F496965

General Info

Members Datasets Scaffolds Average Seq Length
2626 657 2626 80

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0009829|Ga0466968_0009829_1486_1782
Length 98
Sequence MVLSHYNAAEIFPSGGLRNMSTIEERVKKIVAEQLGVKEDEIKPSSSFVDDLGADSLDTVELVMALEEEFECEIPDEDAEKITTVQQAVDYVKAHVQS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
27 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
28 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
30 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
55 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
56 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
57 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
78 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
91 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
92 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
93 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
94 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
95 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
96 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
97 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
98 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
99 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
100 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
108 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
109 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
110 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
117 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
118 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
119 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
128 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
129 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
130 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
131 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
132 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
133 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
140 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
141 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
142 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
145 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
146 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
147 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
148 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
149 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
150 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
152 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
155 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
156 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
157 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
158 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
159 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
160 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
161 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
162 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
163 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
164 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
165 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
166 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
167 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
168 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
171 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
172 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
173 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
174 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
175 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
177 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
178 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
179 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
180 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
181 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
182 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
183 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
184 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
185 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
186 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
187 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
188 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
189 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
190 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
191 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
196 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
197 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
198 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
199 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
200 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
201 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
202 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
203 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
204 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
205 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
206 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
207 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
208 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
209 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
210 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
211 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
212 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
216 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
218 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
220 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
221 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
223 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
224 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
226 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
232 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
236 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
237 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
240 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
331 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
335 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
336 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
337 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
338 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
339 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
340 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
341 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
344 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
345 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
346 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
347 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
348 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
349 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
350 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
351 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
352 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
353 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
354 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
355 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
356 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
357 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
358 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
359 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
360 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
361 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
363 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
364 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
365 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
366 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
367 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
368 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
369 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
370 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
371 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
372 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
373 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
374 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
377 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
378 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
379 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
380 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
381 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
382 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
383 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
384 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
385 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
386 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
387 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
388 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
389 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
390 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
391 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
392 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
393 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
394 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
395 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
396 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
397 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
398 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
399 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
400 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
401 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
402 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
404 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
405 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
406 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
407 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
408 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
409 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
410 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
411 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
412 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
413 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
414 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
415 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
416 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
417 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
418 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
419 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
420 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
421 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
422 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
423 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
424 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
425 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
426 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
427 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
428 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
429 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
430 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
431 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
432 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
433 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
434 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
435 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
436 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
437 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
438 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
439 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
440 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
441 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
442 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
443 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
444 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
445 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
446 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
447 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
448 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
449 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
450 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
451 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
452 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
453 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
454 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
455 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
456 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
457 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
458 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
459 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
460 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
461 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
462 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
463 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
464 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
465 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
466 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
467 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
468 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
469 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
470 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
471 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
472 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
473 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
474 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
475 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
476 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
477 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
478 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
479 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
480 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
481 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
482 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
483 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
484 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
485 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
486 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
487 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
488 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
489 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
490 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
491 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
492 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
493 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
494 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
495 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
496 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
497 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
498 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
499 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
500 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
501 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
502 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
503 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
504 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
505 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
506 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
507 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
508 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
509 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
510 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
511 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
512 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
513 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
514 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
515 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
516 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
517 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
518 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
519 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
520 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
521 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
522 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
523 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
524 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
525 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
526 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
527 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
528 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
529 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
530 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
531 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
532 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
533 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
534 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
535 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
536 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
537 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
538 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
539 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
540 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
541 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
542 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
543 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
544 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
545 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
546 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
547 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
548 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
549 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
550 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
551 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
552 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
553 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
554 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
555 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
556 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
557 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
558 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
559 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
560 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
561 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
562 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
563 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
564 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
565 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
566 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
567 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
568 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
569 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
570 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
571 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
572 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
573 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
574 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
575 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
576 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
577 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
578 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
579 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
580 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
581 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
582 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
583 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
584 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
585 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
587 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
588 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
589 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
592 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
596 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
600 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
605 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
606 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
607 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
608 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
609 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
610 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
611 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
612 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
613 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
614 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
615 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
616 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
617 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
618 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
619 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
620 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
621 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
622 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
624 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
625 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
626 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
627 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
628 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
629 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
630 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
631 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
632 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
633 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
634 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
635 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
636 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
637 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
638 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
639 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
640 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
641 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
642 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
643 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
656 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
657 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.52
Metatranscriptomes 2.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0.23
Rhizoplane 3.5
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_273445 2162886007 Bacteria 1135
2 CNXas_1003874 3300000545 Bacteria 1056
3 JGI24736J21556_1008732 3300001904 Bacteria 1681
4 JGI24736J21556_1008750 3300001904 Bacteria 1679
5 JGI24736J21556_1027135 3300001904 Bacteria 888
6 JGI24736J21556_1048089 3300001904 Bacteria 656
7 JGI24736J21556_1068861 3300001904 Bacteria 551
8 JGI24741J21665_1023111 3300001915 Bacteria 961
9 JGI24740J21852_10001390 3300001979 Bacteria 11048
10 JGI24740J21852_10009438 3300001979 Bacteria 3820
11 JGI24740J21852_10052370 3300001979 Bacteria 1163
12 JGI24740J21852_10055297 3300001979 Bacteria 1117
13 JGI24739J22299_10005226 3300001989 Bacteria 4946
14 JGI24739J22299_10006633 3300001989 Bacteria 4359
15 JGI24739J22299_10112690 3300001989 Bacteria 815
16 JGI24737J22298_10022717 3300001990 Bacteria 1993
17 JGI24737J22298_10033479 3300001990 Bacteria 1596
18 JGI24737J22298_10037502 3300001990 Bacteria 1493
19 JGI24737J22298_10045213 3300001990 Bacteria 1345
20 JGI24737J22298_10109123 3300001990 Bacteria 819
21 JGI24737J22298_10174615 3300001990 Bacteria 634
22 JGI24735J21928_10000381 3300002067 Bacteria 15526
23 JGI24735J21928_10001883 3300002067 Bacteria 7362
24 JGI24735J21928_10017084 3300002067 Bacteria 2245
25 JGI24735J21928_10108905 3300002067 Bacteria 796
26 JGI24738J21930_10002235 3300002075 Bacteria 5140
27 JGI24738J21930_10008280 3300002075 Bacteria 2368
28 JGI24738J21930_10038196 3300002075 Bacteria 976
29 JGI24738J21930_10079152 3300002075 Bacteria 687
30 JGI24744J21845_10013036 3300002077 Bacteria 1679
31 JGI25155J39150_1002623 3300002704 Bacteria 959
32 JGI25155J39150_1003762 3300002704 Bacteria 749
33 JGI25156J39149_1026132 3300002705 Bacteria 929
34 JGI25162J39368_1000421 3300002737 Bacteria 34311
35 JGI25162J39368_1000838 3300002737 Bacteria 20276
36 JGI25154J39366_1008743 3300002738 Bacteria 1288
37 JGI25164J39214_1000296 3300002772 Bacteria 34311
38 JGI25164J39214_1000469 3300002772 Bacteria 20276
39 JGI25159J45721_1059119 3300002987 Bacteria 505
40 Ga0006778J45830_1052111 3300003162 Bacteria 866
41 Ga0006759J45824_1040412 3300003163 Bacteria 712
42 JGI25165J46597_1000528 3300003214 Bacteria 35737
43 JGI25165J46597_1000864 3300003214 Bacteria 21703
44 JGI25165J46597_1001399 3300003214 Bacteria 13173
45 Ga0006758J48902_1017231 3300003300 Bacteria 571
46 rootH1_10044428 3300003316 Bacteria 3912
47 rootH1_10051621 3300003316 Bacteria 1028
48 rootH1_10088632 3300003316 Bacteria 1007
49 rootH2_10006179 3300003320 Bacteria 1044
50 rootL2_10014064 3300003322 Bacteria 12412
51 rootL2_10034245 3300003322 Bacteria 2335
