0496101_0006157_5083_5442 119
1132 3300048905 Ga0496102_0246461 Ga0496102_0246461_585_944 119
1133 3300048906 Ga0496103_0025181 Ga0496103_0025181_2302_2661 119
1134 3300048906 Ga0496103_0031156 Ga0496103_0031156_2264_2623 119
1135 3300048907 Ga0496104_0045446 Ga0496104_0045446_1193_1552 119
1136 3300048907 Ga0496104_0075540 Ga0496104_0075540_2109_2468 119
1137 3300048908 Ga0496105_0017714 Ga0496105_0017714_2698_3057 119
1138 3300048908 Ga0496105_0245083 Ga0496105_0245083_314_673 119
1139 3300048909 Ga0496106_0001491 Ga0496106_0001491_4905_5264 119
1140 3300048909 Ga0496106_0016755 Ga0496106_0016755_4945_5304 119
1141 3300048909 Ga0496106_1001594 Ga0496106_1001594_101_460 119
1142 3300048910 Ga0496107_0002333 Ga0496107_0002333_2723_3082 119
1143 3300048911 Ga0496108_0010399 Ga0496108_0010399_6316_6675 119
1144 3300048911 Ga0496108_0040196 Ga0496108_0040196_2256_2615 119
1145 3300048912 Ga0496109_0005918 Ga0496109_0005918_6343_6702 119
1146 3300048912 Ga0496109_0019052 Ga0496109_0019052_741_1100 119
1147 3300048912 Ga0496109_0124323 Ga0496109_0124323_1513_1872 119
1148 3300048913 Ga0496110_0060694 Ga0496110_0060694_713_1072 119
1149 3300048913 Ga0496110_0216349 Ga0496110_0216349_779_1138 119
1150 3300048913 Ga0496110_0271362 Ga0496110_0271362_816_1175 119
1151 3300048914 Ga0496111_0483177 Ga0496111_0483177_280_639 119
1152 3300048915 Ga0496112_0006537 Ga0496112_0006537_6239_6598 119
1153 3300048915 Ga0496112_0010740 Ga0496112_0010740_6436_6795 119
1154 3300048915 Ga0496112_0015294 Ga0496112_0015294_3946_4305 119
1155 3300048916 Ga0496113_0002327 Ga0496113_0002327_6367_6726 119
1156 3300048916 Ga0496113_0051757 Ga0496113_0051757_1046_1405 119
1157 3300048916 Ga0496113_0185350 Ga0496113_0185350_292_651 119
1158 3300048917 Ga0496114_0012238 Ga0496114_0012238_3663_4022 119
1159 3300048917 Ga0496114_0049077 Ga0496114_0049077_2722_3081 119
1160 3300048918 Ga0496115_0022580 Ga0496115_0022580_518_877 119
1161 3300048918 Ga0496115_0126838 Ga0496115_0126838_498_857 119
1162 3300048919 Ga0496116_0000045 Ga0496116_0000045_169562_169921 119
1163 3300048919 Ga0496116_0048305 Ga0496116_0048305_500_859 119
1164 3300048920 Ga0496117_0043619 Ga0496117_0043619_2884_3243 119
1165 3300048921 Ga0496118_0079231 Ga0496118_0079231_76_435 119
1166 3300048921 Ga0496118_0167629 Ga0496118_0167629_621_980 119
1167 3300048921 Ga0496118_0514098 Ga0496118_0514098_94_453 119
1168 3300048923 Ga0496120_0240170 Ga0496120_0240170_472_831 119
1169 3300048924 Ga0496121_0000017 Ga0496121_0000017_373260_373619 119
1170 3300048924 Ga0496121_0014449 Ga0496121_0014449_6401_6760 119
1171 3300048924 Ga0496121_0017871 Ga0496121_0017871_6746_7105 119
1172 3300048925 Ga0496122_0003264 Ga0496122_0003264_20004_20363 119
1173 3300048925 Ga0496122_0234297 Ga0496122_0234297_253_612 119
1174 3300048926 Ga0496123_0002307 Ga0496123_0002307_4340_4699 119
1175 3300048926 Ga0496123_0065788 Ga0496123_0065788_852_1211 119
1176 3300048927 Ga0496124_0020151 Ga0496124_0020151_5514_5873 119
1177 3300048927 Ga0496124_0089650 Ga0496124_0089650_2018_2377 119
1178 3300048927 Ga0496124_0145848 Ga0496124_0145848_133_492 119
1179 3300048928 Ga0496125_0009436 Ga0496125_0009436_9597_9956 119
1180 3300048928 Ga0496125_0021356 Ga0496125_0021356_3241_3600 119
1181 3300048928 Ga0496125_0564098 Ga0496125_0564098_55_414 119
1182 3300048929 Ga0496126_0000568 Ga0496126_0000568_34195_34554 119
1183 3300048929 Ga0496126_0031442 Ga0496126_0031442_3979_4338 119
1184 3300048929 Ga0496126_0047416 Ga0496126_0047416_473_832 119
1185 3300049459 Ga0495678_128165 Ga0495678_128165_134_493 119
1186 3300049460 Ga0495682_0163019 Ga0495682_0163019_178_537 119
1187 3300049568 Ga0501031_0338726 Ga0501031_0338726_146_505 119
1188 3300049569 Ga0501032_0144429 Ga0501032_0144429_947_1306 119
1189 3300049569 Ga0501032_0532459 Ga0501032_0532459_262_621 119
1190 3300049569 Ga0501032_0992583 Ga0501032_0992583_49_408 119
1191 3300049570 Ga0501033_0076879 Ga0501033_0076879_1559_1918 119
1192 3300049570 Ga0501033_0413660 Ga0501033_0413660_142_501 119
1193 3300049571 Ga0501034_0000089 Ga0501034_0000089_155263_155622 119
1194 3300049571 Ga0501034_0007572 Ga0501034_0007572_8027_8386 119
1195 3300049571 Ga0501034_0056473 Ga0501034_0056473_3467_3826 119
1196 3300049571 Ga0501034_0256658 Ga0501034_0256658_361_720 119
1197 3300049571 Ga0501034_0284235 Ga0501034_0284235_974_1333 119
1198 3300049571 Ga0501034_0388576 Ga0501034_0388576_506_865 119
1199 3300049572 Ga0501036_0002470 Ga0501036_0002470_686_1045 119
1200 3300049572 Ga0501036_0003258 Ga0501036_0003258_269_628 119
1201 3300049572 Ga0501036_0100890 Ga0501036_0100890_33_392 119
1202 3300049572 Ga0501036_0161118 Ga0501036_0161118_20_379 119
1203 3300049573 Ga0501037_0166470 Ga0501037_0166470_1195_1554 119
1204 3300049573 Ga0501037_0217469 Ga0501037_0217469_901_1260 119
1205 3300049574 Ga0501038_0087146 Ga0501038_0087146_563_922 119
1206 3300049574 Ga0501038_0436995 Ga0501038_0436995_405_764 119
1207 3300049574 Ga0501038_1364301 Ga0501038_1364301_78_437 119
1208 3300049575 Ga0501039_0065472 Ga0501039_0065472_319_678 119
1209 3300049575 Ga0501039_0116878 Ga0501039_0116878_1651_2010 119
1210 3300049576 Ga0501040_0010428 Ga0501040_0010428_4732_5091 119
1211 3300049576 Ga0501040_0104758 Ga0501040_0104758_103_462 119
1212 3300049576 Ga0501040_0307954 Ga0501040_0307954_745_1104 119
1213 3300049576 Ga0501040_1086431 Ga0501040_1086431_35_394 119
1214 3300049578 Ga0501042_0104688 Ga0501042_0104688_305_664 119
1215 3300049578 Ga0501042_0633232 Ga0501042_0633232_392_757 119
1216 3300049578 Ga0501042_0639191 Ga0501042_0639191_182_541 119
1217 3300049578 Ga0501042_0710384 Ga0501042_0710384_53_412 119
1218 3300049579 Ga0501043_0206640 Ga0501043_0206640_322_681 119
1219 3300049579 Ga0501043_0245024 Ga0501043_0245024_991_1350 119
1220 3300049579 Ga0501043_0397103 Ga0501043_0397103_48_407 119
1221 3300049580 Ga0501046_0025198 Ga0501046_0025198_241_600 119
1222 3300049580 Ga0501046_0064915 Ga0501046_0064915_2057_2416 119
1223 3300049580 Ga0501046_0112332 Ga0501046_0112332_741_1100 119
1224 3300049580 Ga0501046_0313040 Ga0501046_0313040_379_738 119
1225 3300049580 Ga0501046_0583279 Ga0501046_0583279_299_658 119
1226 3300049581 Ga0501047_0000097 Ga0501047_0000097_106679_107038 119
1227 3300049581 Ga0501047_0066831 Ga0501047_0066831_1968_2327 119
1228 3300049581 Ga0501047_0431512 Ga0501047_0431512_506_865 119
1229 3300049581 Ga0501047_0465574 Ga0501047_0465574_665_1024 119
1230 3300049581 Ga0501047_0615752 Ga0501047_0615752_142_501 119
1231 3300049582 Ga0501048_0001777 Ga0501048_0001777_1621_1980 119
1232 3300049582 Ga0501048_0094504 Ga0501048_0094504_1232_1591 119
1233 3300049582 Ga0501048_0172033 Ga0501048_0172033_749_1108 119
1234 3300049582 Ga0501048_0597836 Ga0501048_0597836_214_573 119
1235 3300049583 Ga0501067_0010136 Ga0501067_0010136_3930_4289 119
1236 3300049583 Ga0501067_0067680 Ga0501067_0067680_1121_1480 119
1237 3300049583 Ga0501067_0268333 Ga0501067_0268333_517_876 119
1238 3300049584 Ga0501068_0019141 Ga0501068_0019141_1076_1435 119
1239 3300049584 Ga0501068_0177162 Ga0501068_0177162_367_726 119
1240 3300049584 Ga0501068_0565874 Ga0501068_0565874_361_720 119
1241 3300049585 Ga0501069_0003384 Ga0501069_0003384_6432_6791 119
1242 3300049585 Ga0501069_0021339 Ga0501069_0021339_1377_1736 119
1243 3300049585 Ga0501069_0060396 Ga0501069_0060396_1725_2084 119
1244 3300049585 Ga0501069_0063967 Ga0501069_0063967_114_473 119
1245 3300049586 Ga0501070_0008856 Ga0501070_0008856_1053_1412 119
1246 3300049586 Ga0501070_0030273 Ga0501070_0030273_1446_1805 119
1247 3300049586 Ga0501070_0094098 Ga0501070_0094098_408_767 119
1248 3300049586 Ga0501070_0178014 Ga0501070_0178014_261_620 119
1249 3300049586 Ga0501070_0333171 Ga0501070_0333171_87_446 119
1250 3300049587 Ga0501071_0013639 Ga0501071_0013639_1911_2270 119
1251 3300049587 Ga0501071_0244426 Ga0501071_0244426_14_373 119
1252 3300049587 Ga0501071_0446407 Ga0501071_0446407_245_604 119
1253 3300049588 Ga0501072_0041181 Ga0501072_0041181_1235_1594 119
1254 3300049588 Ga0501072_0261799 Ga0501072_0261799_229_588 119
1255 3300049588 Ga0501072_0330079 Ga0501072_0330079_812_1171 119
1256 3300049588 Ga0501072_0344974 Ga0501072_0344974_776_1135 119
1257 3300049588 Ga0501072_0394663 Ga0501072_0394663_720_1079 119
1258 3300049589 Ga0501073_0104971 Ga0501073_0104971_1142_1501 119
1259 3300049589 Ga0501073_0162062 Ga0501073_0162062_789_1148 119
1260 3300049589 Ga0501073_0260852 Ga0501073_0260852_783_1142 119
1261 3300049589 Ga0501073_0344055 Ga0501073_0344055_156_515 119
1262 3300049589 Ga0501073_0395722 Ga0501073_0395722_439_798 119
1263 3300049590 Ga0501074_0005920 Ga0501074_0005920_5269_5628 119
1264 3300049590 Ga0501074_0095446 Ga0501074_0095446_1732_2091 119
1265 3300049590 Ga0501074_0233823 Ga0501074_0233823_827_1186 119
1266 3300049590 Ga0501074_0328918 Ga0501074_0328918_43_402 119
1267 3300049590 Ga0501074_0407258 Ga0501074_0407258_134_493 119
1268 3300049590 Ga0501074_0637862 Ga0501074_0637862_92_451 119
1269 3300049591 Ga0501075_0050918 Ga0501075_0050918_902_1261 119
1270 3300049591 Ga0501075_0332423 Ga0501075_0332423_121_480 119
1271 3300049591 Ga0501075_0715526 Ga0501075_0715526_312_671 119
1272 3300049592 Ga0501076_0013557 Ga0501076_0013557_1266_1625 119
1273 3300049593 Ga0501077_0002811 Ga0501077_0002811_9499_9858 119
1274 3300049593 Ga0501077_0864776 Ga0501077_0864776_71_430 119
1275 3300049741 Ga0501079_0204732 Ga0501079_0204732_1096_1455 119
1276 3300049741 Ga0501079_0296612 Ga0501079_0296612_116_475 119
1277 3300049741 Ga0501079_0346874 Ga0501079_0346874_11_370 119
1278 3300049741 Ga0501079_0836975 Ga0501079_0836975_177_536 119
1279 3300049742 Ga0501080_0000045 Ga0501080_0000045_6023_6382 119
1280 3300049742 Ga0501080_0026650 Ga0501080_0026650_2281_2640 119
1281 3300049742 Ga0501080_0115490 Ga0501080_0115490_1862_2221 119
1282 3300049742 Ga0501080_1031409 Ga0501080_1031409_323_682 119
1283 3300049742 Ga0501080_1353415 Ga0501080_1353415_142_501 119
1284 3300049743 Ga0501081_0081250 Ga0501081_0081250_221_580 119
1285 3300049743 Ga0501081_0088169 Ga0501081_0088169_972_1331 119
1286 3300049743 Ga0501081_0366046 Ga0501081_0366046_463_822 119
1287 3300049744 Ga0501083_0015459 Ga0501083_0015459_540_899 119
1288 3300049744 Ga0501083_0126870 Ga0501083_0126870_645_1004 119
1289 3300049744 Ga0501083_0221159 Ga0501083_0221159_856_1215 119
1290 3300049744 Ga0501083_0401085 Ga0501083_0401085_151_510 119
1291 3300049744 Ga0501083_0591541 Ga0501083_0591541_349_708 119
1292 3300049822 Ga0501035_0001208 Ga0501035_0001208_4870_5229 119
1293 3300049822 Ga0501035_0331216 Ga0501035_0331216_850_1209 119
1294 3300049823 Ga0501044_0012045 Ga0501044_0012045_8626_8985 119
1295 3300049823 Ga0501044_0137965 Ga0501044_0137965_1938_2297 119
1296 3300049823 Ga0501044_0151534 Ga0501044_0151534_352_711 119
1297 3300049823 Ga0501044_0425008 Ga0501044_0425008_865_1224 119
1298 3300049823 Ga0501044_0938970 Ga0501044_0938970_66_425 119
1299 3300049823 Ga0501044_1502438 Ga0501044_1502438_25_384 119
1300 3300049823 Ga0501044_1554325 Ga0501044_1554325_127_486 119
1301 3300049824 Ga0501045_0016406 Ga0501045_0016406_4619_4978 119
1302 3300050489 nmdc:mga03683_189888_c1 nmdc:mga03683_189888_c1_26_385 119
1303 3300050489 nmdc:mga03683_2_c1 nmdc:mga03683_2_c1_192898_193257 119
1304 3300050489 nmdc:mga03683_308774_c1 nmdc:mga03683_308774_c1_334_693 119
1305 3300050489 nmdc:mga03683_543904_c1 nmdc:mga03683_543904_c1_171_530 119
1306 3300050490 nmdc:mga03n38_1829_c1 nmdc:mga03n38_1829_c1_3494_3853 119
1307 3300050491 nmdc:mga00v17_1089555_c1 nmdc:mga00v17_1089555_c1_46_405 119
1308 3300050491 nmdc:mga00v17_179731_c1 nmdc:mga00v17_179731_c1_979_1338 119
1309 3300050491 nmdc:mga00v17_992721_c1 nmdc:mga00v17_992721_c1_58_417 119
1310 3300050492 nmdc:mga0yw44_620001_c1 nmdc:mga0yw44_620001_c1_364_723 119
1311 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_105978_106337 119
1312 3300050493 nmdc:mga0k408_3799_c1 nmdc:mga0k408_3799_c1_5824_6183 119
1313 3300050493 nmdc:mga0k408_635812_c1 nmdc:mga0k408_635812_c1_143_502 119
1314 3300050494 nmdc:mga06z11_39210_c1 nmdc:mga06z11_39210_c1_194_553 119
1315 3300050496 nmdc:mga07m45_20437_c1 nmdc:mga07m45_20437_c1_2280_2639 119
1316 3300050496 nmdc:mga07m45_26_c1 nmdc:mga07m45_26_c1_3862_4221 119
1317 3300050496 nmdc:mga07m45_283946_c1 nmdc:mga07m45_283946_c1_328_687 119
1318 3300050507 nmdc:mga05p37_949199_c1 nmdc:mga05p37_949199_c1_133_492 119
1319 3300050508 nmdc:mga09592_29697_c1 nmdc:mga09592_29697_c1_2934_3293 119