52 rootH1_10001154 3300003323 Bacteria 3781
53 JGI25160J50197_1000082 3300003354 Bacteria 97878
54 JGI25160J50197_1068501 3300003354 Bacteria 684
55 JGI26145J50221_1036787 3300003371 Bacteria 512
56 JGI26134J50242_102241 3300003392 Bacteria 643
57 JGI26134J50242_103281 3300003392 Bacteria 553
58 Ga0006556J51387_1016257 3300003479 Bacteria 1994
59 JGI26141J51220_1003644 3300003503 Bacteria 950
60 Ga0006560J51390_1020763 3300003565 Bacteria 577
61 Ga0006554J51385_1020175 3300003567 Bacteria 2104
62 Ga0007409J51694_1032027 3300003575 Bacteria 635
63 Ga0007416J51690_1028031 3300003577 Bacteria 1022
64 Ga0007416J51690_1064754 3300003577 Bacteria 638
65 Ga0006562J51391_1007541 3300003578 Bacteria 2992
66 Ga0007429J51699_1029561 3300003579 Bacteria 720
67 Ga0032354_1045397 3300003693 Bacteria 981
68 Ga0032354_1100187 3300003693 Bacteria 581
69 Ga0055538_1000132 3300003751 Bacteria 54508
70 Ga0055539_1000177 3300003752 Bacteria 54508
71 Ga0055533_1000179 3300003756 Bacteria 54508
72 Ga0055532_1000039 3300003758 Bacteria 198049
73 Ga0055532_1000179 3300003758 Bacteria 54508
74 Ga0055532_1004007 3300003758 Bacteria 2338
75 Ga0055532_1018235 3300003758 Bacteria 751
76 Ga0055525_1000408 3300003759 Bacteria 26491
77 Ga0055525_1024844 3300003759 Bacteria 509
78 Ga0055527_1000024 3300003760 Bacteria 198049
79 Ga0055527_1003207 3300003760 Bacteria 2494
80 Ga0055527_1003454 3300003760 Bacteria 2338
81 Ga0055527_1014914 3300003760 Bacteria 851
82 Ga0055535_1000028 3300003761 Bacteria 198049
83 Ga0055535_1006537 3300003761 Bacteria 2341
84 Ga0055535_1006554 3300003761 Bacteria 2338
85 Ga0055535_1013117 3300003761 Bacteria 1236
86 Ga0055542_1000047 3300003762 Bacteria 198049
87 Ga0055542_1006501 3300003762 Bacteria 2491
88 Ga0055542_1006975 3300003762 Bacteria 2347
89 Ga0055529_1000054 3300003763 Bacteria 198049
90 Ga0055529_1001396 3300003763 Bacteria 7668
91 Ga0055529_1022325 3300003763 Bacteria 784
92 Ga0055526_1064659 3300003771 Bacteria 764
93 Ga0055536_1051384 3300003781 Bacteria 904
94 Ga0055534_1010263 3300003784 Bacteria 1974
95 Ga0055528_1007004 3300003790 Bacteria 5042
96 Ga0055530_10009995 3300003791 Bacteria 3568
97 Ga0055530_10031820 3300003791 Bacteria 1380
98 Ga0055530_10039789 3300003791 Bacteria 1159
99 Ga0055540_1008846 3300003792 Bacteria 3568
100 Ga0055540_1020453 3300003792 Bacteria 1749
101 Ga0055540_1064017 3300003792 Bacteria 729
102 Ga0055531_10000202 3300003794 Bacteria 65776
103 Ga0055541_1000118 3300003841 Bacteria 54508
104 Ga0058692_1007956 3300003856 Bacteria 2762
105 Ga0058692_1025693 3300003856 Bacteria 1168
106 Ga0058692_1031368 3300003856 Bacteria 1001
107 Ga0058692_1037808 3300003856 Bacteria 864
108 Ga0058859_10136142 3300004798 Bacteria 1028
109 Ga0058859_11191534 3300004798 Bacteria 733
110 Ga0058860_10182615 3300004801 Bacteria 738
111 Ga0058860_11694978 3300004801 Bacteria 770
112 Ga0058860_12101958 3300004801 Bacteria 901
113 Ga0058862_11997135 3300004803 Bacteria 589
114 Ga0065165_1000250 3300005262 Bacteria 93116
115 Ga0065714_10000004 3300005288 Bacteria 24654
116 Ga0065714_10005795 3300005288 Bacteria 3643
117 Ga0065714_10006013 3300005288 Bacteria 3729
118 Ga0065714_10015583 3300005288 Bacteria 3679
119 Ga0065714_10041234 3300005288 Bacteria 554
120 Ga0065714_10042434 3300005288 Bacteria 539
121 Ga0065714_10107805 3300005288 Bacteria 1510
122 Ga0065704_10003789 3300005289 Bacteria 3800
123 Ga0065704_10073698 3300005289 Bacteria 6873
124 Ga0065704_10112931 3300005289 Bacteria 1923
125 Ga0065704_10145484 3300005289 Bacteria 1476
126 Ga0065704_10742395 3300005289 Bacteria 545
127 Ga0065712_10048438 3300005290 Bacteria 724
128 Ga0065712_10070345 3300005290 Bacteria 6088
129 Ga0065712_10072035 3300005290 Bacteria 4930
130 Ga0065712_10072573 3300005290 Bacteria 4697
131 Ga0065712_10687916 3300005290 Bacteria 552
132 Ga0065712_10831305 3300005290 Bacteria 503
133 Ga0065715_10002678 3300005293 Bacteria 5970
134 Ga0065715_10030549 3300005293 Bacteria 1479
135 Ga0065715_10731495 3300005293 Bacteria 639
136 Ga0065715_10786776 3300005293 Bacteria 615
137 Ga0065707_10057673 3300005295 Bacteria 709
138 Ga0065707_10220907 3300005295 Bacteria 1225
139 Ga0065707_10244207 3300005295 Bacteria 1146
140 Ga0065707_10525673 3300005295 Bacteria 738
141 Ga0070658_10004301 3300005327 Bacteria 11639
142 Ga0070658_10072517 3300005327 Bacteria 2822
143 Ga0070658_10172797 3300005327 Bacteria 1816
144 Ga0070658_10194613 3300005327 Bacteria 1710
145 Ga0070658_10390848 3300005327 Bacteria 1194
146 Ga0070658_10946156 3300005327 Bacteria 749
147 Ga0070676_10003110 3300005328 Bacteria 8575
148 Ga0070676_10043387 3300005328 Bacteria 2614
149 Ga0070676_10130630 3300005328 Bacteria 1588
150 Ga0070676_10175265 3300005328 Bacteria 1390
151 Ga0070676_10201048 3300005328 Bacteria 1306
152 Ga0070676_10219648 3300005328 Bacteria 1255
153 Ga0070676_10317248 3300005328 Bacteria 1062
154 Ga0070676_10722709 3300005328 Bacteria 729
155 Ga0070676_10830689 3300005328 Bacteria 684
156 Ga0070676_10943438 3300005328 Bacteria 645
157 Ga0070676_11199167 3300005328 Bacteria 577
158 Ga0070676_11234366 3300005328 Bacteria 569
159 Ga0070683_100167270 3300005329 Bacteria 2086
160 Ga0070683_100865984 3300005329 Bacteria 866
161 Ga0070683_100874142 3300005329 Bacteria 862
162 Ga0070683_101093956 3300005329 Bacteria 766
163 Ga0070683_101631398 3300005329 Bacteria 620
164 Ga0070690_100000663 3300005330 Bacteria 17521
165 Ga0070690_100000845 3300005330 Bacteria 15537
166 Ga0070690_100249147 3300005330 Bacteria 1256
167 Ga0070690_100268769 3300005330 Bacteria 1212
168 Ga0070690_100465779 3300005330 Bacteria 940
169 Ga0070690_101095985 3300005330 Bacteria 631
170 Ga0070670_100000001 3300005331 Bacteria 728788
171 Ga0070670_100002410 3300005331 Bacteria 15422
172 Ga0070670_100006838 3300005331 Bacteria 9664
173 Ga0070670_100041721 3300005331 Bacteria 3943
174 Ga0070670_100059281 3300005331 Bacteria 3285
175 Ga0070670_100086484 3300005331 Bacteria 2693
176 Ga0070670_100284018 3300005331 Bacteria 1445
177 Ga0070670_100399774 3300005331 Bacteria 1213
178 Ga0070670_101072797 3300005331 Bacteria 734
179 Ga0070670_101285754 3300005331 Bacteria 669
180 Ga0070670_101915101 3300005331 Bacteria 546
181 Ga0070677_10032322 3300005333 Bacteria 2006
182 Ga0070677_10033487 3300005333 Bacteria 1978
183 Ga0070677_10082795 3300005333 Bacteria 1377
184 Ga0070677_10095291 3300005333 Bacteria 1302
185 Ga0070677_10158466 3300005333 Bacteria 1060
186 Ga0070677_10591228 3300005333 Bacteria 613
187 Ga0068869_100002558 3300005334 Bacteria 10978
188 Ga0068869_100002596 3300005334 Bacteria 10912
189 Ga0068869_100004697 3300005334 Bacteria 8524
190 Ga0068869_100080899 3300005334 Bacteria 2425
191 Ga0068869_100223447 3300005334 Bacteria 1493
192 Ga0068869_100334209 3300005334 Bacteria 1232
193 Ga0068869_100335096 3300005334 Bacteria 1230
194 Ga0068869_101095806 3300005334 Bacteria 697
195 Ga0070666_10000153 3300005335 Bacteria 47364
196 Ga0070666_10011289 3300005335 Bacteria 5606
197 Ga0070666_10025933 3300005335 Bacteria 3824
198 Ga0070666_10033067 3300005335 Bacteria 3420
199 Ga0070666_10074739 3300005335 Bacteria 2310
200 Ga0070666_10251484 3300005335 Bacteria 1251
201 Ga0070666_10333207 3300005335 Bacteria 1084
202 Ga0070666_10335290 3300005335 Bacteria 1080
203 Ga0070666_10352689 3300005335 Bacteria 1053
204 Ga0070666_10768007 3300005335 Bacteria 709
205 Ga0070666_10827610 3300005335 Bacteria 683
206 Ga0070666_10991826 3300005335 Bacteria 623
207 Ga0070666_11018184 3300005335 Bacteria 615
208 Ga0070666_11444858 3300005335 Bacteria 514
209 Ga0070680_100084970 3300005336 Bacteria 2614
210 Ga0070680_100118645 3300005336 Bacteria 2207
211 Ga0070680_100542534 3300005336 Bacteria 996
212 Ga0070680_101041890 3300005336 Bacteria 707
213 Ga0070680_101330230 3300005336 Bacteria 622
214 Ga0070680_101380600 3300005336 Bacteria 610
215 Ga0070680_101535876 3300005336 Bacteria 577
216 Ga0070682_100086733 3300005337 Bacteria 2039
217 Ga0070682_100171240 3300005337 Bacteria 1509
218 Ga0070682_100430860 3300005337 Bacteria 1005
219 Ga0070682_100636347 3300005337 Bacteria 847
220 Ga0068868_100003318 3300005338 Bacteria 11198
221 Ga0068868_100039496 3300005338 Bacteria 3667
222 Ga0068868_100080408 3300005338 Bacteria 2612
223 Ga0068868_100094582 3300005338 Bacteria 2411
224 Ga0068868_100176319 3300005338 Bacteria 1772
225 Ga0068868_100193350 3300005338 Bacteria 1693
226 Ga0068868_100460407 3300005338 Bacteria 1108
227 Ga0068868_100540979 3300005338 Bacteria 1025
228 Ga0068868_102223048 3300005338 Bacteria 523
229 Ga0070660_100000010 3300005339 Bacteria 136324
230 Ga0070660_100005265 3300005339 Bacteria 8945
231 Ga0070660_100085383 3300005339 Bacteria 2482
232 Ga0070660_100242951 3300005339 Bacteria 1467
233 Ga0070660_100381820 3300005339 Bacteria 1163
234 Ga0070660_100530134 3300005339 Bacteria 981
235 Ga0070660_100532633 3300005339 Bacteria 979
236 Ga0070660_101067228 3300005339 Bacteria 683
237 Ga0070689_100004467 3300005340 Bacteria 9455
238 Ga0070689_100012313 3300005340 Bacteria 6157
239 Ga0070689_100139895 3300005340 Bacteria 1946
240 Ga0070689_100340066 3300005340 Bacteria 1257
241 Ga0070689_100372544 3300005340 Bacteria 1202
242 Ga0070689_101182275 3300005340 Bacteria 686
243 Ga0070691_10019667 3300005341 Bacteria 3117
244 Ga0070691_10302674 3300005341 Bacteria 874
245 Ga0070691_10413493 3300005341 Bacteria 763
246 Ga0070691_10925964 3300005341 Bacteria 539
247 Ga0070691_11074400 3300005341 Bacteria 506
248 Ga0070687_100046456 3300005343 Bacteria 2223
249 Ga0070687_100248020 3300005343 Bacteria 1105
250 Ga0070687_100393257 3300005343 Bacteria 907
251 Ga0070661_100000284 3300005344 Bacteria 41018
252 Ga0070661_100001082 3300005344 Bacteria 19286
253 Ga0070661_100017233 3300005344 Bacteria 5122
254 Ga0070661_100205342 3300005344 Bacteria 1507
255 Ga0070661_100292473 3300005344 Bacteria 1266
256 Ga0070661_100490617 3300005344 Bacteria 982
257 Ga0070661_100527388 3300005344 Bacteria 948
258 Ga0070661_101174417 3300005344 Bacteria 641
259 Ga0070692_10079121 3300005345 Bacteria 1767
260 Ga0070692_10153010 3300005345 Bacteria 1315
261 Ga0070692_10411109 3300005345 Bacteria 857
262 Ga0070692_10621450 3300005345 Bacteria 718
263 Ga0070692_11319007 3300005345 Bacteria 518
264 Ga0070668_100010143 3300005347 Bacteria 6983
265 Ga0070668_100018243 3300005347 Bacteria 5265
266 Ga0070668_100074688 3300005347 Bacteria 2645
267 Ga0070668_100136114 3300005347 Bacteria 1976
268 Ga0070668_100194769 3300005347 Bacteria 1661
269 Ga0070668_100211357 3300005347 Bacteria 1596
270 Ga0070668_100224894 3300005347 Bacteria 1549
271 Ga0070668_100422915 3300005347 Bacteria 1141
272 Ga0070668_101557846 3300005347 Bacteria 605
273 Ga0070669_100001202 3300005353 Bacteria 18859
274 Ga0070669_100009649 3300005353 Bacteria 6875
275 Ga0070669_100033214 3300005353 Bacteria 3731
276 Ga0070669_100040387 3300005353 Bacteria 3391
277 Ga0070669_100046626 3300005353 Bacteria 3161
278 Ga0070669_100382007 3300005353 Bacteria 1149
279 Ga0070669_100448598 3300005353 Bacteria 1063
280 Ga0070669_100456851 3300005353 Bacteria 1053
281 Ga0070669_100468593 3300005353 Bacteria 1040
282 Ga0070669_100545716 3300005353 Bacteria 966
283 Ga0070669_100812603 3300005353 Bacteria 795
284 Ga0070675_100005401 3300005354 Bacteria 9769
285 Ga0070675_100007819 3300005354 Bacteria 8286
286 Ga0070675_100038871 3300005354 Bacteria 3881
287 Ga0070675_100051434 3300005354 Bacteria 3385
288 Ga0070675_100130268 3300005354 Bacteria 2143
289 Ga0070675_100278424 3300005354 Bacteria 1469
290 Ga0070675_100776593 3300005354 Bacteria 875
291 Ga0070675_101365696 3300005354 Bacteria 653
292 Ga0070675_101813658 3300005354 Bacteria 563
293 Ga0070671_100000018 3300005355 Bacteria 147427
294 Ga0070671_100009206 3300005355 Bacteria 7931
295 Ga0070671_100030838 3300005355 Bacteria 4425
296 Ga0070671_100035726 3300005355 Bacteria 4117
297 Ga0070671_100107987 3300005355 Bacteria 2337
298 Ga0070671_100152064 3300005355 Bacteria 1954
299 Ga0070671_100287844 3300005355 Bacteria 1398
300 Ga0070671_100409410 3300005355 Bacteria 1161
301 Ga0070671_100418790 3300005355 Bacteria 1147
302 Ga0070671_100429193 3300005355 Bacteria 1132
303 Ga0070671_100454619 3300005355 Bacteria 1099
304 Ga0070671_100943528 3300005355 Bacteria 755
305 Ga0070671_101048591 3300005355 Bacteria 715
306 Ga0070671_101169568 3300005355 Bacteria 677
307 Ga0070674_100003800 3300005356 Bacteria 8533
308 Ga0070674_100062460 3300005356 Bacteria 2603
309 Ga0070674_100064838 3300005356 Bacteria 2562
310 Ga0070674_100071548 3300005356 Bacteria 2453
311 Ga0070674_100131710 3300005356 Bacteria 1865
312 Ga0070674_100248152 3300005356 Bacteria 1397
313 Ga0070674_100470949 3300005356 Bacteria 1041
314 Ga0070674_100497999 3300005356 Bacteria 1014
315 Ga0070674_101053913 3300005356 Bacteria 716
316 Ga0070674_101308080 3300005356 Bacteria 647
317 Ga0070674_101323381 3300005356 Bacteria 643
318 Ga0070674_101379182 3300005356 Bacteria 631
319 Ga0070673_100003793 3300005364 Bacteria 9483
320 Ga0070673_100010465 3300005364 Bacteria 6281
321 Ga0070673_100028043 3300005364 Bacteria 4182
322 Ga0070673_100085869 3300005364 Bacteria 2563
323 Ga0070673_100095905 3300005364 Bacteria 2433
324 Ga0070673_100523818 3300005364 Bacteria 1074
325 Ga0070673_100882440 3300005364 Bacteria 829
326 Ga0070688_100004521 3300005365 Bacteria 7253
327 Ga0070688_100004797 3300005365 Bacteria 7070
328 Ga0070688_100439618 3300005365 Bacteria 973
329 Ga0070688_100520685 3300005365 Bacteria 900
330 Ga0070688_100608497 3300005365 Bacteria 837
331 Ga0070688_101120918 3300005365 Bacteria 630
332 Ga0070659_100000167 3300005366 Bacteria 50757
333 Ga0070659_100050662 3300005366 Bacteria 3263
334 Ga0070659_100052278 3300005366 Bacteria 3213
335 Ga0070659_100245274 3300005366 Bacteria 1483
336 Ga0070659_100280372 3300005366 Bacteria 1386
337 Ga0070659_100643486 3300005366 Bacteria 914
338 Ga0070659_100688124 3300005366 Bacteria 884
339 Ga0070659_101477557 3300005366 Bacteria 605
340 Ga0070659_101549024 3300005366 Bacteria 591
341 Ga0070667_100000026 3300005367 Bacteria 183244
342 Ga0070667_100006047 3300005367 Bacteria 10053
343 Ga0070667_100020285 3300005367 Bacteria 5517
344 Ga0070667_100025595 3300005367 Bacteria 4906
345 Ga0070667_100045008 3300005367 Bacteria 3709
346 Ga0070667_100053230 3300005367 Bacteria 3416
347 Ga0070667_100127631 3300005367 Bacteria 2218
348 Ga0070667_100249480 3300005367 Bacteria 1586
349 Ga0070667_100309486 3300005367 Bacteria 1424
350 Ga0070667_100403357 3300005367 Bacteria 1245
351 Ga0070667_100478781 3300005367 Bacteria 1139
352 Ga0070667_100497740 3300005367 Bacteria 1117
353 Ga0070667_101102579 3300005367 Bacteria 742
354 Ga0070667_102311859 3300005367 Bacteria 506
355 Ga0070703_10040867 3300005406 Bacteria 1444
356 Ga0070709_10276176 3300005434 Bacteria 1219
357 Ga0070709_10663146 3300005434 Bacteria 809
358 Ga0070709_11047061 3300005434 Bacteria 651
359 Ga0070714_100059415 3300005435 Bacteria 3278
360 Ga0070714_100836799 3300005435 Bacteria 892
361 Ga0070714_101438603 3300005435 Bacteria 673
362 Ga0070713_100003384 3300005436 Bacteria 10534
363 Ga0070713_100067752 3300005436 Bacteria 3007
364 Ga0070710_10259447 3300005437 Bacteria 1120
365 Ga0070710_10350085 3300005437 Bacteria 978
366 Ga0070710_10402422 3300005437 Bacteria 918
367 Ga0070710_11440565 3300005437 Bacteria 516
368 Ga0070701_10006734 3300005438 Bacteria 4857
369 Ga0070701_10155879 3300005438 Bacteria 1319
370 Ga0070701_10183383 3300005438 Bacteria 1227
371 Ga0070701_11005360 3300005438 Bacteria 582
372 Ga0070711_100043262 3300005439 Bacteria 3049
373 Ga0070711_100228474 3300005439 Bacteria 1450
374 Ga0070711_100597739 3300005439 Bacteria 920
375 Ga0070711_100619366 3300005439 Bacteria 905
376 Ga0070711_101223704 3300005439 Bacteria 650
377 Ga0070705_100008967 3300005440 Bacteria 4962
378 Ga0070705_100025145 3300005440 Bacteria 3225
379 Ga0070705_100249622 3300005440 Bacteria 1245
380 Ga0070705_100253221 3300005440 Bacteria 1237
381 Ga0070705_100617533 3300005440 Bacteria 841
382 Ga0070705_100686666 3300005440 Bacteria 802
383 Ga0070705_101007161 3300005440 Bacteria 676
384 Ga0070700_100000846 3300005441 Bacteria 15113
385 Ga0070700_100283122 3300005441 Bacteria 1203
386 Ga0070700_100360501 3300005441 Bacteria 1081
387 Ga0070700_100487967 3300005441 Bacteria 945
388 Ga0070700_100662171 3300005441 Bacteria 826
389 Ga0070700_100685019 3300005441 Bacteria 813
390 Ga0070700_101791174 3300005441 Bacteria 529
391 Ga0070694_100035136 3300005444 Bacteria 3311
392 Ga0070694_100043596 3300005444 Bacteria 3000
393 Ga0070694_100044085 3300005444 Bacteria 2984
394 Ga0070694_100969295 3300005444 Bacteria 705
395 Ga0070708_100048840 3300005445 Bacteria 3743
396 Ga0070708_100079739 3300005445 Bacteria 2962
397 Ga0070708_100678764 3300005445 Bacteria 970
398 Ga0070663_100000789 3300005455 Bacteria 17198
399 Ga0070663_100022618 3300005455 Bacteria 4206
400 Ga0070663_100121956 3300005455 Bacteria 1970
401 Ga0070663_100127002 3300005455 Bacteria 1933
402 Ga0070663_100139704 3300005455 Bacteria 1848
403 Ga0070663_100180793 3300005455 Bacteria 1636
404 Ga0070663_100290067 3300005455 Bacteria 1306
405 Ga0070663_100561267 3300005455 Bacteria 955
406 Ga0070663_100764337 3300005455 Bacteria 826
407 Ga0070663_100998009 3300005455 Bacteria 728
408 Ga0070678_100005814 3300005456 Bacteria 7176
409 Ga0070678_100021026 3300005456 Bacteria 4294
410 Ga0070678_100050334 3300005456 Bacteria 3013
411 Ga0070678_100172994 3300005456 Bacteria 1761
412 Ga0070678_100257216 3300005456 Bacteria 1467
413 Ga0070678_100618884 3300005456 Bacteria 968
414 Ga0070678_100798182 3300005456 Bacteria 857
415 Ga0070678_101085570 3300005456 Bacteria 738
416 Ga0070678_102204069 3300005456 Bacteria 522
417 Ga0070662_100000804 3300005457 Bacteria 19304
418 Ga0070662_100046182 3300005457 Bacteria 3129
419 Ga0070662_100165302 3300005457 Bacteria 1734
420 Ga0070662_100170877 3300005457 Bacteria 1707
421 Ga0070662_100208921 3300005457 Bacteria 1552
422 Ga0070662_100361671 3300005457 Bacteria 1191
423 Ga0070662_100412036 3300005457 Bacteria 1117
424 Ga0070662_101054591 3300005457 Bacteria 697
425 Ga0070662_101116566 3300005457 Bacteria 677
426 Ga0070681_10007272 3300005458 Bacteria 10808
427 Ga0070681_10098373 3300005458 Bacteria 2872
428 Ga0070681_10106737 3300005458 Bacteria 2742
429 Ga0070681_10148230 3300005458 Bacteria 2274
430 Ga0070681_10163377 3300005458 Bacteria 2150
431 Ga0070681_10600669 3300005458 Bacteria 1015
432 Ga0068867_100005228 3300005459 Bacteria 9159
433 Ga0068867_100016575 3300005459 Bacteria 5232
434 Ga0068867_100057208 3300005459 Bacteria 2887
435 Ga0068867_100061782 3300005459 Bacteria 2782
436 Ga0068867_100081246 3300005459 Bacteria 2443
437 Ga0068867_100503604 3300005459 Bacteria 1041
438 Ga0068867_100663077 3300005459 Bacteria 917
439 Ga0068867_100685511 3300005459 Bacteria 903
440 Ga0068867_100814274 3300005459 Bacteria 834
441 Ga0068867_100994589 3300005459 Bacteria 760
442 Ga0068867_101336045 3300005459 Bacteria 663
443 Ga0068867_101875358 3300005459 Bacteria 565
444 Ga0070685_10000007 3300005466 Bacteria 180539
445 Ga0070685_10001663 3300005466 Bacteria 11684
446 Ga0070685_10239261 3300005466 Bacteria 1197
447 Ga0070685_10752337 3300005466 Bacteria 715
448 Ga0070685_10945308 3300005466 Bacteria 644
449 Ga0070706_100394119 3300005467 Bacteria 1289
450 Ga0070706_100409253 3300005467 Bacteria 1263
451 Ga0070706_100485702 3300005467 Bacteria 1149
452 Ga0070706_101119425 3300005467 Bacteria 725
453 Ga0070706_101537734 3300005467 Bacteria 608
454 Ga0070706_101609366 3300005467 Bacteria 592
455 Ga0070706_101647794 3300005467 Bacteria 585
456 Ga0070707_100225059 3300005468 Bacteria 1826
457 Ga0070707_100659670 3300005468 Bacteria 1009
458 Ga0070698_100186515 3300005471 Bacteria 2012
459 Ga0070698_100209977 3300005471 Bacteria 1882
460 Ga0070698_100787289 3300005471 Bacteria 895
461 Ga0070699_100220649 3300005518 Bacteria 1689
462 Ga0070699_100373778 3300005518 Bacteria 1286
463 Ga0070699_101002787 3300005518 Bacteria 766
464 Ga0070699_101449501 3300005518 Bacteria 630
465 Ga0070679_100111929 3300005530 Bacteria 2716
466 Ga0070679_100113076 3300005530 Bacteria 2700
467 Ga0070679_101112040 3300005530 Bacteria 735
468 Ga0070679_101846605 3300005530 Bacteria 553
469 Ga0070684_100111334 3300005535 Bacteria 2455
470 Ga0070684_100270276 3300005535 Bacteria 1556
471 Ga0070684_100303775 3300005535 Bacteria 1464
472 Ga0070684_100582364 3300005535 Bacteria 1040
473 Ga0070684_101931002 3300005535 Bacteria 557
474 Ga0070697_100013110 3300005536 Bacteria 6498
475 Ga0070697_100231155 3300005536 Bacteria 1577
476 Ga0070697_100396096 3300005536 Bacteria 1198
477 Ga0070697_101156875 3300005536 Bacteria 689
478 Ga0068853_100003812 3300005539 Bacteria 11552
479 Ga0068853_100039213 3300005539 Bacteria 4040
480 Ga0068853_100054281 3300005539 Bacteria 3453
481 Ga0068853_100173214 3300005539 Bacteria 1953
482 Ga0068853_100200889 3300005539 Bacteria 1814
483 Ga0068853_100402422 3300005539 Bacteria 1281
484 Ga0068853_100586350 3300005539 Bacteria 1058
485 Ga0068853_100702679 3300005539 Bacteria 965
486 Ga0070672_100000540 3300005543 Bacteria 22218
487 Ga0070672_100020517 3300005543 Bacteria 4821
488 Ga0070672_100070478 3300005543 Bacteria 2778
489 Ga0070672_100141702 3300005543 Bacteria 1983
490 Ga0070672_100241010 3300005543 Bacteria 1521
491 Ga0070672_100336758 3300005543 Bacteria 1284
492 Ga0070672_101277114 3300005543 Bacteria 655
493 Ga0070672_101976422 3300005543 Bacteria 525
494 Ga0070686_100001455 3300005544 Bacteria 13358
495 Ga0070686_100459981 3300005544 Bacteria 980
496 Ga0070686_100593233 3300005544 Bacteria 872
497 Ga0070686_100878902 3300005544 Bacteria 728
498 Ga0070686_101069148 3300005544 Bacteria 665
499 Ga0070695_100053350 3300005545 Bacteria 2599
500 Ga0070695_100275110 3300005545 Bacteria 1235
501 Ga0070695_100434354 3300005545 Bacteria 1002
502 Ga0070695_100463093 3300005545 Bacteria 974
503 Ga0070695_100915736 3300005545 Bacteria 709
504 Ga0070695_100994254 3300005545 Bacteria 682
505 Ga0070695_101042913 3300005545 Bacteria 667
506 Ga0070696_100166381 3300005546 Bacteria 1627
507 Ga0070696_100259113 3300005546 Bacteria 1318
508 Ga0070696_100562682 3300005546 Bacteria 915
509 Ga0070696_101276764 3300005546 Bacteria 623
510 Ga0070693_100050147 3300005547 Bacteria 2384
511 Ga0070693_100062893 3300005547 Bacteria 2161
512 Ga0070693_100222443 3300005547 Bacteria 1237
513 Ga0070693_100301224 3300005547 Bacteria 1081
514 Ga0070693_100611990 3300005547 Bacteria 788
515 Ga0070693_100721857 3300005547 Bacteria 732
516 Ga0070665_100001402 3300005548 Bacteria 28337
517 Ga0070665_100008939 3300005548 Bacteria 10151
518 Ga0070665_100059181 3300005548 Bacteria 3840
519 Ga0070665_100060998 3300005548 Bacteria 3780
520 Ga0070665_100068997 3300005548 Bacteria 3543
521 Ga0070665_100126978 3300005548 Bacteria 2553
522 Ga0070665_100172570 3300005548 Bacteria 2163
523 Ga0070665_100303361 3300005548 Bacteria 1600
524 Ga0070665_100318033 3300005548 Bacteria 1561
525 Ga0070665_100320756 3300005548 Bacteria 1553
526 Ga0070665_100429623 3300005548 Bacteria 1330
527 Ga0070665_101143046 3300005548 Bacteria 790
528 Ga0070665_101288384 3300005548 Bacteria 741
529 Ga0070665_101378980 3300005548 Bacteria 714
530 Ga0070704_100039968 3300005549 Bacteria 3224
531 Ga0070704_100068766 3300005549 Bacteria 2563
532 Ga0070704_100114107 3300005549 Bacteria 2061
533 Ga0070704_100134185 3300005549 Bacteria 1923
534 Ga0070704_100134882 3300005549 Bacteria 1919
535 Ga0070704_100143290 3300005549 Bacteria 1869
536 Ga0070704_100216727 3300005549 Bacteria 1554
537 Ga0070704_100370199 3300005549 Bacteria 1215
538 Ga0070704_100400708 3300005549 Bacteria 1171
539 Ga0068855_100001012 3300005563 Bacteria 35037
540 Ga0068855_100001935 3300005563 Bacteria 25716
541 Ga0068855_100066402 3300005563 Bacteria 4206
542 Ga0068855_100363852 3300005563 Bacteria 1591
543 Ga0068855_100403637 3300005563 Bacteria 1497
544 Ga0068855_100580354 3300005563 Bacteria 1211
545 Ga0068855_100918403 3300005563 Bacteria 924
546 Ga0070664_100000681 3300005564 Bacteria 25939
547 Ga0070664_100160639 3300005564 Bacteria 1988
548 Ga0070664_100196035 3300005564 Bacteria 1800
549 Ga0070664_100204324 3300005564 Bacteria 1764
550 Ga0070664_100221808 3300005564 Bacteria 1692
551 Ga0070664_100280812 3300005564 Bacteria 1502
552 Ga0070664_100580316 3300005564 Bacteria 1039
553 Ga0070664_101264136 3300005564 Bacteria 697
554 Ga0068857_100049665 3300005577 Bacteria 3722
555 Ga0068857_100177574 3300005577 Bacteria 1937
556 Ga0068857_100182083 3300005577 Bacteria 1912
557 Ga0068857_100196311 3300005577 Bacteria 1839
558 Ga0068857_100357848 3300005577 Bacteria 1353
559 Ga0068857_100578659 3300005577 Bacteria 1060
560 Ga0068857_100593128 3300005577 Bacteria 1047
561 Ga0068857_100744231 3300005577 Bacteria 933
562 Ga0068854_100023043 3300005578 Bacteria 4250
563 Ga0068854_100121423 3300005578 Bacteria 1984
564 Ga0068854_100192287 3300005578 Bacteria 1600
565 Ga0068854_100252132 3300005578 Bacteria 1410
566 Ga0068854_100373242 3300005578 Bacteria 1173
567 Ga0068854_100841015 3300005578 Bacteria 803
568 Ga0068854_101616479 3300005578 Bacteria 591
569 Ga0068856_100526630 3300005614 Bacteria 1203
570 Ga0068856_100657148 3300005614 Bacteria 1069
571 Ga0068856_100944301 3300005614 Bacteria 881
572 Ga0068856_101111464 3300005614 Bacteria 808
573 Ga0068856_101322975 3300005614 Bacteria 736
574 Ga0068856_101347040 3300005614 Bacteria 729
575 Ga0068856_101388904 3300005614 Bacteria 717
576 Ga0068856_101492247 3300005614 Bacteria 690
577 Ga0070702_100001220 3300005615 Bacteria 10400
578 Ga0070702_100078567 3300005615 Bacteria 1970
579 Ga0070702_100168809 3300005615 Bacteria 1421
580 Ga0070702_100992693 3300005615 Bacteria 664
581 Ga0070702_101293668 3300005615 Bacteria 592
582 Ga0070702_101384339 3300005615 Bacteria 574
583 Ga0070702_101428381 3300005615 Bacteria 567
584 Ga0068852_100002660 3300005616 Bacteria 12353
585 Ga0068852_100091777 3300005616 Bacteria 2718