1320 3300050509 nmdc:mga0qj67_186566_c1 nmdc:mga0qj67_186566_c1_111_470 119
1321 3300050509 nmdc:mga0qj67_813960_c1 nmdc:mga0qj67_813960_c1_239_598 119
1322 3300050510 nmdc:mga06r32_5167_c1 nmdc:mga06r32_5167_c1_7499_7858 119
1323 3300050512 nmdc:mga0n895_457599_c1 nmdc:mga0n895_457599_c1_761_1126 119
1324 3300050513 nmdc:mga0rr50_201409_c1 nmdc:mga0rr50_201409_c1_955_1320 119
1325 3300050514 nmdc:mga08x19_16664_c1 nmdc:mga08x19_16664_c1_2187_2546 119
1326 3300050515 nmdc:mga0a205_44519_c1 nmdc:mga0a205_44519_c1_2314_2673 119
1327 3300050516 nmdc:mga0sz30_196701_c2 nmdc:mga0sz30_196701_c2_12_371 119
1328 3300050516 nmdc:mga0sz30_3200_c1 nmdc:mga0sz30_3200_c1_1398_1757 119
1329 3300053087 Ga0500643_000005 Ga0500643_000005_151373_151732 119
1330 3300053093 Ga0500651_0162496 Ga0500651_0162496_477_836 119
1331 3300053096 Ga0500641_0009270 Ga0500641_0009270_109_468 119
1332 3300053096 Ga0500641_0294615 Ga0500641_0294615_158_517 119
1333 3300053108 Ga0500562_035044 Ga0500562_035044_163_522 119
1334 3300053108 Ga0500562_077438 Ga0500562_077438_208_567 119
1335 3300053111 Ga0500572_103445 Ga0500572_103445_425_784 119
1336 3300053116 Ga0500592_054953 Ga0500592_054953_208_567 119
1337 3300053118 Ga0500594_0027842 Ga0500594_0027842_730_1089 119
1338 3300053118 Ga0500594_0053854 Ga0500594_0053854_348_707 119
1339 3300053119 Ga0500595_007699 Ga0500595_007699_2342_2701 119
1340 3300053121 Ga0500607_000060 Ga0500607_000060_54238_54597 119
1341 3300053125 Ga0500618_010860 Ga0500618_010860_1362_1721 119
1342 3300053131 Ga0500652_000198 Ga0500652_000198_20049_20408 119
1343 3300053139 Ga0500568_0342059 Ga0500568_0342059_102_461 119
1344 3300053146 Ga0500588_0041045 Ga0500588_0041045_952_1311 119
1345 3300053148 Ga0500590_001355 Ga0500590_001355_622_981 119
1346 3300053151 Ga0500604_0208186 Ga0500604_0208186_158_517 119
1347 3300053153 Ga0500616_0001865 Ga0500616_0001865_4767_5126 119
1348 3300053153 Ga0500616_0134187 Ga0500616_0134187_520_879 119
1349 3300053156 Ga0500622_0334066 Ga0500622_0334066_238_597 119
1350 3300053162 Ga0500638_152825 Ga0500638_152825_353_712 119
1351 3300053733 Ga0500552_044069 Ga0500552_044069_316_675 119
1352 3300054114 Ga0501084_0679721 Ga0501084_0679721_438_797 119
1353 3300059505 Ga0587083_0128226 Ga0587083_0128226_17_376 119
1354 3300059508 Ga0587088_184216 Ga0587088_184216_136_498 119
1355 3300059511 Ga0587091_031859 Ga0587091_031859_404_763 119
1356 3300059650 Ga0587104_011260 Ga0587104_011260_289_654 119
1357 3300059652 Ga0587107_069451 Ga0587107_069451_19_378 119
1358 3300059655 Ga0587114_033008 Ga0587114_033008_149_514 119
1359 3300059655 Ga0587114_080971 Ga0587114_080971_209_568 119
1360 3300059658 Ga0587119_039732 Ga0587119_039732_286_651 119
1361 3300060353 Ga0501082_0011708 Ga0501082_0011708_2005_2364 119
1362 3300060353 Ga0501082_0062346 Ga0501082_0062346_1074_1433 119
1363 3300060353 Ga0501082_0400503 Ga0501082_0400503_772_1131 119
1364 3300061719 Ga0466962_0002938 Ga0466962_0002938_3812_4171 119
1365 3300061734 Ga0530510_0013825 Ga0530510_0013825_564_923 119
1366 3300061734 Ga0530510_0233374 Ga0530510_0233374_760_1119 119
1367 3300061734 Ga0530510_0515857 Ga0530510_0515857_110_469 119
1368 2010549000 RicEn_FSXC48362_g1 RicEn_435570 120
1369 2162886007 SwRhRL2b_contig_1023452 SwRhRL2b_0946.00006050 120
1370 2162886007 SwRhRL2b_contig_2614068 SwRhRL2b_0248.00001020 120
1371 3300000041 ARcpr5oldR_c006461 ARcpr5oldR_0064611 120
1372 3300000043 ARcpr5yngRDRAFT_c006253 ARcpr5yngRDRAFT_0062532 120
1373 3300000652 ARCol0yngRDRAFT_1004808 ARCol0yngRDRAFT_10048083 120
1374 3300001904 JGI24736J21556_1000036 JGI24736J21556_10000367 120
1375 3300001904 JGI24736J21556_1012983 JGI24736J21556_10129833 120
1376 3300001915 JGI24741J21665_1000048 JGI24741J21665_100004818 120
1377 3300001915 JGI24741J21665_1003961 JGI24741J21665_10039613 120
1378 3300001976 JGI24752J21851_1010676 JGI24752J21851_10106763 120
1379 3300001979 JGI24740J21852_10029072 JGI24740J21852_100290723 120
1380 3300001979 JGI24740J21852_10042206 JGI24740J21852_100422062 120
1381 3300001989 JGI24739J22299_10005112 JGI24739J22299_100051125 120
1382 3300001989 JGI24739J22299_10042319 JGI24739J22299_100423193 120
1383 3300001989 JGI24739J22299_10092022 JGI24739J22299_100920222 120
1384 3300001989 JGI24739J22299_10218492 JGI24739J22299_102184921 120
1385 3300001990 JGI24737J22298_10010158 JGI24737J22298_100101582 120
1386 3300001990 JGI24737J22298_10013520 JGI24737J22298_100135203 120
1387 3300001990 JGI24737J22298_10257098 JGI24737J22298_102570981 120
1388 3300002074 JGI24748J21848_1020079 JGI24748J21848_10200791 120
1389 3300002075 JGI24738J21930_10007334 JGI24738J21930_100073343 120
1390 3300002075 JGI24738J21930_10025901 JGI24738J21930_100259012 120
1391 3300002075 JGI24738J21930_10051879 JGI24738J21930_100518791 120
1392 3300002126 JGI24035J26624_1007994 JGI24035J26624_10079941 120
1393 3300002239 JGI24034J26672_10005335 JGI24034J26672_100053353 120
1394 3300002239 JGI24034J26672_10034443 JGI24034J26672_100344433 120
1395 3300002459 JGI24751J29686_10000476 JGI24751J29686_100004763 120
1396 3300002774 JGI25150J39212_1000067 JGI25150J39212_100006749 120
1397 3300002774 JGI25150J39212_1034377 JGI25150J39212_10343771 120
1398 3300003187 JGI25151J46595_10024018 JGI25151J46595_100240181 120
1399 3300003215 JGI25153J46596_10000073 JGI25153J46596_1000007334 120
1400 3300003215 JGI25153J46596_10000417 JGI25153J46596_1000041721 120
1401 3300003215 JGI25153J46596_10010562 JGI25153J46596_100105622 120
1402 3300003320 rootH2_10089335 rootH2_100893356 120
1403 3300003759 Ga0055525_1000119 Ga0055525_100011977 120
1404 3300003762 Ga0055542_1000142 Ga0055542_1000142102 120
1405 3300003762 Ga0055542_1000783 Ga0055542_100078317 120
1406 3300003763 Ga0055529_1000167 Ga0055529_1000167102 120
1407 3300003773 Ga0055537_1003859 Ga0055537_10038595 120
1408 3300003773 Ga0055537_1007040 Ga0055537_10070402 120
1409 3300003775 Ga0055524_1000154 Ga0055524_10001545 120
1410 3300003781 Ga0055536_1009288 Ga0055536_10092885 120
1411 3300003781 Ga0055536_1014285 Ga0055536_10142852 120
1412 3300003781 Ga0055536_1016129 Ga0055536_10161292 120
1413 3300003781 Ga0055536_1056849 Ga0055536_10568492 120
1414 3300003784 Ga0055534_1040661 Ga0055534_10406612 120
1415 3300003791 Ga0055530_10000278 Ga0055530_100002782 120
1416 3300003791 Ga0055530_10000919 Ga0055530_1000091913 120
1417 3300003791 Ga0055530_10017727 Ga0055530_100177273 120
1418 3300003792 Ga0055540_1004222 Ga0055540_10042226 120
1419 3300003794 Ga0055531_10000094 Ga0055531_100000941 120
1420 3300003794 Ga0055531_10000576 Ga0055531_100005762 120
1421 3300003794 Ga0055531_10002471 Ga0055531_100024712 120
1422 3300003794 Ga0055531_10019986 Ga0055531_100199864 120
1423 3300003794 Ga0055531_10079625 Ga0055531_100796251 120
1424 3300003794 Ga0055531_10108249 Ga0055531_101082491 120
1425 3300004625 Ga0055543_1028437 Ga0055543_10284372 120
1426 3300005262 Ga0065165_1077226 Ga0065165_10772262 120
1427 3300005262 Ga0065165_1148841 Ga0065165_11488411 120
1428 3300005288 Ga0065714_10445013 Ga0065714_104450132 120
1429 3300005289 Ga0065704_10003962 Ga0065704_100039624 120
1430 3300005289 Ga0065704_10075787 Ga0065704_100757875 120
1431 3300005289 Ga0065704_10337028 Ga0065704_103370283 120
1432 3300005289 Ga0065704_10404655 Ga0065704_104046552 120
1433 3300005293 Ga0065715_10043060 Ga0065715_100430602 120
1434 3300005295 Ga0065707_10795077 Ga0065707_107950772 120
1435 3300005327 Ga0070658_10001088 Ga0070658_100010888 120
1436 3300005327 Ga0070658_10001818 Ga0070658_100018182 120
1437 3300005327 Ga0070658_10121705 Ga0070658_101217052 120
1438 3300005327 Ga0070658_10157951 Ga0070658_101579513 120
1439 3300005327 Ga0070658_10226029 Ga0070658_102260292 120
1440 3300005327 Ga0070658_10753753 Ga0070658_107537531 120
1441 3300005327 Ga0070658_10891125 Ga0070658_108911251 120
1442 3300005328 Ga0070676_10186173 Ga0070676_101861731 120
1443 3300005328 Ga0070676_10220314 Ga0070676_102203142 120
1444 3300005328 Ga0070676_10320630 Ga0070676_103206301 120
1445 3300005328 Ga0070676_10777837 Ga0070676_107778371 120
1446 3300005329 Ga0070683_100026014 Ga0070683_1000260148 120
1447 3300005329 Ga0070683_100915020 Ga0070683_1009150201 120
1448 3300005329 Ga0070683_101298110 Ga0070683_1012981101 120
1449 3300005331 Ga0070670_100003330 Ga0070670_1000033303 120
1450 3300005331 Ga0070670_100130100 Ga0070670_1001301002 120
1451 3300005331 Ga0070670_100191020 Ga0070670_1001910204 120
1452 3300005331 Ga0070670_100317880 Ga0070670_1003178802 120
1453 3300005331 Ga0070670_100595825 Ga0070670_1005958252 120
1454 3300005331 Ga0070670_101389547 Ga0070670_1013895471 120
1455 3300005334 Ga0068869_100961881 Ga0068869_1009618812 120
1456 3300005335 Ga0070666_10000476 Ga0070666_100004763 120
1457 3300005335 Ga0070666_10008159 Ga0070666_100081595 120
1458 3300005335 Ga0070666_11289571 Ga0070666_112895711 120
1459 3300005337 Ga0070682_100573061 Ga0070682_1005730612 120
1460 3300005338 Ga0068868_100000006 Ga0068868_10000000689 120
1461 3300005338 Ga0068868_100257110 Ga0068868_1002571102 120
1462 3300005339 Ga0070660_100124465 Ga0070660_1001244652 120
1463 3300005339 Ga0070660_100292811 Ga0070660_1002928112 120
1464 3300005339 Ga0070660_100404291 Ga0070660_1004042912 120
1465 3300005339 Ga0070660_100511463 Ga0070660_1005114632 120
1466 3300005339 Ga0070660_100562380 Ga0070660_1005623802 120
1467 3300005339 Ga0070660_100644777 Ga0070660_1006447771 120
1468 3300005340 Ga0070689_100190728 Ga0070689_1001907282 120
1469 3300005341 Ga0070691_10004772 Ga0070691_100047725 120
1470 3300005344 Ga0070661_100039616 Ga0070661_1000396162 120
1471 3300005344 Ga0070661_100078488 Ga0070661_1000784884 120
1472 3300005344 Ga0070661_100384803 Ga0070661_1003848032 120
1473 3300005344 Ga0070661_100635173 Ga0070661_1006351732 120
1474 3300005344 Ga0070661_101536523 Ga0070661_1015365231 120
1475 3300005345 Ga0070692_10152416 Ga0070692_101524162 120
1476 3300005347 Ga0070668_100010434 Ga0070668_1000104344 120
1477 3300005347 Ga0070668_100042071 Ga0070668_1000420711 120
1478 3300005347 Ga0070668_100050967 Ga0070668_1000509673 120
1479 3300005347 Ga0070668_100131066 Ga0070668_1001310662 120
1480 3300005347 Ga0070668_100345243 Ga0070668_1003452432 120
1481 3300005353 Ga0070669_100000052 Ga0070669_10000005210 120
1482 3300005353 Ga0070669_100000074 Ga0070669_10000007417 120
1483 3300005353 Ga0070669_100000096 Ga0070669_10000009643 120
1484 3300005353 Ga0070669_100029003 Ga0070669_1000290034 120
1485 3300005353 Ga0070669_100043147 Ga0070669_1000431472 120
1486 3300005353 Ga0070669_100331168 Ga0070669_1003311682 120
1487 3300005354 Ga0070675_100214407 Ga0070675_1002144073 120
1488 3300005354 Ga0070675_100424323 Ga0070675_1004243232 120
1489 3300005354 Ga0070675_100568381 Ga0070675_1005683812 120
1490 3300005354 Ga0070675_100975029 Ga0070675_1009750292 120
1491 3300005355 Ga0070671_100000005 Ga0070671_100000005231 120
1492 3300005355 Ga0070671_100000045 Ga0070671_10000004568 120
1493 3300005355 Ga0070671_100002546 Ga0070671_1000025468 120
1494 3300005355 Ga0070671_101495182 Ga0070671_1014951821 120
1495 3300005356 Ga0070674_100002525 Ga0070674_1000025252 120
1496 3300005356 Ga0070674_100624080 Ga0070674_1006240802 120
1497 3300005356 Ga0070674_101329822 Ga0070674_1013298221 120
1498 3300005356 Ga0070674_101386922 Ga0070674_1013869221 120
1499 3300005364 Ga0070673_100212447 Ga0070673_1002124471 120
1500 3300005364 Ga0070673_100521796 Ga0070673_1005217962 120
1501 3300005364 Ga0070673_101275468 Ga0070673_1012754681 120
1502 3300005365 Ga0070688_100269781 Ga0070688_1002697812 120
1503 3300005365 Ga0070688_101374121 Ga0070688_1013741211 120
1504 3300005366 Ga0070659_100000005 Ga0070659_10000000542 120
1505 3300005366 Ga0070659_100163068 Ga0070659_1001630683 120
1506 3300005367 Ga0070667_100000126 Ga0070667_1000001267 120
1507 3300005367 Ga0070667_100000696 Ga0070667_10000069613 120
1508 3300005367 Ga0070667_100196352 Ga0070667_1001963523 120
1509 3300005367 Ga0070667_100210872 Ga0070667_1002108722 120
1510 3300005367 Ga0070667_100255166 Ga0070667_1002551661 120
1511 3300005434 Ga0070709_11183573 Ga0070709_111835732 120
1512 3300005436 Ga0070713_100402863 Ga0070713_1004028632 120
1513 3300005437 Ga0070710_11248828 Ga0070710_112488281 120
1514 3300005441 Ga0070700_100035052 Ga0070700_1000350522 120
1515 3300005441 Ga0070700_100422249 Ga0070700_1004222493 120
1516 3300005444 Ga0070694_100725800 Ga0070694_1007258002 120
1517 3300005445 Ga0070708_100052438 Ga0070708_1000524381 120
1518 3300005445 Ga0070708_101560542 Ga0070708_1015605422 120