586 Ga0068852_100269315 3300005616 Bacteria 1638
587 Ga0068852_100376994 3300005616 Bacteria 1391
588 Ga0068852_100464958 3300005616 Bacteria 1255
589 Ga0068852_100696387 3300005616 Bacteria 1026
590 Ga0068852_100829129 3300005616 Bacteria 940
591 Ga0068852_100850996 3300005616 Bacteria 928
592 Ga0068852_100984235 3300005616 Bacteria 862
593 Ga0068852_101803997 3300005616 Bacteria 634
594 Ga0068852_102660207 3300005616 Bacteria 520
595 Ga0068852_102839132 3300005616 Bacteria 502
596 Ga0068859_100007107 3300005617 Bacteria 11361
597 Ga0068859_100007685 3300005617 Bacteria 10950
598 Ga0068859_100008168 3300005617 Bacteria 10619
599 Ga0068859_100023634 3300005617 Bacteria 6169
600 Ga0068859_100137750 3300005617 Bacteria 2514
601 Ga0068859_100169531 3300005617 Bacteria 2264
602 Ga0068859_100415458 3300005617 Bacteria 1441
603 Ga0068859_100451492 3300005617 Bacteria 1382
604 Ga0068859_101380837 3300005617 Bacteria 777
605 Ga0068859_101692288 3300005617 Bacteria 699
606 Ga0068859_101865602 3300005617 Bacteria 664
607 Ga0068859_101931986 3300005617 Bacteria 652
608 Ga0068864_100000012 3300005618 Bacteria 335070
609 Ga0068864_100000456 3300005618 Bacteria 35356
610 Ga0068864_100006822 3300005618 Bacteria 9354
611 Ga0068864_100009291 3300005618 Bacteria 8109
612 Ga0068864_100059287 3300005618 Bacteria 3311
613 Ga0068864_100118782 3300005618 Bacteria 2361
614 Ga0068864_100141993 3300005618 Bacteria 2167
615 Ga0068864_100171863 3300005618 Bacteria 1976
616 Ga0068864_100423755 3300005618 Bacteria 1268
617 Ga0068864_100478383 3300005618 Bacteria 1195
618 Ga0068864_100588651 3300005618 Bacteria 1079
619 Ga0068864_101343997 3300005618 Bacteria 715
620 Ga0068864_101475107 3300005618 Bacteria 683
621 Ga0068866_10000235 3300005718 Bacteria 26083
622 Ga0068866_10023053 3300005718 Bacteria 2890
623 Ga0068866_10587585 3300005718 Bacteria 750
624 Ga0068861_100005305 3300005719 Bacteria 8700
625 Ga0068861_100023402 3300005719 Bacteria 4454
626 Ga0068861_100083921 3300005719 Bacteria 2500
627 Ga0068861_100141030 3300005719 Bacteria 1967
628 Ga0068861_100242813 3300005719 Bacteria 1533
629 Ga0068861_100293154 3300005719 Bacteria 1406
630 Ga0068861_100542646 3300005719 Bacteria 1058
631 Ga0068861_101049281 3300005719 Bacteria 781
632 Ga0068861_101051971 3300005719 Bacteria 780
633 Ga0068851_10000011 3300005834 Bacteria 178585
634 Ga0068851_10028532 3300005834 Bacteria 2758
635 Ga0068851_10236419 3300005834 Bacteria 1031
636 Ga0068851_10256275 3300005834 Bacteria 994
637 Ga0068851_10901842 3300005834 Bacteria 554
638 Ga0068851_10979645 3300005834 Bacteria 533
639 Ga0068870_10005533 3300005840 Bacteria 5515
640 Ga0068870_10012623 3300005840 Bacteria 3951
641 Ga0068870_10028689 3300005840 Bacteria 2797
642 Ga0068870_10053111 3300005840 Bacteria 2151
643 Ga0068870_10238157 3300005840 Bacteria 1122
644 Ga0068870_10659324 3300005840 Bacteria 718
645 Ga0068870_10935000 3300005840 Bacteria 614
646 Ga0068870_11288471 3300005840 Bacteria 532
647 Ga0068863_100000521 3300005841 Bacteria 39214
648 Ga0068863_100008813 3300005841 Bacteria 9850
649 Ga0068863_100013369 3300005841 Bacteria 7914
650 Ga0068863_100078037 3300005841 Bacteria 3135
651 Ga0068863_100082598 3300005841 Bacteria 3045
652 Ga0068863_100129449 3300005841 Bacteria 2409
653 Ga0068863_100267994 3300005841 Bacteria 1652
654 Ga0068863_100441975 3300005841 Bacteria 1275
655 Ga0068863_100719628 3300005841 Bacteria 993
656 Ga0068863_101450172 3300005841 Bacteria 694
657 Ga0068863_102426985 3300005841 Bacteria 534
658 Ga0068858_100002549 3300005842 Bacteria 18376
659 Ga0068858_100002595 3300005842 Bacteria 18196
660 Ga0068858_100008135 3300005842 Bacteria 10084
661 Ga0068858_100008910 3300005842 Bacteria 9618
662 Ga0068858_100016226 3300005842 Bacteria 6997
663 Ga0068858_100163182 3300005842 Bacteria 2098
664 Ga0068858_100306152 3300005842 Bacteria 1517
665 Ga0068858_100396994 3300005842 Bacteria 1325
666 Ga0068858_101210125 3300005842 Bacteria 743
667 Ga0068858_102600480 3300005842 Bacteria 500
668 Ga0068860_100007832 3300005843 Bacteria 10665
669 Ga0068860_100008086 3300005843 Bacteria 10474
670 Ga0068860_100009873 3300005843 Bacteria 9463
671 Ga0068860_100050934 3300005843 Bacteria 3941
672 Ga0068860_100058753 3300005843 Bacteria 3656
673 Ga0068860_100109492 3300005843 Bacteria 2640
674 Ga0068860_100124439 3300005843 Bacteria 2471
675 Ga0068860_100216873 3300005843 Bacteria 1857
676 Ga0068860_100555675 3300005843 Bacteria 1150
677 Ga0068860_100971040 3300005843 Bacteria 867
678 Ga0068860_101059519 3300005843 Bacteria 830
679 Ga0068860_101974231 3300005843 Bacteria 605
680 Ga0068860_102477825 3300005843 Bacteria 539
681 Ga0068862_100001146 3300005844 Bacteria 25101
682 Ga0068862_100005397 3300005844 Bacteria 10689
683 Ga0068862_100047813 3300005844 Bacteria 3652
684 Ga0068862_100089797 3300005844 Bacteria 2674
685 Ga0068862_100098405 3300005844 Bacteria 2555
686 Ga0068862_100100687 3300005844 Bacteria 2527
687 Ga0068862_100114766 3300005844 Bacteria 2368
688 Ga0068862_100986109 3300005844 Bacteria 833
689 Ga0081455_10321395 3300005937 Bacteria 1102
690 Ga0081539_10066750 3300005985 Bacteria 1948
691 Ga0070717_10404275 3300006028 Bacteria 1227
692 Ga0070717_10786296 3300006028 Bacteria 866
693 Ga0075363_100179351 3300006048 Bacteria 1204
694 Ga0075364_10239449 3300006051 Bacteria 1232
695 Ga0075364_11248042 3300006051 Bacteria 503
696 Ga0075432_10057718 3300006058 Bacteria 1378
697 Ga0075432_10256911 3300006058 Bacteria 711
698 Ga0070715_10919760 3300006163 Bacteria 540
699 Ga0070716_100024056 3300006173 Bacteria 3238
700 Ga0070716_100045227 3300006173 Bacteria 2471
701 Ga0070716_100754220 3300006173 Bacteria 749
702 Ga0070712_100021793 3300006175 Bacteria 4214
703 Ga0070712_100134108 3300006175 Bacteria 1880
704 Ga0075367_10332651 3300006178 Bacteria 958
705 Ga0075427_10022764 3300006194 Bacteria 1002
706 Ga0097621_100004386 3300006237 Bacteria 9820
707 Ga0097621_100007231 3300006237 Bacteria 7924
708 Ga0097621_100067381 3300006237 Bacteria 2950
709 Ga0097621_100076164 3300006237 Bacteria 2782
710 Ga0097621_100084710 3300006237 Bacteria 2643
711 Ga0097621_100168114 3300006237 Bacteria 1889
712 Ga0097621_100327237 3300006237 Bacteria 1358
713 Ga0097621_100514596 3300006237 Bacteria 1086
714 Ga0097621_101003365 3300006237 Bacteria 781
715 Ga0097621_101052576 3300006237 Bacteria 762
716 Ga0075370_10150592 3300006353 Bacteria 1363
717 Ga0075370_10347844 3300006353 Bacteria 885
718 Ga0068871_100028795 3300006358 Bacteria 4359
719 Ga0068871_100034082 3300006358 Bacteria 4037
720 Ga0068871_100149409 3300006358 Bacteria 1991
721 Ga0068871_100223429 3300006358 Bacteria 1632
722 Ga0068871_100374526 3300006358 Bacteria 1264
723 Ga0068871_100377786 3300006358 Bacteria 1258
724 Ga0068871_100902135 3300006358 Bacteria 819
725 Ga0068871_101029849 3300006358 Bacteria 767
726 Ga0068871_101106437 3300006358 Bacteria 741
727 Ga0068871_101144694 3300006358 Bacteria 728
728 Ga0068871_101415365 3300006358 Bacteria 656
729 Ga0068871_101793433 3300006358 Bacteria 583
730 Ga0075428_100005955 3300006844 Bacteria 13547
731 Ga0075428_100129608 3300006844 Bacteria 2744
732 Ga0075428_100251783 3300006844 Bacteria 1903
733 Ga0075428_101352883 3300006844 Bacteria 748
734 Ga0075428_101654559 3300006844 Bacteria 668
735 Ga0075430_100099132 3300006846 Bacteria 2433
736 Ga0075430_101013536 3300006846 Bacteria 684
737 Ga0075431_100072471 3300006847 Bacteria 3555
738 Ga0075431_100416569 3300006847 Bacteria 1343
739 Ga0075431_100636795 3300006847 Bacteria 1048
740 Ga0075431_100663287 3300006847 Bacteria 1023
741 Ga0075431_101193510 3300006847 Bacteria 724
742 Ga0075433_10006788 3300006852 Bacteria 9078
743 Ga0075433_10320438 3300006852 Bacteria 1371
744 Ga0075433_10565862 3300006852 Bacteria 999
745 Ga0075433_10634998 3300006852 Bacteria 937
746 Ga0075433_11422520 3300006852 Bacteria 600
747 Ga0075433_11633209 3300006852 Bacteria 556
748 Ga0075434_100002012 3300006871 Bacteria 17652
749 Ga0075434_100140135 3300006871 Bacteria 2438
750 Ga0075434_100152265 3300006871 Bacteria 2333
751 Ga0075434_100509763 3300006871 Bacteria 1224
752 Ga0075434_100741026 3300006871 Bacteria 1000
753 Ga0075434_101017045 3300006871 Bacteria 843
754 Ga0075434_101845462 3300006871 Bacteria 611
755 Ga0075429_100019505 3300006880 Bacteria 5875
756 Ga0068865_100000229 3300006881 Bacteria 31243
757 Ga0068865_100038656 3300006881 Bacteria 3231
758 Ga0068865_100106418 3300006881 Bacteria 2062
759 Ga0068865_101291357 3300006881 Bacteria 649
760 Ga0075436_100036184 3300006914 Bacteria 3407
761 Ga0075436_100191148 3300006914 Bacteria 1448
762 Ga0075436_100266335 3300006914 Bacteria 1223
763 Ga0075436_100807372 3300006914 Bacteria 699
764 Ga0097620_100007107 3300006931 Bacteria 11361
765 Ga0097620_100007685 3300006931 Bacteria 10950
766 Ga0097620_100008167 3300006931 Bacteria 10619
767 Ga0097620_100023635 3300006931 Bacteria 6169
768 Ga0097620_100137746 3300006931 Bacteria 2514
769 Ga0097620_100169530 3300006931 Bacteria 2264
770 Ga0097620_100415463 3300006931 Bacteria 1441
771 Ga0097620_100451505 3300006931 Bacteria 1382
772 Ga0097620_101380993 3300006931 Bacteria 777
773 Ga0097620_101692310 3300006931 Bacteria 699
774 Ga0097620_101865505 3300006931 Bacteria 664
775 Ga0097620_101932141 3300006931 Bacteria 652
776 Ga0099823_1116370 3300006944 Bacteria 711
777 Ga0079104_1000094 3300006946 Bacteria 130202
778 Ga0079104_1000668 3300006946 Bacteria 32257
779 Ga0079104_1045206 3300006946 Bacteria 1006
780 Ga0079104_1053778 3300006946 Bacteria 887
781 Ga0099826_10002085 3300006948 Bacteria 12635
782 Ga0075435_100226848 3300007076 Bacteria 1587
783 Ga0075435_100484808 3300007076 Bacteria 1068
784 Ga0075435_100548673 3300007076 Bacteria 1001
785 Ga0075435_101162641 3300007076 Bacteria 675
786 Ga0075435_101353109 3300007076 Bacteria 624
787 Ga0099794_10025576 3300007265 Bacteria 2721
788 Ga0099794_10031682 3300007265 Bacteria 2477
789 Ga0099794_10041909 3300007265 Bacteria 2181
790 Ga0099794_10116650 3300007265 Bacteria 1341
791 Ga0099795_10320911 3300007788 Bacteria 686
792 Ga0099795_10605150 3300007788 Bacteria 522
793 Ga0105251_10000971 3300009011 Bacteria 25452
794 Ga0105251_10001123 3300009011 Bacteria 23287
795 Ga0105251_10001972 3300009011 Bacteria 16765
796 Ga0105251_10006731 3300009011 Bacteria 7254
797 Ga0105251_10013473 3300009011 Bacteria 4573
798 Ga0105251_10046780 3300009011 Bacteria 2081
799 Ga0105251_10139341 3300009011 Bacteria 1098
800 Ga0105251_10144148 3300009011 Bacteria 1077
801 Ga0105244_10000709 3300009036 Bacteria 28850
802 Ga0105244_10004356 3300009036 Bacteria 9764
803 Ga0105244_10012445 3300009036 Bacteria 5025
804 Ga0105244_10015536 3300009036 Bacteria 4363
805 Ga0105244_10018084 3300009036 Bacteria 3966
806 Ga0105244_10065474 3300009036 Bacteria 1820
807 Ga0105244_10084870 3300009036 Bacteria 1563
808 Ga0105244_10211476 3300009036 Bacteria 912
809 Ga0105250_10000074 3300009092 Bacteria 91652
810 Ga0105250_10000735 3300009092 Bacteria 19966
811 Ga0105250_10002613 3300009092 Bacteria 8954
812 Ga0105250_10021246 3300009092 Bacteria 2621
813 Ga0105250_10210893 3300009092 Bacteria 821
814 Ga0105250_10210898 3300009092 Bacteria 821
815 Ga0105250_10251848 3300009092 Bacteria 755
816 Ga0105250_10310399 3300009092 Bacteria 684
817 Ga0105250_10582979 3300009092 Bacteria 516
818 Ga0105240_10001212 3300009093 Bacteria 44945
819 Ga0105240_10014780 3300009093 Bacteria 10641
820 Ga0105240_10022879 3300009093 Bacteria 8279
821 Ga0105240_10200701 3300009093 Bacteria 2337
822 Ga0105240_10213967 3300009093 Bacteria 2250
823 Ga0105240_10260888 3300009093 Bacteria 1999
824 Ga0105240_10461820 3300009093 Bacteria 1419
825 Ga0105240_10470814 3300009093 Bacteria 1402
826 Ga0105240_10559914 3300009093 Bacteria 1264
827 Ga0105240_11845258 3300009093 Bacteria 629
828 Ga0105240_11855701 3300009093 Bacteria 628
829 Ga0111539_10006530 3300009094 Bacteria 15027
830 Ga0111539_10090059 3300009094 Bacteria 3605
831 Ga0111539_10222598 3300009094 Bacteria 2198
832 Ga0111539_10229136 3300009094 Bacteria 2164
833 Ga0111539_10676224 3300009094 Bacteria 1202
834 Ga0111539_11304946 3300009094 Bacteria 842
835 Ga0111539_11602931 3300009094 Bacteria 755
836 Ga0111539_11638932 3300009094 Bacteria 746
837 Ga0105245_10000613 3300009098 Bacteria 32290
838 Ga0105245_10004684 3300009098 Bacteria 12091
839 Ga0105245_10190697 3300009098 Bacteria 1963
840 Ga0105245_10192869 3300009098 Bacteria 1952
841 Ga0105245_10266157 3300009098 Bacteria 1670
842 Ga0105245_10497202 3300009098 Bacteria 1235
843 Ga0105245_10708773 3300009098 Bacteria 1040
844 Ga0105245_10921376 3300009098 Bacteria 916
845 Ga0105245_11047423 3300009098 Bacteria 861
846 Ga0105245_11184682 3300009098 Unclassified 812
847 Ga0105245_11892350 3300009098 Bacteria 650
848 Ga0105247_10038702 3300009101 Bacteria 2912
849 Ga0105247_10143465 3300009101 Bacteria 1567
850 Ga0105247_10354110 3300009101 Bacteria 1033
851 Ga0105247_10401247 3300009101 Bacteria 977
852 Ga0105247_10450621 3300009101 Bacteria 928
853 Ga0105247_10554773 3300009101 Bacteria 845
854 Ga0105247_10655229 3300009101 Bacteria 785
855 Ga0114129_10073649 3300009147 Bacteria 4758
856 Ga0114129_10176049 3300009147 Bacteria 2914
857 Ga0114129_10266858 3300009147 Bacteria 2292
858 Ga0114129_10463461 3300009147 Bacteria 1660
859 Ga0114129_11296646 3300009147 Bacteria 903
860 Ga0105243_10031266 3300009148 Bacteria 4104
861 Ga0105243_10041863 3300009148 Bacteria 3583
862 Ga0105243_10041987 3300009148 Bacteria 3578
863 Ga0105243_10216549 3300009148 Bacteria 1690
864 Ga0105243_10463700 3300009148 Bacteria 1192
865 Ga0105243_10680061 3300009148 Bacteria 1001
866 Ga0105243_10809845 3300009148 Bacteria 924
867 Ga0105243_11031109 3300009148 Bacteria 827
868 Ga0105241_10454042 3300009174 Bacteria 1134
869 Ga0105241_10686137 3300009174 Bacteria 933
870 Ga0105241_10865278 3300009174 Bacteria 837
871 Ga0105241_11998448 3300009174 Bacteria 571
872 Ga0105241_12047381 3300009174 Bacteria 564
873 Ga0105241_12400629 3300009174 Bacteria 526
874 Ga0105241_12634194 3300009174 Bacteria 505
875 Ga0105242_10000626 3300009176 Bacteria 27761
876 Ga0105242_10048474 3300009176 Bacteria 3453
877 Ga0105242_10151814 3300009176 Bacteria 2020
878 Ga0105242_10362854 3300009176 Bacteria 1341
879 Ga0105242_10600705 3300009176 Bacteria 1063
880 Ga0105242_10939642 3300009176 Bacteria 868
881 Ga0105242_11052480 3300009176 Bacteria 825
882 Ga0105242_12758580 3300009176 Bacteria 541
883 Ga0105242_13277019 3300009176 Bacteria 503
884 Ga0105248_10016076 3300009177 Bacteria 8237
885 Ga0105248_10025777 3300009177 Bacteria 6539
886 Ga0105248_10031772 3300009177 Bacteria 5899
887 Ga0105248_10131761 3300009177 Bacteria 2821
888 Ga0105248_10229703 3300009177 Bacteria 2089
889 Ga0105248_10232336 3300009177 Bacteria 2076
890 Ga0105248_10244852 3300009177 Bacteria 2018
891 Ga0105248_10337257 3300009177 Bacteria 1697
892 Ga0105248_10449402 3300009177 Bacteria 1452
893 Ga0105248_10461455 3300009177 Bacteria 1432
894 Ga0105248_10462350 3300009177 Bacteria 1430
895 Ga0105248_10824941 3300009177 Bacteria 1047
896 Ga0105248_12003788 3300009177 Bacteria 658
897 Ga0105237_10001599 3300009545 Bacteria 29440
898 Ga0105237_10016866 3300009545 Bacteria 7579
899 Ga0105237_10109071 3300009545 Bacteria 2760
900 Ga0105237_10442844 3300009545 Bacteria 1305
901 Ga0105237_10503605 3300009545 Bacteria 1218
902 Ga0105237_12592990 3300009545 Bacteria 518
903 Ga0105238_10061407 3300009551 Bacteria 3761
904 Ga0105238_10199494 3300009551 Bacteria 1976
905 Ga0105238_10440258 3300009551 Bacteria 1299
906 Ga0105238_10906076 3300009551 Bacteria 900
907 Ga0105238_11462956 3300009551 Bacteria 711
908 Ga0105238_11708828 3300009551 Bacteria 660
909 Ga0105249_10157990 3300009553 Bacteria 2188
910 Ga0105249_10393878 3300009553 Bacteria 1414
911 Ga0105249_10419172 3300009553 Bacteria 1372
912 Ga0105249_10430074 3300009553 Bacteria 1355
913 Ga0105249_10454791 3300009553 Bacteria 1319
914 Ga0105249_11030256 3300009553 Bacteria 892
915 Ga0105249_11998372 3300009553 Bacteria 652
916 Ga0105030_102507 3300009987 Bacteria 1597
917 Ga0099796_10006145 3300010159 Bacteria 3055
918 Ga0099796_10117601 3300010159 Bacteria 1018
919 Ga0105239_10020010 3300010375 Bacteria 7387
920 Ga0105239_10028127 3300010375 Bacteria 6186
921 Ga0105239_10051990 3300010375 Bacteria 4492
922 Ga0105239_10527288 3300010375 Bacteria 1344
923 Ga0105239_10612593 3300010375 Bacteria 1242
924 Ga0105239_10939594 3300010375 Bacteria 993
925 Ga0105239_11117850 3300010375 Bacteria 907
926 Ga0105239_12636220 3300010375 Bacteria 586
927 Ga0105239_13177965 3300010375 Bacteria 535
928 Ga0105246_10055618 3300011119 Bacteria 2732
929 Ga0105246_10096715 3300011119 Bacteria 2141
930 Ga0105246_10141576 3300011119 Bacteria 1809
931 Ga0105246_10186359 3300011119 Bacteria 1602
932 Ga0105246_10241323 3300011119 Bacteria 1429
933 Ga0105246_10274187 3300011119 Bacteria 1350
934 Ga0105246_10352570 3300011119 Bacteria 1206
935 Ga0105246_11216602 3300011119 Bacteria 694
936 Ga0105246_11277016 3300011119 Bacteria 679
937 Ga0105246_11306373 3300011119 Bacteria 672
938 Ga0105246_12111659 3300011119 Bacteria 546
939 Ga0157336_1019145 3300012477 Bacteria 605
940 Ga0157323_1007831 3300012495 Bacteria 781
941 Ga0157324_1004315 3300012506 Bacteria 978
942 Ga0157326_1072480 3300012513 Bacteria 548
943 Ga0157373_10003636 3300013100 Bacteria 11647
944 Ga0157373_10006519 3300013100 Bacteria 8710
945 Ga0157373_10045928 3300013100 Bacteria 3117
946 Ga0157373_10062383 3300013100 Bacteria 2640
947 Ga0157373_10080067 3300013100 Bacteria 2303
948 Ga0157373_10122418 3300013100 Bacteria 1828
949 Ga0157373_10333312 3300013100 Bacteria 1081
950 Ga0157373_10784312 3300013100 Bacteria 702
951 Ga0157373_10954244 3300013100 Bacteria 638
952 Ga0157371_10000406 3300013102 Bacteria 53786
953 Ga0157371_10019628 3300013102 Bacteria 4980
954 Ga0157371_10020554 3300013102 Bacteria 4858
955 Ga0157371_10132405 3300013102 Bacteria 1774
956 Ga0157371_10178320 3300013102 Bacteria 1519
957 Ga0157371_10205575 3300013102 Bacteria 1412
958 Ga0157371_10300863 3300013102 Bacteria 1161
959 Ga0157371_10955576 3300013102 Bacteria 652
960 Ga0157371_11296152 3300013102 Bacteria 563
961 Ga0157370_10000928 3300013104 Bacteria 37179
962 Ga0157370_10025433 3300013104 Bacteria 5860
963 Ga0157370_10041180 3300013104 Bacteria 4459
964 Ga0157370_10096777 3300013104 Bacteria 2769
965 Ga0157370_10098108 3300013104 Bacteria 2748
966 Ga0157370_10115999 3300013104 Bacteria 2502
967 Ga0157370_10371985 3300013104 Bacteria 1317
968 Ga0157370_10437593 3300013104 Bacteria 1202
969 Ga0157370_10931901 3300013104 Bacteria 788
970 Ga0157369_10000252 3300013105 Bacteria 73217
971 Ga0157369_10000799 3300013105 Bacteria 40249
972 Ga0157369_10002062 3300013105 Bacteria 24256
973 Ga0157369_10002799 3300013105 Bacteria 20815
974 Ga0157369_10046953 3300013105 Bacteria 4691
975 Ga0157369_10284156 3300013105 Bacteria 1723
976 Ga0157369_10298161 3300013105 Bacteria 1677
977 Ga0157369_10980377 3300013105 Bacteria 866
978 Ga0157369_11156758 3300013105 Bacteria 790
979 Ga0157369_11651218 3300013105 Bacteria 651
980 Ga0157374_10000419 3300013296 Bacteria 38408
981 Ga0157374_10004205 3300013296 Bacteria 12099
982 Ga0157374_10086791 3300013296 Bacteria 2977
983 Ga0157374_10439267 3300013296 Bacteria 1305
984 Ga0157374_10561454 3300013296 Bacteria 1150
985 Ga0157374_11271619 3300013296 Unclassified 758
986 Ga0157374_11423310 3300013296 Bacteria 716
987 Ga0157374_12141960 3300013296 Bacteria 586
988 Ga0157374_12153665 3300013296 Bacteria 584
989 Ga0157374_12495585 3300013296 Bacteria 544
990 Ga0157378_10025093 3300013297 Bacteria 5252
991 Ga0157378_10036206 3300013297 Bacteria 4368
992 Ga0157378_10077918 3300013297 Bacteria 2988
993 Ga0157378_10114262 3300013297 Bacteria 2480
994 Ga0157378_10193934 3300013297 Bacteria 1918
995 Ga0157378_10247568 3300013297 Bacteria 1705
996 Ga0157378_10332441 3300013297 Bacteria 1479
997 Ga0157378_10967528 3300013297 Bacteria 884
998 Ga0157378_11322296 3300013297 Bacteria 762
999 Ga0157378_11523830 3300013297 Bacteria 713
1000 Ga0157378_11811739 3300013297 Bacteria 659
1001 Ga0157378_11903869 3300013297 Bacteria 644
1002 Ga0163162_10002139 3300013306 Bacteria 18531
1003 Ga0163162_10005749 3300013306 Bacteria 11996
1004 Ga0163162_10033754 3300013306 Bacteria 5086
1005 Ga0163162_10103173 3300013306 Bacteria 2946
1006 Ga0163162_10108533 3300013306 Bacteria 2872
1007 Ga0163162_10148494 3300013306 Bacteria 2461
1008 Ga0163162_10168141 3300013306 Bacteria 2317
1009 Ga0163162_10220704 3300013306 Bacteria 2025
1010 Ga0163162_10864738 3300013306 Bacteria 1019
1011 Ga0163162_11156106 3300013306 Bacteria 878
1012 Ga0163162_11167445 3300013306 Bacteria 873
1013 Ga0163162_11325029 3300013306 Bacteria 818
1014 Ga0163162_11726759 3300013306 Bacteria 715
1015 Ga0157372_10001701 3300013307 Bacteria 23836
1016 Ga0157372_10006569 3300013307 Bacteria 12375
1017 Ga0157372_10023895 3300013307 Bacteria 6631
1018 Ga0157372_10038617 3300013307 Bacteria 5268
1019 Ga0157372_10105161 3300013307 Bacteria 3229
1020 Ga0157372_10118475 3300013307 Bacteria 3038
1021 Ga0157372_10413294 3300013307 Bacteria 1572
1022 Ga0157372_10423246 3300013307 Bacteria 1552
1023 Ga0157372_10753380 3300013307 Bacteria 1132
1024 Ga0157372_10958458 3300013307 Bacteria 992
1025 Ga0157372_11085941 3300013307 Bacteria 926
1026 Ga0157372_11572176 3300013307 Bacteria 757
1027 Ga0157375_10008010 3300013308 Bacteria 9253
1028 Ga0157375_10009300 3300013308 Bacteria 8625
1029 Ga0157375_10051109 3300013308 Bacteria 4058
1030 Ga0157375_10059025 3300013308 Bacteria 3798
1031 Ga0157375_10084253 3300013308 Bacteria 3227
1032 Ga0157375_10212389 3300013308 Bacteria 2093
1033 Ga0157375_10471462 3300013308 Bacteria 1421
1034 Ga0157375_10507672 3300013308 Bacteria 1370
1035 Ga0157375_10624193 3300013308 Bacteria 1236
1036 Ga0157375_10978892 3300013308 Bacteria 986
1037 Ga0157375_11087914 3300013308 Bacteria 935
1038 Ga0157375_11228508 3300013308 Bacteria 880
1039 Ga0157375_11233448 3300013308 Bacteria 878
1040 Ga0157375_12234413 3300013308 Bacteria 652
1041 Ga0157375_12508856 3300013308 Bacteria 616
1042 Ga0157375_12903488 3300013308 Bacteria 573
1043 Ga0157514_100622 3300013874 Bacteria 2017
1044 Ga0163163_10000051 3300014325 Bacteria 128275
1045 Ga0163163_10000233 3300014325 Bacteria 57369
1046 Ga0163163_10011827 3300014325 Bacteria 7936
1047 Ga0163163_10023409 3300014325 Bacteria 5862
1048 Ga0163163_10042671 3300014325 Bacteria 4444
1049 Ga0163163_10064936 3300014325 Bacteria 3622
1050 Ga0163163_10097611 3300014325 Bacteria 2958
1051 Ga0163163_11366663 3300014325 Bacteria 770
1052 Ga0163163_11656916 3300014325 Bacteria 700
1053 Ga0163163_11817015 3300014325 Bacteria 670
1054 Ga0163163_11818434 3300014325 Bacteria 669
1055 Ga0163163_12067957 3300014325 Bacteria 629
1056 Ga0163163_12255717 3300014325 Bacteria 603
1057 Ga0163163_12318315 3300014325 Bacteria 596
1058 Ga0157380_10001394 3300014326 Bacteria 15775
1059 Ga0157380_10018325 3300014326 Bacteria 5195
1060 Ga0157380_10045572 3300014326 Bacteria 3442
1061 Ga0157380_10084164 3300014326 Bacteria 2608
1062 Ga0157380_10201604 3300014326 Bacteria 1766
1063 Ga0157380_10358089 3300014326 Bacteria 1368
1064 Ga0157380_10600227 3300014326 Bacteria 1089
1065 Ga0157380_10640246 3300014326 Bacteria 1059
1066 Ga0157380_11090363 3300014326 Bacteria 837
1067 Ga0157380_11113528 3300014326 Bacteria 829
1068 Ga0157380_11813109 3300014326 Bacteria 669
1069 Ga0182008_10001189 3300014497 Bacteria 17933
1070 Ga0182008_10058956 3300014497 Bacteria 1894
1071 Ga0182008_10255795 3300014497 Bacteria 904
1072 Ga0182008_10355960 3300014497 Bacteria 777
1073 Ga0157377_10020450 3300014745 Bacteria 3468
1074 Ga0157377_10254735 3300014745 Bacteria 1139
1075 Ga0157379_10000246 3300014968 Bacteria 42489
1076 Ga0157379_10002212 3300014968 Bacteria 16183
1077 Ga0157379_10044671 3300014968 Bacteria 3955
1078 Ga0157379_10054532 3300014968 Bacteria 3572
1079 Ga0157379_10204127 3300014968 Bacteria 1788
1080 Ga0157379_10208165 3300014968 Bacteria 1770
1081 Ga0157379_10259801 3300014968 Bacteria 1578
1082 Ga0157379_10282485 3300014968 Bacteria 1511
1083 Ga0157379_10466232 3300014968 Bacteria 1168
1084 Ga0157379_10566973 3300014968 Bacteria 1057
1085 Ga0157379_11168841 3300014968 Bacteria 739
1086 Ga0157379_12289043 3300014968 Bacteria 538
1087 Ga0157376_10024704 3300014969 Bacteria 4723
1088 Ga0157376_10047230 3300014969 Bacteria 3553
1089 Ga0157376_10054971 3300014969 Bacteria 3320
1090 Ga0157376_10219838 3300014969 Bacteria 1759
1091 Ga0157376_10270027 3300014969 Bacteria 1597
1092 Ga0157376_10366003 3300014969 Bacteria 1384
1093 Ga0157376_10488867 3300014969 Bacteria 1207
1094 Ga0157376_10576417 3300014969 Bacteria 1117
1095 Ga0157376_10702870 3300014969 Bacteria 1016
1096 Ga0157376_10980098 3300014969 Bacteria 867
1097 Ga0157376_11953169 3300014969 Bacteria 624
1098 Ga0182006_1006695 3300015261 Bacteria 5331
1099 Ga0182006_1065653 3300015261 Bacteria 1358
1100 Ga0182006_1079587 3300015261 Bacteria 1198
1101 Ga0182006_1106857 3300015261 Bacteria 986
1102 Ga0182007_10019435 3300015262 Bacteria 2442
1103 Ga0182007_10275444 3300015262 Bacteria 611
1104 Ga0182005_1006082 3300015265 Bacteria 3720
1105 Ga0182005_1047696 3300015265 Bacteria 1164
1106 Ga0183361_10025 3300016635 Bacteria 72014
1107 Ga0163161_10045466 3300017792 Bacteria 3166
1108 Ga0163161_10155402 3300017792 Bacteria 1741
1109 Ga0163161_10782133 3300017792 Bacteria 801
1110 Ga0163161_10982481 3300017792 Bacteria 720
1111 Ga0163161_11720695 3300017792 Bacteria 556
1112 Ga0197907_10892649 3300020069 Bacteria 2184
1113 Ga0206356_10331770 3300020070 Bacteria 547
1114 Ga0206356_10371893 3300020070 Unclassified 634
1115 Ga0206356_11455669 3300020070 Bacteria 5638
1116 Ga0206349_1580423 3300020075 Bacteria 530
1117 Ga0206349_1874314 3300020075 Bacteria 503
1118 Ga0206355_1017993 3300020076 Bacteria 725
1119 Ga0206355_1595245 3300020076 Bacteria 1007
1120 Ga0206351_10877725 3300020077 Bacteria 674