1519 3300005455 Ga0070663_100020880 Ga0070663_1000208803 120
1520 3300005455 Ga0070663_100073988 Ga0070663_1000739883 120
1521 3300005455 Ga0070663_100272767 Ga0070663_1002727672 120
1522 3300005457 Ga0070662_100215228 Ga0070662_1002152282 120
1523 3300005458 Ga0070681_10369511 Ga0070681_103695113 120
1524 3300005458 Ga0070681_12004575 Ga0070681_120045751 120
1525 3300005459 Ga0068867_100108248 Ga0068867_1001082482 120
1526 3300005459 Ga0068867_101601851 Ga0068867_1016018511 120
1527 3300005466 Ga0070685_11169043 Ga0070685_111690431 120
1528 3300005530 Ga0070679_100009637 Ga0070679_1000096372 120
1529 3300005530 Ga0070679_100460451 Ga0070679_1004604512 120
1530 3300005530 Ga0070679_100987862 Ga0070679_1009878622 120
1531 3300005535 Ga0070684_100154029 Ga0070684_1001540292 120
1532 3300005535 Ga0070684_101214535 Ga0070684_1012145352 120
1533 3300005539 Ga0068853_100035403 Ga0068853_1000354032 120
1534 3300005539 Ga0068853_100103310 Ga0068853_1001033103 120
1535 3300005539 Ga0068853_100280041 Ga0068853_1002800413 120
1536 3300005539 Ga0068853_100306321 Ga0068853_1003063213 120
1537 3300005539 Ga0068853_100636422 Ga0068853_1006364222 120
1538 3300005539 Ga0068853_102161994 Ga0068853_1021619941 120
1539 3300005543 Ga0070672_100132101 Ga0070672_1001321014 120
1540 3300005544 Ga0070686_100000180 Ga0070686_10000018014 120
1541 3300005544 Ga0070686_100147930 Ga0070686_1001479302 120
1542 3300005545 Ga0070695_100002848 Ga0070695_1000028487 120
1543 3300005546 Ga0070696_100000325 Ga0070696_10000032527 120
1544 3300005546 Ga0070696_100132064 Ga0070696_1001320643 120
1545 3300005548 Ga0070665_100007214 Ga0070665_1000072146 120
1546 3300005548 Ga0070665_100035098 Ga0070665_1000350982 120
1547 3300005548 Ga0070665_100096351 Ga0070665_1000963515 120
1548 3300005548 Ga0070665_100520073 Ga0070665_1005200732 120
1549 3300005548 Ga0070665_101645239 Ga0070665_1016452392 120
1550 3300005548 Ga0070665_101718934 Ga0070665_1017189341 120
1551 3300005548 Ga0070665_102014263 Ga0070665_1020142631 120
1552 3300005563 Ga0068855_100013711 Ga0068855_1000137116 120
1553 3300005563 Ga0068855_100019332 Ga0068855_1000193327 120
1554 3300005563 Ga0068855_101260806 Ga0068855_1012608062 120
1555 3300005563 Ga0068855_101298053 Ga0068855_1012980531 120
1556 3300005563 Ga0068855_101361997 Ga0068855_1013619972 120
1557 3300005564 Ga0070664_100052478 Ga0070664_1000524781 120
1558 3300005564 Ga0070664_100054332 Ga0070664_1000543322 120
1559 3300005564 Ga0070664_100241839 Ga0070664_1002418392 120
1560 3300005564 Ga0070664_101394205 Ga0070664_1013942052 120
1561 3300005577 Ga0068857_100348275 Ga0068857_1003482752 120
1562 3300005577 Ga0068857_100461560 Ga0068857_1004615603 120
1563 3300005577 Ga0068857_100630845 Ga0068857_1006308452 120
1564 3300005577 Ga0068857_100985947 Ga0068857_1009859471 120
1565 3300005577 Ga0068857_101200472 Ga0068857_1012004722 120
1566 3300005577 Ga0068857_101679906 Ga0068857_1016799061 120
1567 3300005578 Ga0068854_100032623 Ga0068854_1000326233 120
1568 3300005578 Ga0068854_100133400 Ga0068854_1001334001 120
1569 3300005578 Ga0068854_100133726 Ga0068854_1001337262 120
1570 3300005578 Ga0068854_100192007 Ga0068854_1001920071 120
1571 3300005578 Ga0068854_101544537 Ga0068854_1015445371 120
1572 3300005578 Ga0068854_101583692 Ga0068854_1015836921 120
1573 3300005578 Ga0068854_101854222 Ga0068854_1018542221 120
1574 3300005578 Ga0068854_101972686 Ga0068854_1019726861 120
1575 3300005614 Ga0068856_100022744 Ga0068856_1000227446 120
1576 3300005614 Ga0068856_100026525 Ga0068856_1000265253 120
1577 3300005614 Ga0068856_100147182 Ga0068856_1001471822 120
1578 3300005614 Ga0068856_100289963 Ga0068856_1002899632 120
1579 3300005614 Ga0068856_101135505 Ga0068856_1011355052 120
1580 3300005616 Ga0068852_100235764 Ga0068852_1002357643 120
1581 3300005616 Ga0068852_100509361 Ga0068852_1005093612 120
1582 3300005616 Ga0068852_100521503 Ga0068852_1005215032 120
1583 3300005616 Ga0068852_100711923 Ga0068852_1007119232 120
1584 3300005616 Ga0068852_100712043 Ga0068852_1007120432 120
1585 3300005616 Ga0068852_101268045 Ga0068852_1012680452 120
1586 3300005617 Ga0068859_100000162 Ga0068859_10000016270 120
1587 3300005617 Ga0068859_100362355 Ga0068859_1003623552 120
1588 3300005617 Ga0068859_100556770 Ga0068859_1005567701 120
1589 3300005617 Ga0068859_100669333 Ga0068859_1006693332 120
1590 3300005618 Ga0068864_100004757 Ga0068864_10000475710 120
1591 3300005618 Ga0068864_100882244 Ga0068864_1008822442 120
1592 3300005618 Ga0068864_101043020 Ga0068864_1010430202 120
1593 3300005618 Ga0068864_101245018 Ga0068864_1012450182 120
1594 3300005719 Ga0068861_100001387 Ga0068861_1000013874 120
1595 3300005719 Ga0068861_100007263 Ga0068861_1000072634 120
1596 3300005719 Ga0068861_100199975 Ga0068861_1001999752 120
1597 3300005719 Ga0068861_100203136 Ga0068861_1002031361 120
1598 3300005719 Ga0068861_100425121 Ga0068861_1004251212 120
1599 3300005719 Ga0068861_102574236 Ga0068861_1025742361 120
1600 3300005834 Ga0068851_10081837 Ga0068851_100818372 120
1601 3300005840 Ga0068870_10057602 Ga0068870_100576023 120
1602 3300005841 Ga0068863_100004418 Ga0068863_10000441812 120
1603 3300005841 Ga0068863_100032893 Ga0068863_1000328933 120
1604 3300005841 Ga0068863_100037604 Ga0068863_1000376044 120
1605 3300005841 Ga0068863_100586385 Ga0068863_1005863853 120
1606 3300005841 Ga0068863_100778089 Ga0068863_1007780891 120
1607 3300005842 Ga0068858_100002314 Ga0068858_10000231422 120
1608 3300005842 Ga0068858_100004410 Ga0068858_10000441010 120
1609 3300005842 Ga0068858_100069876 Ga0068858_1000698763 120
1610 3300005842 Ga0068858_101354931 Ga0068858_1013549312 120
1611 3300005842 Ga0068858_101426778 Ga0068858_1014267781 120
1612 3300005843 Ga0068860_100004581 Ga0068860_10000458115 120
1613 3300005843 Ga0068860_100013991 Ga0068860_1000139919 120
1614 3300005843 Ga0068860_100084995 Ga0068860_1000849954 120
1615 3300005843 Ga0068860_100113883 Ga0068860_1001138832 120
1616 3300005843 Ga0068860_100776527 Ga0068860_1007765271 120
1617 3300005843 Ga0068860_100900779 Ga0068860_1009007792 120
1618 3300005844 Ga0068862_100001387 Ga0068862_10000138734 120
1619 3300005844 Ga0068862_100030244 Ga0068862_1000302443 120
1620 3300005844 Ga0068862_100119545 Ga0068862_1001195451 120
1621 3300005844 Ga0068862_101160773 Ga0068862_1011607731 120
1622 3300005981 Ga0081538_10201233 Ga0081538_102012333 120
1623 3300005983 Ga0081540_1088598 Ga0081540_10885982 120
1624 3300005983 Ga0081540_1106603 Ga0081540_11066031 120
1625 3300005985 Ga0081539_10462094 Ga0081539_104620941 120
1626 3300006028 Ga0070717_11593547 Ga0070717_115935471 120
1627 3300006038 Ga0075365_10014968 Ga0075365_100149685 120
1628 3300006038 Ga0075365_10017980 Ga0075365_100179802 120
1629 3300006038 Ga0075365_10031317 Ga0075365_100313171 120
1630 3300006038 Ga0075365_10611234 Ga0075365_106112341 120
1631 3300006038 Ga0075365_11075421 Ga0075365_110754211 120
1632 3300006042 Ga0075368_10001183 Ga0075368_100011839 120
1633 3300006042 Ga0075368_10001519 Ga0075368_100015193 120
1634 3300006042 Ga0075368_10008487 Ga0075368_100084872 120
1635 3300006042 Ga0075368_10034408 Ga0075368_100344082 120
1636 3300006042 Ga0075368_10168999 Ga0075368_101689991 120
1637 3300006048 Ga0075363_100025336 Ga0075363_1000253364 120
1638 3300006048 Ga0075363_100097619 Ga0075363_1000976193 120
1639 3300006048 Ga0075363_100565137 Ga0075363_1005651372 120
1640 3300006048 Ga0075363_100596728 Ga0075363_1005967281 120
1641 3300006051 Ga0075364_10005322 Ga0075364_100053224 120
1642 3300006051 Ga0075364_10008502 Ga0075364_100085027 120
1643 3300006051 Ga0075364_10079128 Ga0075364_100791282 120
1644 3300006051 Ga0075364_10433331 Ga0075364_104333312 120
1645 3300006051 Ga0075364_10773171 Ga0075364_107731712 120
1646 3300006175 Ga0070712_100608373 Ga0070712_1006083732 120
1647 3300006177 Ga0075362_10000497 Ga0075362_1000049716 120
1648 3300006177 Ga0075362_10138488 Ga0075362_101384883 120
1649 3300006177 Ga0075362_10177958 Ga0075362_101779581 120
1650 3300006177 Ga0075362_10179116 Ga0075362_101791163 120
1651 3300006178 Ga0075367_10001647 Ga0075367_100016473 120
1652 3300006178 Ga0075367_10021430 Ga0075367_100214303 120
1653 3300006178 Ga0075367_10027526 Ga0075367_100275261 120
1654 3300006178 Ga0075367_10946747 Ga0075367_109467472 120
1655 3300006186 Ga0075369_10016540 Ga0075369_100165401 120
1656 3300006186 Ga0075369_10021076 Ga0075369_100210762 120
1657 3300006186 Ga0075369_10039066 Ga0075369_100390663 120
1658 3300006186 Ga0075369_10048256 Ga0075369_100482562 120
1659 3300006195 Ga0075366_10043580 Ga0075366_100435801 120
1660 3300006195 Ga0075366_10097395 Ga0075366_100973952 120
1661 3300006237 Ga0097621_100049047 Ga0097621_1000490473 120
1662 3300006237 Ga0097621_100358242 Ga0097621_1003582423 120
1663 3300006237 Ga0097621_102080544 Ga0097621_1020805441 120
1664 3300006353 Ga0075370_10033069 Ga0075370_100330692 120
1665 3300006353 Ga0075370_10076731 Ga0075370_100767313 120
1666 3300006353 Ga0075370_10104865 Ga0075370_101048651 120
1667 3300006353 Ga0075370_10134495 Ga0075370_101344952 120
1668 3300006353 Ga0075370_10483391 Ga0075370_104833912 120
1669 3300006358 Ga0068871_100104063 Ga0068871_1001040633 120
1670 3300006358 Ga0068871_100205579 Ga0068871_1002055792 120
1671 3300006358 Ga0068871_100317687 Ga0068871_1003176873 120
1672 3300006844 Ga0075428_100164917 Ga0075428_1001649174 120
1673 3300006852 Ga0075433_10317467 Ga0075433_103174671 120
1674 3300006871 Ga0075434_100436550 Ga0075434_1004365503 120
1675 3300006881 Ga0068865_100328907 Ga0068865_1003289072 120
1676 3300006931 Ga0097620_100000162 Ga0097620_10000016270 120
1677 3300006931 Ga0097620_100362395 Ga0097620_1003623952 120
1678 3300006931 Ga0097620_100556807 Ga0097620_1005568071 120
1679 3300006931 Ga0097620_100669344 Ga0097620_1006693442 120
1680 3300006946 Ga0079104_1109781 Ga0079104_11097811 120
1681 3300006948 Ga0099826_10195975 Ga0099826_101959752 120
1682 3300007076 Ga0075435_102023647 Ga0075435_1020236471 120
1683 3300009011 Ga0105251_10031794 Ga0105251_100317944 120
1684 3300009011 Ga0105251_10070853 Ga0105251_100708533 120
1685 3300009011 Ga0105251_10100684 Ga0105251_101006842 120
1686 3300009011 Ga0105251_10476000 Ga0105251_104760001 120
1687 3300009092 Ga0105250_10012839 Ga0105250_100128392 120
1688 3300009092 Ga0105250_10031842 Ga0105250_100318423 120
1689 3300009093 Ga0105240_10011600 Ga0105240_1001160012 120
1690 3300009093 Ga0105240_10193654 Ga0105240_101936542 120
1691 3300009093 Ga0105240_10436407 Ga0105240_104364072 120
1692 3300009093 Ga0105240_11177219 Ga0105240_111772192 120
1693 3300009093 Ga0105240_11846607 Ga0105240_118466072 120
1694 3300009093 Ga0105240_12000063 Ga0105240_120000631 120
1695 3300009094 Ga0111539_10046885 Ga0111539_100468855 120
1696 3300009094 Ga0111539_10763422 Ga0111539_107634221 120
1697 3300009098 Ga0105245_10000318 Ga0105245_1000031830 120
1698 3300009098 Ga0105245_10158902 Ga0105245_101589022 120
1699 3300009098 Ga0105245_10208349 Ga0105245_102083492 120
1700 3300009098 Ga0105245_10508226 Ga0105245_105082262 120
1701 3300009101 Ga0105247_10001548 Ga0105247_1000154822 120
1702 3300009101 Ga0105247_10089889 Ga0105247_100898892 120
1703 3300009101 Ga0105247_10150437 Ga0105247_101504373 120
1704 3300009101 Ga0105247_10425180 Ga0105247_104251801 120
1705 3300009147 Ga0114129_12775333 Ga0114129_127753331 120
1706 3300009147 Ga0114129_12775800 Ga0114129_127758002 120
1707 3300009148 Ga0105243_10001886 Ga0105243_100018864 120
1708 3300009148 Ga0105243_10194387 Ga0105243_101943873 120
1709 3300009148 Ga0105243_10440144 Ga0105243_104401442 120
1710 3300009174 Ga0105241_10029901 Ga0105241_100299015 120
1711 3300009174 Ga0105241_10123227 Ga0105241_101232273 120
1712 3300009174 Ga0105241_10406239 Ga0105241_104062392 120
1713 3300009174 Ga0105241_10831370 Ga0105241_108313702 120
1714 3300009174 Ga0105241_10840621 Ga0105241_108406212 120
1715 3300009174 Ga0105241_11549111 Ga0105241_115491112 120
1716 3300009174 Ga0105241_12068996 Ga0105241_120689962 120
1717 3300009176 Ga0105242_10102404 Ga0105242_101024043 120
1718 3300009176 Ga0105242_10155865 Ga0105242_101558652 120
1719 3300009176 Ga0105242_10177452 Ga0105242_101774523 120
1720 3300009177 Ga0105248_10115172 Ga0105248_101151723 120
1721 3300009177 Ga0105248_10210904 Ga0105248_102109042 120
1722 3300009177 Ga0105248_10251683 Ga0105248_102516834 120
1723 3300009177 Ga0105248_10372767 Ga0105248_103727672 120
1724 3300009177 Ga0105248_11441774 Ga0105248_114417742 120
1725 3300009177 Ga0105248_12202955 Ga0105248_122029552 120