1121 Ga0206352_10068392 3300020078 Bacteria 646
1122 Ga0206352_10273038 3300020078 Bacteria 858
1123 Ga0206352_10468945 3300020078 Bacteria 512
1124 Ga0206352_10807075 3300020078 Bacteria 911
1125 Ga0206350_10341210 3300020080 Bacteria 1372
1126 Ga0206350_11415002 3300020080 Bacteria 547
1127 Ga0206350_11558051 3300020080 Bacteria 1274
1128 Ga0206354_10229861 3300020081 Bacteria 718
1129 Ga0206354_10913120 3300020081 Bacteria 2683
1130 Ga0206354_11341774 3300020081 Bacteria 790
1131 Ga0206353_10126844 3300020082 Bacteria 5549
1132 Ga0206353_10909448 3300020082 Bacteria 1454
1133 Ga0206353_11941909 3300020082 Bacteria 737
1134 Ga0154015_1575671 3300020610 Bacteria 1002
1135 Ga0213872_10000957 3300021361 Bacteria 20201
1136 Ga0213872_10021426 3300021361 Bacteria 2976
1137 Ga0213872_10395719 3300021361 Bacteria 561
1138 Ga0213875_10272832 3300021388 Bacteria 798
1139 Ga0224712_10000008 3300022467 Bacteria 28961
1140 Ga0209435_102935 3300025206 Bacteria 1966
1141 Ga0209566_100896 3300025225 Bacteria 14309
1142 Ga0209674_100013 3300025226 Bacteria 813140
1143 Ga0209672_100010 3300025228 Bacteria 873151
1144 Ga0209672_100019 3300025228 Bacteria 432215
1145 Ga0209672_100051 3300025228 Bacteria 234414
1146 Ga0209672_101777 3300025228 Bacteria 6691
1147 Ga0209147_100006 3300025229 Bacteria 873276
1148 Ga0209147_100026 3300025229 Bacteria 421622
1149 Ga0209147_101674 3300025229 Bacteria 7277
1150 Ga0209563_101563 3300025230 Bacteria 5950
1151 Ga0207427_101131 3300025231 Bacteria 10608
1152 Ga0209258_100010 3300025242 Bacteria 873276
1153 Ga0209258_100031 3300025242 Bacteria 463572
1154 Ga0209258_100253 3300025242 Bacteria 96309
1155 Ga0209646_1006525 3300025246 Bacteria 1955
1156 Ga0209646_1011658 3300025246 Bacteria 1357
1157 Ga0209148_1000018 3300025254 Bacteria 756247
1158 Ga0209148_1000027 3300025254 Bacteria 616374
1159 Ga0209148_1006738 3300025254 Bacteria 2457
1160 Ga0209759_1000327 3300025256 Bacteria 62700
1161 Ga0209759_1000804 3300025256 Bacteria 25401
1162 Ga0209759_1001294 3300025256 Bacteria 14869
1163 Ga0209759_1003179 3300025256 Bacteria 6683
1164 Ga0209233_1000135 3300025261 Bacteria 201057
1165 Ga0209455_1000015 3300025272 Bacteria 756128
1166 Ga0209455_1000213 3300025272 Bacteria 82040
1167 Ga0209673_1000201 3300025273 Bacteria 120059
1168 Ga0209130_1023870 3300025284 Bacteria 1342
1169 Ga0209564_1002800 3300025295 Bacteria 12995
1170 Ga0207426_1000240 3300025302 Bacteria 123149
1171 Ga0207426_1003279 3300025302 Bacteria 9024
1172 Ga0207697_10095477 3300025315 Bacteria 1263
1173 Ga0207697_10221012 3300025315 Bacteria 836
1174 Ga0207697_10332004 3300025315 Bacteria 675
1175 Ga0207656_10004225 3300025321 Bacteria 4998
1176 Ga0207656_10267178 3300025321 Bacteria 841
1177 Ga0207656_10355207 3300025321 Bacteria 732
1178 Ga0207656_10538468 3300025321 Bacteria 594
1179 Ga0207696_1020681 3300025711 Bacteria 2117
1180 Ga0207696_1157107 3300025711 Bacteria 606
1181 Ga0207655_1068184 3300025728 Bacteria 1335
1182 Ga0207655_1100383 3300025728 Bacteria 998
1183 Ga0207713_1001188 3300025735 Bacteria 21909
1184 Ga0207713_1003181 3300025735 Bacteria 11351
1185 Ga0207713_1104041 3300025735 Bacteria 975
1186 Ga0207713_1259058 3300025735 Bacteria 510
1187 Ga0207653_10050773 3300025885 Bacteria 1379
1188 Ga0207682_10000600 3300025893 Bacteria 16720
1189 Ga0207682_10042063 3300025893 Bacteria 1866
1190 Ga0207682_10043259 3300025893 Bacteria 1843
1191 Ga0207682_10133892 3300025893 Bacteria 1108
1192 Ga0207682_10151698 3300025893 Bacteria 1045
1193 Ga0207682_10230781 3300025893 Bacteria 858
1194 Ga0207692_10261941 3300025898 Bacteria 1040
1195 Ga0207692_10302739 3300025898 Bacteria 973
1196 Ga0207692_10308955 3300025898 Bacteria 964
1197 Ga0207692_10536588 3300025898 Bacteria 746
1198 Ga0207692_10999335 3300025898 Bacteria 552
1199 Ga0207642_10639176 3300025899 Bacteria 666
1200 Ga0207642_11140648 3300025899 Bacteria 505
1201 Ga0207710_10067012 3300025900 Bacteria 1639
1202 Ga0207710_10120180 3300025900 Bacteria 1254
1203 Ga0207710_10231807 3300025900 Bacteria 919
1204 Ga0207710_10700960 3300025900 Bacteria 531
1205 Ga0207688_10127428 3300025901 Bacteria 1490
1206 Ga0207688_10164505 3300025901 Bacteria 1317
1207 Ga0207688_10420039 3300025901 Bacteria 831
1208 Ga0207680_10000573 3300025903 Bacteria 17366
1209 Ga0207680_10008494 3300025903 Bacteria 5044
1210 Ga0207680_10041684 3300025903 Bacteria 2681
1211 Ga0207680_10115095 3300025903 Bacteria 1751
1212 Ga0207680_10117934 3300025903 Bacteria 1732
1213 Ga0207680_10129161 3300025903 Bacteria 1663
1214 Ga0207680_10339211 3300025903 Bacteria 1054
1215 Ga0207680_10403014 3300025903 Bacteria 967
1216 Ga0207680_10431713 3300025903 Bacteria 934
1217 Ga0207680_10497584 3300025903 Bacteria 868
1218 Ga0207680_10533256 3300025903 Bacteria 837
1219 Ga0207680_10789411 3300025903 Bacteria 681
1220 Ga0207647_10000835 3300025904 Bacteria 23959
1221 Ga0207647_10007495 3300025904 Bacteria 7883
1222 Ga0207647_10009886 3300025904 Bacteria 6756
1223 Ga0207647_10015486 3300025904 Bacteria 5225
1224 Ga0207647_10022436 3300025904 Bacteria 4193
1225 Ga0207647_10029595 3300025904 Bacteria 3542
1226 Ga0207647_10253571 3300025904 Bacteria 1008
1227 Ga0207647_10477253 3300025904 Bacteria 697
1228 Ga0207699_10378573 3300025906 Bacteria 1004
1229 Ga0207699_10595859 3300025906 Bacteria 804
1230 Ga0207699_10981656 3300025906 Bacteria 624
1231 Ga0207645_10004697 3300025907 Bacteria 10049
1232 Ga0207645_10127862 3300025907 Bacteria 1652
1233 Ga0207645_10174486 3300025907 Bacteria 1409
1234 Ga0207645_10247802 3300025907 Bacteria 1178
1235 Ga0207645_10306374 3300025907 Bacteria 1058
1236 Ga0207645_10327248 3300025907 Bacteria 1023
1237 Ga0207643_10006465 3300025908 Bacteria 6274
1238 Ga0207643_10103188 3300025908 Bacteria 1674
1239 Ga0207643_10119999 3300025908 Bacteria 1557
1240 Ga0207643_10158788 3300025908 Bacteria 1359
1241 Ga0207643_10844815 3300025908 Bacteria 593
1242 Ga0207643_10881654 3300025908 Bacteria 580
1243 Ga0207705_10003399 3300025909 Bacteria 12102
1244 Ga0207705_10059351 3300025909 Bacteria 2761
1245 Ga0207705_10106604 3300025909 Bacteria 2067
1246 Ga0207705_10126994 3300025909 Bacteria 1896
1247 Ga0207705_10975620 3300025909 Bacteria 655
1248 Ga0207684_10361746 3300025910 Bacteria 1249
1249 Ga0207684_10413142 3300025910 Bacteria 1160
1250 Ga0207684_10651679 3300025910 Bacteria 897
1251 Ga0207684_11119150 3300025910 Bacteria 655
1252 Ga0207684_11416434 3300025910 Bacteria 568
1253 Ga0207654_10006792 3300025911 Bacteria 5756
1254 Ga0207654_10173299 3300025911 Bacteria 1403
1255 Ga0207654_10387167 3300025911 Bacteria 970
1256 Ga0207654_11190603 3300025911 Bacteria 555
1257 Ga0207707_10012029 3300025912 Bacteria 7523
1258 Ga0207707_10120773 3300025912 Bacteria 2291
1259 Ga0207707_10121019 3300025912 Bacteria 2289
1260 Ga0207707_10173235 3300025912 Bacteria 1886
1261 Ga0207707_10287340 3300025912 Bacteria 1423
1262 Ga0207707_10682440 3300025912 Bacteria 864
1263 Ga0207695_10000295 3300025913 Bacteria 123533
1264 Ga0207695_10011620 3300025913 Bacteria 10649
1265 Ga0207695_10036204 3300025913 Bacteria 5338
1266 Ga0207695_10043035 3300025913 Bacteria 4817
1267 Ga0207695_10125853 3300025913 Bacteria 2525
1268 Ga0207695_10134250 3300025913 Bacteria 2430
1269 Ga0207695_10328114 3300025913 Bacteria 1419
1270 Ga0207695_10331147 3300025913 Bacteria 1411
1271 Ga0207695_10446447 3300025913 Bacteria 1177
1272 Ga0207695_10960275 3300025913 Bacteria 734
1273 Ga0207671_10016929 3300025914 Bacteria 5642
1274 Ga0207671_10063970 3300025914 Bacteria 2735
1275 Ga0207671_10120577 3300025914 Bacteria 2004
1276 Ga0207671_10124643 3300025914 Bacteria 1972
1277 Ga0207693_10001071 3300025915 Bacteria 24521
1278 Ga0207693_10010413 3300025915 Bacteria 7548
1279 Ga0207693_10639411 3300025915 Bacteria 827
1280 Ga0207663_10003519 3300025916 Bacteria 7683
1281 Ga0207663_10230338 3300025916 Bacteria 1353
1282 Ga0207663_10293141 3300025916 Bacteria 1213
1283 Ga0207663_10404723 3300025916 Bacteria 1044
1284 Ga0207660_10238920 3300025917 Bacteria 1431
1285 Ga0207660_10698845 3300025917 Bacteria 827
1286 Ga0207660_10806828 3300025917 Bacteria 766
1287 Ga0207660_11075554 3300025917 Bacteria 656
1288 Ga0207662_10051494 3300025918 Bacteria 2450
1289 Ga0207662_10219651 3300025918 Bacteria 1237
1290 Ga0207662_10297060 3300025918 Bacteria 1073
1291 Ga0207662_10438740 3300025918 Bacteria 891
1292 Ga0207662_10543806 3300025918 Bacteria 804
1293 Ga0207657_10000001 3300025919 Bacteria 458536
1294 Ga0207657_10004018 3300025919 Bacteria 15631
1295 Ga0207657_10011501 3300025919 Bacteria 8788
1296 Ga0207657_10019179 3300025919 Bacteria 6503
1297 Ga0207657_10376247 3300025919 Bacteria 1119
1298 Ga0207649_10007431 3300025920 Bacteria 5959
1299 Ga0207649_10082869 3300025920 Bacteria 2080
1300 Ga0207649_10160663 3300025920 Bacteria 1556
1301 Ga0207649_10341982 3300025920 Bacteria 1105
1302 Ga0207649_10395570 3300025920 Bacteria 1033
1303 Ga0207649_10842209 3300025920 Bacteria 717
1304 Ga0207649_11058742 3300025920 Bacteria 639
1305 Ga0207649_11210202 3300025920 Bacteria 597
1306 Ga0207652_10068590 3300025921 Bacteria 3077
1307 Ga0207652_10194853 3300025921 Bacteria 1823
1308 Ga0207652_10292895 3300025921 Bacteria 1469
1309 Ga0207652_10964425 3300025921 Bacteria 751
1310 Ga0207646_10329052 3300025922 Bacteria 1380
1311 Ga0207681_10019593 3300025923 Bacteria 4276
1312 Ga0207681_10043508 3300025923 Bacteria 3006
1313 Ga0207681_10060616 3300025923 Bacteria 2598
1314 Ga0207681_10106257 3300025923 Bacteria 2034
1315 Ga0207681_10349848 3300025923 Bacteria 1183
1316 Ga0207681_10461862 3300025923 Bacteria 1034
1317 Ga0207681_10795144 3300025923 Bacteria 790
1318 Ga0207681_10899162 3300025923 Bacteria 741
1319 Ga0207694_10021170 3300025924 Bacteria 4924
1320 Ga0207694_10022298 3300025924 Bacteria 4802
1321 Ga0207694_10175693 3300025924 Bacteria 1735
1322 Ga0207694_10220409 3300025924 Bacteria 1547
1323 Ga0207694_10436466 3300025924 Bacteria 1092
1324 Ga0207694_10684056 3300025924 Bacteria 865
1325 Ga0207694_10943521 3300025924 Bacteria 730
1326 Ga0207694_11148950 3300025924 Bacteria 657
1327 Ga0207650_10004702 3300025925 Bacteria 9329
1328 Ga0207650_10017867 3300025925 Bacteria 4969
1329 Ga0207650_10097653 3300025925 Bacteria 2256
1330 Ga0207650_10116911 3300025925 Bacteria 2071
1331 Ga0207650_10219846 3300025925 Bacteria 1528
1332 Ga0207650_10566613 3300025925 Bacteria 953
1333 Ga0207650_10808513 3300025925 Bacteria 795
1334 Ga0207650_10818117 3300025925 Bacteria 790
1335 Ga0207650_11110663 3300025925 Bacteria 673
1336 Ga0207659_10018959 3300025926 Bacteria 4519
1337 Ga0207659_10032891 3300025926 Bacteria 3563
1338 Ga0207659_10033204 3300025926 Bacteria 3549
1339 Ga0207659_10072091 3300025926 Bacteria 2524
1340 Ga0207659_10106090 3300025926 Bacteria 2127
1341 Ga0207659_10527489 3300025926 Bacteria 1002
1342 Ga0207659_10746805 3300025926 Bacteria 839
1343 Ga0207659_10886310 3300025926 Bacteria 767
1344 Ga0207659_11232731 3300025926 Bacteria 643
1345 Ga0207659_11349021 3300025926 Bacteria 612
1346 Ga0207687_10010306 3300025927 Bacteria 6107
1347 Ga0207687_10199412 3300025927 Bacteria 1563
1348 Ga0207687_10360826 3300025927 Bacteria 1186
1349 Ga0207687_10502354 3300025927 Bacteria 1012
1350 Ga0207687_10843075 3300025927 Bacteria 783
1351 Ga0207687_11928080 3300025927 Bacteria 505
1352 Ga0207700_10051359 3300025928 Bacteria 3077
1353 Ga0207700_10147438 3300025928 Bacteria 1941
1354 Ga0207700_10729243 3300025928 Bacteria 885
1355 Ga0207700_11100419 3300025928 Bacteria 710
1356 Ga0207700_11434543 3300025928 Bacteria 613
1357 Ga0207700_11609433 3300025928 Bacteria 575
1358 Ga0207664_10010925 3300025929 Bacteria 6430
1359 Ga0207664_11484866 3300025929 Bacteria 599
1360 Ga0207644_10005182 3300025931 Bacteria 8514
1361 Ga0207644_10023304 3300025931 Bacteria 4239
1362 Ga0207644_10064495 3300025931 Bacteria 2661
1363 Ga0207644_10180156 3300025931 Bacteria 1655
1364 Ga0207644_10186482 3300025931 Bacteria 1629
1365 Ga0207644_10267490 3300025931 Bacteria 1369
1366 Ga0207644_10292083 3300025931 Bacteria 1311
1367 Ga0207644_10671212 3300025931 Bacteria 863
1368 Ga0207644_11064226 3300025931 Bacteria 679
1369 Ga0207644_11251714 3300025931 Bacteria 624
1370 Ga0207690_10000006 3300025932 Bacteria 433880
1371 Ga0207690_10065938 3300025932 Bacteria 2478
1372 Ga0207690_10704511 3300025932 Bacteria 830
1373 Ga0207690_10944330 3300025932 Bacteria 716
1374 Ga0207706_10079848 3300025933 Bacteria 2877
1375 Ga0207706_10094244 3300025933 Bacteria 2633
1376 Ga0207706_10160814 3300025933 Bacteria 1974
1377 Ga0207706_10184016 3300025933 Bacteria 1835
1378 Ga0207706_10242497 3300025933 Bacteria 1576
1379 Ga0207706_10666186 3300025933 Bacteria 891
1380 Ga0207706_11063587 3300025933 Bacteria 677
1381 Ga0207686_10037331 3300025934 Bacteria 2931
1382 Ga0207686_10157435 3300025934 Bacteria 1589
1383 Ga0207686_10499645 3300025934 Bacteria 943
1384 Ga0207709_10762405 3300025935 Bacteria 779
1385 Ga0207709_11826780 3300025935 Bacteria 506
1386 Ga0207670_10011332 3300025936 Bacteria 5171
1387 Ga0207670_10364698 3300025936 Bacteria 1147
1388 Ga0207670_10730361 3300025936 Bacteria 821
1389 Ga0207670_11357593 3300025936 Bacteria 603
1390 Ga0207669_10050337 3300025937 Bacteria 2489
1391 Ga0207669_10061129 3300025937 Bacteria 2313
1392 Ga0207669_10107091 3300025937 Bacteria 1864
1393 Ga0207669_10431641 3300025937 Bacteria 1039
1394 Ga0207669_10433371 3300025937 Bacteria 1038
1395 Ga0207669_10909730 3300025937 Bacteria 735
1396 Ga0207669_11004209 3300025937 Bacteria 701
1397 Ga0207704_10091711 3300025938 Bacteria 1997
1398 Ga0207704_10561486 3300025938 Bacteria 929
1399 Ga0207704_10590992 3300025938 Bacteria 907
1400 Ga0207704_10800568 3300025938 Bacteria 787
1401 Ga0207665_10013769 3300025939 Bacteria 5319
1402 Ga0207665_10041678 3300025939 Bacteria 3067
1403 Ga0207665_10924696 3300025939 Bacteria 692
1404 Ga0207691_10008356 3300025940 Bacteria 9945
1405 Ga0207691_10014472 3300025940 Bacteria 7522
1406 Ga0207691_10019284 3300025940 Bacteria 6456
1407 Ga0207691_10075428 3300025940 Bacteria 3040
1408 Ga0207691_10229296 3300025940 Bacteria 1609
1409 Ga0207691_10270932 3300025940 Bacteria 1462
1410 Ga0207691_10340622 3300025940 Bacteria 1284
1411 Ga0207691_10452051 3300025940 Bacteria 1093
1412 Ga0207691_11657638 3300025940 Bacteria 519
1413 Ga0207711_10000654 3300025941 Bacteria 34558
1414 Ga0207711_10062960 3300025941 Bacteria 3201
1415 Ga0207711_10175461 3300025941 Bacteria 1947
1416 Ga0207711_10183684 3300025941 Bacteria 1903
1417 Ga0207711_10216730 3300025941 Bacteria 1749
1418 Ga0207711_10219887 3300025941 Bacteria 1737
1419 Ga0207711_10224577 3300025941 Bacteria 1719
1420 Ga0207711_10344939 3300025941 Bacteria 1379
1421 Ga0207711_10377045 3300025941 Bacteria 1316
1422 Ga0207711_11014897 3300025941 Bacteria 769
1423 Ga0207689_10001032 3300025942 Bacteria 26745
1424 Ga0207689_10030304 3300025942 Bacteria 4509
1425 Ga0207689_10145956 3300025942 Bacteria 1949
1426 Ga0207689_10161513 3300025942 Bacteria 1846
1427 Ga0207689_10300526 3300025942 Bacteria 1330
1428 Ga0207689_11233375 3300025942 Bacteria 629
1429 Ga0207689_11318536 3300025942 Bacteria 606
1430 Ga0207661_10118477 3300025944 Bacteria 2250
1431 Ga0207661_10667822 3300025944 Bacteria 955
1432 Ga0207661_10730493 3300025944 Bacteria 911
1433 Ga0207661_11566686 3300025944 Bacteria 603
1434 Ga0207679_10074737 3300025945 Bacteria 2569
1435 Ga0207679_10197584 3300025945 Bacteria 1678
1436 Ga0207679_10644666 3300025945 Bacteria 958
1437 Ga0207679_11070773 3300025945 Bacteria 739
1438 Ga0207679_11096889 3300025945 Bacteria 730
1439 Ga0207679_11383410 3300025945 Bacteria 646
1440 Ga0207679_11692798 3300025945 Bacteria 579
1441 Ga0207667_10004361 3300025949 Bacteria 17336
1442 Ga0207667_10016348 3300025949 Bacteria 8388
1443 Ga0207667_10016707 3300025949 Bacteria 8280
1444 Ga0207667_10040404 3300025949 Bacteria 4967
1445 Ga0207667_10172585 3300025949 Bacteria 2222
1446 Ga0207667_10282754 3300025949 Bacteria 1695
1447 Ga0207667_10325058 3300025949 Bacteria 1571
1448 Ga0207667_10668248 3300025949 Bacteria 1043
1449 Ga0207667_11591708 3300025949 Bacteria 622
1450 Ga0207651_10004079 3300025960 Bacteria 7281
1451 Ga0207651_10005657 3300025960 Bacteria 6444
1452 Ga0207651_10015937 3300025960 Bacteria 4386
1453 Ga0207651_10025885 3300025960 Bacteria 3654
1454 Ga0207651_10154501 3300025960 Bacteria 1791
1455 Ga0207651_10944893 3300025960 Bacteria 769
1456 Ga0207712_10202238 3300025961 Bacteria 1576
1457 Ga0207712_10611623 3300025961 Bacteria 944
1458 Ga0207712_10754960 3300025961 Bacteria 852
1459 Ga0207712_11182584 3300025961 Bacteria 682
1460 Ga0207668_10002227 3300025972 Bacteria 11308
1461 Ga0207668_10036167 3300025972 Bacteria 3294
1462 Ga0207668_10036725 3300025972 Bacteria 3273
1463 Ga0207668_10052552 3300025972 Bacteria 2819
1464 Ga0207668_10087447 3300025972 Bacteria 2279
1465 Ga0207668_10090834 3300025972 Bacteria 2242
1466 Ga0207668_10655097 3300025972 Bacteria 919
1467 Ga0207668_11030841 3300025972 Bacteria 736
1468 Ga0207668_11157620 3300025972 Bacteria 694
1469 Ga0207640_10201269 3300025981 Bacteria 1509
1470 Ga0207640_10273799 3300025981 Bacteria 1322
1471 Ga0207640_10433999 3300025981 Bacteria 1078
1472 Ga0207640_10435060 3300025981 Bacteria 1077
1473 Ga0207640_11472421 3300025981 Bacteria 611
1474 Ga0207640_11649695 3300025981 Bacteria 578
1475 Ga0207658_10004931 3300025986 Bacteria 9207
1476 Ga0207658_10014362 3300025986 Bacteria 5423
1477 Ga0207658_10081580 3300025986 Bacteria 2480
1478 Ga0207658_10278248 3300025986 Bacteria 1433
1479 Ga0207658_10361790 3300025986 Bacteria 1266
1480 Ga0207658_10485459 3300025986 Bacteria 1098
1481 Ga0207658_10532564 3300025986 Bacteria 1049
1482 Ga0207658_10542800 3300025986 Bacteria 1040
1483 Ga0207658_10618250 3300025986 Bacteria 974
1484 Ga0207658_11547663 3300025986 Bacteria 606
1485 Ga0207658_11889735 3300025986 Bacteria 544
1486 Ga0207677_10000162 3300026023 Bacteria 53309
1487 Ga0207677_10048568 3300026023 Bacteria 2858
1488 Ga0207677_10117757 3300026023 Bacteria 1992
1489 Ga0207677_10260857 3300026023 Bacteria 1412
1490 Ga0207677_10347127 3300026023 Bacteria 1242
1491 Ga0207677_10393675 3300026023 Bacteria 1173
1492 Ga0207677_10483471 3300026023 Bacteria 1067
1493 Ga0207677_10521638 3300026023 Bacteria 1031
1494 Ga0207677_10730582 3300026023 Bacteria 881
1495 Ga0207677_10804934 3300026023 Bacteria 841
1496 Ga0207703_10007505 3300026035 Bacteria 8656
1497 Ga0207703_10008217 3300026035 Bacteria 8245
1498 Ga0207703_10328884 3300026035 Bacteria 1401
1499 Ga0207703_10360445 3300026035 Bacteria 1341
1500 Ga0207703_10388901 3300026035 Bacteria 1292
1501 Ga0207703_10435773 3300026035 Bacteria 1222
1502 Ga0207703_10446774 3300026035 Bacteria 1207
1503 Ga0207703_10449791 3300026035 Bacteria 1203
1504 Ga0207703_10681946 3300026035 Bacteria 976
1505 Ga0207639_10005858 3300026041 Bacteria 8325
1506 Ga0207639_10060867 3300026041 Bacteria 2914
1507 Ga0207639_10246661 3300026041 Bacteria 1556
1508 Ga0207639_10287186 3300026041 Bacteria 1449
1509 Ga0207639_10386797 3300026041 Bacteria 1257
1510 Ga0207639_10421851 3300026041 Bacteria 1206
1511 Ga0207639_10946441 3300026041 Bacteria 806
1512 Ga0207639_11004550 3300026041 Bacteria 781
1513 Ga0207639_11982576 3300026041 Bacteria 543
1514 Ga0207678_10000167 3300026067 Bacteria 55724
1515 Ga0207678_10087685 3300026067 Bacteria 2659
1516 Ga0207678_10142424 3300026067 Bacteria 2046
1517 Ga0207678_10264738 3300026067 Bacteria 1474
1518 Ga0207678_10273267 3300026067 Bacteria 1449
1519 Ga0207678_10441543 3300026067 Bacteria 1130
1520 Ga0207678_10502333 3300026067 Bacteria 1057
1521 Ga0207678_10612316 3300026067 Bacteria 955
1522 Ga0207678_11287258 3300026067 Bacteria 647
1523 Ga0207708_10167723 3300026075 Bacteria 1737
1524 Ga0207708_10399225 3300026075 Bacteria 1137
1525 Ga0207708_10679880 3300026075 Bacteria 878
1526 Ga0207708_10711457 3300026075 Bacteria 859
1527 Ga0207708_10770817 3300026075 Bacteria 827
1528 Ga0207708_11560205 3300026075 Bacteria 580
1529 Ga0207708_11813945 3300026075 Bacteria 535
1530 Ga0207708_11959896 3300026075 Bacteria 513
1531 Ga0207702_10007090 3300026078 Bacteria 9590
1532 Ga0207702_10113744 3300026078 Bacteria 2411
1533 Ga0207702_10115481 3300026078 Bacteria 2394
1534 Ga0207702_10271337 3300026078 Bacteria 1600
1535 Ga0207702_10345543 3300026078 Bacteria 1422
1536 Ga0207702_10847855 3300026078 Bacteria 904
1537 Ga0207702_10954301 3300026078 Bacteria 850
1538 Ga0207702_11762533 3300026078 Bacteria 612
1539 Ga0207641_10004151 3300026088 Bacteria 12624
1540 Ga0207641_10011107 3300026088 Bacteria 7389
1541 Ga0207641_10013613 3300026088 Bacteria 6671
1542 Ga0207641_10035367 3300026088 Bacteria 4161
1543 Ga0207641_10037526 3300026088 Bacteria 4047
1544 Ga0207641_10043578 3300026088 Bacteria 3769
1545 Ga0207641_10102166 3300026088 Bacteria 2527
1546 Ga0207641_10167505 3300026088 Bacteria 2002
1547 Ga0207641_10846487 3300026088 Bacteria 906
1548 Ga0207641_11018968 3300026088 Bacteria 825
1549 Ga0207641_11452295 3300026088 Bacteria 687
1550 Ga0207648_10004696 3300026089 Bacteria 13969
1551 Ga0207648_10025450 3300026089 Bacteria 5271
1552 Ga0207648_10034975 3300026089 Bacteria 4429
1553 Ga0207648_10053682 3300026089 Bacteria 3522
1554 Ga0207648_10068494 3300026089 Bacteria 3092
1555 Ga0207648_10154746 3300026089 Bacteria 2024
1556 Ga0207648_10200423 3300026089 Bacteria 1770
1557 Ga0207648_10410248 3300026089 Bacteria 1228
1558 Ga0207648_10670582 3300026089 Bacteria 959
1559 Ga0207648_10777652 3300026089 Bacteria 890
1560 Ga0207648_10869957 3300026089 Bacteria 841
1561 Ga0207648_11858176 3300026089 Bacteria 564
1562 Ga0207676_10000451 3300026095 Bacteria 34663
1563 Ga0207676_10001747 3300026095 Bacteria 15971
1564 Ga0207676_10007467 3300026095 Bacteria 7757
1565 Ga0207676_10049757 3300026095 Bacteria 3263
1566 Ga0207676_10079044 3300026095 Bacteria 2666
1567 Ga0207676_10131379 3300026095 Bacteria 2129
1568 Ga0207676_10485811 3300026095 Bacteria 1170
1569 Ga0207676_10624228 3300026095 Bacteria 1037
1570 Ga0207676_11222189 3300026095 Bacteria 745
1571 Ga0207676_11631282 3300026095 Bacteria 643
1572 Ga0207674_10003529 3300026116 Bacteria 19091
1573 Ga0207674_10099176 3300026116 Bacteria 2896
1574 Ga0207674_10117508 3300026116 Bacteria 2630
1575 Ga0207674_10224931 3300026116 Bacteria 1825
1576 Ga0207674_10269455 3300026116 Bacteria 1650
1577 Ga0207674_10849781 3300026116 Bacteria 880
1578 Ga0207674_11490641 3300026116 Bacteria 646
1579 Ga0207674_12244361 3300026116 Bacteria 508
1580 Ga0207675_100006036 3300026118 Bacteria 11526
1581 Ga0207675_100067821 3300026118 Bacteria 3335
1582 Ga0207675_100096866 3300026118 Bacteria 2778
1583 Ga0207675_100150043 3300026118 Bacteria 2218
1584 Ga0207675_100554570 3300026118 Bacteria 1149
1585 Ga0207675_100598291 3300026118 Bacteria 1105
1586 Ga0207675_100657482 3300026118 Bacteria 1054
1587 Ga0207675_100713683 3300026118 Bacteria 1012
1588 Ga0207683_10006461 3300026121 Bacteria 10034
1589 Ga0207683_10033759 3300026121 Bacteria 4446
1590 Ga0207683_10200175 3300026121 Bacteria 1815
1591 Ga0207683_10307488 3300026121 Bacteria 1451
1592 Ga0207683_10438636 3300026121 Bacteria 1204
1593 Ga0207683_10552178 3300026121 Bacteria 1065
1594 Ga0207683_10854190 3300026121 Bacteria 845
1595 Ga0207683_11383370 3300026121 Bacteria 651
1596 Ga0207683_11418563 3300026121 Bacteria 642
1597 Ga0207698_10025847 3300026142 Bacteria 4144
1598 Ga0207698_10026274 3300026142 Bacteria 4117
1599 Ga0207698_10094050 3300026142 Bacteria 2463
1600 Ga0207698_10151169 3300026142 Bacteria 2015
1601 Ga0207698_10178520 3300026142 Bacteria 1878
1602 Ga0207698_10313535 3300026142 Bacteria 1466
1603 Ga0207698_10779177 3300026142 Bacteria 957
1604 Ga0207698_10834999 3300026142 Bacteria 925
1605 Ga0207698_10842720 3300026142 Bacteria 921
1606 Ga0207698_10858544 3300026142 Bacteria 913
1607 Ga0207698_11788398 3300026142 Bacteria 630
1608 Ga0209371_1000297 3300027312 Bacteria 55845
1609 Ga0209371_1014528 3300027312 Bacteria 2155
1610 Ga0209969_1004652 3300027360 Bacteria 1920
1611 Ga0209969_1022702 3300027360 Bacteria 939
1612 Ga0209967_1000890 3300027364 Bacteria 3825
1613 Ga0209967_1017888 3300027364 Bacteria 1024
1614 Ga0209967_1071006 3300027364 Bacteria 544
1615 Ga0209981_1001970 3300027378 Bacteria 2621
1616 Ga0209981_1016193 3300027378 Bacteria 1047
1617 Ga0209996_1005820 3300027395 Bacteria 1582
1618 Ga0209984_1007553 3300027424 Bacteria 1352
1619 Ga0209984_1046486 3300027424 Bacteria 631
1620 Ga0210000_1000628 3300027462 Bacteria 4847
1621 Ga0210000_1003114 3300027462 Bacteria 2379
1622 Ga0209995_1000831 3300027471 Bacteria 4777
1623 Ga0209968_1022603 3300027526 Bacteria 1026
1624 Ga0209968_1040753 3300027526 Bacteria 793
1625 Ga0209999_1001887 3300027543 Bacteria 3643
1626 Ga0209999_1025950 3300027543 Bacteria 1082
1627 Ga0209982_1001464 3300027552 Bacteria 3238
1628 Ga0209982_1003265 3300027552 Bacteria 2297
1629 Ga0209970_1015429 3300027614 Bacteria 1271
1630 Ga0209970_1017888 3300027614 Bacteria 1188
1631 Ga0210002_1028995 3300027617 Bacteria 915
1632 Ga0209983_1014893 3300027665 Bacteria 1604
1633 Ga0209983_1028000 3300027665 Bacteria 1194
1634 Ga0209983_1039414 3300027665 Bacteria 1020
1635 Ga0209983_1151829 3300027665 Bacteria 531
1636 Ga0209588_1032443 3300027671 Bacteria 1673
1637 Ga0209588_1121063 3300027671 Bacteria 837
1638 Ga0209971_1001915 3300027682 Bacteria 5087
1639 Ga0209971_1032910 3300027682 Bacteria 1245
1640 Ga0209971_1053610 3300027682 Bacteria 975
1641 Ga0209966_1023126 3300027695 Bacteria 1220
1642 Ga0209966_1050960 3300027695 Bacteria 881
1643 Ga0209966_1060882 3300027695 Bacteria 816
1644 Ga0209974_10003639 3300027876 Bacteria 5532
1645 Ga0209974_10005991 3300027876 Bacteria 4255
1646 Ga0209974_10018146 3300027876 Bacteria 2334
1647 Ga0207428_10043638 3300027907 Bacteria 3621
1648 Ga0207428_10632574 3300027907 Bacteria 769
1649 Ga0268266_10009629 3300028379 Bacteria 8496
1650 Ga0268266_10114058 3300028379 Bacteria 2397
1651 Ga0268266_10115607 3300028379 Bacteria 2382
1652 Ga0268266_10199657 3300028379 Bacteria 1830
1653 Ga0268266_10254204 3300028379 Bacteria 1626
1654 Ga0268266_10460789 3300028379 Bacteria 1209
1655 Ga0268266_10645931 3300028379 Bacteria 1018
1656 Ga0268266_11123081 3300028379 Bacteria 760
1657 Ga0268266_11665048 3300028379 Bacteria 613
1658 Ga0268266_12051178 3300028379 Bacteria 545
1659 Ga0268265_10042652 3300028380 Bacteria 3367
1660 Ga0268265_10264736 3300028380 Bacteria 1530
1661 Ga0268265_10328407 3300028380 Bacteria 1388
1662 Ga0268265_10358848 3300028380 Bacteria 1333
1663 Ga0268265_10702497 3300028380 Bacteria 977
1664 Ga0268265_10821593 3300028380 Bacteria 907
1665 Ga0268265_11240709 3300028380 Bacteria 744
1666 Ga0268264_10002760 3300028381 Bacteria 15322
1667 Ga0268264_10005591 3300028381 Bacteria 10650
1668 Ga0268264_10011193 3300028381 Bacteria 7410
1669 Ga0268264_10074061 3300028381 Bacteria 2892
1670 Ga0268264_10193300 3300028381 Bacteria 1856
1671 Ga0268264_10360459 3300028381 Bacteria 1386
1672 Ga0268264_10452669 3300028381 Bacteria 1244
1673 Ga0268264_10618414 3300028381 Bacteria 1069
1674 Ga0268264_11040045 3300028381 Bacteria 826
1675 Ga0268264_11756236 3300028381 Bacteria 631
1676 Ga0268264_11777998 3300028381 Bacteria 627
1677 Ga0265319_1168789 3300028563 Bacteria 675
1678 Ga0265318_10137665 3300028577 Bacteria 897
1679 Ga0265336_10089047 3300028666 Bacteria 920
1680 Ga0307517_10370830 3300028786 Bacteria 769
1681 Ga0265338_10000104 3300028800 Bacteria 156596
1682 Ga0265338_10002059 3300028800 Bacteria 31074
1683 Ga0265338_10011793 3300028800 Bacteria 10047
1684 Ga0265338_10106077 3300028800 Bacteria 2276
1685 Ga0265324_10044125 3300029957 Bacteria 1538
1686 Ga0265324_10232921 3300029957 Bacteria 625
1687 Ga0268256_1000261 3300030500 Bacteria 55844
1688 Ga0268256_1016085 3300030500 Bacteria 2156
1689 Ga0265766_1014920 3300030863 Bacteria 595
1690 Ga0265766_1022216 3300030863 Bacteria 529
1691 Ga0265769_109769 3300030888 Bacteria 648
1692 Ga0265330_10009093 3300031235 Bacteria 4737
1693 Ga0265332_10000824 3300031238 Bacteria 18837
1694 Ga0265332_10121476 3300031238 Bacteria 1097
1695 Ga0265328_10008589 3300031239 Bacteria 4201
1696 Ga0265328_10025812 3300031239 Bacteria 2211
1697 Ga0265320_10004773 3300031240 Bacteria 8821
1698 Ga0265320_10009198 3300031240 Bacteria 5977
1699 Ga0265320_10121715 3300031240 Bacteria 1189
1700 Ga0265325_10090302 3300031241 Bacteria 1512
1701 Ga0265329_10004859 3300031242 Bacteria 5509
1702 Ga0265329_10225441 3300031242 Bacteria 621
1703 Ga0265339_10017148 3300031249 Bacteria 4294
1704 Ga0265339_10034965 3300031249 Bacteria 2821
1705 Ga0265331_10000305 3300031250 Bacteria 53782
1706 Ga0265331_10164616 3300031250 Bacteria 1005
1707 Ga0265327_10004446 3300031251 Bacteria 12401
1708 Ga0265327_10241250 3300031251 Bacteria 807
1709 Ga0265316_10015795 3300031344 Bacteria 6581
1710 Ga0265316_10247381 3300031344 Bacteria 1310
1711 Ga0265316_10394771 3300031344 Bacteria 997
1712 Ga0307408_100029481 3300031548 Bacteria 3802
1713 Ga0307408_100145866 3300031548 Bacteria 1863
1714 Ga0307408_100569474 3300031548 Bacteria 1002
1715 Ga0307408_100767607 3300031548 Bacteria 872
1716 Ga0307408_101112395 3300031548 Bacteria 733
1717 Ga0316575_10002071 3300031665 Bacteria 6684
1718 Ga0316575_10007475 3300031665 Bacteria 3959
1719 Ga0316575_10009398 3300031665 Bacteria 3581
1720 Ga0316575_10069068 3300031665 Bacteria 1418
1721 Ga0316579_10089832 3300031691 Bacteria 1466
1722 Ga0265314_10005310 3300031711 Bacteria 11656
1723 Ga0265314_10110497 3300031711 Bacteria 1747
1724 Ga0265314_10115968 3300031711 Bacteria 1694
1725 Ga0265342_10000388 3300031712 Bacteria 48589
1726 Ga0265342_10003302 3300031712 Bacteria 13326
1727 Ga0265342_10091945 3300031712 Bacteria 1738
1728 Ga0265342_10641431 3300031712 Bacteria 534
1729 Ga0316576_10006590 3300031727 Bacteria 7247
1730 Ga0316578_10018579 3300031728 Bacteria 3813
1731 Ga0316578_10748156 3300031728 Bacteria 568
1732 Ga0307405_10010971 3300031731 Bacteria 4723
1733 Ga0307405_10207011 3300031731 Bacteria 1429
1734 Ga0307405_11320174 3300031731 Bacteria 628
1735 Ga0307405_11499036 3300031731 Bacteria 592
1736 Ga0247548_102195 3300031814 Bacteria 834
1737 Ga0307413_10020134 3300031824 Bacteria 3541
1738 Ga0307413_10314636 3300031824 Bacteria 1193
1739 Ga0307413_11455851 3300031824 Bacteria 604
1740 Ga0307410_10089068 3300031852 Bacteria 2186
1741 Ga0307410_10114262 3300031852 Bacteria 1958
1742 Ga0307410_10116672 3300031852 Bacteria 1940
1743 Ga0307410_10128268 3300031852 Bacteria 1860
1744 Ga0307406_10007130 3300031901 Bacteria 6189
1745 Ga0307406_10063403 3300031901 Bacteria 2394
1746 Ga0307406_10117253 3300031901 Bacteria 1844
1747 Ga0307407_10001249 3300031903 Bacteria 9055
1748 Ga0307407_10067954 3300031903 Bacteria 2109
1749 Ga0307407_10335608 3300031903 Bacteria 1065
1750 Ga0307412_10000008 3300031911 Bacteria 461034
1751 Ga0307412_10023363 3300031911 Bacteria 3803
1752 Ga0307412_10092788 3300031911 Bacteria 2116
1753 Ga0307412_10109182 3300031911 Bacteria 1972
1754 Ga0307412_10368925 3300031911 Bacteria 1158
1755 Ga0307409_100041499 3300031995 Bacteria 3437
1756 Ga0307409_100604805 3300031995 Bacteria 1084
1757 Ga0307409_100779299 3300031995 Bacteria 962
1758 Ga0307409_101059768 3300031995 Bacteria 831
1759 Ga0307416_100004433 3300032002 Bacteria 8460
1760 Ga0307416_100020107 3300032002 Bacteria 4755
1761 Ga0307416_100023587 3300032002 Bacteria 4469
1762 Ga0307416_100475719 3300032002 Bacteria 1308
1763 Ga0307416_101645891 3300032002 Bacteria 747
1764 Ga0307416_103767607 3300032002 Bacteria 508
1765 Ga0307414_10007240 3300032004 Bacteria 6231
1766 Ga0307414_10200312 3300032004 Bacteria 1623
1767 Ga0307414_10524409 3300032004 Bacteria 1052
1768 Ga0307414_10561373 3300032004 Bacteria 1019
1769 Ga0307411_10012879 3300032005 Bacteria 4586
1770 Ga0307411_10318278 3300032005 Bacteria 1255
1771 Ga0307411_10932152 3300032005 Bacteria 773
1772 Ga0307411_12160475 3300032005 Bacteria 521
1773 Ga0307415_100030356 3300032126 Bacteria 3468
1774 Ga0307415_101769527 3300032126 Bacteria 597
1775 Ga0316583_10001269 3300032133 Bacteria 8323
1776 Ga0316583_10005979 3300032133 Bacteria 4373
1777 Ga0316583_10010915 3300032133 Bacteria 3271
1778 Ga0316580_10026428 3300032139 Bacteria 1795
1779 Ga0316593_10080302 3300032168 Bacteria 1137
1780 Ga0316586_1091140 3300033527 Bacteria 576
1781 Ga0316212_1057993 3300033547 Bacteria 556
1782 Ga0373930_0111087 3300034816 Bacteria 660
1783 Ga0373959_0046960 3300034820 Bacteria 922
1784 Ga0373928_0020488 3300035084 Bacteria 1386
1785 Ga0373928_0123844 3300035084 Bacteria 695
1786 Ga0373929_0008628 3300035085 Bacteria 1880
1787 Ga0373934_0010703 3300035086 Bacteria 3444
1788 Ga0373934_0068218 3300035086 Bacteria 1421
1789 Ga0373944_0258699 3300035089 Bacteria 644
1790 Ga0373949_0059598 3300035090 Bacteria 979
1791 Ga0373923_0023084 3300035111 Bacteria 2444
1792 Ga0373923_0187144 3300035111 Bacteria 953
1793 Ga0373936_0598101 3300035113 Bacteria 518
1794 Ga0373939_0072159 3300035114 Bacteria 1127
1795 Ga0373939_0180533 3300035114 Bacteria 787
1796 Ga0373939_0363524 3300035114 Bacteria 592
1797 Ga0373939_0413447 3300035114 Bacteria 561
1798 Ga0373953_0001744 3300035117 Bacteria 6418
1799 Ga0373953_0010602 3300035117 Bacteria 3214
1800 Ga0373954_0002279 3300035118 Bacteria 7990
1801 Ga0373954_0017066 3300035118 Bacteria 3256
1802 Ga0373954_0069665 3300035118 Bacteria 1670
1803 Ga0373956_0014211 3300035119 Bacteria 3324
1804 Ga0373957_0016400 3300035120 Bacteria 2563
1805 Ga0373943_0048322 3300035170 Bacteria 2084
1806 Ga0373946_0614035 3300035171 Bacteria 564
1807 Ga0373955_0004393 3300035172 Bacteria 6238
1808 Ga0373955_0007947 3300035172 Bacteria 4900
1809 Ga0373955_0627946 3300035172 Bacteria 658
1810 Ga0373942_0010434 3300035207 Bacteria 2186
1811 Ga0373942_0234637 3300035207 Bacteria 619
1812 Ga0316574_0064950 3300035398 Bacteria 2297
1813 Ga0316574_0261170 3300035398 Bacteria 1106
1814 Ga0316574_0404562 3300035398 Bacteria 859
1815 Ga0373931_0293893 3300035691 Bacteria 1001
1816 Ga0373931_0824205 3300035691 Bacteria 620
1817 Ga0373931_1163084 3300035691 Unclassified 527
1818 Ga0373935_0141319 3300035692 Bacteria 1626
1819 Ga0373927_0049863 3300035695 Bacteria 2706
1820 Ga0373927_0178138 3300035695 Bacteria 1394
1821 Ga0373927_0306027 3300035695 Bacteria 1046
1822 Ga0373933_0115325 3300035724 Bacteria 1678
1823 Ga0373933_0297291 3300035724 Bacteria 1045
1824 Ga0373933_0326774 3300035724 Bacteria 995
1825 Ga0373933_0441592 3300035724 Bacteria 851
1826 Ga0373933_0849958 3300035724 Bacteria 601
1827 Ga0373933_1106112 3300035724 Bacteria 522
1828 Ga0373947_0139431 3300035725 Bacteria 1554
1829 Ga0373947_0153700 3300035725 Bacteria 1483
1830 Ga0373947_0354075 3300035725 Bacteria 985
1831 Ga0373947_0879496 3300035725 Bacteria 612
1832 Ga0373937_0003896 3300036401 Bacteria 12623
1833 Ga0373937_0057219 3300036401 Bacteria 3581
1834 Ga0373937_0086813 3300036401 Bacteria 2895
1835 Ga0373937_0191982 3300036401 Bacteria 1919
1836 Ga0373937_0334657 3300036401 Bacteria 1433
1837 Ga0373937_0364493 3300036401 Bacteria 1370
1838 Ga0265778_065979 3300036457 Bacteria 509
1839 Ga0316582_0014186 3300036647 Bacteria 4513
1840 Ga0373925_0057755 3300037068 Bacteria 2908
1841 Ga0373925_0082947 3300037068 Bacteria 2440
1842 Ga0373925_0229534 3300037068 Bacteria 1484
1843 Ga0373925_0264278 3300037068 Bacteria 1383
1844 Ga0395899_0000041 3300037312 Bacteria 255615
1845 Ga0395899_0080162 3300037312 Bacteria 2377
1846 Ga0395900_0000797 3300037418 Bacteria 41664
1847 Ga0395900_0001690 3300037418 Bacteria 25639
1848 Ga0395900_0101488 3300037418 Bacteria 2955
1849 Ga0395900_0230840 3300037418 Bacteria 1861
1850 Ga0395900_0312542 3300037418 Bacteria 1554
1851 Ga0395898_0000220 3300037466 Bacteria 146473
1852 Ga0395898_0000947 3300037466 Bacteria 46185
1853 Ga0395898_0005227 3300037466 Bacteria 14034
1854 Ga0395898_0098763 3300037466 Bacteria 2803
1855 Ga0395898_0997774 3300037466 Bacteria 773
1856 Ga0395905_0000098 3300037471 Bacteria 145524
1857 Ga0395905_0031587 3300037471 Bacteria 4985
1858 Ga0316581_0001344 3300037588 Bacteria 5463
1859 Ga0436364_0882767 3300037853 Bacteria 1033
1860 Ga0395901_0000011 3300038443 Bacteria 400724
1861 Ga0395901_0000106 3300038443 Bacteria 114313
1862 Ga0395901_0000423 3300038443 Bacteria 49918
1863 Ga0395901_0506561 3300038443 Bacteria 1228
1864 Ga0436365_0200015 3300039437 Bacteria 625
1865 Ga0436365_0661281 3300039437 Bacteria 1042
1866 Ga0436365_0815767 3300039437 Bacteria 1762
1867 Ga0436365_1306082 3300039437 Bacteria 2472
1868 Ga0436360_0638761 3300039438 Bacteria 514
1869 Ga0436360_0767044 3300039438 Bacteria 861
1870 Ga0436360_1321577 3300039438 Bacteria 1179
1871 Ga0436361_0360842 3300039447 Bacteria 25330
1872 Ga0436361_0380284 3300039447 Bacteria 558
1873 Ga0436361_0779041 3300039447 Bacteria 1376
1874 Ga0436361_0781847 3300039447 Bacteria 1770
1875 Ga0436361_1162453 3300039447 Bacteria 1524
1876 Ga0439436_0148006 3300041404 Bacteria 662
1877 Ga0439439_0060116 3300041406 Bacteria 1008
1878 Ga0439439_0138629 3300041406 Bacteria 686
1879 Ga0439447_129618 3300041407 Bacteria 579
1880 Ga0439461_0225447 3300041410 Bacteria 512
1881 Ga0451793_1085242 3300041452 Bacteria 555
1882 Ga0451835_0482549 3300041492 Bacteria 549
1883 Ga0451839_1417856 3300041496 Bacteria 522
1884 Ga0451853_1934416 3300041512 Bacteria 609
1885 Ga0451853_2569216 3300041512 Bacteria 703
1886 Ga0439441_036553 3300042001 Bacteria 971
1887 Ga0439442_050104 3300042002 Bacteria 881
1888 Ga0439443_005158 3300042003 Bacteria 1737
1889 Ga0439443_062206 3300042003 Bacteria 670
1890 Ga0439448_0000799 3300042005 Bacteria 7636
1891 Ga0439451_038169 3300042009 Bacteria 965
1892 Ga0439456_108678 3300042013 Bacteria 631
1893 Ga0450913_009229 3300042117 Bacteria 772
1894 Ga0450922_023106 3300042124 Bacteria 650
1895 Ga0450923_000546 3300042125 Bacteria 4230
1896 Ga0450888_015898 3300042126 Bacteria 923
1897 Ga0450888_047687 3300042126 Bacteria 608
1898 Ga0450888_068920 3300042126 Bacteria 529
1899 Ga0450897_010779 3300042128 Bacteria 883
1900 Ga0450897_036016 3300042128 Bacteria 573
1901 Ga0450894_004246 3300042131 Bacteria 1865
1902 Ga0450898_017167 3300042134 Bacteria 1242
1903 Ga0450898_049929 3300042134 Bacteria 807
1904 Ga0450910_004089 3300042147 Bacteria 1963
1905 Ga0439446_0000630 3300042156 Bacteria 7305
1906 Ga0439446_0003297 3300042156 Bacteria 3987
1907 Ga0450908_005760 3300042184 Bacteria 2369
1908 Ga0450909_028872 3300042185 Bacteria 839
1909 Ga0439434_0028425 3300042435 Bacteria 1693
1910 Ga0439434_0055560 3300042435 Bacteria 1232
1911 Ga0439435_0000294 3300042436 Bacteria 7431
1912 Ga0439435_0072035 3300042436 Bacteria 1024
1913 Ga0439435_0078151 3300042436 Bacteria 990
1914 Ga0439444_0000596 3300042437 Bacteria 4151
1915 Ga0439460_0014563 3300042461 Bacteria 2068
1916 Ga0439460_0017305 3300042461 Bacteria 1930
1917 Ga0439460_0109199 3300042461 Bacteria 896
1918 Ga0450916_066143 3300042530 Bacteria 596
1919 Ga0450918_008432 3300042531 Bacteria 1810
1920 Ga0450893_0107581 3300042532 Bacteria 573
1921 Ga0451577_0006944 3300042876 Bacteria 11187
1922 Ga0451577_0030634 3300042876 Bacteria 4860
1923 Ga0451577_0034347 3300042876 Bacteria 4571
1924 Ga0451577_0034644 3300042876 Bacteria 4549
1925 Ga0451577_0043761 3300042876 Bacteria 4010
1926 Ga0451577_0044644 3300042876 Bacteria 3968
1927 Ga0451577_0063910 3300042876 Bacteria 3282
1928 Ga0451577_1871569 3300042876 Bacteria 526
1929 Ga0451577_1930707 3300042876 Bacteria 517
1930 Ga0451577_1967274 3300042876 Bacteria 511
1931 Ga0466969_0000212 3300044656 Bacteria 31753
1932 Ga0466969_0002954 3300044656 Bacteria 9077
1933 Ga0466969_0004471 3300044656 Bacteria 7443
1934 Ga0466969_0167284 3300044656 Bacteria 1009
1935 Ga0466972_0020242 3300044658 Bacteria 3324
1936 Ga0466973_0017092 3300044659 Bacteria 6898
1937 Ga0466977_0003512 3300044666 Bacteria 7626
1938 Ga0466982_0408480 3300044672 Bacteria 732
1939 Ga0453683_0011624 3300044673 Bacteria 5799
1940 Ga0453683_0044511 3300044673 Bacteria 2785
1941 Ga0453683_0325319 3300044673 Bacteria 985
1942 Ga0466965_0003246 3300044683 Bacteria 7109
1943 Ga0466965_0018893 3300044683 Bacteria 3307
1944 Ga0466966_0000244 3300044684 Bacteria 36047
1945 Ga0466966_0018072 3300044684 Bacteria 4654
1946 Ga0466966_0028514 3300044684 Bacteria 3635
1947 Ga0466966_0202153 3300044684 Bacteria 1202
1948 Ga0466966_0346698 3300044684 Bacteria 892
1949 Ga0466961_0000037 3300044693 Bacteria 80759
1950 Ga0466961_0003134 3300044693 Bacteria 10298
1951 Ga0466961_0028625 3300044693 Bacteria 3582
1952 Ga0466961_0097182 3300044693 Bacteria 1857
1953 Ga0466963_0001278 3300044694 Bacteria 13354
1954 Ga0466963_0017736 3300044694 Bacteria 4440
1955 Ga0466963_0026281 3300044694 Bacteria 3722
1956 Ga0466964_0000841 3300044706 Bacteria 10048
1957 Ga0453684_0000816 3300044712 Bacteria 105676
1958 Ga0453684_0179144 3300044712 Bacteria 2489
1959 Ga0453684_0179370 3300044712 Bacteria 2488
1960 Ga0453684_0339420 3300044712 Bacteria 1697
1961 Ga0453684_0752183 3300044712 Bacteria 1055
1962 Ga0453684_1994803 3300044712 Bacteria 585
1963 Ga0466971_0001557 3300044719 Bacteria 9682
1964 Ga0466971_0007613 3300044719 Bacteria 4722
1965 Ga0466971_0025660 3300044719 Bacteria 2631
1966 Ga0466968_0009829 3300044735 Bacteria 3692
1967 Ga0466968_0037762 3300044735 Bacteria 2028
1968 Ga0466968_0358432 3300044735 Bacteria 709
1969 Ga0466968_0682095 3300044735 Bacteria 523
1970 Ga0466970_0021582 3300044765 Bacteria 3354
1971 Ga0466970_0029366 3300044765 Bacteria 2894
1972 Ga0466970_0253667 3300044765 Bacteria 986
1973 Ga0466957_0003208 3300044842 Bacteria 8941
1974 Ga0466957_0003616 3300044842 Bacteria 8518
1975 Ga0466957_0025105 3300044842 Bacteria 3530
1976 Ga0466957_0036894 3300044842 Bacteria 2941
1977 Ga0466957_0254157 3300044842 Bacteria 1169
1978 Ga0466957_1375772 3300044842 Bacteria 513
1979 Ga0466960_0207076 3300044901 Bacteria 1074
1980 Ga0466960_0579951 3300044901 Bacteria 664
1981 Ga0466960_0768045 3300044901 Bacteria 582
1982 Ga0466959_0002658 3300045049 Bacteria 11471
1983 Ga0466959_0007503 3300045049 Bacteria 7658
1984 Ga0466959_0099886 3300045049 Bacteria 2077
1985 Ga0466959_0119194 3300045049 Bacteria 1877
1986 Ga0466959_0403446 3300045049 Bacteria 929
1987 Ga0451576_0001131 3300045051 Bacteria 48320
1988 Ga0451576_0002798 3300045051 Bacteria 25168
1989 Ga0451576_0055941 3300045051 Bacteria 4127
1990 Ga0451576_0062050 3300045051 Bacteria 3897
1991 Ga0451576_0069357 3300045051 Bacteria 3668
1992 Ga0451576_0144085 3300045051 Bacteria 2484
1993 Ga0451576_0218970 3300045051 Bacteria 1988
1994 Ga0451576_0282593 3300045051 Bacteria 1735
1995 Ga0451576_0761337 3300045051 Bacteria 1017
1996 Ga0466958_0013842 3300045836 Bacteria 4600
1997 Ga0466958_0016955 3300045836 Bacteria 4201
1998 Ga0466958_0047389 3300045836 Bacteria 2594
1999 Ga0466958_0063773 3300045836 Bacteria 2247
2000 Ga0466967_0528918 3300045976 Bacteria 1159
2001 Ga0466967_1009176 3300045976 Bacteria 829
2002 Ga0495592_0024962 3300046454 Bacteria 4540
2003 Ga0495592_0409514 3300046454 Bacteria 857
2004 Ga0495592_0507634 3300046454 Bacteria 747
2005 Ga0495603_0001200 3300046455 Bacteria 15127
2006 Ga0495603_0121471 3300046455 Bacteria 1522
2007 Ga0495603_0125873 3300046455 Bacteria 1493
2008 Ga0495603_0261592 3300046455 Bacteria 996
2009 Ga0495590_0005835 3300046457 Bacteria 4836
2010 Ga0495590_0036297 3300046457 Bacteria 1719
2011 Ga0495590_0191829 3300046457 Bacteria 749
2012 Ga0495591_093532 3300046458 Bacteria 752
2013 Ga0495629_0000293 3300046459 Bacteria 43087
2014 Ga0495629_0292568 3300046459 Bacteria 1116
2015 Ga0495629_0389986 3300046459 Bacteria 947
2016 Ga0495629_1123723 3300046459 Bacteria 507
2017 Ga0495638_0043896 3300046460 Bacteria 2818
2018 Ga0495641_0081701 3300046461 Bacteria 1447
2019 Ga0495651_0105865 3300046462 Bacteria 2086
2020 Ga0495651_0232060 3300046462 Bacteria 1270
2021 Ga0495651_0283250 3300046462 Bacteria 1119
2022 Ga0495651_0810927 3300046462 Bacteria 577
2023 Ga0495653_0144315 3300046463 Bacteria 1670
2024 Ga0495653_0380373 3300046463 Bacteria 902
2025 Ga0495653_0647682 3300046463 Bacteria 645
2026 Ga0495650_0006614 3300046471 Bacteria 7196
2027 Ga0495650_0062836 3300046471 Bacteria 1483
2028 Ga0495650_0179921 3300046471 Bacteria 744
2029 Ga0495580_0003989 3300046472 Bacteria 12454
2030 Ga0495580_0012359 3300046472 Bacteria 6550
2031 Ga0495580_0130378 3300046472 Bacteria 1744
2032 Ga0495580_0312192 3300046472 Bacteria 1069
2033 Ga0495582_0055801 3300046473 Bacteria 2177
2034 Ga0495582_0180170 3300046473 Bacteria 1204
2035 Ga0495582_0191729 3300046473 Bacteria 1166
2036 Ga0495582_0639090 3300046473 Bacteria 616
2037 Ga0495605_0003987 3300046474 Bacteria 8725
2038 Ga0495605_0015985 3300046474 Bacteria 4072
2039 Ga0495605_0059792 3300046474 Bacteria 1829
2040 Ga0495605_0125912 3300046474 Bacteria 1158
2041 Ga0495605_0364844 3300046474 Bacteria 604
2042 Ga0495639_0128668 3300046475 Bacteria 1211
2043 Ga0495639_0685960 3300046475 Bacteria 529
2044 Ga0495662_0031906 3300046476 Bacteria 2544
2045 Ga0495662_0148208 3300046476 Bacteria 1156
2046 Ga0495662_0163900 3300046476 Bacteria 1095
2047 Ga0495662_0226355 3300046476 Bacteria 922
2048 Ga0495664_0003554 3300046477 Bacteria 8500
2049 Ga0495664_0028280 3300046477 Bacteria 3274
2050 Ga0495664_0048678 3300046477 Bacteria 2516
2051 Ga0495584_0050865 3300046491 Bacteria 2087
2052 Ga0495584_0375490 3300046491 Bacteria 722
2053 Ga0495585_0188441 3300046492 Bacteria 1057
2054 Ga0495596_0017515 3300046500 Bacteria 2963
2055 Ga0495596_0137831 3300046500 Bacteria 947
2056 Ga0495596_0142897 3300046500 Bacteria 929
2057 Ga0495596_0201660 3300046500 Bacteria 773
2058 Ga0495607_0070613 3300046501 Bacteria 1951
2059 Ga0495583_0001256 3300046506 Bacteria 26737
2060 Ga0495606_0033594 3300046507 Bacteria 3536
2061 Ga0495606_0069892 3300046507 Bacteria 2216
2062 Ga0495606_0273392 3300046507 Bacteria 927
2063 Ga0495606_0342057 3300046507 Bacteria 797
2064 Ga0495606_0441435 3300046507 Bacteria 668
2065 Ga0495606_0544593 3300046507 Bacteria 578
2066 Ga0495608_0048972 3300046511 Bacteria 2806
2067 Ga0495610_0003920 3300046512 Bacteria 11276
2068 Ga0495610_0227035 3300046512 Bacteria 751
2069 Ga0495616_0028857 3300046513 Bacteria 2934
2070 Ga0495618_0012902 3300046514 Bacteria 5079
2071 Ga0495620_0210625 3300046515 Bacteria 746
2072 Ga0495628_0011133 3300046516 Bacteria 7615
2073 Ga0495628_0027015 3300046516 Bacteria 4672
2074 Ga0495628_0116858 3300046516 Bacteria 2048
2075 Ga0495628_0354493 3300046516 Bacteria 1078
2076 Ga0495628_0817679 3300046516 Bacteria 651
2077 Ga0495630_0013181 3300046517 Bacteria 6010
2078 Ga0495630_0100495 3300046517 Bacteria 2188
2079 Ga0495630_1230893 3300046517 Bacteria 565
2080 Ga0495631_0043238 3300046518 Bacteria 1988
2081 Ga0495631_0248761 3300046518 Bacteria 758
2082 Ga0495643_0098924 3300046522 Bacteria 1497
2083 Ga0495644_0179837 3300046523 Bacteria 813
2084 Ga0495648_0038507 3300046524 Bacteria 3056
2085 Ga0495666_0027558 3300046526 Bacteria 2796
2086 Ga0495666_0033321 3300046526 Bacteria 2516
2087 Ga0495666_0075817 3300046526 Bacteria 1594
2088 Ga0495666_0134946 3300046526 Bacteria 1152
2089 Ga0495642_0010355 3300046528 Bacteria 3571
2090 Ga0495642_0038170 3300046528 Bacteria 1946
2091 Ga0495642_0116633 3300046528 Bacteria 1144
2092 Ga0495642_0450247 3300046528 Bacteria 569
2093 Ga0495642_0497050 3300046528 Bacteria 540
2094 Ga0495652_0011413 3300046529 Bacteria 8036
2095 Ga0495652_0162928 3300046529 Bacteria 1729
2096 Ga0495652_0214169 3300046529 Bacteria 1452
2097 Ga0495652_1017360 3300046529 Bacteria 541
2098 Ga0495652_1154847 3300046529 Bacteria 501
2099 Ga0495654_0110603 3300046530 Bacteria 1254
2100 Ga0495665_0019322 3300046531 Bacteria 3663
2101 Ga0495665_0056112 3300046531 Bacteria 2079
2102 Ga0495665_0070494 3300046531 Bacteria 1842
2103 Ga0495640_0011260 3300046533 Bacteria 6885
2104 Ga0495640_0012380 3300046533 Bacteria 6520
2105 Ga0495586_0063317 3300046535 Bacteria 2015
2106 Ga0495586_0084228 3300046535 Bacteria 1750
2107 Ga0495586_0198890 3300046535 Bacteria 1136
2108 Ga0495586_0865591 3300046535 Bacteria 521
2109 Ga0495587_0093053 3300046536 Bacteria 1741
2110 Ga0495621_0068013 3300046539 Bacteria 1306
2111 Ga0495597_0006296 3300046542 Bacteria 6148
2112 Ga0495645_0057084 3300046543 Bacteria 2834
2113 Ga0495645_0063297 3300046543 Bacteria 2679
2114 Ga0495645_0086523 3300046543 Bacteria 2242
2115 Ga0495645_0149107 3300046543 Bacteria 1626
2116 Ga0495645_0156241 3300046543 Bacteria 1580
2117 Ga0495645_0180135 3300046543 Bacteria 1448
2118 Ga0495622_0214370 3300046557 Bacteria 854
2119 Ga0495633_0221107 3300046558 Bacteria 867
2120 Ga0495667_0092270 3300046559 Bacteria 1961
2121 Ga0495667_0145306 3300046559 Bacteria 1528
2122 Ga0495668_0293941 3300046616 Bacteria 890
2123 Ga0495634_0015541 3300046642 Bacteria 5464
2124 Ga0495611_0250231 3300046648 Bacteria 821
2125 Ga0495611_0267381 3300046648 Bacteria 791
2126 Ga0495611_0582137 3300046648 Bacteria 506
2127 Ga0495625_0349939 3300046660 Bacteria 934
2128 Ga0495635_0010140 3300046663 Bacteria 6590
2129 Ga0495635_0039843 3300046663 Bacteria 3249
2130 Ga0495635_0112766 3300046663 Bacteria 1857
2131 Ga0495635_0590303 3300046663 Bacteria 726
2132 Ga0495635_0625382 3300046663 Bacteria 702
2133 Ga0495635_0776508 3300046663 Bacteria 618
2134 Ga0495661_0421779 3300046665 Bacteria 646
2135 Ga0495588_0377354 3300046674 Bacteria 745
2136 Ga0495657_0042791 3300046675 Bacteria 3090
2137 Ga0495599_0447222 3300046678 Bacteria 765
2138 Ga0495623_0007364 3300046679 Bacteria 7144
2139 Ga0495623_0157114 3300046679 Bacteria 1339
2140 Ga0495646_0036392 3300046680 Bacteria 3049
2141 Ga0495646_0066620 3300046680 Bacteria 2129
2142 Ga0495646_0180727 3300046680 Bacteria 1158
2143 Ga0495658_0237057 3300046683 Bacteria 1145
2144 Ga0495658_0761980 3300046683 Bacteria 620
2145 Ga0495669_0101547 3300046684 Bacteria 1336
2146 Ga0495669_0118953 3300046684 Bacteria 1237
2147 Ga0495669_0192909 3300046684 Bacteria 972
2148 Ga0495669_0305537 3300046684 Bacteria 767
2149 Ga0495613_0574021 3300046689 Bacteria 753
2150 Ga0495613_0841468 3300046689 Bacteria 597
2151 Ga0495624_0079871 3300046690 Bacteria 2027
2152 Ga0495624_0103282 3300046690 Bacteria 1754
2153 Ga0495624_0755443 3300046690 Bacteria 576
2154 Ga0495624_0931691 3300046690 Bacteria 511
2155 Ga0495670_0090193 3300046691 Bacteria 1568
2156 Ga0495671_0476915 3300046692 Bacteria 596
2157 Ga0495649_0011595 3300046694 Bacteria 5165
2158 Ga0495649_0012013 3300046694 Bacteria 5057
2159 Ga0495649_0200525 3300046694 Bacteria 1036
2160 Ga0495649_0216101 3300046694 Bacteria 992
2161 Ga0495589_0022891 3300046794 Bacteria 3185
2162 Ga0495589_0079628 3300046794 Bacteria 1594
2163 Ga0495589_0301541 3300046794 Bacteria 742
2164 Ga0495589_0338715 3300046794 Bacteria 694
2165 Ga0495600_0047351 3300046809 Bacteria 2804
2166 Ga0495600_0302308 3300046809 Bacteria 1009
2167 Ga0495600_0683603 3300046809 Bacteria 618
2168 Ga0495600_0922047 3300046809 Bacteria 514
2169 Ga0495660_0147657 3300046810 Bacteria 1164
2170 Ga0495581_0068856 3300047315 Bacteria 2046
2171 Ga0495581_0152823 3300047315 Bacteria 1348
2172 Ga0495604_0136964 3300047317 Bacteria 1753
2173 Ga0495604_0696019 3300047317 Bacteria 645
2174 Ga0495636_0007298 3300047318 Bacteria 4349
2175 Ga0495674_0006962 3300047319 Bacteria 10818
2176 Ga0495674_0019748 3300047319 Bacteria 6249
2177 Ga0495674_0087712 3300047319 Bacteria 2662
2178 Ga0495674_0119292 3300047319 Bacteria 2229
2179 Ga0495674_0219415 3300047319 Bacteria 1572
2180 Ga0495674_0354311 3300047319 Bacteria 1191
2181 Ga0495674_0636629 3300047319 Bacteria 842
2182 Ga0495672_0007237 3300047320 Bacteria 8374
2183 Ga0495672_0124050 3300047320 Bacteria 1368
2184 Ga0495676_0023779 3300047321 Bacteria 5311
2185 Ga0495680_0013833 3300047322 Bacteria 7020
2186 Ga0495680_0053845 3300047322 Bacteria 3128
2187 Ga0495680_0139763 3300047322 Bacteria 1773
2188 Ga0495680_0160640 3300047322 Bacteria 1632
2189 Ga0495680_0734601 3300047322 Bacteria 649