1726 3300009545 Ga0105237_10276377 Ga0105237_102763773 120
1727 3300009545 Ga0105237_10321660 Ga0105237_103216603 120
1728 3300009545 Ga0105237_10497074 Ga0105237_104970742 120
1729 3300009545 Ga0105237_10531298 Ga0105237_105312983 120
1730 3300009545 Ga0105237_10555384 Ga0105237_105553843 120
1731 3300009545 Ga0105237_11116429 Ga0105237_111164292 120
1732 3300009551 Ga0105238_10069194 Ga0105238_100691943 120
1733 3300009551 Ga0105238_10681721 Ga0105238_106817211 120
1734 3300009551 Ga0105238_10714458 Ga0105238_107144582 120
1735 3300009551 Ga0105238_11385148 Ga0105238_113851482 120
1736 3300009551 Ga0105238_11992100 Ga0105238_119921002 120
1737 3300009553 Ga0105249_10002562 Ga0105249_100025624 120
1738 3300009553 Ga0105249_10035761 Ga0105249_100357612 120
1739 3300009553 Ga0105249_10316735 Ga0105249_103167353 120
1740 3300009553 Ga0105249_12278545 Ga0105249_122785452 120
1741 3300010375 Ga0105239_10059516 Ga0105239_100595163 120
1742 3300010375 Ga0105239_10903803 Ga0105239_109038032 120
1743 3300010375 Ga0105239_12306236 Ga0105239_123062362 120
1744 3300011119 Ga0105246_10001471 Ga0105246_1000147113 120
1745 3300011119 Ga0105246_10427618 Ga0105246_104276182 120
1746 3300011119 Ga0105246_11081648 Ga0105246_110816481 120
1747 3300011119 Ga0105246_11296518 Ga0105246_112965182 120
1748 3300012490 Ga0157322_1020236 Ga0157322_10202361 120
1749 3300012502 Ga0157347_1013462 Ga0157347_10134622 120
1750 3300012512 Ga0157327_1020044 Ga0157327_10200441 120
1751 3300012513 Ga0157326_1028903 Ga0157326_10289031 120
1752 3300013100 Ga0157373_10098658 Ga0157373_100986583 120
1753 3300013100 Ga0157373_10160202 Ga0157373_101602022 120
1754 3300013100 Ga0157373_10185021 Ga0157373_101850212 120
1755 3300013100 Ga0157373_10383688 Ga0157373_103836882 120
1756 3300013102 Ga0157371_10000062 Ga0157371_1000006238 120
1757 3300013102 Ga0157371_10154772 Ga0157371_101547721 120
1758 3300013102 Ga0157371_10363897 Ga0157371_103638972 120
1759 3300013104 Ga0157370_10187429 Ga0157370_101874291 120
1760 3300013104 Ga0157370_10282834 Ga0157370_102828343 120
1761 3300013104 Ga0157370_10683278 Ga0157370_106832781 120
1762 3300013105 Ga0157369_10105295 Ga0157369_101052954 120
1763 3300013105 Ga0157369_10736481 Ga0157369_107364812 120
1764 3300013296 Ga0157374_10077068 Ga0157374_100770682 120
1765 3300013296 Ga0157374_10155442 Ga0157374_101554423 120
1766 3300013297 Ga0157378_10105700 Ga0157378_101057003 120
1767 3300013297 Ga0157378_11337921 Ga0157378_113379211 120
1768 3300013297 Ga0157378_13243432 Ga0157378_132434321 120
1769 3300013306 Ga0163162_10000823 Ga0163162_100008234 120
1770 3300013306 Ga0163162_10006344 Ga0163162_100063444 120
1771 3300013306 Ga0163162_10111614 Ga0163162_101116143 120
1772 3300013306 Ga0163162_10146476 Ga0163162_101464761 120
1773 3300013306 Ga0163162_10331280 Ga0163162_103312803 120
1774 3300013306 Ga0163162_10939429 Ga0163162_109394291 120
1775 3300013306 Ga0163162_11336930 Ga0163162_113369302 120
1776 3300013306 Ga0163162_12003456 Ga0163162_120034562 120
1777 3300013306 Ga0163162_12172311 Ga0163162_121723111 120
1778 3300013307 Ga0157372_10778361 Ga0157372_107783611 120
1779 3300013307 Ga0157372_10919623 Ga0157372_109196232 120
1780 3300013308 Ga0157375_10106173 Ga0157375_101061733 120
1781 3300013308 Ga0157375_10242307 Ga0157375_102423071 120
1782 3300013308 Ga0157375_10269885 Ga0157375_102698853 120
1783 3300013308 Ga0157375_10314419 Ga0157375_103144193 120
1784 3300013308 Ga0157375_10721260 Ga0157375_107212601 120
1785 3300014325 Ga0163163_10098327 Ga0163163_100983272 120
1786 3300014325 Ga0163163_10422424 Ga0163163_104224243 120
1787 3300014325 Ga0163163_10727617 Ga0163163_107276172 120
1788 3300014325 Ga0163163_10936956 Ga0163163_109369562 120
1789 3300014326 Ga0157380_10101524 Ga0157380_101015244 120
1790 3300014326 Ga0157380_10270474 Ga0157380_102704742 120
1791 3300014326 Ga0157380_10785256 Ga0157380_107852561 120
1792 3300014326 Ga0157380_11081820 Ga0157380_110818202 120
1793 3300014497 Ga0182008_10034454 Ga0182008_100344543 120
1794 3300014497 Ga0182008_10292256 Ga0182008_102922562 120
1795 3300014745 Ga0157377_11527519 Ga0157377_115275192 120
1796 3300014968 Ga0157379_10500846 Ga0157379_105008462 120
1797 3300014968 Ga0157379_11463918 Ga0157379_114639181 120
1798 3300014969 Ga0157376_12417710 Ga0157376_124177102 120
1799 3300015690 Ga0183363_1010 Ga0183363_101013 120
1800 3300017792 Ga0163161_10003384 Ga0163161_1000338411 120
1801 3300017792 Ga0163161_10228318 Ga0163161_102283183 120
1802 3300017792 Ga0163161_10485376 Ga0163161_104853761 120
1803 3300017792 Ga0163161_10599458 Ga0163161_105994582 120
1804 3300017792 Ga0163161_11106532 Ga0163161_111065322 120
1805 3300017792 Ga0163161_11184614 Ga0163161_111846141 120
1806 3300017792 Ga0163161_11619609 Ga0163161_116196091 120
1807 3300019182 Ga0184598_117135 Ga0184598_1171352 120
1808 3300020070 Ga0206356_10714324 Ga0206356_107143242 120
1809 3300020077 Ga0206351_10987137 Ga0206351_109871371 120
1810 3300020081 Ga0206354_11017406 Ga0206354_110174062 120
1811 3300021361 Ga0213872_10334032 Ga0213872_103340322 120
1812 3300021384 Ga0213876_10021404 Ga0213876_100214042 120
1813 3300021384 Ga0213876_10562904 Ga0213876_105629041 120
1814 3300025229 Ga0209147_101180 Ga0209147_1011804 120
1815 3300025233 Ga0209437_100050 Ga0209437_100050156 120
1816 3300025245 Ga0207425_1000005 Ga0207425_1000005788 120
1817 3300025258 Ga0209129_1001455 Ga0209129_10014558 120
1818 3300025261 Ga0209233_1000037 Ga0209233_1000037198 120
1819 3300025263 Ga0209565_1000007 Ga0209565_1000007649 120
1820 3300025263 Ga0209565_1000850 Ga0209565_10008503 120
1821 3300025272 Ga0209455_1005872 Ga0209455_10058723 120
1822 3300025272 Ga0209455_1025055 Ga0209455_10250552 120
1823 3300025273 Ga0209673_1007333 Ga0209673_10073333 120
1824 3300025273 Ga0209673_1008711 Ga0209673_10087113 120
1825 3300025290 Ga0207673_1001765 Ga0207673_10017652 120
1826 3300025291 Ga0209675_1000169 Ga0209675_10001692 120
1827 3300025291 Ga0209675_1016124 Ga0209675_10161242 120
1828 3300025292 Ga0209676_1000651 Ga0209676_100065130 120
1829 3300025292 Ga0209676_1000807 Ga0209676_100080724 120
1830 3300025292 Ga0209676_1001585 Ga0209676_100158514 120
1831 3300025292 Ga0209676_1012139 Ga0209676_10121393 120
1832 3300025292 Ga0209676_1022177 Ga0209676_10221772 120
1833 3300025294 Ga0209025_1000477 Ga0209025_100047773 120
1834 3300025294 Ga0209025_1016458 Ga0209025_10164582 120
1835 3300025294 Ga0209025_1035205 Ga0209025_10352055 120
1836 3300025295 Ga0209564_1001268 Ga0209564_100126813 120
1837 3300025297 Ga0209758_1000002 Ga0209758_1000002557 120
1838 3300025297 Ga0209758_1020798 Ga0209758_10207983 120
1839 3300025297 Ga0209758_1073008 Ga0209758_10730082 120
1840 3300025298 Ga0209050_1000001 Ga0209050_1000001504 120
1841 3300025298 Ga0209050_1000071 Ga0209050_1000071272 120
1842 3300025298 Ga0209050_1000213 Ga0209050_1000213128 120
1843 3300025298 Ga0209050_1000310 Ga0209050_100031066 120
1844 3300025298 Ga0209050_1022136 Ga0209050_10221363 120
1845 3300025298 Ga0209050_1023898 Ga0209050_10238982 120
1846 3300025298 Ga0209050_1027937 Ga0209050_10279372 120
1847 3300025299 Ga0209256_1000008 Ga0209256_1000008491 120
1848 3300025303 Ga0209051_1001344 Ga0209051_100134422 120
1849 3300025304 Ga0209257_1000027 Ga0209257_100002732 120
1850 3300025304 Ga0209257_1000113 Ga0209257_1000113222 120
1851 3300025304 Ga0209257_1000379 Ga0209257_100037955 120
1852 3300025304 Ga0209257_1002330 Ga0209257_100233014 120
1853 3300025304 Ga0209257_1002535 Ga0209257_100253512 120
1854 3300025304 Ga0209257_1008172 Ga0209257_10081724 120
1855 3300025304 Ga0209257_1073908 Ga0209257_10739082 120
1856 3300025315 Ga0207697_10003130 Ga0207697_100031306 120
1857 3300025315 Ga0207697_10049627 Ga0207697_100496272 120
1858 3300025315 Ga0207697_10495982 Ga0207697_104959821 120
1859 3300025321 Ga0207656_10015606 Ga0207656_100156063 120
1860 3300025711 Ga0207696_1009621 Ga0207696_10096212 120
1861 3300025711 Ga0207696_1182462 Ga0207696_11824622 120
1862 3300025735 Ga0207713_1027808 Ga0207713_10278081 120
1863 3300025893 Ga0207682_10489826 Ga0207682_104898262 120
1864 3300025899 Ga0207642_11127734 Ga0207642_111277341 120
1865 3300025900 Ga0207710_10001500 Ga0207710_1000150010 120
1866 3300025900 Ga0207710_10087066 Ga0207710_100870662 120
1867 3300025900 Ga0207710_10186876 Ga0207710_101868762 120
1868 3300025900 Ga0207710_10611203 Ga0207710_106112031 120
1869 3300025903 Ga0207680_10003876 Ga0207680_1000387610 120
1870 3300025903 Ga0207680_11061657 Ga0207680_110616571 120
1871 3300025904 Ga0207647_10015010 Ga0207647_100150102 120
1872 3300025904 Ga0207647_10257697 Ga0207647_102576973 120
1873 3300025907 Ga0207645_10157581 Ga0207645_101575812 120
1874 3300025907 Ga0207645_10491243 Ga0207645_104912431 120
1875 3300025909 Ga0207705_10000037 Ga0207705_10000037149 120
1876 3300025909 Ga0207705_10001756 Ga0207705_100017569 120
1877 3300025909 Ga0207705_10305783 Ga0207705_103057832 120
1878 3300025909 Ga0207705_10372330 Ga0207705_103723303 120
1879 3300025909 Ga0207705_10515727 Ga0207705_105157272 120
1880 3300025911 Ga0207654_10205025 Ga0207654_102050252 120
1881 3300025911 Ga0207654_10565528 Ga0207654_105655281 120
1882 3300025911 Ga0207654_10949379 Ga0207654_109493791 120
1883 3300025913 Ga0207695_10063442 Ga0207695_100634424 120
1884 3300025913 Ga0207695_10090796 Ga0207695_100907963 120
1885 3300025913 Ga0207695_10425775 Ga0207695_104257752 120
1886 3300025913 Ga0207695_11008826 Ga0207695_110088262 120
1887 3300025914 Ga0207671_10123662 Ga0207671_101236622 120
1888 3300025915 Ga0207693_10905594 Ga0207693_109055941 120
1889 3300025917 Ga0207660_10939625 Ga0207660_109396252 120
1890 3300025917 Ga0207660_10959431 Ga0207660_109594311 120
1891 3300025919 Ga0207657_10000695 Ga0207657_1000069526 120
1892 3300025919 Ga0207657_10053790 Ga0207657_100537904 120
1893 3300025920 Ga0207649_10921635 Ga0207649_109216352 120
1894 3300025920 Ga0207649_11334309 Ga0207649_113343092 120
1895 3300025921 Ga0207652_10000474 Ga0207652_100004748 120
1896 3300025921 Ga0207652_10078695 Ga0207652_100786953 120
1897 3300025923 Ga0207681_10000030 Ga0207681_10000030158 120
1898 3300025923 Ga0207681_10000120 Ga0207681_1000012043 120
1899 3300025923 Ga0207681_10000188 Ga0207681_1000018830 120
1900 3300025923 Ga0207681_10116214 Ga0207681_101162142 120
1901 3300025923 Ga0207681_10121656 Ga0207681_101216563 120
1902 3300025923 Ga0207681_10701429 Ga0207681_107014291 120
1903 3300025924 Ga0207694_10032047 Ga0207694_100320472 120
1904 3300025924 Ga0207694_10205261 Ga0207694_102052613 120
1905 3300025924 Ga0207694_11687627 Ga0207694_116876271 120
1906 3300025925 Ga0207650_10007097 Ga0207650_100070972 120
1907 3300025925 Ga0207650_10034458 Ga0207650_100344582 120
1908 3300025925 Ga0207650_10165351 Ga0207650_101653513 120
1909 3300025925 Ga0207650_10330158 Ga0207650_103301582 120
1910 3300025925 Ga0207650_10503856 Ga0207650_105038562 120
1911 3300025926 Ga0207659_10037022 Ga0207659_100370225 120
1912 3300025926 Ga0207659_11366318 Ga0207659_113663181 120
1913 3300025927 Ga0207687_10000398 Ga0207687_100003986 120
1914 3300025927 Ga0207687_10032848 Ga0207687_100328484 120
1915 3300025927 Ga0207687_10053051 Ga0207687_100530512 120
1916 3300025927 Ga0207687_10109163 Ga0207687_101091632 120
1917 3300025931 Ga0207644_10000008 Ga0207644_1000000893 120
1918 3300025931 Ga0207644_10000017 Ga0207644_10000017160 120
1919 3300025931 Ga0207644_10000758 Ga0207644_1000075812 120
1920 3300025931 Ga0207644_10038642 Ga0207644_100386425 120
1921 3300025931 Ga0207644_10101281 Ga0207644_101012812 120
1922 3300025932 Ga0207690_10000002 Ga0207690_10000002687 120
1923 3300025932 Ga0207690_10000033 Ga0207690_1000003342 120
1924 3300025932 Ga0207690_10231150 Ga0207690_102311503 120
1925 3300025933 Ga0207706_10020532 Ga0207706_100205321 120
1926 3300025933 Ga0207706_10139104 Ga0207706_101391043 120
1927 3300025933 Ga0207706_10509923 Ga0207706_105099232 120
1928 3300025934 Ga0207686_11494933 Ga0207686_114949332 120
1929 3300025935 Ga0207709_10180597 Ga0207709_101805972 120
1930 3300025935 Ga0207709_11047834 Ga0207709_110478342 120
1931 3300025936 Ga0207670_10344537 Ga0207670_103445371 120
1932 3300025936 Ga0207670_11424369 Ga0207670_114243692 120
1933 3300025937 Ga0207669_10194822 Ga0207669_101948222 120
1934 3300025938 Ga0207704_10414271 Ga0207704_104142711 120
1935 3300025940 Ga0207691_10407224 Ga0207691_104072243 120
1936 3300025941 Ga0207711_10028129 Ga0207711_100281294 120
1937 3300025941 Ga0207711_10107428 Ga0207711_101074282 120
1938 3300025941 Ga0207711_10297055 Ga0207711_102970552 120
1939 3300025941 Ga0207711_10443263 Ga0207711_104432633 120
1940 3300025944 Ga0207661_10329297 Ga0207661_103292972 120
1941 3300025944 Ga0207661_11041435 Ga0207661_110414351 120
1942 3300025944 Ga0207661_11169481 Ga0207661_111694812 120
1943 3300025945 Ga0207679_10062647 Ga0207679_100626475 120
1944 3300025945 Ga0207679_11674967 Ga0207679_116749671 120
1945 3300025949 Ga0207667_10004469 Ga0207667_100044698 120
1946 3300025949 Ga0207667_10133914 Ga0207667_101339142 120
1947 3300025949 Ga0207667_10283960 Ga0207667_102839601 120
1948 3300025960 Ga0207651_10827572 Ga0207651_108275722 120
1949 3300025960 Ga0207651_11099308 Ga0207651_110993082 120
1950 3300025961 Ga0207712_10003733 Ga0207712_1000373315 120
1951 3300025961 Ga0207712_10068985 Ga0207712_100689852 120
1952 3300025961 Ga0207712_10523654 Ga0207712_105236542 120
1953 3300025961 Ga0207712_10691242 Ga0207712_106912422 120
1954 3300025972 Ga0207668_10000403 Ga0207668_100004034 120
1955 3300025972 Ga0207668_10000620 Ga0207668_1000062025 120
1956 3300025972 Ga0207668_10004688 Ga0207668_100046884 120
1957 3300025972 Ga0207668_10013122 Ga0207668_100131221 120
1958 3300025972 Ga0207668_10064519 Ga0207668_100645193 120
1959 3300025972 Ga0207668_10298211 Ga0207668_102982112 120
1960 3300025972 Ga0207668_10372637 Ga0207668_103726373 120
1961 3300025981 Ga0207640_10033791 Ga0207640_100337915 120
1962 3300025981 Ga0207640_10064291 Ga0207640_100642913 120
1963 3300025981 Ga0207640_10099354 Ga0207640_100993542 120
1964 3300025981 Ga0207640_11415498 Ga0207640_114154982 120
1965 3300025986 Ga0207658_10000737 Ga0207658_1000073718 120
1966 3300025986 Ga0207658_10001017 Ga0207658_1000101711 120
1967 3300025986 Ga0207658_10001740 Ga0207658_100017405 120
1968 3300025986 Ga0207658_10065651 Ga0207658_100656513 120
1969 3300025986 Ga0207658_10485692 Ga0207658_104856922 120
1970 3300025986 Ga0207658_10899019 Ga0207658_108990192 120
1971 3300025986 Ga0207658_11027688 Ga0207658_110276882 120
1972 3300026023 Ga0207677_10000043 Ga0207677_1000004375 120
1973 3300026023 Ga0207677_10507965 Ga0207677_105079652 120
1974 3300026035 Ga0207703_10003192 Ga0207703_1000319210 120
1975 3300026035 Ga0207703_10003477 Ga0207703_100034778 120
1976 3300026035 Ga0207703_10008313 Ga0207703_100083135 120
1977 3300026035 Ga0207703_10438240 Ga0207703_104382403 120
1978 3300026035 Ga0207703_10452911 Ga0207703_104529111 120
1979 3300026035 Ga0207703_11537737 Ga0207703_115377371 120
1980 3300026041 Ga0207639_10016083 Ga0207639_100160834 120
1981 3300026041 Ga0207639_10362187 Ga0207639_103621872 120
1982 3300026067 Ga0207678_10001466 Ga0207678_1000146613 120
1983 3300026075 Ga0207708_10075845 Ga0207708_100758452 120
1984 3300026075 Ga0207708_10367232 Ga0207708_103672322 120
1985 3300026075 Ga0207708_10452388 Ga0207708_104523882 120
1986 3300026078 Ga0207702_10001194 Ga0207702_1000119412 120
1987 3300026078 Ga0207702_10123220 Ga0207702_101232202 120
1988 3300026088 Ga0207641_10005506 Ga0207641_1000550610 120
1989 3300026088 Ga0207641_10092440 Ga0207641_100924402 120
1990 3300026088 Ga0207641_10132678 Ga0207641_101326782 120
1991 3300026088 Ga0207641_11189814 Ga0207641_111898142 120
1992 3300026088 Ga0207641_11594920 Ga0207641_115949202 120
1993 3300026089 Ga0207648_10201266 Ga0207648_102012662 120
1994 3300026095 Ga0207676_10003461 Ga0207676_100034615 120
1995 3300026095 Ga0207676_10411528 Ga0207676_104115282 120
1996 3300026095 Ga0207676_10503127 Ga0207676_105031274 120
1997 3300026116 Ga0207674_10018149 Ga0207674_100181491 120
1998 3300026116 Ga0207674_10344010 Ga0207674_103440103 120
1999 3300026116 Ga0207674_10364107 Ga0207674_103641072 120
2000 3300026116 Ga0207674_10689739 Ga0207674_106897392 120
2001 3300026116 Ga0207674_11692586 Ga0207674_116925862 120
2002 3300026118 Ga0207675_100000221 Ga0207675_10000022170 120
2003 3300026118 Ga0207675_100032035 Ga0207675_1000320353 120
2004 3300026118 Ga0207675_100048571 Ga0207675_1000485714 120
2005 3300026118 Ga0207675_100551440 Ga0207675_1005514402 120
2006 3300026121 Ga0207683_10468017 Ga0207683_104680172 120
2007 3300026142 Ga0207698_10493207 Ga0207698_104932072 120
2008 3300026142 Ga0207698_10498066 Ga0207698_104980662 120
2009 3300026142 Ga0207698_10534432 Ga0207698_105344322 120
2010 3300026142 Ga0207698_10538591 Ga0207698_105385911 120
2011 3300026142 Ga0207698_10829874 Ga0207698_108298742 120
2012 3300026142 Ga0207698_10917793 Ga0207698_109177932 120
2013 3300026142 Ga0207698_11378092 Ga0207698_113780922 120
2014 3300027111 Ga0209281_1062390 Ga0209281_10623901 120
2015 3300027462 Ga0210000_1081151 Ga0210000_10811512 120
2016 3300027666 Ga0209282_1254740 Ga0209282_12547401 120
2017 3300027866 Ga0209813_10000014 Ga0209813_1000001413 120
2018 3300027866 Ga0209813_10000230 Ga0209813_1000023013 120
2019 3300027866 Ga0209813_10006694 Ga0209813_100066942 120
2020 3300027866 Ga0209813_10008755 Ga0209813_100087552 120
2021 3300027866 Ga0209813_10020418 Ga0209813_100204182 120
2022 3300027866 Ga0209813_10077130 Ga0209813_100771302 120
2023 3300027907 Ga0207428_10232679 Ga0207428_102326792 120
2024 3300027907 Ga0207428_10247950 Ga0207428_102479501 120
2025 3300028379 Ga0268266_10000002 Ga0268266_10000002404 120
2026 3300028379 Ga0268266_10003113 Ga0268266_1000311312 120
2027 3300028379 Ga0268266_10029371 Ga0268266_100293716 120
2028 3300028379 Ga0268266_10130141 Ga0268266_101301413 120
2029 3300028379 Ga0268266_10314309 Ga0268266_103143092 120
2030 3300028379 Ga0268266_11475120 Ga0268266_114751201 120
2031 3300028380 Ga0268265_10000074 Ga0268265_1000007417 120
2032 3300028380 Ga0268265_10023312 Ga0268265_100233123 120
2033 3300028380 Ga0268265_10035883 Ga0268265_100358833 120
2034 3300028380 Ga0268265_10178490 Ga0268265_101784903 120
2035 3300028380 Ga0268265_11531053 Ga0268265_115310531 120
2036 3300028381 Ga0268264_10000215 Ga0268264_1000021596 120
2037 3300028381 Ga0268264_10015091 Ga0268264_100150912 120
2038 3300028381 Ga0268264_10024453 Ga0268264_100244534 120
2039 3300028381 Ga0268264_10068596 Ga0268264_100685965 120
2040 3300028381 Ga0268264_10664297 Ga0268264_106642972 120
2041 3300028381 Ga0268264_10732494 Ga0268264_107324942 120
2042 3300028381 Ga0268264_10753907 Ga0268264_107539072 120
2043 3300028381 Ga0268264_11707721 Ga0268264_117077211 120
2044 3300028381 Ga0268264_12052361 Ga0268264_120523611 120
2045 3300028786 Ga0307517_10097484 Ga0307517_100974843 120
2046 3300028786 Ga0307517_10143392 Ga0307517_101433921 120
2047 3300030731 Ga0316177_1186482 Ga0316177_11864822 120
2048 3300030733 Ga0314311_1038512 Ga0314311_10385123 120
2049 3300030745 Ga0316182_1427119 Ga0316182_14271192 120
2050 3300030760 Ga0265762_1040596 Ga0265762_10405961 120
2051 3300030863 Ga0265766_1007313 Ga0265766_10073131 120
2052 3300031456 Ga0307513_10133646 Ga0307513_101336463 120
2053 3300031456 Ga0307513_10483897 Ga0307513_104838972 120
2054 3300031456 Ga0307513_10640871 Ga0307513_106408712 120
2055 3300031456 Ga0307513_10660788 Ga0307513_106607882 120
2056 3300031548 Ga0307408_100004861 Ga0307408_1000048619 120
2057 3300031548 Ga0307408_100049461 Ga0307408_1000494612 120
2058 3300031548 Ga0307408_100205359 Ga0307408_1002053592 120
2059 3300031548 Ga0307408_100345626 Ga0307408_1003456262 120
2060 3300031548 Ga0307408_100531713 Ga0307408_1005317132 120
2061 3300031616 Ga0307508_10000011 Ga0307508_10000011122 120
2062 3300031665 Ga0316575_10169027 Ga0316575_101690272 120
2063 3300031711 Ga0265314_10526871 Ga0265314_105268711 120
2064 3300031712 Ga0265342_10299559 Ga0265342_102995592 120
2065 3300031730 Ga0307516_10264534 Ga0307516_102645343 120
2066 3300031731 Ga0307405_10010011 Ga0307405_100100115 120
2067 3300031731 Ga0307405_10022461 Ga0307405_100224614 120
2068 3300031731 Ga0307405_10041042 Ga0307405_100410423 120
2069 3300031731 Ga0307405_10111030 Ga0307405_101110302 120
2070 3300031731 Ga0307405_10464827 Ga0307405_104648272 120
2071 3300031731 Ga0307405_10847687 Ga0307405_108476871 120
2072 3300031824 Ga0307413_10078911 Ga0307413_100789112 120
2073 3300031824 Ga0307413_10089977 Ga0307413_100899773 120
2074 3300031824 Ga0307413_10230820 Ga0307413_102308204 120
2075 3300031824 Ga0307413_10379746 Ga0307413_103797462 120
2076 3300031824 Ga0307413_10578605 Ga0307413_105786052 120
2077 3300031824 Ga0307413_12063674 Ga0307413_120636741 120
2078 3300031852 Ga0307410_10009373 Ga0307410_100093735 120
2079 3300031852 Ga0307410_10011923 Ga0307410_100119233 120
2080 3300031852 Ga0307410_10015917 Ga0307410_100159174 120
2081 3300031852 Ga0307410_10303638 Ga0307410_103036381 120
2082 3300031852 Ga0307410_10380611 Ga0307410_103806112 120
2083 3300031852 Ga0307410_10406987 Ga0307410_104069872 120
2084 3300031852 Ga0307410_10595253 Ga0307410_105952531 120
2085 3300031852 Ga0307410_10640323 Ga0307410_106403232 120
2086 3300031901 Ga0307406_10001425 Ga0307406_100014252 120
2087 3300031901 Ga0307406_10051708 Ga0307406_100517082 120
2088 3300031901 Ga0307406_10083387 Ga0307406_100833873 120
2089 3300031901 Ga0307406_10258244 Ga0307406_102582442 120
2090 3300031901 Ga0307406_10495425 Ga0307406_104954253 120
2091 3300031903 Ga0307407_10132995 Ga0307407_101329954 120
2092 3300031903 Ga0307407_10321829 Ga0307407_103218291 120
2093 3300031903 Ga0307407_10481382 Ga0307407_104813822 120
2094 3300031903 Ga0307407_10575746 Ga0307407_105757462 120
2095 3300031903 Ga0307407_10942369 Ga0307407_109423692 120
2096 3300031911 Ga0307412_10020098 Ga0307412_100200984 120
2097 3300031911 Ga0307412_10024329 Ga0307412_100243294 120
2098 3300031911 Ga0307412_10029631 Ga0307412_100296311 120
2099 3300031911 Ga0307412_10060113 Ga0307412_100601133 120
2100 3300031911 Ga0307412_10085252 Ga0307412_100852523 120
2101 3300031911 Ga0307412_10212445 Ga0307412_102124452 120
2102 3300031911 Ga0307412_10496938 Ga0307412_104969382 120
2103 3300031911 Ga0307412_10500432 Ga0307412_105004322 120
2104 3300031911 Ga0307412_10501543 Ga0307412_105015432 120
2105 3300031911 Ga0307412_10673017 Ga0307412_106730172 120
2106 3300031995 Ga0307409_100010502 Ga0307409_1000105022 120
2107 3300031995 Ga0307409_100049412 Ga0307409_1000494123 120
2108 3300031995 Ga0307409_100121708 Ga0307409_1001217082 120
2109 3300031995 Ga0307409_100483059 Ga0307409_1004830592 120
2110 3300031995 Ga0307409_100498590 Ga0307409_1004985903 120
2111 3300031995 Ga0307409_101042606 Ga0307409_1010426062 120
2112 3300031995 Ga0307409_101184418 Ga0307409_1011844182 120
2113 3300031995 Ga0307409_101823183 Ga0307409_1018231832 120
2114 3300031995 Ga0307409_102434774 Ga0307409_1024347741 120
2115 3300032002 Ga0307416_100029861 Ga0307416_1000298615 120
2116 3300032002 Ga0307416_100101817 Ga0307416_1001018173 120
2117 3300032002 Ga0307416_100116550 Ga0307416_1001165502 120
2118 3300032002 Ga0307416_100313124 Ga0307416_1003131241 120
2119 3300032002 Ga0307416_100439929 Ga0307416_1004399292 120
2120 3300032002 Ga0307416_101362775 Ga0307416_1013627752 120
2121 3300032002 Ga0307416_101746545 Ga0307416_1017465452 120
2122 3300032002 Ga0307416_101867127 Ga0307416_1018671271 120
2123 3300032002 Ga0307416_102513524 Ga0307416_1025135242 120
2124 3300032004 Ga0307414_10000371 Ga0307414_100003715 120
2125 3300032004 Ga0307414_10004614 Ga0307414_100046144 120
2126 3300032004 Ga0307414_10008100 Ga0307414_100081003 120
2127 3300032004 Ga0307414_10027055 Ga0307414_100270555 120
2128 3300032004 Ga0307414_10035772 Ga0307414_100357721 120
2129 3300032004 Ga0307414_10069418 Ga0307414_100694184 120
2130 3300032004 Ga0307414_10087115 Ga0307414_100871151 120
2131 3300032004 Ga0307414_10096364 Ga0307414_100963644 120
2132 3300032004 Ga0307414_10192892 Ga0307414_101928922 120
2133 3300032004 Ga0307414_10226868 Ga0307414_102268683 120
2134 3300032004 Ga0307414_10529256 Ga0307414_105292561 120
2135 3300032004 Ga0307414_10717603 Ga0307414_107176031 120
2136 3300032004 Ga0307414_11388803 Ga0307414_113888031 120
2137 3300032005 Ga0307411_10029626 Ga0307411_100296262 120
2138 3300032005 Ga0307411_10037350 Ga0307411_100373504 120
2139 3300032005 Ga0307411_10072538 Ga0307411_100725382 120
2140 3300032005 Ga0307411_10511312 Ga0307411_105113123 120
2141 3300032005 Ga0307411_10665199 Ga0307411_106651992 120
2142 3300032005 Ga0307411_11016560 Ga0307411_110165601 120
2143 3300032126 Ga0307415_100191609 Ga0307415_1001916093 120
2144 3300032126 Ga0307415_100211944 Ga0307415_1002119442 120
2145 3300032126 Ga0307415_100499301 Ga0307415_1004993012 120
2146 3300032126 Ga0307415_100524571 Ga0307415_1005245712 120
2147 3300032126 Ga0307415_101279797 Ga0307415_1012797972 120