2190 Ga0495683_0012145 3300047323 Bacteria 4526
2191 Ga0495683_0026601 3300047323 Bacteria 2960
2192 Ga0495683_0138949 3300047323 Bacteria 1140
2193 Ga0495683_0339381 3300047323 Bacteria 636
2194 Ga0495687_000025 3300047443 Bacteria 310498
2195 Ga0495687_009941 3300047443 Bacteria 5264
2196 Ga0495687_091654 3300047443 Bacteria 1162
2197 Ga0495675_0002828 3300047444 Bacteria 10396
2198 Ga0495675_0478294 3300047444 Bacteria 718
2199 Ga0495677_0233145 3300047445 Bacteria 718
2200 Ga0495677_0344996 3300047445 Bacteria 587
2201 Ga0495685_092903 3300047447 Bacteria 999
2202 Ga0495685_227755 3300047447 Bacteria 594
2203 Ga0495673_0002104 3300047469 Bacteria 14484
2204 Ga0495673_0078649 3300047469 Bacteria 1370
2205 Ga0495673_0286001 3300047469 Bacteria 594
2206 Ga0495681_0105438 3300047470 Bacteria 1227
2207 Ga0495681_0214625 3300047470 Bacteria 774
2208 Ga0495684_1025799 3300047471 Bacteria 522
2209 Ga0495686_0000032 3300047472 Bacteria 345132
2210 Ga0495593_0007279 3300047673 Bacteria 6481
2211 Ga0495593_0147541 3300047673 Bacteria 1190
2212 Ga0495593_0227462 3300047673 Bacteria 935
2213 Ga0495602_0038407 3300048088 Bacteria 4426
2214 Ga0495602_0305588 3300048088 Bacteria 1162
2215 Ga0495602_1083210 3300048088 Bacteria 526
2216 Ga0495614_0029314 3300048089 Bacteria 2368
2217 Ga0495614_0256756 3300048089 Bacteria 800
2218 Ga0495626_0085944 3300048091 Bacteria 1390
2219 Ga0495626_0146423 3300048091 Bacteria 998
2220 Ga0496100_0001564 3300048903 Bacteria 11251
2221 Ga0496100_0328768 3300048903 Bacteria 1150
2222 Ga0496100_0355804 3300048903 Bacteria 1107
2223 Ga0496100_1162315 3300048903 Bacteria 608
2224 Ga0496100_1245386 3300048903 Unclassified 587
2225 Ga0496101_0004610 3300048904 Bacteria 8706
2226 Ga0496101_0017506 3300048904 Bacteria 4860
2227 Ga0496101_0032663 3300048904 Bacteria 3666
2228 Ga0496101_0186763 3300048904 Bacteria 1598
2229 Ga0496101_0263281 3300048904 Bacteria 1345
2230 Ga0496101_1010642 3300048904 Bacteria 654
2231 Ga0496102_0004786 3300048905 Bacteria 11451
2232 Ga0496102_0008702 3300048905 Bacteria 8712
2233 Ga0496102_0068560 3300048905 Bacteria 3255
2234 Ga0496102_0073083 3300048905 Bacteria 3152
2235 Ga0496102_1696966 3300048905 Bacteria 549
2236 Ga0496103_0000337 3300048906 Bacteria 42834
2237 Ga0496103_0020377 3300048906 Bacteria 3982
2238 Ga0496103_0108081 3300048906 Bacteria 1765
2239 Ga0496104_0022440 3300048907 Bacteria 5799
2240 Ga0496104_0186818 3300048907 Bacteria 1983
2241 Ga0496104_0200509 3300048907 Bacteria 1907
2242 Ga0496104_0305418 3300048907 Bacteria 1503
2243 Ga0496104_0327094 3300048907 Bacteria 1446
2244 Ga0496104_0469788 3300048907 Bacteria 1169
2245 Ga0496104_0861095 3300048907 Bacteria 811
2246 Ga0496104_1564919 3300048907 Bacteria 562
2247 Ga0496105_0024699 3300048908 Bacteria 4885
2248 Ga0496105_0089855 3300048908 Bacteria 2537
2249 Ga0496105_0098075 3300048908 Bacteria 2420
2250 Ga0496105_0224494 3300048908 Bacteria 1528
2251 Ga0496105_0264974 3300048908 Bacteria 1389
2252 Ga0496105_0701875 3300048908 Bacteria 776
2253 Ga0496105_0718058 3300048908 Bacteria 766
2254 Ga0496105_0742420 3300048908 Bacteria 750
2255 Ga0496106_0000019 3300048909 Bacteria 174698
2256 Ga0496106_0059660 3300048909 Bacteria 2890
2257 Ga0496106_0062504 3300048909 Bacteria 2827
2258 Ga0496106_0091780 3300048909 Bacteria 2345
2259 Ga0496106_0105294 3300048909 Bacteria 2192
2260 Ga0496106_0203457 3300048909 Bacteria 1576
2261 Ga0496106_0433970 3300048909 Bacteria 1055
2262 Ga0496107_0107310 3300048910 Bacteria 2051
2263 Ga0496107_0168090 3300048910 Bacteria 1626
2264 Ga0496107_0318260 3300048910 Bacteria 1158
2265 Ga0496107_0330392 3300048910 Bacteria 1134
2266 Ga0496107_0616400 3300048910 Bacteria 801
2267 Ga0496107_1024163 3300048910 Bacteria 598
2268 Ga0496107_1255398 3300048910 Bacteria 531
2269 Ga0496108_0035074 3300048911 Bacteria 4169
2270 Ga0496108_0097513 3300048911 Bacteria 2505
2271 Ga0496108_0482064 3300048911 Bacteria 1083
2272 Ga0496108_0602987 3300048911 Bacteria 957
2273 Ga0496108_0723940 3300048911 Bacteria 862
2274 Ga0496108_1349101 3300048911 Bacteria 598
2275 Ga0496109_0137879 3300048912 Bacteria 2280
2276 Ga0496109_0191473 3300048912 Bacteria 1922
2277 Ga0496109_0644351 3300048912 Bacteria 996
2278 Ga0496109_0973305 3300048912 Bacteria 786
2279 Ga0496110_0005432 3300048913 Bacteria 9995
2280 Ga0496110_0191437 3300048913 Bacteria 1858
2281 Ga0496110_0708890 3300048913 Bacteria 908
2282 Ga0496110_0732920 3300048913 Bacteria 891
2283 Ga0496110_1021898 3300048913 Bacteria 734
2284 Ga0496111_0059171 3300048914 Bacteria 2776
2285 Ga0496111_0206982 3300048914 Bacteria 1458
2286 Ga0496112_0000241 3300048915 Bacteria 35206
2287 Ga0496112_0016052 3300048915 Bacteria 7003
2288 Ga0496112_0110203 3300048915 Bacteria 2723
2289 Ga0496112_0113356 3300048915 Bacteria 2682
2290 Ga0496112_0252525 3300048915 Bacteria 1714
2291 Ga0496112_0900822 3300048915 Bacteria 806
2292 Ga0496113_0049457 3300048916 Bacteria 3130
2293 Ga0496113_0056511 3300048916 Bacteria 2947
2294 Ga0496113_0517088 3300048916 Bacteria 958
2295 Ga0496113_0701692 3300048916 Bacteria 807
2296 Ga0496113_0720260 3300048916 Bacteria 795
2297 Ga0496113_1013503 3300048916 Bacteria 654
2298 Ga0496114_0072946 3300048917 Bacteria 2888
2299 Ga0496114_0390780 3300048917 Bacteria 1232
2300 Ga0496114_0426301 3300048917 Bacteria 1175
2301 Ga0496114_0541336 3300048917 Bacteria 1029
2302 Ga0496114_0799938 3300048917 Bacteria 822
2303 Ga0496114_1319769 3300048917 Bacteria 608
2304 Ga0496115_0039159 3300048918 Bacteria 3764
2305 Ga0496115_0114641 3300048918 Bacteria 2215
2306 Ga0496115_0126003 3300048918 Bacteria 2110
2307 Ga0496115_0162425 3300048918 Bacteria 1846
2308 Ga0496115_0520153 3300048918 Bacteria 954
2309 Ga0496115_1054315 3300048918 Bacteria 618
2310 Ga0496115_1299567 3300048918 Bacteria 542
2311 Ga0496116_0012470 3300048919 Bacteria 6944
2312 Ga0496116_0022873 3300048919 Bacteria 4668
2313 Ga0496116_0125474 3300048919 Bacteria 1475
2314 Ga0496116_0216453 3300048919 Bacteria 987
2315 Ga0496116_0315894 3300048919 Bacteria 734
2316 Ga0496117_0002161 3300048920 Bacteria 25640
2317 Ga0496117_0004960 3300048920 Bacteria 14287
2318 Ga0496117_0015919 3300048920 Bacteria 6372
2319 Ga0496117_0019854 3300048920 Bacteria 5501
2320 Ga0496117_0023308 3300048920 Bacteria 4938
2321 Ga0496117_0074066 3300048920 Bacteria 2269
2322 Ga0496118_0000420 3300048921 Bacteria 70373
2323 Ga0496118_0013056 3300048921 Bacteria 7897
2324 Ga0496118_0036943 3300048921 Bacteria 3940
2325 Ga0496118_0112271 3300048921 Bacteria 1804
2326 Ga0496118_0156691 3300048921 Bacteria 1415
2327 Ga0496118_0184665 3300048921 Bacteria 1255
2328 Ga0496118_0314047 3300048921 Bacteria 853
2329 Ga0496119_0039205 3300048922 Bacteria 3047
2330 Ga0496119_0261245 3300048922 Bacteria 869
2331 Ga0496120_0072272 3300048923 Bacteria 1891
2332 Ga0496120_0202992 3300048923 Bacteria 959
2333 Ga0496120_0527672 3300048923 Bacteria 504
2334 Ga0496121_0000310 3300048924 Bacteria 101522
2335 Ga0496121_0004537 3300048924 Bacteria 18576
2336 Ga0496121_0025157 3300048924 Bacteria 5661
2337 Ga0496121_0299808 3300048924 Bacteria 1091
2338 Ga0496121_0353020 3300048924 Bacteria 979
2339 Ga0496121_0440423 3300048924 Bacteria 842
2340 Ga0496122_0004387 3300048925 Bacteria 17565
2341 Ga0496122_0231869 3300048925 Bacteria 1049
2342 Ga0496122_0363954 3300048925 Bacteria 749
2343 Ga0496123_0021267 3300048926 Bacteria 5047
2344 Ga0496123_0081134 3300048926 Bacteria 1973
2345 Ga0496123_0239360 3300048926 Bacteria 902
2346 Ga0496124_0050016 3300048927 Bacteria 3563
2347 Ga0496124_0239991 3300048927 Bacteria 1348
2348 Ga0496124_0371268 3300048927 Bacteria 1004
2349 Ga0496125_0022845 3300048928 Bacteria 5795
2350 Ga0496125_0207457 3300048928 Bacteria 1276
2351 Ga0496125_0434521 3300048928 Bacteria 757
2352 Ga0496126_0000034 3300048929 Bacteria 362440
2353 Ga0496126_0003687 3300048929 Bacteria 19130
2354 Ga0496126_0192584 3300048929 Bacteria 1726
2355 Ga0496126_0452152 3300048929 Bacteria 1034
2356 Ga0496126_0465519 3300048929 Bacteria 1015
2357 Ga0466983_0411850 3300048986 Bacteria 972
2358 Ga0501310_048552 3300049130 Bacteria 609
2359 Ga0495678_007415 3300049459 Bacteria 5684
2360 Ga0495678_100022 3300049459 Bacteria 1006
2361 Ga0495678_164804 3300049459 Bacteria 706
2362 Ga0495682_0081796 3300049460 Bacteria 1161
2363 Ga0495682_0146788 3300049460 Bacteria 842
2364 Ga0501300_012317 3300049523 Bacteria 1247
2365 Ga0501031_0057086 3300049568 Bacteria 2544
2366 Ga0501031_0078286 3300049568 Bacteria 2154
2367 Ga0501031_0462307 3300049568 Bacteria 819
2368 Ga0501031_0994534 3300049568 Bacteria 536
2369 Ga0501032_0579590 3300049569 Bacteria 714
2370 Ga0501033_0007290 3300049570 Bacteria 8627
2371 Ga0501033_0261643 3300049570 Bacteria 1224
2372 Ga0501033_0382862 3300049570 Bacteria 983
2373 Ga0501033_0399487 3300049570 Bacteria 959
2374 Ga0501033_0582917 3300049570 Bacteria 768
2375 Ga0501033_0950022 3300049570 Bacteria 576
2376 Ga0501034_0028843 3300049571 Bacteria 5646
2377 Ga0501034_0326579 3300049571 Bacteria 1466
2378 Ga0501034_1697975 3300049571 Bacteria 504
2379 Ga0501036_0000381 3300049572 Bacteria 31374
2380 Ga0501036_0054298 3300049572 Bacteria 3393
2381 Ga0501036_0281722 3300049572 Bacteria 1391
2382 Ga0501036_0666247 3300049572 Bacteria 861
2383 Ga0501036_0784796 3300049572 Bacteria 785
2384 Ga0501037_0067484 3300049573 Bacteria 2604
2385 Ga0501037_0831571 3300049573 Bacteria 608
2386 Ga0501037_1071940 3300049573 Bacteria 523
2387 Ga0501038_0001967 3300049574 Bacteria 18964
2388 Ga0501038_0002645 3300049574 Bacteria 16751
2389 Ga0501038_1149577 3300049574 Bacteria 565
2390 Ga0501039_0000492 3300049575 Bacteria 28646
2391 Ga0501039_0155662 3300049575 Bacteria 1795
2392 Ga0501039_0187835 3300049575 Bacteria 1625
2393 Ga0501039_0258486 3300049575 Bacteria 1369
2394 Ga0501039_0365826 3300049575 Bacteria 1133
2395 Ga0501040_0000262 3300049576 Bacteria 30759
2396 Ga0501040_0008180 3300049576 Bacteria 6799
2397 Ga0501040_0039045 3300049576 Bacteria 3228
2398 Ga0501040_0057853 3300049576 Bacteria 2663
2399 Ga0501040_0321188 3300049576 Bacteria 1107
2400 Ga0501040_1199090 3300049576 Bacteria 551
2401 Ga0501040_1226237 3300049576 Bacteria 544
2402 Ga0501041_0000582 3300049577 Bacteria 19027
2403 Ga0501041_0007725 3300049577 Bacteria 6313
2404 Ga0501041_0009158 3300049577 Bacteria 5830
2405 Ga0501041_0105469 3300049577 Bacteria 1747
2406 Ga0501041_0430649 3300049577 Bacteria 837
2407 Ga0501041_0441216 3300049577 Bacteria 826
2408 Ga0501041_0483339 3300049577 Bacteria 787
2409 Ga0501041_1072744 3300049577 Bacteria 519
2410 Ga0501042_0003650 3300049578 Bacteria 9705
2411 Ga0501042_0027726 3300049578 Bacteria 3984
2412 Ga0501042_0065145 3300049578 Bacteria 2604
2413 Ga0501042_0244901 3300049578 Bacteria 1294
2414 Ga0501042_0385345 3300049578 Bacteria 1015
2415 Ga0501042_0555686 3300049578 Bacteria 834
2416 Ga0501042_1110550 3300049578 Bacteria 576
2417 Ga0501043_0119430 3300049579 Bacteria 2067
2418 Ga0501043_0247476 3300049579 Bacteria 1374
2419 Ga0501043_0429496 3300049579 Bacteria 995
2420 Ga0501043_1216640 3300049579 Bacteria 528
2421 Ga0501046_0000630 3300049580 Bacteria 34607
2422 Ga0501046_0322345 3300049580 Bacteria 1126
2423 Ga0501047_0515816 3300049581 Bacteria 1021
2424 Ga0501048_0000975 3300049582 Bacteria 21200
2425 Ga0501048_0509313 3300049582 Bacteria 863
2426 Ga0501048_0520054 3300049582 Bacteria 853
2427 Ga0501048_0775491 3300049582 Bacteria 689
2428 Ga0501048_1255569 3300049582 Bacteria 533
2429 Ga0501048_1286721 3300049582 Bacteria 526
2430 Ga0501067_0022921 3300049583 Bacteria 3458
2431 Ga0501068_0018668 3300049584 Bacteria 4017
2432 Ga0501068_0031007 3300049584 Bacteria 3174
2433 Ga0501068_0058736 3300049584 Bacteria 2335
2434 Ga0501068_0188950 3300049584 Bacteria 1304
2435 Ga0501068_0342839 3300049584 Bacteria 960
2436 Ga0501070_0117662 3300049586 Bacteria 2195
2437 Ga0501070_0372200 3300049586 Bacteria 1158
2438 Ga0501070_0586598 3300049586 Bacteria 890
2439 Ga0501070_0872949 3300049586 Bacteria 703
2440 Ga0501071_0000815 3300049587 Bacteria 16611
2441 Ga0501071_0005516 3300049587 Bacteria 8142
2442 Ga0501071_0008606 3300049587 Bacteria 6744
2443 Ga0501071_0017826 3300049587 Bacteria 4906
2444 Ga0501071_0103687 3300049587 Bacteria 2099
2445 Ga0501071_0404073 3300049587 Bacteria 1043
2446 Ga0501071_0535278 3300049587 Bacteria 899
2447 Ga0501071_0735501 3300049587 Bacteria 760
2448 Ga0501071_0945310 3300049587 Bacteria 665
2449 Ga0501071_1257219 3300049587 Bacteria 572
2450 Ga0501072_0002061 3300049588 Bacteria 14944
2451 Ga0501072_0008844 3300049588 Bacteria 7653
2452 Ga0501072_0029125 3300049588 Bacteria 4311
2453 Ga0501072_0038872 3300049588 Bacteria 3735
2454 Ga0501072_0078611 3300049588 Bacteria 2612
2455 Ga0501072_0267121 3300049588 Bacteria 1361
2456 Ga0501072_0310657 3300049588 Bacteria 1253
2457 Ga0501072_0801123 3300049588 Bacteria 738
2458 Ga0501072_0827648 3300049588 Bacteria 724
2459 Ga0501072_1156324 3300049588 Bacteria 602
2460 Ga0501073_0004210 3300049589 Bacteria 10786
2461 Ga0501073_0011761 3300049589 Bacteria 6390
2462 Ga0501073_0016618 3300049589 Bacteria 5332
2463 Ga0501073_0094955 3300049589 Bacteria 2071
2464 Ga0501073_0176212 3300049589 Bacteria 1480
2465 Ga0501074_0031593 3300049590 Bacteria 3836
2466 Ga0501074_0084102 3300049590 Bacteria 2281
2467 Ga0501074_0088777 3300049590 Bacteria 2214
2468 Ga0501074_0114695 3300049590 Bacteria 1928
2469 Ga0501074_0324352 3300049590 Bacteria 1093
2470 Ga0501074_0544697 3300049590 Bacteria 822
2471 Ga0501075_0001050 3300049591 Bacteria 17750
2472 Ga0501075_0008966 3300049591 Bacteria 6978
2473 Ga0501075_0087597 3300049591 Bacteria 2360
2474 Ga0501075_0161388 3300049591 Bacteria 1710
2475 Ga0501075_1368257 3300049591 Bacteria 536
2476 Ga0501075_1514595 3300049591 Bacteria 508
2477 Ga0501076_0000475 3300049592 Bacteria 25328
2478 Ga0501076_0019529 3300049592 Bacteria 5181
2479 Ga0501076_0047763 3300049592 Bacteria 3384
2480 Ga0501076_0076915 3300049592 Bacteria 2677
2481 Ga0501076_0135873 3300049592 Bacteria 1996
2482 Ga0501076_0529739 3300049592 Bacteria 971
2483 Ga0501076_0596708 3300049592 Bacteria 911
2484 Ga0501076_0691836 3300049592 Bacteria 842
2485 Ga0501076_0725756 3300049592 Bacteria 820
2486 Ga0501077_0028843 3300049593 Bacteria 3527
2487 Ga0501077_0222922 3300049593 Bacteria 1198
2488 Ga0501077_0407379 3300049593 Bacteria 869
2489 Ga0501252_082846 3300049682 Bacteria 533
2490 Ga0501259_101847 3300049688 Bacteria 660
2491 Ga0501079_0001439 3300049741 Bacteria 16812
2492 Ga0501079_0012051 3300049741 Bacteria 6597
2493 Ga0501079_0070222 3300049741 Bacteria 2704
2494 Ga0501079_0309751 3300049741 Bacteria 1235
2495 Ga0501079_1228925 3300049741 Bacteria 590
2496 Ga0501080_0001393 3300049742 Bacteria 20224
2497 Ga0501080_0001490 3300049742 Bacteria 19765
2498 Ga0501080_0010032 3300049742 Bacteria 8657
2499 Ga0501080_0044335 3300049742 Bacteria 4141
2500 Ga0501080_0262742 3300049742 Bacteria 1572
2501 Ga0501080_0667089 3300049742 Bacteria 919
2502 Ga0501081_0000755 3300049743 Bacteria 18932
2503 Ga0501081_0010137 3300049743 Bacteria 6148
2504 Ga0501081_0021871 3300049743 Bacteria 4273
2505 Ga0501081_0084845 3300049743 Bacteria 2222
2506 Ga0501081_0100441 3300049743 Bacteria 2045
2507 Ga0501081_0197489 3300049743 Bacteria 1458
2508 Ga0501081_0943623 3300049743 Bacteria 651
2509 Ga0501083_0020059 3300049744 Bacteria 4652
2510 Ga0501083_0085921 3300049744 Bacteria 2081
2511 Ga0501083_0223531 3300049744 Bacteria 1226
2512 Ga0501083_0432175 3300049744 Bacteria 857
2513 Ga0501083_0520430 3300049744 Bacteria 774
2514 Ga0501280_000952 3300049776 Bacteria 6051
2515 Ga0501282_001509 3300049778 Bacteria 2577
2516 Ga0501035_0003745 3300049822 Bacteria 14506
2517 Ga0501035_0122766 3300049822 Bacteria 2269
2518 Ga0501035_0919994 3300049822 Bacteria 692
2519 Ga0501035_1244605 3300049822 Bacteria 576
2520 Ga0501035_1304379 3300049822 Bacteria 560
2521 Ga0501035_1392694 3300049822 Bacteria 538
2522 Ga0501044_0031331 3300049823 Bacteria 5598
2523 Ga0501044_1261836 3300049823 Bacteria 606
2524 Ga0501045_0000167 3300049824 Bacteria 35865
2525 Ga0501045_0108142 3300049824 Bacteria 2061
2526 Ga0501045_0133162 3300049824 Bacteria 1848
2527 Ga0501045_0145604 3300049824 Bacteria 1762
2528 Ga0501045_0321547 3300049824 Bacteria 1151
2529 Ga0501045_0455346 3300049824 Bacteria 951
2530 Ga0501045_0655878 3300049824 Bacteria 775
2531 Ga0501045_1254041 3300049824 Bacteria 540
2532 nmdc:mga05p37_1121930_c1 3300050507 Bacteria 821
2533 nmdc:mga05p37_1667_c1 3300050507 Bacteria 25807
2534 nmdc:mga05p37_219146_c1 3300050507 Bacteria 2297
2535 nmdc:mga05p37_561405_c1 3300050507 Bacteria 1297
2536 nmdc:mga05p37_914730_c1 3300050507 Bacteria 944
2537 nmdc:mga09592_1054_c1 3300050508 Bacteria 21854
2538 nmdc:mga09592_116100_c1 3300050508 Bacteria 2297
2539 nmdc:mga0qj67_514567_c1 3300050509 Bacteria 962
2540 nmdc:mga0qj67_722529_c1 3300050509 Bacteria 791
2541 nmdc:mga06r32_115722_c1 3300050510 Bacteria 2641
2542 nmdc:mga06r32_1630396_c1 3300050510 Bacteria 583
2543 nmdc:mga06r32_469093_c1 3300050510 Bacteria 1237
2544 nmdc:mga06r32_545809_c1 3300050510 Bacteria 1133
2545 nmdc:mga06r32_819457_c1 3300050510 Bacteria 890
2546 nmdc:mga08y16_1088953_c1 3300050511 Bacteria 775
2547 nmdc:mga08y16_1646796_c1 3300050511 Bacteria 598
2548 nmdc:mga08y16_1684428_c1 3300050511 Bacteria 590
2549 nmdc:mga08y16_188292_c1 3300050511 Bacteria 2141
2550 nmdc:mga08y16_62381_c1 3300050511 Bacteria 3893
2551 nmdc:mga0n895_1514874_c1 3300050512 Bacteria 637
2552 nmdc:mga0n895_20653_c1 3300050512 Bacteria 6147
2553 nmdc:mga0n895_298647_c1 3300050512 Bacteria 1633
2554 nmdc:mga0n895_312021_c1 3300050512 Bacteria 1594
2555 nmdc:mga0n895_497055_c1 3300050512 Bacteria 1229
2556 nmdc:mga0n895_87081_c1 3300050512 Bacteria 3120
2557 nmdc:mga0n895_912325_c1 3300050512 Bacteria 863
2558 nmdc:mga0rr50_1104355_c1 3300050513 Bacteria 675
2559 nmdc:mga0rr50_223029_c1 3300050513 Bacteria 1557
2560 nmdc:mga0rr50_393592_c1 3300050513 Bacteria 1170
2561 nmdc:mga0rr50_90742_c1 3300050513 Bacteria 2378
2562 nmdc:mga0rr50_960522_c1 3300050513 Bacteria 728
2563 nmdc:mga0rr50_991159_c1 3300050513 Bacteria 716
2564 nmdc:mga08x19_1172376_c1 3300050514 Bacteria 545
2565 nmdc:mga08x19_156563_c1 3300050514 Bacteria 1545
2566 nmdc:mga08x19_17024_c2 3300050514 Bacteria 2596
2567 nmdc:mga08x19_297230_c1 3300050514 Bacteria 1121
2568 nmdc:mga0a205_1054899_c1 3300050515 Bacteria 660
2569 nmdc:mga0a205_144832_c1 3300050515 Bacteria 2276
2570 nmdc:mga0a205_1585761_c1 3300050515 Bacteria 503
2571 nmdc:mga0a205_202_c1 3300050515 Bacteria 41638
2572 nmdc:mga0a205_251578_c1 3300050515 Bacteria 1646
2573 Ga0495601_0160947 3300053077 Bacteria 1467
2574 Ga0495601_0606801 3300053077 Unclassified 702
2575 Ga0495595_0508199 3300053084 Bacteria 614
2576 Ga0495595_0697914 3300053084 Bacteria 520
2577 Ga0495619_0042231 3300053085 Bacteria 2985
2578 Ga0495619_0079770 3300053085 Bacteria 2202
2579 Ga0495619_0191658 3300053085 Bacteria 1415
2580 Ga0495619_0718181 3300053085 Bacteria 679
2581 Ga0500651_0000033 3300053093 Bacteria 108567
2582 Ga0500618_003380 3300053125 Bacteria 5500
2583 Ga0500655_102429 3300053133 Bacteria 601
2584 Ga0500568_0294028 3300053139 Bacteria 590
2585 Ga0501084_0001772 3300054114 Bacteria 17179
2586 Ga0501084_0030490 3300054114 Bacteria 4509
2587 Ga0501084_0066368 3300054114 Bacteria 3019
2588 Ga0501084_0178067 3300054114 Bacteria 1795
2589 Ga0501084_0596411 3300054114 Bacteria 933
2590 Ga0501084_0876072 3300054114 Bacteria 755
2591 Ga0501084_0950323 3300054114 Bacteria 723
2592 Ga0501084_1242060 3300054114 Bacteria 625
2593 Ga0501084_1391769 3300054114 Bacteria 588
2594 Ga0590077_118185 3300059426 Bacteria 626
2595 Ga0587084_011754 3300059477 Bacteria 1172
2596 Ga0587082_133245 3300059504 Bacteria 573
2597 Ga0587088_146522 3300059508 Bacteria 568
2598 Ga0587090_084556 3300059510 Bacteria 641
2599 Ga0587094_034035 3300059513 Bacteria 803
2600 Ga0587094_113420 3300059513 Bacteria 536
2601 Ga0587101_104744 3300059623 Bacteria 567
2602 Ga0587109_198398 3300059624 Bacteria 521
2603 Ga0587068_115413 3300059641 Bacteria 578
2604 Ga0587075_106534 3300059644 Bacteria 566
2605 Ga0587100_020608 3300059648 Bacteria 641
2606 Ga0587071_047986 3300060344 Bacteria 875
2607 Ga0587071_220570 3300060344 Bacteria 504
2608 Ga0587111_0210261 3300060346 Bacteria 556
2609 Ga0501082_0003622 3300060353 Bacteria 13491
2610 Ga0501082_0004013 3300060353 Bacteria 12844
2611 Ga0501082_0006976 3300060353 Bacteria 9754
2612 Ga0501082_0038853 3300060353 Bacteria 4106
2613 Ga0501082_0289095 3300060353 Bacteria 1427
2614 Ga0501082_0489497 3300060353 Bacteria 1075
2615 Ga0501082_0818103 3300060353 Bacteria 815
2616 Ga0501082_0844112 3300060353 Bacteria 801
2617 Ga0501082_1484331 3300060353 Bacteria 592
2618 Ga0501082_1499301 3300060353 Bacteria 589
2619 Ga0466962_0001388 3300061719 Bacteria 11248
2620 Ga0466962_0014487 3300061719 Bacteria 3800
2621 Ga0530510_0001699 3300061734 Bacteria 14937
2622 Ga0530510_0056587 3300061734 Bacteria 2833
2623 Ga0530510_0108288 3300061734 Bacteria 2034
2624 Ga0530510_0169051 3300061734 Bacteria 1619
2625 Ga0530510_0559543 3300061734 Bacteria 869
2626 Ga0530510_1586865 3300061734 Bacteria 503

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0218970 Ga0451576_0218970_709_951 77
2 3300000545 CNXas_1003874 CNXas_10038742 78
3 3300001990 JGI24737J22298_10109123 JGI24737J22298_101091231 78
4 3300002704 JGI25155J39150_1003762 JGI25155J39150_10037622 78
5 3300002737 JGI25162J39368_1000421 JGI25162J39368_100042134 78
6 3300002737 JGI25162J39368_1000838 JGI25162J39368_100083822 78
7 3300002738 JGI25154J39366_1008743 JGI25154J39366_10087432 78
8 3300002772 JGI25164J39214_1000296 JGI25164J39214_10002961 78
9 3300002772 JGI25164J39214_1000469 JGI25164J39214_100046922 78
10 3300003214 JGI25165J46597_1000528 JGI25165J46597_10005281 78
11 3300003214 JGI25165J46597_1000864 JGI25165J46597_100086422 78
12 3300003323 rootH1_10001154 rootH1_100011544 78
13 3300003578 Ga0006562J51391_1007541 Ga0006562J51391_10075414 78
14 3300003751 Ga0055538_1000132 Ga0055538_100013222 78
15 3300003752 Ga0055539_1000177 Ga0055539_100017722 78
16 3300003756 Ga0055533_1000179 Ga0055533_100017922 78
17 3300003758 Ga0055532_1000179 Ga0055532_100017935 78
18 3300003759 Ga0055525_1000408 Ga0055525_100040822 78
19 3300003759 Ga0055525_1024844 Ga0055525_10248441 78
20 3300003761 Ga0055535_1013117 Ga0055535_10131172 78
21 3300003781 Ga0055536_1051384 Ga0055536_10513841 78
22 3300003784 Ga0055534_1010263 Ga0055534_10102633 78
23 3300003791 Ga0055530_10009995 Ga0055530_100099954 78
24 3300003791 Ga0055530_10031820 Ga0055530_100318202 78
25 3300003791 Ga0055530_10039789 Ga0055530_100397892 78
26 3300003792 Ga0055540_1008846 Ga0055540_10088464 78
27 3300003792 Ga0055540_1020453 Ga0055540_10204532 78
28 3300003792 Ga0055540_1064017 Ga0055540_10640172 78
29 3300003794 Ga0055531_10000202 Ga0055531_1000020233 78
30 3300003841 Ga0055541_1000118 Ga0055541_100011822 78
31 3300003856 Ga0058692_1031368 Ga0058692_10313682 78
32 3300003856 Ga0058692_1037808 Ga0058692_10378082 78
33 3300004798 Ga0058859_10136142 Ga0058859_101361421 78
34 3300004798 Ga0058859_11191534 Ga0058859_111915342 78
35 3300004801 Ga0058860_10182615 Ga0058860_101826152 78
36 3300004801 Ga0058860_11694978 Ga0058860_116949782 78
37 3300004801 Ga0058860_12101958 Ga0058860_121019582 78
38 3300005288 Ga0065714_10000004 Ga0065714_1000000420 78
39 3300005288 Ga0065714_10005795 Ga0065714_100057953 78
40 3300005288 Ga0065714_10006013 Ga0065714_100060132 78
41 3300005288 Ga0065714_10015583 Ga0065714_100155834 78
42 3300005288 Ga0065714_10041234 Ga0065714_100412342 78
43 3300005288 Ga0065714_10042434 Ga0065714_100424341 78
44 3300005288 Ga0065714_10107805 Ga0065714_101078052 78
45 3300005289 Ga0065704_10003789 Ga0065704_100037895 78
46 3300005289 Ga0065704_10073698 Ga0065704_100736987 78
47 3300005289 Ga0065704_10145484 Ga0065704_101454842 78
48 3300005290 Ga0065712_10070345 Ga0065712_100703458 78
49 3300005290 Ga0065712_10072035 Ga0065712_100720353 78
50 3300005290 Ga0065712_10072573 Ga0065712_100725735 78
51 3300005293 Ga0065715_10002678 Ga0065715_100026784 78
52 3300005293 Ga0065715_10030549 Ga0065715_100305492 78
53 3300005328 Ga0070676_10201048 Ga0070676_102010482 78
54 3300005329 Ga0070683_101093956 Ga0070683_1010939562 78
55 3300005329 Ga0070683_101631398 Ga0070683_1016313982 78
56 3300005330 Ga0070690_100000845 Ga0070690_10000084514 78
57 3300005330 Ga0070690_101095985 Ga0070690_1010959851 78
58 3300005331 Ga0070670_100000001 Ga0070670_100000001539 78
59 3300005333 Ga0070677_10591228 Ga0070677_105912281 78
60 3300005334 Ga0068869_100002558 Ga0068869_1000025589 78
61 3300005335 Ga0070666_10251484 Ga0070666_102514842 78
62 3300005335 Ga0070666_11444858 Ga0070666_114448581 78
63 3300005336 Ga0070680_100084970 Ga0070680_1000849703 78
64 3300005337 Ga0070682_100171240 Ga0070682_1001712402 78
65 3300005337 Ga0070682_100636347 Ga0070682_1006363472 78
66 3300005339 Ga0070660_100242951 Ga0070660_1002429512 78
67 3300005339 Ga0070660_100530134 Ga0070660_1005301341 78
68 3300005339 Ga0070660_101067228 Ga0070660_1010672281 78
69 3300005340 Ga0070689_100004467 Ga0070689_1000044675 78
70 3300005341 Ga0070691_10019667 Ga0070691_100196672 78
71 3300005341 Ga0070691_10925964 Ga0070691_109259642 78
72 3300005343 Ga0070687_100046456 Ga0070687_1000464562 78
73 3300005344 Ga0070661_100000284 Ga0070661_10000028417 78
74 3300005345 Ga0070692_10153010 Ga0070692_101530102 78
75 3300005353 Ga0070669_100001202 Ga0070669_10000120221 78
76 3300005353 Ga0070669_100033214 Ga0070669_1000332142 78
77 3300005353 Ga0070669_100046626 Ga0070669_1000466262 78
78 3300005354 Ga0070675_101365696 Ga0070675_1013656961 78
79 3300005355 Ga0070671_100000018 Ga0070671_10000001897 78
80 3300005355 Ga0070671_100287844 Ga0070671_1002878442 78
81 3300005356 Ga0070674_100062460 Ga0070674_1000624604 78
82 3300005356 Ga0070674_100064838 Ga0070674_1000648383 78
83 3300005356 Ga0070674_100497999 Ga0070674_1004979991 78