2148 3300032126 Ga0307415_101749277 Ga0307415_1017492771 120
2149 3300035085 Ga0373929_0027435 Ga0373929_0027435_489_851 120
2150 3300035111 Ga0373923_0342435 Ga0373923_0342435_76_444 120
2151 3300035114 Ga0373939_0424902 Ga0373939_0424902_57_422 120
2152 3300035115 Ga0373941_0186789 Ga0373941_0186789_335_700 120
2153 3300035120 Ga0373957_0273689 Ga0373957_0273689_97_465 120
2154 3300035410 Ga0373924_0404487 Ga0373924_0404487_83_451 120
2155 3300035691 Ga0373931_0462120 Ga0373931_0462120_219_584 120
2156 3300035691 Ga0373931_0975101 Ga0373931_0975101_189_554 120
2157 3300035692 Ga0373935_0793286 Ga0373935_0793286_297_665 120
2158 3300035695 Ga0373927_0279401 Ga0373927_0279401_161_526 120
2159 3300035725 Ga0373947_0708922 Ga0373947_0708922_62_427 120
2160 3300035725 Ga0373947_1029478 Ga0373947_1029478_150_515 120
2161 3300036401 Ga0373937_0756978 Ga0373937_0756978_218_580 120
2162 3300037312 Ga0395899_0058394 Ga0395899_0058394_472_840 120
2163 3300037418 Ga0395900_0088445 Ga0395900_0088445_2642_3010 120
2164 3300037466 Ga0395898_0534956 Ga0395898_0534956_521_889 120
2165 3300037471 Ga0395905_0000608 Ga0395905_0000608_10579_10983 120
2166 3300037471 Ga0395905_1239144 Ga0395905_1239144_159_524 120
2167 3300037471 Ga0395905_1491671 Ga0395905_1491671_20_388 120
2168 3300037853 Ga0436364_0084899 Ga0436364_0084899_86_451 120
2169 3300037853 Ga0436364_0222939 Ga0436364_0222939_315_680 120
2170 3300038443 Ga0395901_0077970 Ga0395901_0077970_1266_1634 120
2171 3300038443 Ga0395901_0217858 Ga0395901_0217858_630_995 120
2172 3300039437 Ga0436365_0331130 Ga0436365_0331130_220_585 120
2173 3300039437 Ga0436365_1924518 Ga0436365_1924518_3029_3394 120
2174 3300039438 Ga0436360_0343032 Ga0436360_0343032_102_467 120
2175 3300039438 Ga0436360_0349025 Ga0436360_0349025_63_428 120
2176 3300039438 Ga0436360_0374078 Ga0436360_0374078_584_949 120
2177 3300039438 Ga0436360_1022661 Ga0436360_1022661_85_450 120
2178 3300039438 Ga0436360_1036016 Ga0436360_1036016_31_396 120
2179 3300039447 Ga0436361_0696162 Ga0436361_0696162_2221_2586 120
2180 3300039447 Ga0436361_0777262 Ga0436361_0777262_1182_1547 120
2181 3300039450 Ga0436363_1349972 Ga0436363_1349972_2575_2940 120
2182 3300039450 Ga0436363_1597741 Ga0436363_1597741_450_815 120
2183 3300039453 Ga0436362_0215979 Ga0436362_0215979_342_707 120
2184 3300039453 Ga0436362_0535229 Ga0436362_0535229_43_405 120
2185 3300039453 Ga0436362_0634200 Ga0436362_0634200_135_509 120
2186 3300039453 Ga0436362_0835643 Ga0436362_0835643_81_479 120
2187 3300039453 Ga0436362_1285925 Ga0436362_1285925_212_577 120
2188 3300041404 Ga0439436_0064552 Ga0439436_0064552_607_1008 120
2189 3300041406 Ga0439439_0005078 Ga0439439_0005078_1164_1529 120
2190 3300041407 Ga0439447_059227 Ga0439447_059227_83_448 120
2191 3300041410 Ga0439461_0010778 Ga0439461_0010778_47_412 120
2192 3300041411 Ga0439466_0019806 Ga0439466_0019806_533_898 120
2193 3300041413 Ga0439465_0001868 Ga0439465_0001868_6192_6557 120
2194 3300041413 Ga0439465_0003473 Ga0439465_0003473_4705_5070 120
2195 3300041443 Ga0451789_0762327 Ga0451789_0762327_15_380 120
2196 3300041444 Ga0451790_26137 Ga0451790_26137_19_384 120
2197 3300041445 Ga0451792_07864 Ga0451792_07864_23_388 120
2198 3300041451 Ga0451791_1586556 Ga0451791_1586556_311_676 120
2199 3300041453 Ga0451797_1467030 Ga0451797_1467030_362_727 120
2200 3300041455 Ga0451801_34670 Ga0451801_34670_23_388 120
2201 3300041458 Ga0451798_0032465 Ga0451798_0032465_136_501 120
2202 3300041458 Ga0451798_0965105 Ga0451798_0965105_143_505 120
2203 3300041459 Ga0451800_1517120 Ga0451800_1517120_190_555 120
2204 3300041460 Ga0451802_0604284 Ga0451802_0604284_105_470 120
2205 3300041462 Ga0451806_501791 Ga0451806_501791_128_493 120
2206 3300041463 Ga0451804_0497676 Ga0451804_0497676_89_451 120
2207 3300041486 Ga0451807_0346685 Ga0451807_0346685_224_589 120
2208 3300041486 Ga0451807_1013799 Ga0451807_1013799_23_385 120
2209 3300041491 Ga0451833_0170114 Ga0451833_0170114_215_580 120
2210 3300041492 Ga0451835_0912455 Ga0451835_0912455_53_418 120
2211 3300041498 Ga0451841_0666561 Ga0451841_0666561_427_792 120
2212 3300041501 Ga0451845_0989282 Ga0451845_0989282_29_394 120
2213 3300041507 Ga0451851_1228336 Ga0451851_1228336_162_527 120
2214 3300041509 Ga0451843_1470911 Ga0451843_1470911_289_654 120
2215 3300041511 Ga0451855_0483205 Ga0451855_0483205_67_471 120
2216 3300041512 Ga0451853_2334469 Ga0451853_2334469_326_691 120
2217 3300041997 Ga0439431_0000104 Ga0439431_0000104_10305_10670 120
2218 3300041997 Ga0439431_0003546 Ga0439431_0003546_1926_2291 120
2219 3300042002 Ga0439442_000783 Ga0439442_000783_5156_5521 120
2220 3300042003 Ga0439443_030922 Ga0439443_030922_301_663 120
2221 3300042004 Ga0439445_0001513 Ga0439445_0001513_1336_1701 120
2222 3300042004 Ga0439445_0025857 Ga0439445_0025857_327_692 120
2223 3300042004 Ga0439445_0093162 Ga0439445_0093162_424_786 120
2224 3300042006 Ga0439432_001274 Ga0439432_001274_3482_3847 120
2225 3300042006 Ga0439432_018010 Ga0439432_018010_91_456 120
2226 3300042010 Ga0439452_022629 Ga0439452_022629_935_1300 120
2227 3300042014 Ga0439457_005922 Ga0439457_005922_1437_1802 120
2228 3300042015 Ga0439462_0000844 Ga0439462_0000844_324_689 120
2229 3300042015 Ga0439462_0012289 Ga0439462_0012289_1736_2101 120
2230 3300042116 Ga0450912_022816 Ga0450912_022816_158_520 120
2231 3300042125 Ga0450923_025883 Ga0450923_025883_710_1075 120
2232 3300042126 Ga0450888_078432 Ga0450888_078432_20_406 120
2233 3300042144 Ga0450889_000023 Ga0450889_000023_6514_6879 120
2234 3300042185 Ga0450909_009470 Ga0450909_009470_555_920 120
2235 3300042435 Ga0439434_0005357 Ga0439434_0005357_1617_1982 120
2236 3300042435 Ga0439434_0098487 Ga0439434_0098487_204_569 120
2237 3300042436 Ga0439435_0009252 Ga0439435_0009252_1442_1804 120
2238 3300042436 Ga0439435_0193719 Ga0439435_0193719_251_613 120
2239 3300042438 Ga0439459_0050109 Ga0439459_0050109_447_812 120
2240 3300042876 Ga0451577_1620962 Ga0451577_1620962_63_428 120
2241 3300044656 Ga0466969_0091069 Ga0466969_0091069_75_440 120
2242 3300044683 Ga0466965_0545941 Ga0466965_0545941_235_639 120
2243 3300044684 Ga0466966_0003640 Ga0466966_0003640_7057_7422 120
2244 3300044694 Ga0466963_0254291 Ga0466963_0254291_732_1097 120
2245 3300044719 Ga0466971_0147659 Ga0466971_0147659_12_410 120
2246 3300044765 Ga0466970_0521680 Ga0466970_0521680_234_599 120
2247 3300044842 Ga0466957_0826159 Ga0466957_0826159_36_401 120
2248 3300045049 Ga0466959_0013668 Ga0466959_0013668_1379_1744 120
2249 3300045049 Ga0466959_0240105 Ga0466959_0240105_54_419 120
2250 3300045836 Ga0466958_0110375 Ga0466958_0110375_91_456 120
2251 3300045976 Ga0466967_0825658 Ga0466967_0825658_80_478 120
2252 3300046452 Ga0495617_005172 Ga0495617_005172_4056_4418 120
2253 3300046453 Ga0495627_000295 Ga0495627_000295_42641_43003 120
2254 3300046453 Ga0495627_000507 Ga0495627_000507_14844_15209 120
2255 3300046453 Ga0495627_000928 Ga0495627_000928_9975_10337 120
2256 3300046453 Ga0495627_017826 Ga0495627_017826_1790_2155 120
2257 3300046460 Ga0495638_0000207 Ga0495638_0000207_21794_22159 120
2258 3300046460 Ga0495638_0143540 Ga0495638_0143540_99_467 120
2259 3300046460 Ga0495638_0151305 Ga0495638_0151305_396_761 120
2260 3300046460 Ga0495638_0158058 Ga0495638_0158058_128_493 120
2261 3300046460 Ga0495638_0408671 Ga0495638_0408671_28_390 120
2262 3300046462 Ga0495651_0217711 Ga0495651_0217711_401_769 120
2263 3300046471 Ga0495650_0004608 Ga0495650_0004608_1170_1535 120
2264 3300046471 Ga0495650_0047173 Ga0495650_0047173_1009_1374 120
2265 3300046471 Ga0495650_0303078 Ga0495650_0303078_132_497 120
2266 3300046472 Ga0495580_0617920 Ga0495580_0617920_29_394 120
2267 3300046474 Ga0495605_0088630 Ga0495605_0088630_413_778 120
2268 3300046475 Ga0495639_0267650 Ga0495639_0267650_435_797 120
2269 3300046477 Ga0495664_0412313 Ga0495664_0412313_171_539 120
2270 3300046491 Ga0495584_0056669 Ga0495584_0056669_1480_1842 120
2271 3300046492 Ga0495585_0119990 Ga0495585_0119990_287_652 120
2272 3300046500 Ga0495596_0000153 Ga0495596_0000153_12351_12716 120
2273 3300046500 Ga0495596_0000154 Ga0495596_0000154_40607_40969 120
2274 3300046500 Ga0495596_0201578 Ga0495596_0201578_234_599 120
2275 3300046501 Ga0495607_0009022 Ga0495607_0009022_4017_4382 120
2276 3300046506 Ga0495583_0085714 Ga0495583_0085714_140_505 120
2277 3300046506 Ga0495583_0183298 Ga0495583_0183298_359_724 120
2278 3300046507 Ga0495606_0009651 Ga0495606_0009651_4005_4370 120
2279 3300046512 Ga0495610_0000015 Ga0495610_0000015_303605_303970 120
2280 3300046512 Ga0495610_0000102 Ga0495610_0000102_50411_50773 120
2281 3300046512 Ga0495610_0001618 Ga0495610_0001618_15609_15971 120
2282 3300046512 Ga0495610_0048245 Ga0495610_0048245_429_791 120
2283 3300046512 Ga0495610_0173077 Ga0495610_0173077_303_668 120
2284 3300046512 Ga0495610_0350328 Ga0495610_0350328_115_480 120
2285 3300046514 Ga0495618_0448869 Ga0495618_0448869_158_526 120
2286 3300046515 Ga0495620_0007378 Ga0495620_0007378_532_897 120
2287 3300046518 Ga0495631_0026605 Ga0495631_0026605_1856_2218 120
2288 3300046518 Ga0495631_0369642 Ga0495631_0369642_215_580 120
2289 3300046519 Ga0495632_0000013 Ga0495632_0000013_67015_67377 120
2290 3300046519 Ga0495632_0004141 Ga0495632_0004141_3222_3587 120
2291 3300046519 Ga0495632_0142646 Ga0495632_0142646_600_962 120
2292 3300046519 Ga0495632_0144521 Ga0495632_0144521_46_411 120
2293 3300046520 Ga0495637_0000336 Ga0495637_0000336_31039_31401 120
2294 3300046520 Ga0495637_0002839 Ga0495637_0002839_8408_8770 120
2295 3300046520 Ga0495637_0092301 Ga0495637_0092301_666_1031 120
2296 3300046522 Ga0495643_0000010 Ga0495643_0000010_205670_206032 120
2297 3300046522 Ga0495643_0001635 Ga0495643_0001635_8723_9088 120
2298 3300046522 Ga0495643_0005120 Ga0495643_0005120_6615_6980 120
2299 3300046524 Ga0495648_0018736 Ga0495648_0018736_1333_1695 120
2300 3300046524 Ga0495648_0045425 Ga0495648_0045425_1806_2168 120
2301 3300046525 Ga0495663_0000004 Ga0495663_0000004_174279_174641 120
2302 3300046525 Ga0495663_0063329 Ga0495663_0063329_435_800 120
2303 3300046525 Ga0495663_0133121 Ga0495663_0133121_84_449 120
2304 3300046528 Ga0495642_0058469 Ga0495642_0058469_155_520 120
2305 3300046529 Ga0495652_0275174 Ga0495652_0275174_623_991 120
2306 3300046530 Ga0495654_0038375 Ga0495654_0038375_1284_1649 120
2307 3300046530 Ga0495654_0272704 Ga0495654_0272704_79_441 120
2308 3300046536 Ga0495587_0093132 Ga0495587_0093132_576_944 120
2309 3300046537 Ga0495598_0013519 Ga0495598_0013519_456_818 120
2310 3300046538 Ga0495609_0001714 Ga0495609_0001714_2414_2779 120
2311 3300046539 Ga0495621_0465570 Ga0495621_0465570_170_532 120
2312 3300046558 Ga0495633_0000092 Ga0495633_0000092_47997_48359 120
2313 3300046558 Ga0495633_0001239 Ga0495633_0001239_3778_4140 120
2314 3300046558 Ga0495633_0009946 Ga0495633_0009946_2279_2644 120
2315 3300046558 Ga0495633_0042220 Ga0495633_0042220_711_1073 120
2316 3300046559 Ga0495667_0192194 Ga0495667_0192194_489_857 120
2317 3300046616 Ga0495668_0000087 Ga0495668_0000087_30473_30838 120
2318 3300046616 Ga0495668_0056696 Ga0495668_0056696_427_792 120
2319 3300046616 Ga0495668_0423788 Ga0495668_0423788_132_497 120
2320 3300046660 Ga0495625_0000275 Ga0495625_0000275_18655_19020 120
2321 3300046660 Ga0495625_0001182 Ga0495625_0001182_18676_19041 120
2322 3300046660 Ga0495625_0137896 Ga0495625_0137896_616_981 120
2323 3300046660 Ga0495625_0371219 Ga0495625_0371219_459_824 120
2324 3300046663 Ga0495635_0109018 Ga0495635_0109018_1349_1717 120
2325 3300046665 Ga0495661_0039270 Ga0495661_0039270_1776_2138 120
2326 3300046675 Ga0495657_0257287 Ga0495657_0257287_355_723 120
2327 3300046691 Ga0495670_0000010 Ga0495670_0000010_14129_14494 120
2328 3300046692 Ga0495671_0000014 Ga0495671_0000014_205670_206032 120
2329 3300046694 Ga0495649_0277269 Ga0495649_0277269_228_593 120
2330 3300046809 Ga0495600_0464772 Ga0495600_0464772_344_712 120
2331 3300047317 Ga0495604_0234463 Ga0495604_0234463_266_634 120
2332 3300047323 Ga0495683_0171932 Ga0495683_0171932_252_617 120
2333 3300047323 Ga0495683_0329538 Ga0495683_0329538_29_391 120
2334 3300047444 Ga0495675_0511700 Ga0495675_0511700_63_431 120
2335 3300047469 Ga0495673_0143742 Ga0495673_0143742_349_717 120
2336 3300047469 Ga0495673_0170489 Ga0495673_0170489_291_653 120
2337 3300047470 Ga0495681_0000046 Ga0495681_0000046_102210_102572 120
2338 3300047470 Ga0495681_0000062 Ga0495681_0000062_14857_15222 120
2339 3300047470 Ga0495681_0024722 Ga0495681_0024722_1453_1815 120
2340 3300047470 Ga0495681_0111775 Ga0495681_0111775_323_688 120
2341 3300047470 Ga0495681_0207630 Ga0495681_0207630_163_528 120
2342 3300047470 Ga0495681_0241178 Ga0495681_0241178_264_626 120
2343 3300047472 Ga0495686_0000354 Ga0495686_0000354_18408_18773 120
2344 3300047472 Ga0495686_0006459 Ga0495686_0006459_810_1175 120
2345 3300047472 Ga0495686_0017144 Ga0495686_0017144_2421_2783 120
2346 3300047472 Ga0495686_0023999 Ga0495686_0023999_1908_2270 120
2347 3300047472 Ga0495686_0214633 Ga0495686_0214633_702_1067 120
2348 3300048088 Ga0495602_0601516 Ga0495602_0601516_247_615 120
2349 3300048090 Ga0495615_0000114 Ga0495615_0000114_16246_16611 120
2350 3300048091 Ga0495626_0000459 Ga0495626_0000459_27979_28341 120
2351 3300048903 Ga0496100_0012625 Ga0496100_0012625_2833_3195 120
2352 3300048903 Ga0496100_0738193 Ga0496100_0738193_353_715 120
2353 3300048904 Ga0496101_0072704 Ga0496101_0072704_371_733 120
2354 3300048904 Ga0496101_0171874 Ga0496101_0171874_597_962 120
2355 3300048904 Ga0496101_0172161 Ga0496101_0172161_909_1271 120
2356 3300048904 Ga0496101_0269458 Ga0496101_0269458_402_767 120
2357 3300048905 Ga0496102_0002803 Ga0496102_0002803_8084_8446 120
2358 3300048905 Ga0496102_0150254 Ga0496102_0150254_904_1266 120
2359 3300048905 Ga0496102_0263736 Ga0496102_0263736_1137_1502 120
2360 3300048905 Ga0496102_0456756 Ga0496102_0456756_280_645 120
2361 3300048905 Ga0496102_0792194 Ga0496102_0792194_110_475 120
2362 3300048906 Ga0496103_0001927 Ga0496103_0001927_9912_10274 120
2363 3300048906 Ga0496103_0032759 Ga0496103_0032759_91_456 120
2364 3300048906 Ga0496103_0209714 Ga0496103_0209714_278_640 120
2365 3300048907 Ga0496104_0000521 Ga0496104_0000521_21886_22251 120
2366 3300048907 Ga0496104_0034766 Ga0496104_0034766_564_926 120
2367 3300048907 Ga0496104_0081421 Ga0496104_0081421_1438_1800 120
2368 3300048907 Ga0496104_0123318 Ga0496104_0123318_612_977 120
2369 3300048907 Ga0496104_0384608 Ga0496104_0384608_418_780 120
2370 3300048907 Ga0496104_0620043 Ga0496104_0620043_554_919 120
2371 3300048908 Ga0496105_0004218 Ga0496105_0004218_2252_2617 120
2372 3300048908 Ga0496105_0023279 Ga0496105_0023279_2448_2810 120
2373 3300048908 Ga0496105_0045068 Ga0496105_0045068_258_623 120
2374 3300048908 Ga0496105_0073984 Ga0496105_0073984_904_1266 120
2375 3300048908 Ga0496105_0535018 Ga0496105_0535018_400_765 120
2376 3300048908 Ga0496105_0890584 Ga0496105_0890584_180_542 120
2377 3300048909 Ga0496106_0000171 Ga0496106_0000171_8937_9299 120
2378 3300048909 Ga0496106_0387377 Ga0496106_0387377_224_586 120
2379 3300048909 Ga0496106_0400803 Ga0496106_0400803_317_682 120
2380 3300048909 Ga0496106_0865491 Ga0496106_0865491_295_660 120
2381 3300048909 Ga0496106_0912581 Ga0496106_0912581_310_675 120
2382 3300048910 Ga0496107_0006109 Ga0496107_0006109_6661_7023 120
2383 3300048911 Ga0496108_0000270 Ga0496108_0000270_21247_21609 120
2384 3300048911 Ga0496108_0011935 Ga0496108_0011935_3324_3689 120
2385 3300048911 Ga0496108_0053300 Ga0496108_0053300_2371_2736 120
2386 3300048911 Ga0496108_0317759 Ga0496108_0317759_130_492 120
2387 3300048912 Ga0496109_0003581 Ga0496109_0003581_1133_1498 120
2388 3300048912 Ga0496109_0018512 Ga0496109_0018512_2044_2409 120
2389 3300048912 Ga0496109_0131795 Ga0496109_0131795_207_569 120
2390 3300048912 Ga0496109_0240083 Ga0496109_0240083_114_476 120
2391 3300048913 Ga0496110_0000727 Ga0496110_0000727_15296_15661 120
2392 3300048913 Ga0496110_0035372 Ga0496110_0035372_3841_4203 120
2393 3300048913 Ga0496110_0135456 Ga0496110_0135456_1101_1466 120
2394 3300048913 Ga0496110_0158134 Ga0496110_0158134_131_493 120
2395 3300048913 Ga0496110_0249281 Ga0496110_0249281_1233_1598 120
2396 3300048913 Ga0496110_0582163 Ga0496110_0582163_453_815 120
2397 3300048914 Ga0496111_0002340 Ga0496111_0002340_1963_2328 120
2398 3300048914 Ga0496111_0008968 Ga0496111_0008968_6160_6522 120
2399 3300048914 Ga0496111_0027330 Ga0496111_0027330_3109_3474 120
2400 3300048914 Ga0496111_0392728 Ga0496111_0392728_533_895 120
2401 3300048914 Ga0496111_0785082 Ga0496111_0785082_164_529 120
2402 3300048914 Ga0496111_1174580 Ga0496111_1174580_40_402 120
2403 3300048914 Ga0496111_1248166 Ga0496111_1248166_55_420 120
2404 3300048915 Ga0496112_0138104 Ga0496112_0138104_1927_2292 120
2405 3300048915 Ga0496112_0172444 Ga0496112_0172444_627_992 120
2406 3300048915 Ga0496112_0293746 Ga0496112_0293746_25_390 120
2407 3300048915 Ga0496112_0458278 Ga0496112_0458278_796_1158 120
2408 3300048916 Ga0496113_0002792 Ga0496113_0002792_3464_3829 120
2409 3300048916 Ga0496113_0011945 Ga0496113_0011945_3471_3833 120
2410 3300048916 Ga0496113_0018160 Ga0496113_0018160_1038_1400 120
2411 3300048916 Ga0496113_0182228 Ga0496113_0182228_192_557 120
2412 3300048918 Ga0496115_0000325 Ga0496115_0000325_28183_28548 120
2413 3300048918 Ga0496115_0272478 Ga0496115_0272478_472_837 120
2414 3300048919 Ga0496116_0085482 Ga0496116_0085482_347_709 120
2415 3300048919 Ga0496116_0208824 Ga0496116_0208824_168_530 120
2416 3300048920 Ga0496117_0015681 Ga0496117_0015681_1522_1899 120
2417 3300048920 Ga0496117_0455486 Ga0496117_0455486_174_539 120
2418 3300048921 Ga0496118_0001632 Ga0496118_0001632_22615_22992 120
2419 3300048921 Ga0496118_0200944 Ga0496118_0200944_762_1163 120
2420 3300048921 Ga0496118_0210434 Ga0496118_0210434_542_904 120
2421 3300048921 Ga0496118_0453005 Ga0496118_0453005_58_462 120
2422 3300048922 Ga0496119_0009439 Ga0496119_0009439_1298_1702 120
2423 3300048922 Ga0496119_0012109 Ga0496119_0012109_963_1325 120
2424 3300048922 Ga0496119_0307964 Ga0496119_0307964_369_731 120
2425 3300048922 Ga0496119_0313285 Ga0496119_0313285_361_726 120
2426 3300048923 Ga0496120_0096375 Ga0496120_0096375_787_1191 120
2427 3300048924 Ga0496121_0000128 Ga0496121_0000128_106824_107189 120
2428 3300048924 Ga0496121_0003936 Ga0496121_0003936_6359_6721 120
2429 3300048924 Ga0496121_0016508 Ga0496121_0016508_283_645 120
2430 3300048924 Ga0496121_0027742 Ga0496121_0027742_2284_2685 120
2431 3300048924 Ga0496121_0185075 Ga0496121_0185075_44_406 120
2432 3300048924 Ga0496121_0190824 Ga0496121_0190824_1004_1366 120
2433 3300048924 Ga0496121_0268463 Ga0496121_0268463_262_639 120
2434 3300048924 Ga0496121_0325408 Ga0496121_0325408_423_827 120
2435 3300048924 Ga0496121_0394494 Ga0496121_0394494_280_660 120
2436 3300048925 Ga0496122_0012455 Ga0496122_0012455_3879_4244 120
2437 3300048925 Ga0496122_0084726 Ga0496122_0084726_541_903 120
2438 3300048925 Ga0496122_0157005 Ga0496122_0157005_739_1101 120
2439 3300048925 Ga0496122_0311926 Ga0496122_0311926_387_791 120
2440 3300048925 Ga0496122_0507230 Ga0496122_0507230_143_547 120
2441 3300048926 Ga0496123_0002815 Ga0496123_0002815_3932_4297 120
2442 3300048926 Ga0496123_0059229 Ga0496123_0059229_188_550 120
2443 3300048926 Ga0496123_0067431 Ga0496123_0067431_1308_1670 120
2444 3300048926 Ga0496123_0113838 Ga0496123_0113838_777_1181 120
2445 3300048926 Ga0496123_0259082 Ga0496123_0259082_73_477 120
2446 3300048927 Ga0496124_0010966 Ga0496124_0010966_2514_2876 120
2447 3300048927 Ga0496124_0019874 Ga0496124_0019874_3843_4208 120
2448 3300048927 Ga0496124_0021231 Ga0496124_0021231_3803_4180 120
2449 3300048927 Ga0496124_0037039 Ga0496124_0037039_2486_2851 120
2450 3300048927 Ga0496124_0367649 Ga0496124_0367649_461_823 120
2451 3300048928 Ga0496125_0012308 Ga0496125_0012308_5481_5843 120
2452 3300048928 Ga0496125_0013394 Ga0496125_0013394_938_1300 120
2453 3300048928 Ga0496125_0042770 Ga0496125_0042770_1637_2041 120
2454 3300048928 Ga0496125_0069740 Ga0496125_0069740_2290_2652 120
2455 3300048928 Ga0496125_0333205 Ga0496125_0333205_87_452 120
2456 3300048928 Ga0496125_0544777 Ga0496125_0544777_136_498 120
2457 3300048928 Ga0496125_0753732 Ga0496125_0753732_75_440 120
2458 3300048929 Ga0496126_0000365 Ga0496126_0000365_72563_72925 120
2459 3300048929 Ga0496126_0042950 Ga0496126_0042950_2108_2473 120
2460 3300048929 Ga0496126_0065970 Ga0496126_0065970_2263_2625 120
2461 3300048929 Ga0496126_0154602 Ga0496126_0154602_1004_1408 120
2462 3300049459 Ga0495678_010130 Ga0495678_010130_3228_3590 120
2463 3300049527 Ga0501311_034984 Ga0501311_034984_51_452 120
2464 3300049529 Ga0501313_066165 Ga0501313_066165_35_397 120
2465 3300049530 Ga0501314_021872 Ga0501314_021872_20_382 120
2466 3300049533 Ga0501317_048036 Ga0501317_048036_26_415 120
2467 3300049538 Ga0501322_009290 Ga0501322_009290_52_453 120
2468 3300049550 Ga0501334_11529 Ga0501334_11529_24_386 120
2469 3300049551 Ga0501335_024020 Ga0501335_024020_20_382 120
2470 3300049568 Ga0501031_0173637 Ga0501031_0173637_522_887 120
2471 3300049569 Ga0501032_0017922 Ga0501032_0017922_2914_3279 120
2472 3300049569 Ga0501032_0200349 Ga0501032_0200349_48_410 120
2473 3300049569 Ga0501032_0666305 Ga0501032_0666305_240_605 120
2474 3300049570 Ga0501033_0016714 Ga0501033_0016714_4551_4916 120
2475 3300049570 Ga0501033_0178915 Ga0501033_0178915_329_691 120
2476 3300049570 Ga0501033_0459338 Ga0501033_0459338_286_648 120
2477 3300049571 Ga0501034_0009998 Ga0501034_0009998_1988_2353 120
2478 3300049571 Ga0501034_0118260 Ga0501034_0118260_1177_1578 120
2479 3300049571 Ga0501034_0310532 Ga0501034_0310532_767_1132 120
2480 3300049571 Ga0501034_0887119 Ga0501034_0887119_40_402 120
2481 3300049572 Ga0501036_0028055 Ga0501036_0028055_3005_3370 120
2482 3300049572 Ga0501036_0100626 Ga0501036_0100626_1015_1377 120
2483 3300049573 Ga0501037_0148798 Ga0501037_0148798_294_659 120
2484 3300049573 Ga0501037_0259870 Ga0501037_0259870_311_673 120
2485 3300049573 Ga0501037_0515667 Ga0501037_0515667_370_732 120
2486 3300049574 Ga0501038_0114232 Ga0501038_0114232_1128_1493 120
2487 3300049574 Ga0501038_0680091 Ga0501038_0680091_313_675 120
2488 3300049575 Ga0501039_0442683 Ga0501039_0442683_269_634 120
2489 3300049575 Ga0501039_0601038 Ga0501039_0601038_335_697 120
2490 3300049577 Ga0501041_0169978 Ga0501041_0169978_859_1221 120
2491 3300049579 Ga0501043_0323972 Ga0501043_0323972_305_670 120
2492 3300049579 Ga0501043_0770683 Ga0501043_0770683_13_375 120
2493 3300049579 Ga0501043_1140725 Ga0501043_1140725_167_529 120
2494 3300049580 Ga0501046_0000058 Ga0501046_0000058_81622_81990 120
2495 3300049580 Ga0501046_0068840 Ga0501046_0068840_39_404 120
2496 3300049580 Ga0501046_0759272 Ga0501046_0759272_270_632 120
2497 3300049580 Ga0501046_1219056 Ga0501046_1219056_87_449 120
2498 3300049581 Ga0501047_0258739 Ga0501047_0258739_173_535 120
2499 3300049581 Ga0501047_0495578 Ga0501047_0495578_666_1031 120
2500 3300049582 Ga0501048_0847012 Ga0501048_0847012_94_459 120
2501 3300049583 Ga0501067_0168573 Ga0501067_0168573_23_385 120
2502 3300049584 Ga0501068_0374610 Ga0501068_0374610_266_628 120
2503 3300049585 Ga0501069_0011661 Ga0501069_0011661_3651_4013 120
2504 3300049585 Ga0501069_0295308 Ga0501069_0295308_434_796 120
2505 3300049585 Ga0501069_0777613 Ga0501069_0777613_169_531 120
2506 3300049586 Ga0501070_0488029 Ga0501070_0488029_141_503 120
2507 3300049586 Ga0501070_0781897 Ga0501070_0781897_105_467 120
2508 3300049589 Ga0501073_1066095 Ga0501073_1066095_44_415 120
2509 3300049590 Ga0501074_0090189 Ga0501074_0090189_707_1069 120
2510 3300049591 Ga0501075_1008779 Ga0501075_1008779_95_457 120
2511 3300049592 Ga0501076_0024210 Ga0501076_0024210_4254_4616 120
2512 3300049592 Ga0501076_0079146 Ga0501076_0079146_1493_1855 120
2513 3300049592 Ga0501076_0614010 Ga0501076_0614010_135_497 120
2514 3300049593 Ga0501077_0041128 Ga0501077_0041128_2273_2635 120
2515 3300049593 Ga0501077_0097383 Ga0501077_0097383_1008_1370 120
2516 3300049593 Ga0501077_0154000 Ga0501077_0154000_1010_1372 120
2517 3300049593 Ga0501077_0370705 Ga0501077_0370705_231_593 120
2518 3300049664 Ga0501224_002711 Ga0501224_002711_1728_2090 120
2519 3300049678 Ga0501248_007378 Ga0501248_007378_529_891 120
2520 3300049679 Ga0501249_012622 Ga0501249_012622_707_1069 120
2521 3300049683 Ga0501253_058522 Ga0501253_058522_351_713 120
2522 3300049686 Ga0501257_149816 Ga0501257_149816_31_393 120
2523 3300049741 Ga0501079_0113836 Ga0501079_0113836_556_918 120
2524 3300049743 Ga0501081_0187943 Ga0501081_0187943_813_1175 120
2525 3300049744 Ga0501083_0780607 Ga0501083_0780607_190_552 120
2526 3300049758 Ga0501241_016730 Ga0501241_016730_438_803 120
2527 3300049778 Ga0501282_027800 Ga0501282_027800_41_406 120
2528 3300049822 Ga0501035_0081680 Ga0501035_0081680_2247_2612 120
2529 3300049822 Ga0501035_0673981 Ga0501035_0673981_256_621 120
2530 3300049823 Ga0501044_0010970 Ga0501044_0010970_9296_9661 120
2531 3300049823 Ga0501044_0115709 Ga0501044_0115709_1460_1822 120
2532 3300049823 Ga0501044_0628645 Ga0501044_0628645_408_773 120