84 3300005356 Ga0070674_101323381 Ga0070674_1013233812 78
85 3300005365 Ga0070688_100004521 Ga0070688_10000452112 78
86 3300005365 Ga0070688_100608497 Ga0070688_1006084972 78
87 3300005366 Ga0070659_100050662 Ga0070659_1000506623 78
88 3300005366 Ga0070659_100643486 Ga0070659_1006434862 78
89 3300005366 Ga0070659_101477557 Ga0070659_1014775572 78
90 3300005367 Ga0070667_100000026 Ga0070667_10000002675 78
91 3300005367 Ga0070667_102311859 Ga0070667_1023118591 78
92 3300005434 Ga0070709_11047061 Ga0070709_110470611 78
93 3300005435 Ga0070714_101438603 Ga0070714_1014386031 78
94 3300005437 Ga0070710_10259447 Ga0070710_102594472 78
95 3300005438 Ga0070701_10006734 Ga0070701_100067343 78
96 3300005438 Ga0070701_10183383 Ga0070701_101833832 78
97 3300005439 Ga0070711_101223704 Ga0070711_1012237042 78
98 3300005440 Ga0070705_100008967 Ga0070705_1000089671 78
99 3300005440 Ga0070705_100025145 Ga0070705_1000251452 78
100 3300005440 Ga0070705_100253221 Ga0070705_1002532212 78
101 3300005440 Ga0070705_100686666 Ga0070705_1006866661 78
102 3300005441 Ga0070700_100000846 Ga0070700_10000084616 78
103 3300005441 Ga0070700_100487967 Ga0070700_1004879672 78
104 3300005441 Ga0070700_100685019 Ga0070700_1006850192 78
105 3300005445 Ga0070708_100678764 Ga0070708_1006787642 78
106 3300005455 Ga0070663_100127002 Ga0070663_1001270022 78
107 3300005456 Ga0070678_100005814 Ga0070678_1000058142 78
108 3300005456 Ga0070678_100618884 Ga0070678_1006188841 78
109 3300005457 Ga0070662_100000804 Ga0070662_1000008045 78
110 3300005457 Ga0070662_100412036 Ga0070662_1004120361 78
111 3300005458 Ga0070681_10148230 Ga0070681_101482302 78
112 3300005459 Ga0068867_100057208 Ga0068867_1000572084 78
113 3300005459 Ga0068867_100994589 Ga0068867_1009945892 78
114 3300005466 Ga0070685_10000007 Ga0070685_10000007150 78
115 3300005466 Ga0070685_10945308 Ga0070685_109453081 78
116 3300005467 Ga0070706_100485702 Ga0070706_1004857022 78
117 3300005467 Ga0070706_101647794 Ga0070706_1016477941 78
118 3300005468 Ga0070707_100659670 Ga0070707_1006596702 78
119 3300005518 Ga0070699_100373778 Ga0070699_1003737782 78
120 3300005535 Ga0070684_100582364 Ga0070684_1005823642 78
121 3300005536 Ga0070697_101156875 Ga0070697_1011568752 78
122 3300005539 Ga0068853_100003812 Ga0068853_1000038124 78
123 3300005543 Ga0070672_101277114 Ga0070672_1012771142 78
124 3300005543 Ga0070672_101976422 Ga0070672_1019764221 78
125 3300005544 Ga0070686_100001455 Ga0070686_1000014555 78
126 3300005544 Ga0070686_100593233 Ga0070686_1005932331 78
127 3300005546 Ga0070696_100259113 Ga0070696_1002591132 78
128 3300005547 Ga0070693_100062893 Ga0070693_1000628932 78
129 3300005548 Ga0070665_100059181 Ga0070665_1000591814 78
130 3300005548 Ga0070665_100060998 Ga0070665_1000609982 78
131 3300005548 Ga0070665_100068997 Ga0070665_1000689974 78
132 3300005564 Ga0070664_100000681 Ga0070664_1000006816 78
133 3300005577 Ga0068857_100182083 Ga0068857_1001820831 78
134 3300005577 Ga0068857_100593128 Ga0068857_1005931281 78
135 3300005578 Ga0068854_100023043 Ga0068854_1000230432 78
136 3300005615 Ga0070702_100001220 Ga0070702_10000122014 78
137 3300005615 Ga0070702_100992693 Ga0070702_1009926932 78
138 3300005615 Ga0070702_101384339 Ga0070702_1013843392 78
139 3300005617 Ga0068859_100007107 Ga0068859_10000710712 78
140 3300005617 Ga0068859_100007685 Ga0068859_1000076858 78
141 3300005618 Ga0068864_100000012 Ga0068864_100000012181 78
142 3300005718 Ga0068866_10000235 Ga0068866_1000023523 78
143 3300005718 Ga0068866_10587585 Ga0068866_105875852 78
144 3300005719 Ga0068861_100005305 Ga0068861_1000053051 78
145 3300005834 Ga0068851_10000011 Ga0068851_1000001188 78
146 3300005840 Ga0068870_10005533 Ga0068870_100055335 78
147 3300005840 Ga0068870_10935000 Ga0068870_109350002 78
148 3300005841 Ga0068863_101450172 Ga0068863_1014501722 78
149 3300005842 Ga0068858_100002549 Ga0068858_10000254914 78
150 3300005842 Ga0068858_100016226 Ga0068858_1000162262 78
151 3300005843 Ga0068860_100007832 Ga0068860_1000078324 78
152 3300005843 Ga0068860_100009873 Ga0068860_1000098732 78
153 3300005844 Ga0068862_100001146 Ga0068862_1000011469 78
154 3300005844 Ga0068862_100005397 Ga0068862_10000539710 78
155 3300005985 Ga0081539_10066750 Ga0081539_100667503 78
156 3300006028 Ga0070717_10786296 Ga0070717_107862961 78
157 3300006048 Ga0075363_100179351 Ga0075363_1001793512 78
158 3300006051 Ga0075364_10239449 Ga0075364_102394492 78
159 3300006051 Ga0075364_11248042 Ga0075364_112480422 78
160 3300006058 Ga0075432_10057718 Ga0075432_100577182 78
161 3300006058 Ga0075432_10256911 Ga0075432_102569112 78
162 3300006178 Ga0075367_10332651 Ga0075367_103326512 78
163 3300006194 Ga0075427_10022764 Ga0075427_100227642 78
164 3300006237 Ga0097621_100004386 Ga0097621_1000043863 78
165 3300006353 Ga0075370_10150592 Ga0075370_101505922 78
166 3300006353 Ga0075370_10347844 Ga0075370_103478441 78
167 3300006358 Ga0068871_100034082 Ga0068871_1000340825 78
168 3300006881 Ga0068865_100000229 Ga0068865_10000022918 78
169 3300006914 Ga0075436_100191148 Ga0075436_1001911483 78
170 3300006931 Ga0097620_100007107 Ga0097620_10000710712 78
171 3300006931 Ga0097620_100007685 Ga0097620_1000076858 78
172 3300006944 Ga0099823_1116370 Ga0099823_11163702 78
173 3300006946 Ga0079104_1000094 Ga0079104_1000094128 78
174 3300006946 Ga0079104_1000668 Ga0079104_100066830 78
175 3300006946 Ga0079104_1045206 Ga0079104_10452062 78
176 3300006946 Ga0079104_1053778 Ga0079104_10537781 78
177 3300006948 Ga0099826_10002085 Ga0099826_1000208512 78
178 3300009011 Ga0105251_10000971 Ga0105251_100009715 78
179 3300009011 Ga0105251_10001972 Ga0105251_100019725 78
180 3300009011 Ga0105251_10006731 Ga0105251_100067315 78
181 3300009011 Ga0105251_10013473 Ga0105251_100134732 78
182 3300009011 Ga0105251_10046780 Ga0105251_100467802 78
183 3300009011 Ga0105251_10139341 Ga0105251_101393412 78
184 3300009036 Ga0105244_10000709 Ga0105244_1000070928 78
185 3300009036 Ga0105244_10004356 Ga0105244_1000435612 78
186 3300009036 Ga0105244_10012445 Ga0105244_100124454 78
187 3300009036 Ga0105244_10015536 Ga0105244_100155364 78
188 3300009036 Ga0105244_10018084 Ga0105244_100180843 78
189 3300009036 Ga0105244_10084870 Ga0105244_100848701 78
190 3300009092 Ga0105250_10000074 Ga0105250_100000745 78
191 3300009092 Ga0105250_10000735 Ga0105250_100007354 78
192 3300009092 Ga0105250_10002613 Ga0105250_100026135 78
193 3300009092 Ga0105250_10210898 Ga0105250_102108981 78
194 3300009092 Ga0105250_10582979 Ga0105250_105829792 78
195 3300009093 Ga0105240_10559914 Ga0105240_105599141 78
196 3300009093 Ga0105240_11845258 Ga0105240_118452581 78
197 3300009094 Ga0111539_10006530 Ga0111539_1000653011 78
198 3300009094 Ga0111539_10090059 Ga0111539_100900592 78
199 3300009094 Ga0111539_11304946 Ga0111539_113049462 78
200 3300009098 Ga0105245_10000613 Ga0105245_1000061325 78
201 3300009098 Ga0105245_10497202 Ga0105245_104972022 78
202 3300009098 Ga0105245_11184682 Ga0105245_111846821 78
203 3300009098 Ga0105245_11892350 Ga0105245_118923502 78
204 3300009101 Ga0105247_10143465 Ga0105247_101434652 78
205 3300009101 Ga0105247_10655229 Ga0105247_106552292 78
206 3300009148 Ga0105243_10031266 Ga0105243_100312661 78
207 3300009148 Ga0105243_10041863 Ga0105243_100418632 78
208 3300009148 Ga0105243_10041987 Ga0105243_100419871 78
209 3300009148 Ga0105243_10216549 Ga0105243_102165492 78
210 3300009148 Ga0105243_10463700 Ga0105243_104637002 78
211 3300009176 Ga0105242_10000626 Ga0105242_100006264 78
212 3300009176 Ga0105242_10151814 Ga0105242_101518143 78
213 3300009176 Ga0105242_10362854 Ga0105242_103628542 78
214 3300009177 Ga0105248_10031772 Ga0105248_100317725 78
215 3300009177 Ga0105248_10232336 Ga0105248_102323362 78
216 3300009545 Ga0105237_10001599 Ga0105237_1000159910 78
217 3300009545 Ga0105237_10442844 Ga0105237_104428442 78
218 3300009551 Ga0105238_11462956 Ga0105238_114629561 78
219 3300009553 Ga0105249_10393878 Ga0105249_103938782 78
220 3300010375 Ga0105239_10612593 Ga0105239_106125932 78
221 3300010375 Ga0105239_13177965 Ga0105239_131779651 78
222 3300011119 Ga0105246_10055618 Ga0105246_100556182 78
223 3300011119 Ga0105246_10241323 Ga0105246_102413232 78
224 3300011119 Ga0105246_10274187 Ga0105246_102741872 78
225 3300013100 Ga0157373_10003636 Ga0157373_100036364 78
226 3300013100 Ga0157373_10045928 Ga0157373_100459283 78
227 3300013100 Ga0157373_10062383 Ga0157373_100623832 78
228 3300013100 Ga0157373_10080067 Ga0157373_100800672 78
229 3300013100 Ga0157373_10333312 Ga0157373_103333122 78
230 3300013100 Ga0157373_10784312 Ga0157373_107843122 78
231 3300013102 Ga0157371_10000406 Ga0157371_100004064 78
232 3300013102 Ga0157371_10019628 Ga0157371_100196284 78
233 3300013102 Ga0157371_10132405 Ga0157371_101324052 78
234 3300013102 Ga0157371_10205575 Ga0157371_102055752 78
235 3300013102 Ga0157371_10300863 Ga0157371_103008632 78
236 3300013104 Ga0157370_10041180 Ga0157370_100411802 78
237 3300013104 Ga0157370_10371985 Ga0157370_103719852 78
238 3300013104 Ga0157370_10437593 Ga0157370_104375932 78
239 3300013105 Ga0157369_10002062 Ga0157369_100020628 78
240 3300013105 Ga0157369_11651218 Ga0157369_116512182 78
241 3300013296 Ga0157374_11271619 Ga0157374_112716191 78
242 3300013297 Ga0157378_10332441 Ga0157378_103324412 78
243 3300013306 Ga0163162_10108533 Ga0163162_101085332 78
244 3300013306 Ga0163162_10168141 Ga0163162_101681413 78
245 3300013307 Ga0157372_10006569 Ga0157372_100065697 78
246 3300013307 Ga0157372_10038617 Ga0157372_100386176 78
247 3300013307 Ga0157372_10105161 Ga0157372_101051613 78
248 3300013307 Ga0157372_10413294 Ga0157372_104132942 78
249 3300013307 Ga0157372_10423246 Ga0157372_104232462 78
250 3300013308 Ga0157375_10507672 Ga0157375_105076722 78
251 3300014325 Ga0163163_10000051 Ga0163163_1000005158 78
252 3300014326 Ga0157380_10001394 Ga0157380_100013947 78
253 3300014326 Ga0157380_10358089 Ga0157380_103580892 78
254 3300014497 Ga0182008_10058956 Ga0182008_100589562 78
255 3300014968 Ga0157379_10259801 Ga0157379_102598012 78
256 3300014969 Ga0157376_10702870 Ga0157376_107028702 78
257 3300015261 Ga0182006_1006695 Ga0182006_10066956 78
258 3300015261 Ga0182006_1065653 Ga0182006_10656533 78
259 3300015265 Ga0182005_1006082 Ga0182005_10060823 78
260 3300020070 Ga0206356_10331770 Ga0206356_103317702 78
261 3300020070 Ga0206356_10371893 Ga0206356_103718932 78
262 3300020078 Ga0206352_10068392 Ga0206352_100683922 78
263 3300025898 Ga0207692_10302739 Ga0207692_103027392 78
264 3300025906 Ga0207699_10595859 Ga0207699_105958592 78
265 3300025912 Ga0207707_10120773 Ga0207707_101207733 78
266 3300025921 Ga0207652_10194853 Ga0207652_101948532 78
267 3300025944 Ga0207661_11566686 Ga0207661_115666862 78
268 3300026023 Ga0207677_10804934 Ga0207677_108049342 78
269 3300026075 Ga0207708_10711457 Ga0207708_107114571 78
270 3300028666 Ga0265336_10089047 Ga0265336_100890471 78
271 3300028800 Ga0265338_10011793 Ga0265338_100117937 78
272 3300028800 Ga0265338_10106077 Ga0265338_101060772 78
273 3300029957 Ga0265324_10044125 Ga0265324_100441252 78
274 3300031238 Ga0265332_10121476 Ga0265332_101214762 78
275 3300031239 Ga0265328_10025812 Ga0265328_100258122 78
276 3300031240 Ga0265320_10004773 Ga0265320_100047736 78
277 3300031240 Ga0265320_10009198 Ga0265320_100091985 78
278 3300031242 Ga0265329_10225441 Ga0265329_102254411 78
279 3300031249 Ga0265339_10017148 Ga0265339_100171485 78
280 3300031249 Ga0265339_10034965 Ga0265339_100349652 78
281 3300031250 Ga0265331_10164616 Ga0265331_101646162 78
282 3300031251 Ga0265327_10241250 Ga0265327_102412502 78
283 3300031711 Ga0265314_10005310 Ga0265314_100053106 78
284 3300031711 Ga0265314_10110497 Ga0265314_101104972 78
285 3300031712 Ga0265342_10000388 Ga0265342_1000038825 78
286 3300031712 Ga0265342_10003302 Ga0265342_1000330215 78
287 3300035086 Ga0373934_0068218 Ga0373934_0068218_1104_1343 78
288 3300035111 Ga0373923_0187144 Ga0373923_0187144_332_571 78
289 3300035117 Ga0373953_0010602 Ga0373953_0010602_1377_1616 78
290 3300035118 Ga0373954_0017066 Ga0373954_0017066_2710_2949 78
291 3300035118 Ga0373954_0069665 Ga0373954_0069665_91_330 78
292 3300035119 Ga0373956_0014211 Ga0373956_0014211_153_392 78
293 3300035120 Ga0373957_0016400 Ga0373957_0016400_637_876 78
294 3300035172 Ga0373955_0004393 Ga0373955_0004393_3538_3777 78
295 3300035695 Ga0373927_0178138 Ga0373927_0178138_850_1089 78
296 3300035724 Ga0373933_0115325 Ga0373933_0115325_818_1057 78
297 3300035725 Ga0373947_0139431 Ga0373947_0139431_512_751 78
298 3300035725 Ga0373947_0354075 Ga0373947_0354075_163_402 78
299 3300036401 Ga0373937_0003896 Ga0373937_0003896_10754_10993 78
300 3300036401 Ga0373937_0086813 Ga0373937_0086813_406_645 78
301 3300036401 Ga0373937_0191982 Ga0373937_0191982_610_849 78
302 3300037068 Ga0373925_0229534 Ga0373925_0229534_891_1130 78
303 3300037068 Ga0373925_0264278 Ga0373925_0264278_177_416 78
304 3300039437 Ga0436365_0815767 Ga0436365_0815767_33_272 78
305 3300045976 Ga0466967_1009176 Ga0466967_1009176_308_550 78
306 3300046455 Ga0495603_0121471 Ga0495603_0121471_336_575 78
307 3300046461 Ga0495641_0081701 Ga0495641_0081701_1192_1431 78
308 3300046462 Ga0495651_0283250 Ga0495651_0283250_328_567 78
309 3300046463 Ga0495653_0380373 Ga0495653_0380373_415_654 78
310 3300046475 Ga0495639_0685960 Ga0495639_0685960_142_381 78
311 3300046535 Ga0495586_0198890 Ga0495586_0198890_42_281 78
312 3300046689 Ga0495613_0841468 Ga0495613_0841468_182_421 78
313 3300046690 Ga0495624_0755443 Ga0495624_0755443_174_413 78
314 3300046809 Ga0495600_0683603 Ga0495600_0683603_185_424 78
315 3300047319 Ga0495674_0636629 Ga0495674_0636629_436_675 78
316 3300047322 Ga0495680_0160640 Ga0495680_0160640_22_261 78
317 3300048903 Ga0496100_1245386 Ga0496100_1245386_202_441 78
318 3300053077 Ga0495601_0606801 Ga0495601_0606801_18_257 78
319 3300053085 Ga0495619_0191658 Ga0495619_0191658_634_873 78
320 3300053133 Ga0500655_102429 Ga0500655_102429_333_572 78
321 2162886007 SwRhRL2b_contig_273445 SwRhRL2b_0336.00007400 79
322 3300001904 JGI24736J21556_1008732 JGI24736J21556_10087322 79
323 3300001904 JGI24736J21556_1008750 JGI24736J21556_10087502 79
324 3300001904 JGI24736J21556_1027135 JGI24736J21556_10271352 79
325 3300001904 JGI24736J21556_1048089 JGI24736J21556_10480891 79
326 3300001904 JGI24736J21556_1068861 JGI24736J21556_10688611 79
327 3300001915 JGI24741J21665_1023111 JGI24741J21665_10231112 79
328 3300001979 JGI24740J21852_10001390 JGI24740J21852_100013902 79
329 3300001979 JGI24740J21852_10009438 JGI24740J21852_100094383 79
330 3300001979 JGI24740J21852_10052370 JGI24740J21852_100523702 79
331 3300001979 JGI24740J21852_10055297 JGI24740J21852_100552972 79
332 3300001989 JGI24739J22299_10005226 JGI24739J22299_100052265 79
333 3300001989 JGI24739J22299_10006633 JGI24739J22299_100066333 79
334 3300001989 JGI24739J22299_10112690 JGI24739J22299_101126902 79
335 3300001990 JGI24737J22298_10022717 JGI24737J22298_100227172 79
336 3300001990 JGI24737J22298_10033479 JGI24737J22298_100334792 79
337 3300001990 JGI24737J22298_10037502 JGI24737J22298_100375022 79
338 3300001990 JGI24737J22298_10045213 JGI24737J22298_100452132 79
339 3300001990 JGI24737J22298_10174615 JGI24737J22298_101746152 79
340 3300002067 JGI24735J21928_10000381 JGI24735J21928_100003815 79
341 3300002067 JGI24735J21928_10001883 JGI24735J21928_100018837 79
342 3300002067 JGI24735J21928_10017084 JGI24735J21928_100170843 79
343 3300002067 JGI24735J21928_10108905 JGI24735J21928_101089052 79
344 3300002075 JGI24738J21930_10002235 JGI24738J21930_100022356 79
345 3300002075 JGI24738J21930_10008280 JGI24738J21930_100082802 79
346 3300002075 JGI24738J21930_10038196 JGI24738J21930_100381961 79
347 3300002075 JGI24738J21930_10079152 JGI24738J21930_100791522 79
348 3300002077 JGI24744J21845_10013036 JGI24744J21845_100130362 79
349 3300002704 JGI25155J39150_1002623 JGI25155J39150_10026232 79
350 3300002705 JGI25156J39149_1026132 JGI25156J39149_10261321 79
351 3300002987 JGI25159J45721_1059119 JGI25159J45721_10591191 79
352 3300003162 Ga0006778J45830_1052111 Ga0006778J45830_10521111 79
353 3300003163 Ga0006759J45824_1040412 Ga0006759J45824_10404121 79
354 3300003214 JGI25165J46597_1001399 JGI25165J46597_10013992 79
355 3300003300 Ga0006758J48902_1017231 Ga0006758J48902_10172312 79
356 3300003316 rootH1_10044428 rootH1_100444282 79
357 3300003316 rootH1_10051621 rootH1_100516212 79
358 3300003316 rootH1_10088632 rootH1_100886321 79
359 3300003320 rootH2_10006179 rootH2_100061792 79
360 3300003322 rootL2_10014064 rootL2_100140642 79
361 3300003322 rootL2_10034245 rootL2_100342453 79
362 3300003354 JGI25160J50197_1000082 JGI25160J50197_100008238 79
363 3300003354 JGI25160J50197_1068501 JGI25160J50197_10685011 79
364 3300003371 JGI26145J50221_1036787 JGI26145J50221_10367871 79
365 3300003392 JGI26134J50242_102241 JGI26134J50242_1022412 79
366 3300003392 JGI26134J50242_103281 JGI26134J50242_1032811 79
367 3300003479 Ga0006556J51387_1016257 Ga0006556J51387_10162571 79
368 3300003503 JGI26141J51220_1003644 JGI26141J51220_10036442 79
369 3300003565 Ga0006560J51390_1020763 Ga0006560J51390_10207631 79
370 3300003567 Ga0006554J51385_1020175 Ga0006554J51385_10201752 79
371 3300003575 Ga0007409J51694_1032027 Ga0007409J51694_10320271 79
372 3300003577 Ga0007416J51690_1028031 Ga0007416J51690_10280312 79
373 3300003577 Ga0007416J51690_1064754 Ga0007416J51690_10647541 79
374 3300003579 Ga0007429J51699_1029561 Ga0007429J51699_10295611 79
375 3300003693 Ga0032354_1045397 Ga0032354_10453971 79
376 3300003693 Ga0032354_1100187 Ga0032354_11001871 79
377 3300003758 Ga0055532_1000039 Ga0055532_100003969 79
378 3300003758 Ga0055532_1004007 Ga0055532_10040071 79
379 3300003758 Ga0055532_1018235 Ga0055532_10182352 79
380 3300003760 Ga0055527_1000024 Ga0055527_100002469 79
381 3300003760 Ga0055527_1003207 Ga0055527_10032074 79
382 3300003760 Ga0055527_1003454 Ga0055527_10034541 79
383 3300003760 Ga0055527_1014914 Ga0055527_10149142 79
384 3300003761 Ga0055535_1000028 Ga0055535_100002869 79
385 3300003761 Ga0055535_1006537 Ga0055535_10065371 79
386 3300003761 Ga0055535_1006554 Ga0055535_10065541 79
387 3300003762 Ga0055542_1000047 Ga0055542_1000047117 79
388 3300003762 Ga0055542_1006501 Ga0055542_10065014 79
389 3300003762 Ga0055542_1006975 Ga0055542_10069751 79
390 3300003763 Ga0055529_1000054 Ga0055529_100005469 79
391 3300003763 Ga0055529_1001396 Ga0055529_10013961 79
392 3300003763 Ga0055529_1022325 Ga0055529_10223252 79
393 3300003771 Ga0055526_1064659 Ga0055526_10646591 79
394 3300003790 Ga0055528_1007004 Ga0055528_10070042 79
395 3300003856 Ga0058692_1007956 Ga0058692_10079562 79
396 3300003856 Ga0058692_1025693 Ga0058692_10256932 79
397 3300004803 Ga0058862_11997135 Ga0058862_119971351 79
398 3300005262 Ga0065165_1000250 Ga0065165_100025058 79
399 3300005289 Ga0065704_10112931 Ga0065704_101129312 79
400 3300005289 Ga0065704_10742395 Ga0065704_107423951 79
401 3300005290 Ga0065712_10048438 Ga0065712_100484381 79
402 3300005290 Ga0065712_10687916 Ga0065712_106879162 79
403 3300005290 Ga0065712_10831305 Ga0065712_108313051 79
404 3300005293 Ga0065715_10731495 Ga0065715_107314952 79
405 3300005293 Ga0065715_10786776 Ga0065715_107867761 79
406 3300005295 Ga0065707_10057673 Ga0065707_100576731 79
407 3300005295 Ga0065707_10220907 Ga0065707_102209072 79
408 3300005295 Ga0065707_10244207 Ga0065707_102442072 79
409 3300005295 Ga0065707_10525673 Ga0065707_105256731 79
410 3300005327 Ga0070658_10004301 Ga0070658_100043012 79
411 3300005327 Ga0070658_10072517 Ga0070658_100725172 79
412 3300005327 Ga0070658_10172797 Ga0070658_101727971 79
413 3300005327 Ga0070658_10194613 Ga0070658_101946132 79
414 3300005327 Ga0070658_10390848 Ga0070658_103908482 79
415 3300005327 Ga0070658_10946156 Ga0070658_109461562 79
416 3300005328 Ga0070676_10003110 Ga0070676_100031102 79
417 3300005328 Ga0070676_10043387 Ga0070676_100433873 79
418 3300005328 Ga0070676_10130630 Ga0070676_101306302 79
419 3300005328 Ga0070676_10175265 Ga0070676_101752652 79
420 3300005328 Ga0070676_10219648 Ga0070676_102196481 79
421 3300005328 Ga0070676_10317248 Ga0070676_103172482 79
422 3300005328 Ga0070676_10722709 Ga0070676_107227092 79
423 3300005328 Ga0070676_10830689 Ga0070676_108306891 79
424 3300005328 Ga0070676_10943438 Ga0070676_109434382 79
425 3300005328 Ga0070676_11199167 Ga0070676_111991671 79
426 3300005328 Ga0070676_11234366 Ga0070676_112343662 79
427 3300005329 Ga0070683_100167270 Ga0070683_1001672702 79
428 3300005329 Ga0070683_100865984 Ga0070683_1008659842 79
429 3300005329 Ga0070683_100874142 Ga0070683_1008741422 79
430 3300005330 Ga0070690_100000663 Ga0070690_10000066318 79
431 3300005330 Ga0070690_100249147 Ga0070690_1002491472 79
432 3300005330 Ga0070690_100268769 Ga0070690_1002687691 79
433 3300005330 Ga0070690_100465779 Ga0070690_1004657792 79
434 3300005331 Ga0070670_100002410 Ga0070670_1000024104 79
435 3300005331 Ga0070670_100006838 Ga0070670_10000683811 79
436 3300005331 Ga0070670_100041721 Ga0070670_1000417214 79
437 3300005331 Ga0070670_100059281 Ga0070670_1000592811 79
438 3300005331 Ga0070670_100086484 Ga0070670_1000864841 79
439 3300005331 Ga0070670_100284018 Ga0070670_1002840181 79
440 3300005331 Ga0070670_100399774 Ga0070670_1003997742 79
441 3300005331 Ga0070670_101072797 Ga0070670_1010727971 79
442 3300005331 Ga0070670_101285754 Ga0070670_1012857542 79
443 3300005331 Ga0070670_101915101 Ga0070670_1019151011 79
444 3300005333 Ga0070677_10032322 Ga0070677_100323223 79
445 3300005333 Ga0070677_10033487 Ga0070677_100334872 79
446 3300005333 Ga0070677_10082795 Ga0070677_100827952 79
447 3300005333 Ga0070677_10095291 Ga0070677_100952912 79
448 3300005333 Ga0070677_10158466 Ga0070677_101584662 79
449 3300005334 Ga0068869_100002596 Ga0068869_1000025968 79
450 3300005334 Ga0068869_100004697 Ga0068869_1000046972 79
451 3300005334 Ga0068869_100080899 Ga0068869_1000808993 79
452 3300005334 Ga0068869_100223447 Ga0068869_1002234471 79
453 3300005334 Ga0068869_100334209 Ga0068869_1003342091 79
454 3300005334 Ga0068869_100335096 Ga0068869_1003350962 79
455 3300005334 Ga0068869_101095806 Ga0068869_1010958061 79
456 3300005335 Ga0070666_10000153 Ga0070666_1000015350 79
457 3300005335 Ga0070666_10011289 Ga0070666_100112893 79
458 3300005335 Ga0070666_10025933 Ga0070666_100259331 79
459 3300005335 Ga0070666_10033067 Ga0070666_100330672 79
460 3300005335 Ga0070666_10074739 Ga0070666_100747392 79
461 3300005335 Ga0070666_10333207 Ga0070666_103332072 79
462 3300005335 Ga0070666_10335290 Ga0070666_103352902 79
463 3300005335 Ga0070666_10352689 Ga0070666_103526892 79
464 3300005335 Ga0070666_10768007 Ga0070666_107680072 79
465 3300005335 Ga0070666_10827610 Ga0070666_108276102 79
466 3300005335 Ga0070666_10991826 Ga0070666_109918262 79
467 3300005335 Ga0070666_11018184 Ga0070666_110181842 79
468 3300005336 Ga0070680_100118645 Ga0070680_1001186452 79
469 3300005336 Ga0070680_100542534 Ga0070680_1005425341 79
470 3300005336 Ga0070680_101041890 Ga0070680_1010418902 79
471 3300005336 Ga0070680_101330230 Ga0070680_1013302302 79
472 3300005336 Ga0070680_101380600 Ga0070680_1013806001 79
473 3300005336 Ga0070680_101535876 Ga0070680_1015358762 79
474 3300005337 Ga0070682_100086733 Ga0070682_1000867331 79
475 3300005337 Ga0070682_100430860 Ga0070682_1004308601 79
476 3300005338 Ga0068868_100003318 Ga0068868_10000331812 79
477 3300005338 Ga0068868_100039496 Ga0068868_1000394962 79
478 3300005338 Ga0068868_100080408 Ga0068868_1000804083 79
479 3300005338 Ga0068868_100094582 Ga0068868_1000945822 79
480 3300005338 Ga0068868_100176319 Ga0068868_1001763192 79
481 3300005338 Ga0068868_100193350 Ga0068868_1001933502 79
482 3300005338 Ga0068868_100460407 Ga0068868_1004604072 79
483 3300005338 Ga0068868_100540979 Ga0068868_1005409792 79
484 3300005338 Ga0068868_102223048 Ga0068868_1022230481 79
485 3300005339 Ga0070660_100000010 Ga0070660_10000001020 79
486 3300005339 Ga0070660_100005265 Ga0070660_1000052658 79
487 3300005339 Ga0070660_100085383 Ga0070660_1000853832 79
488 3300005339 Ga0070660_100381820 Ga0070660_1003818202 79
489 3300005339 Ga0070660_100532633 Ga0070660_1005326332 79
490 3300005340 Ga0070689_100012313 Ga0070689_1000123135 79
491 3300005340 Ga0070689_100139895 Ga0070689_1001398952 79
492 3300005340 Ga0070689_100340066 Ga0070689_1003400662 79
493 3300005340 Ga0070689_100372544 Ga0070689_1003725442 79
494 3300005340 Ga0070689_101182275 Ga0070689_1011822752 79
495 3300005341 Ga0070691_10302674 Ga0070691_103026741 79
496 3300005341 Ga0070691_10413493 Ga0070691_104134932 79
497 3300005341 Ga0070691_11074400 Ga0070691_110744002 79
498 3300005343 Ga0070687_100248020 Ga0070687_1002480202 79
499 3300005343 Ga0070687_100393257 Ga0070687_1003932572 79
500 3300005344 Ga0070661_100001082 Ga0070661_1000010829 79
501 3300005344 Ga0070661_100017233 Ga0070661_1000172332 79
502 3300005344 Ga0070661_100205342 Ga0070661_1002053421 79
503 3300005344 Ga0070661_100292473 Ga0070661_1002924732 79
504 3300005344 Ga0070661_100490617 Ga0070661_1004906172 79
505 3300005344 Ga0070661_100527388 Ga0070661_1005273882 79
506 3300005344 Ga0070661_101174417 Ga0070661_1011744171 79
507 3300005345 Ga0070692_10079121 Ga0070692_100791213 79
508 3300005345 Ga0070692_10411109 Ga0070692_104111092 79
509 3300005345 Ga0070692_10621450 Ga0070692_106214502 79
510 3300005345 Ga0070692_11319007 Ga0070692_113190072 79
511 3300005347 Ga0070668_100010143 Ga0070668_1000101435 79
512 3300005347 Ga0070668_100018243 Ga0070668_1000182434 79
513 3300005347 Ga0070668_100074688 Ga0070668_1000746881 79
514 3300005347 Ga0070668_100136114 Ga0070668_1001361142 79
515 3300005347 Ga0070668_100194769 Ga0070668_1001947691 79
516 3300005347 Ga0070668_100211357 Ga0070668_1002113572 79
517 3300005347 Ga0070668_100224894 Ga0070668_1002248942 79
518 3300005347 Ga0070668_100422915 Ga0070668_1004229151 79
519 3300005347 Ga0070668_101557846 Ga0070668_1015578462 79
520 3300005353 Ga0070669_100009649 Ga0070669_1000096492 79
521 3300005353 Ga0070669_100040387 Ga0070669_1000403874 79