2533 3300049823 Ga0501044_0631558 Ga0501044_0631558_175_540 120
2534 3300049824 Ga0501045_0964239 Ga0501045_0964239_65_430 120
2535 3300050489 nmdc:mga03683_51312_c1 nmdc:mga03683_51312_c1_817_1182 120
2536 3300050489 nmdc:mga03683_61_c1 nmdc:mga03683_61_c1_17223_17585 120
2537 3300050489 nmdc:mga03683_88534_c1 nmdc:mga03683_88534_c1_33_395 120
2538 3300050490 nmdc:mga03n38_131721_c1 nmdc:mga03n38_131721_c1_559_924 120
2539 3300050490 nmdc:mga03n38_227884_c1 nmdc:mga03n38_227884_c1_177_542 120
2540 3300050490 nmdc:mga03n38_526_c1 nmdc:mga03n38_526_c1_2070_2432 120
2541 3300050491 nmdc:mga00v17_1044520_c1 nmdc:mga00v17_1044520_c1_44_409 120
2542 3300050491 nmdc:mga00v17_1572_c1 nmdc:mga00v17_1572_c1_10180_10542 120
2543 3300050491 nmdc:mga00v17_26014_c1 nmdc:mga00v17_26014_c1_1818_2180 120
2544 3300050491 nmdc:mga00v17_40398_c1 nmdc:mga00v17_40398_c1_1326_1691 120
2545 3300050492 nmdc:mga0yw44_19458_c1 nmdc:mga0yw44_19458_c1_2709_3074 120
2546 3300050492 nmdc:mga0yw44_202483_c1 nmdc:mga0yw44_202483_c1_15_380 120
2547 3300050493 nmdc:mga0k408_12410_c1 nmdc:mga0k408_12410_c1_634_996 120
2548 3300050493 nmdc:mga0k408_174625_c1 nmdc:mga0k408_174625_c1_307_669 120
2549 3300050494 nmdc:mga06z11_332_c1 nmdc:mga06z11_332_c1_879_1241 120
2550 3300050494 nmdc:mga06z11_3726_c1 nmdc:mga06z11_3726_c1_645_1010 120
2551 3300050494 nmdc:mga06z11_38986_c1 nmdc:mga06z11_38986_c1_1811_2176 120
2552 3300050494 nmdc:mga06z11_40485_c1 nmdc:mga06z11_40485_c1_1494_1859 120
2553 3300050494 nmdc:mga06z11_47_c1 nmdc:mga06z11_47_c1_49626_49988 120
2554 3300050494 nmdc:mga06z11_49020_c1 nmdc:mga06z11_49020_c1_367_732 120
2555 3300050494 nmdc:mga06z11_88737_c1 nmdc:mga06z11_88737_c1_1001_1366 120
2556 3300050495 nmdc:mga04h51_14887_c1 nmdc:mga04h51_14887_c1_1854_2219 120
2557 3300050495 nmdc:mga04h51_182_c1 nmdc:mga04h51_182_c1_15708_16070 120
2558 3300050495 nmdc:mga04h51_187_c1 nmdc:mga04h51_187_c1_6612_6974 120
2559 3300050495 nmdc:mga04h51_4410_c1 nmdc:mga04h51_4410_c1_2432_2797 120
2560 3300050496 nmdc:mga07m45_108019_c1 nmdc:mga07m45_108019_c1_575_937 120
2561 3300050496 nmdc:mga07m45_151799_c1 nmdc:mga07m45_151799_c1_349_711 120
2562 3300050496 nmdc:mga07m45_191370_c1 nmdc:mga07m45_191370_c1_449_811 120
2563 3300050496 nmdc:mga07m45_23094_c1 nmdc:mga07m45_23094_c1_2872_3234 120
2564 3300050507 nmdc:mga05p37_1758866_c1 nmdc:mga05p37_1758866_c1_222_584 120
2565 3300050509 nmdc:mga0qj67_27585_c1 nmdc:mga0qj67_27585_c1_2212_2574 120
2566 3300050511 nmdc:mga08y16_55896_c1 nmdc:mga08y16_55896_c1_2474_2839 120
2567 3300050512 nmdc:mga0n895_404601_c1 nmdc:mga0n895_404601_c1_643_1008 120
2568 3300050513 nmdc:mga0rr50_1285414_c1 nmdc:mga0rr50_1285414_c1_161_526 120
2569 3300050513 nmdc:mga0rr50_813484_c1 nmdc:mga0rr50_813484_c1_15_380 120
2570 3300050515 nmdc:mga0a205_298312_c1 nmdc:mga0a205_298312_c1_819_1184 120
2571 3300050515 nmdc:mga0a205_871553_c1 nmdc:mga0a205_871553_c1_220_582 120
2572 3300050516 nmdc:mga0sz30_1158_c1 nmdc:mga0sz30_1158_c1_4892_5254 120
2573 3300050516 nmdc:mga0sz30_156233_c1 nmdc:mga0sz30_156233_c1_44_406 120
2574 3300050516 nmdc:mga0sz30_44210_c1 nmdc:mga0sz30_44210_c1_551_913 120
2575 3300053077 Ga0495601_0050386 Ga0495601_0050386_850_1218 120
2576 3300053078 Ga0495612_0271102 Ga0495612_0271102_107_475 120
2577 3300053085 Ga0495619_0143229 Ga0495619_0143229_1135_1500 120
2578 3300053087 Ga0500643_045660 Ga0500643_045660_791_1156 120
2579 3300053091 Ga0500647_0092474 Ga0500647_0092474_1068_1430 120
2580 3300053091 Ga0500647_0192714 Ga0500647_0192714_130_495 120
2581 3300053093 Ga0500651_0327603 Ga0500651_0327603_89_493 120
2582 3300053094 Ga0500566_0000259 Ga0500566_0000259_5680_6045 120
2583 3300053096 Ga0500641_0006777 Ga0500641_0006777_104_469 120
2584 3300053108 Ga0500562_000398 Ga0500562_000398_1572_1937 120
2585 3300053108 Ga0500562_015570 Ga0500562_015570_1457_1822 120
2586 3300053111 Ga0500572_084547 Ga0500572_084547_254_652 120
2587 3300053116 Ga0500592_008128 Ga0500592_008128_31_396 120
2588 3300053118 Ga0500594_0029841 Ga0500594_0029841_47_409 120
2589 3300053119 Ga0500595_013870 Ga0500595_013870_2428_2793 120
2590 3300053120 Ga0500597_181793 Ga0500597_181793_486_851 120
2591 3300053122 Ga0500608_000074 Ga0500608_000074_35535_35897 120
2592 3300053123 Ga0500614_143692 Ga0500614_143692_187_549 120
2593 3300053125 Ga0500618_002141 Ga0500618_002141_5156_5518 120
2594 3300053128 Ga0500626_064675 Ga0500626_064675_1251_1616 120
2595 3300053131 Ga0500652_156648 Ga0500652_156648_170_535 120
2596 3300053134 Ga0500658_0001309 Ga0500658_0001309_1378_1743 120
2597 3300053134 Ga0500658_0049193 Ga0500658_0049193_1225_1590 120
2598 3300053134 Ga0500658_0088968 Ga0500658_0088968_641_1006 120
2599 3300053138 Ga0500564_214222 Ga0500564_214222_229_594 120
2600 3300053139 Ga0500568_0006304 Ga0500568_0006304_2917_3282 120
2601 3300053139 Ga0500568_0060966 Ga0500568_0060966_71_436 120
2602 3300053140 Ga0500573_0000010 Ga0500573_0000010_55175_55540 120
2603 3300053140 Ga0500573_0058350 Ga0500573_0058350_337_699 120
2604 3300053146 Ga0500588_0270775 Ga0500588_0270775_63_428 120
2605 3300053151 Ga0500604_0100552 Ga0500604_0100552_89_454 120
2606 3300053151 Ga0500604_0125217 Ga0500604_0125217_165_530 120
2607 3300053153 Ga0500616_0209444 Ga0500616_0209444_84_485 120
2608 3300053157 Ga0500624_000005 Ga0500624_000005_44358_44723 120
2609 3300053158 Ga0500627_0000009 Ga0500627_0000009_122032_122397 120
2610 3300053158 Ga0500627_0056561 Ga0500627_0056561_144_545 120
2611 3300053177 Ga0500636_0308214 Ga0500636_0308214_29_391 120
2612 3300053723 Ga0500567_003234 Ga0500567_003234_125_487 120
2613 3300053729 Ga0500625_000004 Ga0500625_000004_235285_235647 120
2614 3300054114 Ga0501084_0005823 Ga0501084_0005823_3891_4253 120
2615 3300059477 Ga0587084_010598 Ga0587084_010598_366_728 120
2616 3300059477 Ga0587084_033847 Ga0587084_033847_443_808 120
2617 3300059478 Ga0587093_029285 Ga0587093_029285_23_421 120
2618 3300059491 Ga0587070_044808 Ga0587070_044808_55_453 120
2619 3300059491 Ga0587070_069660 Ga0587070_069660_328_732 120
2620 3300059491 Ga0587070_086986 Ga0587070_086986_20_382 120
2621 3300059491 Ga0587070_090623 Ga0587070_090623_288_653 120
2622 3300059492 Ga0587073_0144873 Ga0587073_0144873_288_653 120
2623 3300059493 Ga0587077_094062 Ga0587077_094062_327_689 120
2624 3300059493 Ga0587077_118346 Ga0587077_118346_282_644 120
2625 3300059493 Ga0587077_137970 Ga0587077_137970_18_383 120
2626 3300059504 Ga0587082_063565 Ga0587082_063565_355_720 120
2627 3300059504 Ga0587082_070831 Ga0587082_070831_287_688 120
2628 3300059504 Ga0587082_083955 Ga0587082_083955_289_651 120
2629 3300059506 Ga0587085_112733 Ga0587085_112733_206_568 120
2630 3300059507 Ga0587086_023832 Ga0587086_023832_120_524 120
2631 3300059507 Ga0587086_037199 Ga0587086_037199_86_451 120
2632 3300059507 Ga0587086_052061 Ga0587086_052061_283_645 120
2633 3300059508 Ga0587088_005977 Ga0587088_005977_49_453 120
2634 3300059510 Ga0587090_044225 Ga0587090_044225_115_516 120
2635 3300059510 Ga0587090_054494 Ga0587090_054494_292_657 120
2636 3300059510 Ga0587090_059379 Ga0587090_059379_337_699 120
2637 3300059510 Ga0587090_075884 Ga0587090_075884_18_383 120
2638 3300059511 Ga0587091_008973 Ga0587091_008973_474_839 120
2639 3300059511 Ga0587091_054643 Ga0587091_054643_403_807 120
2640 3300059511 Ga0587091_058928 Ga0587091_058928_127_528 120
2641 3300059511 Ga0587091_099441 Ga0587091_099441_15_380 120
2642 3300059511 Ga0587091_104615 Ga0587091_104615_286_648 120
2643 3300059511 Ga0587091_109358 Ga0587091_109358_18_383 120
2644 3300059512 Ga0587092_079574 Ga0587092_079574_216_620 120
2645 3300059513 Ga0587094_030473 Ga0587094_030473_234_599 120
2646 3300059604 Ga0587098_014190 Ga0587098_014190_409_810 120
2647 3300059607 Ga0587125_013380 Ga0587125_013380_196_597 120
2648 3300059608 Ga0587129_007039 Ga0587129_007039_24_422 120
2649 3300059623 Ga0587101_063203 Ga0587101_063203_287_649 120
2650 3300059624 Ga0587109_053459 Ga0587109_053459_410_808 120
2651 3300059624 Ga0587109_111546 Ga0587109_111546_18_383 120
2652 3300059626 Ga0587115_027471 Ga0587115_027471_284_685 120
2653 3300059626 Ga0587115_028126 Ga0587115_028126_281_679 120
2654 3300059626 Ga0587115_049365 Ga0587115_049365_292_666 120
2655 3300059630 Ga0587128_021056 Ga0587128_021056_576_941 120
2656 3300059630 Ga0587128_051545 Ga0587128_051545_330_734 120
2657 3300059630 Ga0587128_060599 Ga0587128_060599_244_648 120
2658 3300059630 Ga0587128_061801 Ga0587128_061801_283_684 120
2659 3300059630 Ga0587128_156556 Ga0587128_156556_80_481 120
2660 3300059639 Ga0587062_022984 Ga0587062_022984_292_657 120
2661 3300059639 Ga0587062_029906 Ga0587062_029906_324_725 120
2662 3300059639 Ga0587062_051120 Ga0587062_051120_18_383 120
2663 3300059639 Ga0587062_057944 Ga0587062_057944_291_653 120
2664 3300059641 Ga0587068_045621 Ga0587068_045621_234_599 120
2665 3300059641 Ga0587068_055079 Ga0587068_055079_270_674 120
2666 3300059641 Ga0587068_077127 Ga0587068_077127_288_650 120
2667 3300059643 Ga0587072_020475 Ga0587072_020475_785_1147 120
2668 3300059643 Ga0587072_110335 Ga0587072_110335_245_610 120
2669 3300059643 Ga0587072_174039 Ga0587072_174039_55_459 120
2670 3300059644 Ga0587075_050672 Ga0587075_050672_290_655 120
2671 3300059645 Ga0587076_070182 Ga0587076_070182_292_657 120
2672 3300059645 Ga0587076_074743 Ga0587076_074743_21_422 120
2673 3300059645 Ga0587076_091031 Ga0587076_091031_285_647 120
2674 3300059646 Ga0587078_006441 Ga0587078_006441_625_990 120
2675 3300059646 Ga0587078_021911 Ga0587078_021911_385_789 120
2676 3300059646 Ga0587078_038780 Ga0587078_038780_19_381 120
2677 3300059648 Ga0587100_005937 Ga0587100_005937_135_536 120
2678 3300059648 Ga0587100_017547 Ga0587100_017547_290_655 120
2679 3300059648 Ga0587100_018158 Ga0587100_018158_286_648 120
2680 3300059652 Ga0587107_094970 Ga0587107_094970_136_537 120
2681 3300059652 Ga0587107_129916 Ga0587107_129916_68_472 120
2682 3300059653 Ga0587108_008472 Ga0587108_008472_145_546 120
2683 3300059654 Ga0587110_028280 Ga0587110_028280_221_586 120
2684 3300059654 Ga0587110_062436 Ga0587110_062436_18_416 120
2685 3300059660 Ga0587124_009500 Ga0587124_009500_49_447 120
2686 3300059660 Ga0587124_017999 Ga0587124_017999_110_511 120
2687 3300060344 Ga0587071_087886 Ga0587071_087886_292_657 120
2688 3300060344 Ga0587071_180495 Ga0587071_180495_44_448 120
2689 3300060346 Ga0587111_0018494 Ga0587111_0018494_133_534 120
2690 3300060346 Ga0587111_0085023 Ga0587111_0085023_121_486 120
2691 3300060346 Ga0587111_0105828 Ga0587111_0105828_278_682 120
2692 3300060346 Ga0587111_0113064 Ga0587111_0113064_306_671 120
2693 3300060346 Ga0587111_0130291 Ga0587111_0130291_278_640 120
2694 3300060346 Ga0587111_0234668 Ga0587111_0234668_75_440 120
2695 3300060353 Ga0501082_0006851 Ga0501082_0006851_1673_2035 120
2696 3300060353 Ga0501082_0242864 Ga0501082_0242864_457_822 120
2697 3300060353 Ga0501082_0680804 Ga0501082_0680804_307_681 120
2698 3300060353 Ga0501082_1357103 Ga0501082_1357103_96_488 120
2699 3300060353 Ga0501082_1389094 Ga0501082_1389094_46_408 120
2700 3300061719 Ga0466962_0359011 Ga0466962_0359011_285_683 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

21

127

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.9391 14 114
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.9328 14 114
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.9205 15 115
6xyw-assembly1.cif.gz_Aq structure of the plant mitochondrial ribosome 0.9079 13 117
6xyw-assembly1.cif.gz_Aq structure of the plant mitochondrial ribosome 0.8921 13 117
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9471 53 120 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9206 53 120 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9064 58 116 1.10.1900.20
3bjaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8663 46 88 1.10.10.10
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.86 61 120 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A2N8FNS0-F1-model_v4 deleted 0.9937 55 120
AF-A0A432PU90-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9918 56 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X0Z215-F1-model_v4 50S ribosomal protein L20 0.9769 42 115 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q7H6R6-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9705 47 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Z9XIZ9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9698 53 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
90.85 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map