522 3300005353 Ga0070669_100382007 Ga0070669_1003820072 79
523 3300005353 Ga0070669_100448598 Ga0070669_1004485982 79
524 3300005353 Ga0070669_100456851 Ga0070669_1004568511 79
525 3300005353 Ga0070669_100468593 Ga0070669_1004685932 79
526 3300005353 Ga0070669_100545716 Ga0070669_1005457162 79
527 3300005353 Ga0070669_100812603 Ga0070669_1008126031 79
528 3300005354 Ga0070675_100005401 Ga0070675_1000054012 79
529 3300005354 Ga0070675_100007819 Ga0070675_1000078199 79
530 3300005354 Ga0070675_100038871 Ga0070675_1000388713 79
531 3300005354 Ga0070675_100051434 Ga0070675_1000514341 79
532 3300005354 Ga0070675_100130268 Ga0070675_1001302683 79
533 3300005354 Ga0070675_100278424 Ga0070675_1002784241 79
534 3300005354 Ga0070675_100776593 Ga0070675_1007765932 79
535 3300005354 Ga0070675_101813658 Ga0070675_1018136581 79
536 3300005355 Ga0070671_100009206 Ga0070671_1000092066 79
537 3300005355 Ga0070671_100030838 Ga0070671_1000308384 79
538 3300005355 Ga0070671_100035726 Ga0070671_1000357261 79
539 3300005355 Ga0070671_100107987 Ga0070671_1001079872 79
540 3300005355 Ga0070671_100152064 Ga0070671_1001520643 79
541 3300005355 Ga0070671_100409410 Ga0070671_1004094101 79
542 3300005355 Ga0070671_100418790 Ga0070671_1004187902 79
543 3300005355 Ga0070671_100429193 Ga0070671_1004291931 79
544 3300005355 Ga0070671_100454619 Ga0070671_1004546192 79
545 3300005355 Ga0070671_100943528 Ga0070671_1009435282 79
546 3300005355 Ga0070671_101048591 Ga0070671_1010485912 79
547 3300005355 Ga0070671_101169568 Ga0070671_1011695682 79
548 3300005356 Ga0070674_100003800 Ga0070674_1000038007 79
549 3300005356 Ga0070674_100071548 Ga0070674_1000715483 79
550 3300005356 Ga0070674_100131710 Ga0070674_1001317102 79
551 3300005356 Ga0070674_100248152 Ga0070674_1002481522 79
552 3300005356 Ga0070674_100470949 Ga0070674_1004709491 79
553 3300005356 Ga0070674_101053913 Ga0070674_1010539131 79
554 3300005356 Ga0070674_101308080 Ga0070674_1013080802 79
555 3300005356 Ga0070674_101379182 Ga0070674_1013791822 79
556 3300005364 Ga0070673_100003793 Ga0070673_10000379311 79
557 3300005364 Ga0070673_100010465 Ga0070673_1000104652 79
558 3300005364 Ga0070673_100028043 Ga0070673_1000280432 79
559 3300005364 Ga0070673_100085869 Ga0070673_1000858693 79
560 3300005364 Ga0070673_100095905 Ga0070673_1000959053 79
561 3300005364 Ga0070673_100523818 Ga0070673_1005238181 79
562 3300005364 Ga0070673_100882440 Ga0070673_1008824402 79
563 3300005365 Ga0070688_100004797 Ga0070688_1000047973 79
564 3300005365 Ga0070688_100439618 Ga0070688_1004396182 79
565 3300005365 Ga0070688_100520685 Ga0070688_1005206852 79
566 3300005365 Ga0070688_101120918 Ga0070688_1011209181 79
567 3300005366 Ga0070659_100000167 Ga0070659_10000016738 79
568 3300005366 Ga0070659_100052278 Ga0070659_1000522783 79
569 3300005366 Ga0070659_100245274 Ga0070659_1002452742 79
570 3300005366 Ga0070659_100280372 Ga0070659_1002803721 79
571 3300005366 Ga0070659_100688124 Ga0070659_1006881242 79
572 3300005366 Ga0070659_101549024 Ga0070659_1015490241 79
573 3300005367 Ga0070667_100006047 Ga0070667_1000060475 79
574 3300005367 Ga0070667_100020285 Ga0070667_1000202855 79
575 3300005367 Ga0070667_100025595 Ga0070667_1000255953 79
576 3300005367 Ga0070667_100045008 Ga0070667_1000450083 79
577 3300005367 Ga0070667_100053230 Ga0070667_1000532303 79
578 3300005367 Ga0070667_100127631 Ga0070667_1001276312 79
579 3300005367 Ga0070667_100249480 Ga0070667_1002494801 79
580 3300005367 Ga0070667_100309486 Ga0070667_1003094862 79
581 3300005367 Ga0070667_100403357 Ga0070667_1004033571 79
582 3300005367 Ga0070667_100478781 Ga0070667_1004787812 79
583 3300005367 Ga0070667_100497740 Ga0070667_1004977402 79
584 3300005367 Ga0070667_101102579 Ga0070667_1011025792 79
585 3300005406 Ga0070703_10040867 Ga0070703_100408672 79
586 3300005434 Ga0070709_10276176 Ga0070709_102761762 79
587 3300005434 Ga0070709_10663146 Ga0070709_106631461 79
588 3300005435 Ga0070714_100059415 Ga0070714_1000594153 79
589 3300005435 Ga0070714_100836799 Ga0070714_1008367992 79
590 3300005436 Ga0070713_100003384 Ga0070713_10000338413 79
591 3300005436 Ga0070713_100067752 Ga0070713_1000677522 79
592 3300005437 Ga0070710_10350085 Ga0070710_103500851 79
593 3300005437 Ga0070710_10402422 Ga0070710_104024221 79
594 3300005437 Ga0070710_11440565 Ga0070710_114405652 79
595 3300005438 Ga0070701_10155879 Ga0070701_101558792 79
596 3300005438 Ga0070701_11005360 Ga0070701_110053602 79
597 3300005439 Ga0070711_100043262 Ga0070711_1000432622 79
598 3300005439 Ga0070711_100228474 Ga0070711_1002284742 79
599 3300005439 Ga0070711_100597739 Ga0070711_1005977392 79
600 3300005439 Ga0070711_100619366 Ga0070711_1006193661 79
601 3300005440 Ga0070705_100249622 Ga0070705_1002496222 79
602 3300005440 Ga0070705_100617533 Ga0070705_1006175332 79
603 3300005440 Ga0070705_101007161 Ga0070705_1010071612 79
604 3300005441 Ga0070700_100283122 Ga0070700_1002831222 79
605 3300005441 Ga0070700_100360501 Ga0070700_1003605011 79
606 3300005441 Ga0070700_100662171 Ga0070700_1006621712 79
607 3300005441 Ga0070700_101791174 Ga0070700_1017911741 79
608 3300005444 Ga0070694_100035136 Ga0070694_1000351362 79
609 3300005444 Ga0070694_100043596 Ga0070694_1000435962 79
610 3300005444 Ga0070694_100044085 Ga0070694_1000440853 79
611 3300005444 Ga0070694_100969295 Ga0070694_1009692952 79
612 3300005445 Ga0070708_100048840 Ga0070708_1000488403 79
613 3300005445 Ga0070708_100079739 Ga0070708_1000797394 79
614 3300005455 Ga0070663_100000789 Ga0070663_1000007897 79
615 3300005455 Ga0070663_100022618 Ga0070663_1000226185 79
616 3300005455 Ga0070663_100121956 Ga0070663_1001219562 79
617 3300005455 Ga0070663_100139704 Ga0070663_1001397042 79
618 3300005455 Ga0070663_100180793 Ga0070663_1001807932 79
619 3300005455 Ga0070663_100290067 Ga0070663_1002900672 79
620 3300005455 Ga0070663_100561267 Ga0070663_1005612672 79
621 3300005455 Ga0070663_100764337 Ga0070663_1007643372 79
622 3300005455 Ga0070663_100998009 Ga0070663_1009980092 79
623 3300005456 Ga0070678_100021026 Ga0070678_1000210265 79
624 3300005456 Ga0070678_100050334 Ga0070678_1000503343 79
625 3300005456 Ga0070678_100172994 Ga0070678_1001729943 79
626 3300005456 Ga0070678_100257216 Ga0070678_1002572162 79
627 3300005456 Ga0070678_100798182 Ga0070678_1007981821 79
628 3300005456 Ga0070678_101085570 Ga0070678_1010855701 79
629 3300005456 Ga0070678_102204069 Ga0070678_1022040691 79
630 3300005457 Ga0070662_100046182 Ga0070662_1000461822 79
631 3300005457 Ga0070662_100165302 Ga0070662_1001653022 79
632 3300005457 Ga0070662_100170877 Ga0070662_1001708772 79
633 3300005457 Ga0070662_100208921 Ga0070662_1002089213 79
634 3300005457 Ga0070662_100361671 Ga0070662_1003616712 79
635 3300005457 Ga0070662_101054591 Ga0070662_1010545911 79
636 3300005457 Ga0070662_101116566 Ga0070662_1011165662 79
637 3300005458 Ga0070681_10007272 Ga0070681_100072729 79
638 3300005458 Ga0070681_10098373 Ga0070681_100983732 79
639 3300005458 Ga0070681_10106737 Ga0070681_101067372 79
640 3300005458 Ga0070681_10163377 Ga0070681_101633772 79
641 3300005458 Ga0070681_10600669 Ga0070681_106006691 79
642 3300005459 Ga0068867_100005228 Ga0068867_1000052289 79
643 3300005459 Ga0068867_100016575 Ga0068867_1000165752 79
644 3300005459 Ga0068867_100061782 Ga0068867_1000617823 79
645 3300005459 Ga0068867_100081246 Ga0068867_1000812462 79
646 3300005459 Ga0068867_100503604 Ga0068867_1005036041 79
647 3300005459 Ga0068867_100663077 Ga0068867_1006630772 79
648 3300005459 Ga0068867_100685511 Ga0068867_1006855112 79
649 3300005459 Ga0068867_100814274 Ga0068867_1008142742 79
650 3300005459 Ga0068867_101336045 Ga0068867_1013360451 79
651 3300005459 Ga0068867_101875358 Ga0068867_1018753582 79
652 3300005466 Ga0070685_10001663 Ga0070685_100016632 79
653 3300005466 Ga0070685_10239261 Ga0070685_102392612 79
654 3300005466 Ga0070685_10752337 Ga0070685_107523371 79
655 3300005467 Ga0070706_100394119 Ga0070706_1003941192 79
656 3300005467 Ga0070706_100409253 Ga0070706_1004092532 79
657 3300005467 Ga0070706_101119425 Ga0070706_1011194252 79
658 3300005467 Ga0070706_101537734 Ga0070706_1015377341 79
659 3300005467 Ga0070706_101609366 Ga0070706_1016093661 79
660 3300005468 Ga0070707_100225059 Ga0070707_1002250593 79
661 3300005471 Ga0070698_100186515 Ga0070698_1001865152 79
662 3300005471 Ga0070698_100209977 Ga0070698_1002099773 79
663 3300005471 Ga0070698_100787289 Ga0070698_1007872891 79
664 3300005518 Ga0070699_100220649 Ga0070699_1002206492 79
665 3300005518 Ga0070699_101002787 Ga0070699_1010027872 79
666 3300005518 Ga0070699_101449501 Ga0070699_1014495012 79
667 3300005530 Ga0070679_100111929 Ga0070679_1001119292 79
668 3300005530 Ga0070679_100113076 Ga0070679_1001130762 79
669 3300005530 Ga0070679_101112040 Ga0070679_1011120401 79
670 3300005530 Ga0070679_101846605 Ga0070679_1018466051 79
671 3300005535 Ga0070684_100111334 Ga0070684_1001113342 79
672 3300005535 Ga0070684_100270276 Ga0070684_1002702762 79
673 3300005535 Ga0070684_100303775 Ga0070684_1003037752 79
674 3300005535 Ga0070684_101931002 Ga0070684_1019310022 79
675 3300005536 Ga0070697_100013110 Ga0070697_1000131105 79
676 3300005536 Ga0070697_100231155 Ga0070697_1002311552 79
677 3300005536 Ga0070697_100396096 Ga0070697_1003960962 79
678 3300005539 Ga0068853_100039213 Ga0068853_1000392134 79
679 3300005539 Ga0068853_100054281 Ga0068853_1000542812 79
680 3300005539 Ga0068853_100173214 Ga0068853_1001732143 79
681 3300005539 Ga0068853_100200889 Ga0068853_1002008892 79
682 3300005539 Ga0068853_100402422 Ga0068853_1004024221 79
683 3300005539 Ga0068853_100586350 Ga0068853_1005863502 79
684 3300005539 Ga0068853_100702679 Ga0068853_1007026792 79
685 3300005543 Ga0070672_100000540 Ga0070672_10000054020 79
686 3300005543 Ga0070672_100020517 Ga0070672_1000205175 79
687 3300005543 Ga0070672_100070478 Ga0070672_1000704783 79
688 3300005543 Ga0070672_100141702 Ga0070672_1001417022 79
689 3300005543 Ga0070672_100241010 Ga0070672_1002410102 79
690 3300005543 Ga0070672_100336758 Ga0070672_1003367583 79
691 3300005544 Ga0070686_100459981 Ga0070686_1004599812 79
692 3300005544 Ga0070686_100878902 Ga0070686_1008789022 79
693 3300005544 Ga0070686_101069148 Ga0070686_1010691482 79
694 3300005545 Ga0070695_100053350 Ga0070695_1000533502 79
695 3300005545 Ga0070695_100275110 Ga0070695_1002751102 79
696 3300005545 Ga0070695_100434354 Ga0070695_1004343542 79
697 3300005545 Ga0070695_100463093 Ga0070695_1004630932 79
698 3300005545 Ga0070695_100915736 Ga0070695_1009157362 79
699 3300005545 Ga0070695_100994254 Ga0070695_1009942542 79
700 3300005545 Ga0070695_101042913 Ga0070695_1010429131 79
701 3300005546 Ga0070696_100166381 Ga0070696_1001663812 79
702 3300005546 Ga0070696_100562682 Ga0070696_1005626821 79
703 3300005546 Ga0070696_101276764 Ga0070696_1012767641 79
704 3300005547 Ga0070693_100050147 Ga0070693_1000501473 79
705 3300005547 Ga0070693_100222443 Ga0070693_1002224432 79
706 3300005547 Ga0070693_100301224 Ga0070693_1003012242 79
707 3300005547 Ga0070693_100611990 Ga0070693_1006119902 79
708 3300005547 Ga0070693_100721857 Ga0070693_1007218572 79
709 3300005548 Ga0070665_100001402 Ga0070665_1000014027 79
710 3300005548 Ga0070665_100008939 Ga0070665_1000089394 79
711 3300005548 Ga0070665_100126978 Ga0070665_1001269783 79
712 3300005548 Ga0070665_100172570 Ga0070665_1001725702 79
713 3300005548 Ga0070665_100303361 Ga0070665_1003033611 79
714 3300005548 Ga0070665_100318033 Ga0070665_1003180331 79
715 3300005548 Ga0070665_100320756 Ga0070665_1003207562 79
716 3300005548 Ga0070665_100429623 Ga0070665_1004296231 79
717 3300005548 Ga0070665_101143046 Ga0070665_1011430461 79
718 3300005548 Ga0070665_101288384 Ga0070665_1012883841 79
719 3300005548 Ga0070665_101378980 Ga0070665_1013789801 79
720 3300005549 Ga0070704_100039968 Ga0070704_1000399685 79
721 3300005549 Ga0070704_100068766 Ga0070704_1000687663 79
722 3300005549 Ga0070704_100114107 Ga0070704_1001141072 79
723 3300005549 Ga0070704_100134185 Ga0070704_1001341852 79
724 3300005549 Ga0070704_100134882 Ga0070704_1001348822 79
725 3300005549 Ga0070704_100143290 Ga0070704_1001432902 79
726 3300005549 Ga0070704_100216727 Ga0070704_1002167272 79
727 3300005549 Ga0070704_100370199 Ga0070704_1003701991 79
728 3300005549 Ga0070704_100400708 Ga0070704_1004007082 79
729 3300005563 Ga0068855_100001012 Ga0068855_10000101224 79
730 3300005563 Ga0068855_100001935 Ga0068855_10000193513 79
731 3300005563 Ga0068855_100066402 Ga0068855_1000664022 79
732 3300005563 Ga0068855_100363852 Ga0068855_1003638521 79
733 3300005563 Ga0068855_100403637 Ga0068855_1004036372 79
734 3300005563 Ga0068855_100580354 Ga0068855_1005803542 79
735 3300005563 Ga0068855_100918403 Ga0068855_1009184032 79
736 3300005564 Ga0070664_100160639 Ga0070664_1001606392 79
737 3300005564 Ga0070664_100196035 Ga0070664_1001960353 79
738 3300005564 Ga0070664_100204324 Ga0070664_1002043243 79
739 3300005564 Ga0070664_100221808 Ga0070664_1002218082 79
740 3300005564 Ga0070664_100280812 Ga0070664_1002808122 79
741 3300005564 Ga0070664_100580316 Ga0070664_1005803162 79
742 3300005564 Ga0070664_101264136 Ga0070664_1012641362 79
743 3300005577 Ga0068857_100049665 Ga0068857_1000496653 79
744 3300005577 Ga0068857_100177574 Ga0068857_1001775742 79
745 3300005577 Ga0068857_100196311 Ga0068857_1001963112 79
746 3300005577 Ga0068857_100357848 Ga0068857_1003578482 79
747 3300005577 Ga0068857_100578659 Ga0068857_1005786592 79
748 3300005577 Ga0068857_100744231 Ga0068857_1007442311 79
749 3300005578 Ga0068854_100121423 Ga0068854_1001214232 79
750 3300005578 Ga0068854_100192287 Ga0068854_1001922872 79
751 3300005578 Ga0068854_100252132 Ga0068854_1002521322 79
752 3300005578 Ga0068854_100373242 Ga0068854_1003732422 79
753 3300005578 Ga0068854_100841015 Ga0068854_1008410152 79
754 3300005578 Ga0068854_101616479 Ga0068854_1016164791 79
755 3300005614 Ga0068856_100526630 Ga0068856_1005266302 79
756 3300005614 Ga0068856_100657148 Ga0068856_1006571482 79
757 3300005614 Ga0068856_100944301 Ga0068856_1009443012 79
758 3300005614 Ga0068856_101111464 Ga0068856_1011114642 79
759 3300005614 Ga0068856_101322975 Ga0068856_1013229752 79
760 3300005614 Ga0068856_101347040 Ga0068856_1013470402 79
761 3300005614 Ga0068856_101388904 Ga0068856_1013889041 79
762 3300005614 Ga0068856_101492247 Ga0068856_1014922472 79
763 3300005615 Ga0070702_100078567 Ga0070702_1000785672 79
764 3300005615 Ga0070702_100168809 Ga0070702_1001688092 79
765 3300005615 Ga0070702_101293668 Ga0070702_1012936681 79
766 3300005615 Ga0070702_101428381 Ga0070702_1014283812 79
767 3300005616 Ga0068852_100002660 Ga0068852_10000266011 79
768 3300005616 Ga0068852_100091777 Ga0068852_1000917774 79
769 3300005616 Ga0068852_100269315 Ga0068852_1002693152 79
770 3300005616 Ga0068852_100376994 Ga0068852_1003769942 79
771 3300005616 Ga0068852_100464958 Ga0068852_1004649581 79
772 3300005616 Ga0068852_100696387 Ga0068852_1006963872 79
773 3300005616 Ga0068852_100829129 Ga0068852_1008291291 79
774 3300005616 Ga0068852_100850996 Ga0068852_1008509962 79
775 3300005616 Ga0068852_100984235 Ga0068852_1009842351 79
776 3300005616 Ga0068852_101803997 Ga0068852_1018039971 79
777 3300005616 Ga0068852_102660207 Ga0068852_1026602072 79
778 3300005616 Ga0068852_102839132 Ga0068852_1028391321 79
779 3300005617 Ga0068859_100008168 Ga0068859_1000081689 79
780 3300005617 Ga0068859_100023634 Ga0068859_1000236345 79
781 3300005617 Ga0068859_100137750 Ga0068859_1001377502 79
782 3300005617 Ga0068859_100169531 Ga0068859_1001695312 79
783 3300005617 Ga0068859_100415458 Ga0068859_1004154583 79
784 3300005617 Ga0068859_100451492 Ga0068859_1004514921 79
785 3300005617 Ga0068859_101380837 Ga0068859_1013808372 79
786 3300005617 Ga0068859_101692288 Ga0068859_1016922882 79
787 3300005617 Ga0068859_101865602 Ga0068859_1018656022 79
788 3300005617 Ga0068859_101931986 Ga0068859_1019319862 79
789 3300005618 Ga0068864_100000456 Ga0068864_1000004568 79
790 3300005618 Ga0068864_100006822 Ga0068864_1000068228 79
791 3300005618 Ga0068864_100009291 Ga0068864_1000092912 79
792 3300005618 Ga0068864_100059287 Ga0068864_1000592872 79
793 3300005618 Ga0068864_100118782 Ga0068864_1001187822 79
794 3300005618 Ga0068864_100141993 Ga0068864_1001419933 79
795 3300005618 Ga0068864_100171863 Ga0068864_1001718632 79
796 3300005618 Ga0068864_100423755 Ga0068864_1004237551 79
797 3300005618 Ga0068864_100478383 Ga0068864_1004783832 79
798 3300005618 Ga0068864_100588651 Ga0068864_1005886512 79
799 3300005618 Ga0068864_101343997 Ga0068864_1013439972 79
800 3300005618 Ga0068864_101475107 Ga0068864_1014751072 79
801 3300005718 Ga0068866_10023053 Ga0068866_100230532 79
802 3300005719 Ga0068861_100023402 Ga0068861_1000234024 79
803 3300005719 Ga0068861_100083921 Ga0068861_1000839213 79
804 3300005719 Ga0068861_100141030 Ga0068861_1001410302 79
805 3300005719 Ga0068861_100242813 Ga0068861_1002428132 79
806 3300005719 Ga0068861_100293154 Ga0068861_1002931542 79
807 3300005719 Ga0068861_100542646 Ga0068861_1005426462 79
808 3300005719 Ga0068861_101049281 Ga0068861_1010492812 79
809 3300005719 Ga0068861_101051971 Ga0068861_1010519712 79
810 3300005834 Ga0068851_10028532 Ga0068851_100285323 79
811 3300005834 Ga0068851_10236419 Ga0068851_102364191 79
812 3300005834 Ga0068851_10256275 Ga0068851_102562752 79
813 3300005834 Ga0068851_10901842 Ga0068851_109018422 79
814 3300005834 Ga0068851_10979645 Ga0068851_109796451 79
815 3300005840 Ga0068870_10012623 Ga0068870_100126232 79
816 3300005840 Ga0068870_10028689 Ga0068870_100286892 79
817 3300005840 Ga0068870_10053111 Ga0068870_100531112 79
818 3300005840 Ga0068870_10238157 Ga0068870_102381572 79
819 3300005840 Ga0068870_10659324 Ga0068870_106593242 79
820 3300005840 Ga0068870_11288471 Ga0068870_112884712 79
821 3300005841 Ga0068863_100000521 Ga0068863_10000052114 79
822 3300005841 Ga0068863_100008813 Ga0068863_1000088133 79
823 3300005841 Ga0068863_100013369 Ga0068863_1000133695 79
824 3300005841 Ga0068863_100078037 Ga0068863_1000780372 79
825 3300005841 Ga0068863_100082598 Ga0068863_1000825984 79
826 3300005841 Ga0068863_100129449 Ga0068863_1001294492 79
827 3300005841 Ga0068863_100267994 Ga0068863_1002679943 79
828 3300005841 Ga0068863_100441975 Ga0068863_1004419752 79
829 3300005841 Ga0068863_100719628 Ga0068863_1007196282 79
830 3300005841 Ga0068863_102426985 Ga0068863_1024269852 79
831 3300005842 Ga0068858_100002595 Ga0068858_10000259517 79
832 3300005842 Ga0068858_100008135 Ga0068858_1000081352 79
833 3300005842 Ga0068858_100008910 Ga0068858_1000089108 79
834 3300005842 Ga0068858_100163182 Ga0068858_1001631823 79
835 3300005842 Ga0068858_100306152 Ga0068858_1003061522 79
836 3300005842 Ga0068858_100396994 Ga0068858_1003969942 79
837 3300005842 Ga0068858_101210125 Ga0068858_1012101252 79
838 3300005842 Ga0068858_102600480 Ga0068858_1026004801 79
839 3300005843 Ga0068860_100008086 Ga0068860_1000080869 79
840 3300005843 Ga0068860_100050934 Ga0068860_1000509344 79
841 3300005843 Ga0068860_100058753 Ga0068860_1000587534 79
842 3300005843 Ga0068860_100109492 Ga0068860_1001094923 79
843 3300005843 Ga0068860_100124439 Ga0068860_1001244392 79
844 3300005843 Ga0068860_100216873 Ga0068860_1002168732 79
845 3300005843 Ga0068860_100555675 Ga0068860_1005556751 79
846 3300005843 Ga0068860_100971040 Ga0068860_1009710402 79
847 3300005843 Ga0068860_101059519 Ga0068860_1010595192 79
848 3300005843 Ga0068860_101974231 Ga0068860_1019742312 79
849 3300005843 Ga0068860_102477825 Ga0068860_1024778251 79
850 3300005844 Ga0068862_100047813 Ga0068862_1000478134 79
851 3300005844 Ga0068862_100089797 Ga0068862_1000897972 79
852 3300005844 Ga0068862_100098405 Ga0068862_1000984052 79
853 3300005844 Ga0068862_100100687 Ga0068862_1001006872 79
854 3300005844 Ga0068862_100114766 Ga0068862_1001147663 79
855 3300005844 Ga0068862_100986109 Ga0068862_1009861091 79
856 3300005937 Ga0081455_10321395 Ga0081455_103213952 79
857 3300006028 Ga0070717_10404275 Ga0070717_104042752 79
858 3300006163 Ga0070715_10919760 Ga0070715_109197602 79
859 3300006173 Ga0070716_100024056 Ga0070716_1000240563 79
860 3300006173 Ga0070716_100045227 Ga0070716_1000452272 79
861 3300006173 Ga0070716_100754220 Ga0070716_1007542201 79
862 3300006175 Ga0070712_100021793 Ga0070712_1000217934 79
863 3300006175 Ga0070712_100134108 Ga0070712_1001341083 79
864 3300006237 Ga0097621_100007231 Ga0097621_1000072315 79
865 3300006237 Ga0097621_100067381 Ga0097621_1000673812 79
866 3300006237 Ga0097621_100076164 Ga0097621_1000761644 79
867 3300006237 Ga0097621_100084710 Ga0097621_1000847103 79
868 3300006237 Ga0097621_100168114 Ga0097621_1001681142 79
869 3300006237 Ga0097621_100327237 Ga0097621_1003272372 79
870 3300006237 Ga0097621_100514596 Ga0097621_1005145962 79
871 3300006237 Ga0097621_101003365 Ga0097621_1010033652 79
872 3300006237 Ga0097621_101052576 Ga0097621_1010525762 79
873 3300006358 Ga0068871_100028795 Ga0068871_1000287954 79
874 3300006358 Ga0068871_100149409 Ga0068871_1001494092 79
875 3300006358 Ga0068871_100223429 Ga0068871_1002234292 79
876 3300006358 Ga0068871_100374526 Ga0068871_1003745262 79
877 3300006358 Ga0068871_100377786 Ga0068871_1003777862 79
878 3300006358 Ga0068871_100902135 Ga0068871_1009021351 79
879 3300006358 Ga0068871_101029849 Ga0068871_1010298491 79
880 3300006358 Ga0068871_101106437 Ga0068871_1011064372 79
881 3300006358 Ga0068871_101144694 Ga0068871_1011446942 79
882 3300006358 Ga0068871_101415365 Ga0068871_1014153651 79
883 3300006358 Ga0068871_101793433 Ga0068871_1017934332 79
884 3300006844 Ga0075428_100005955 Ga0075428_1000059555 79
885 3300006844 Ga0075428_100129608 Ga0075428_1001296082 79
886 3300006844 Ga0075428_100251783 Ga0075428_1002517831 79
887 3300006844 Ga0075428_101352883 Ga0075428_1013528832 79
888 3300006844 Ga0075428_101654559 Ga0075428_1016545592 79
889 3300006846 Ga0075430_100099132 Ga0075430_1000991323 79
890 3300006846 Ga0075430_101013536 Ga0075430_1010135361 79
891 3300006847 Ga0075431_100072471 Ga0075431_1000724712 79
892 3300006847 Ga0075431_100416569 Ga0075431_1004165692 79
893 3300006847 Ga0075431_100636795 Ga0075431_1006367952 79
894 3300006847 Ga0075431_100663287 Ga0075431_1006632871 79
895 3300006847 Ga0075431_101193510 Ga0075431_1011935102 79
896 3300006852 Ga0075433_10006788 Ga0075433_1000678812 79
897 3300006852 Ga0075433_10320438 Ga0075433_103204382 79
898 3300006852 Ga0075433_10565862 Ga0075433_105658621 79
899 3300006852 Ga0075433_10634998 Ga0075433_106349982 79
900 3300006852 Ga0075433_11422520 Ga0075433_114225202 79
901 3300006852 Ga0075433_11633209 Ga0075433_116332091 79
902 3300006871 Ga0075434_100002012 Ga0075434_10000201211 79
903 3300006871 Ga0075434_100140135 Ga0075434_1001401351 79
904 3300006871 Ga0075434_100152265 Ga0075434_1001522653 79
905 3300006871 Ga0075434_100509763 Ga0075434_1005097633 79
906 3300006871 Ga0075434_100741026 Ga0075434_1007410262 79
907 3300006871 Ga0075434_101017045 Ga0075434_1010170451 79
908 3300006871 Ga0075434_101845462 Ga0075434_1018454622 79
909 3300006880 Ga0075429_100019505 Ga0075429_1000195054 79
910 3300006881 Ga0068865_100038656 Ga0068865_1000386563 79
911 3300006881 Ga0068865_100106418 Ga0068865_1001064182 79
912 3300006881 Ga0068865_101291357 Ga0068865_1012913572 79
913 3300006914 Ga0075436_100036184 Ga0075436_1000361845 79
914 3300006914 Ga0075436_100266335 Ga0075436_1002663352 79
915 3300006914 Ga0075436_100807372 Ga0075436_1008073722 79
916 3300006931 Ga0097620_100008167 Ga0097620_1000081679 79
917 3300006931 Ga0097620_100023635 Ga0097620_1000236355 79
918 3300006931 Ga0097620_100137746 Ga0097620_1001377462 79
919 3300006931 Ga0097620_100169530 Ga0097620_1001695302 79
920 3300006931 Ga0097620_100415463 Ga0097620_1004154633 79
921 3300006931 Ga0097620_100451505 Ga0097620_1004515051 79
922 3300006931 Ga0097620_101380993 Ga0097620_1013809932 79
923 3300006931 Ga0097620_101692310 Ga0097620_1016923102 79
924 3300006931 Ga0097620_101865505 Ga0097620_1018655052 79
925 3300006931 Ga0097620_101932141 Ga0097620_1019321412 79
926 3300007076 Ga0075435_100226848 Ga0075435_1002268482 79
927 3300007076 Ga0075435_100484808 Ga0075435_1004848082 79
928 3300007076 Ga0075435_100548673 Ga0075435_1005486732 79
929 3300007076 Ga0075435_101162641 Ga0075435_1011626412 79
930 3300007076 Ga0075435_101353109 Ga0075435_1013531091 79
931 3300007265 Ga0099794_10025576 Ga0099794_100255763 79
932 3300007265 Ga0099794_10031682 Ga0099794_100316824 79
933 3300007265 Ga0099794_10041909 Ga0099794_100419092 79
934 3300007265 Ga0099794_10116650 Ga0099794_101166502 79
935 3300007788 Ga0099795_10320911 Ga0099795_103209112 79
936 3300007788 Ga0099795_10605150 Ga0099795_106051501 79
937 3300009011 Ga0105251_10001123 Ga0105251_100011234 79
938 3300009011 Ga0105251_10144148 Ga0105251_101441482 79
939 3300009036 Ga0105244_10065474 Ga0105244_100654742 79
940 3300009036 Ga0105244_10211476 Ga0105244_102114762 79
941 3300009092 Ga0105250_10021246 Ga0105250_100212462 79
942 3300009092 Ga0105250_10210893 Ga0105250_102108932 79
943 3300009092 Ga0105250_10251848 Ga0105250_102518482 79
944 3300009092 Ga0105250_10310399 Ga0105250_103103991 79
945 3300009093 Ga0105240_10001212 Ga0105240_1000121222 79
946 3300009093 Ga0105240_10014780 Ga0105240_100147808 79
947 3300009093 Ga0105240_10022879 Ga0105240_100228793 79
948 3300009093 Ga0105240_10200701 Ga0105240_102007012 79
949 3300009093 Ga0105240_10213967 Ga0105240_102139671 79
950 3300009093 Ga0105240_10260888 Ga0105240_102608882 79
951 3300009093 Ga0105240_10461820 Ga0105240_104618203 79
952 3300009093 Ga0105240_10470814 Ga0105240_104708142 79
953 3300009093 Ga0105240_11855701 Ga0105240_118557011 79
954 3300009094 Ga0111539_10222598 Ga0111539_102225983 79
955 3300009094 Ga0111539_10229136 Ga0111539_102291362 79
956 3300009094 Ga0111539_10676224 Ga0111539_106762242 79
957 3300009094 Ga0111539_11602931 Ga0111539_116029312 79
958 3300009094 Ga0111539_11638932 Ga0111539_116389322 79
959 3300009098 Ga0105245_10004684 Ga0105245_100046843 79
960 3300009098 Ga0105245_10190697 Ga0105245_101906972 79
961 3300009098 Ga0105245_10192869 Ga0105245_101928692 79
962 3300009098 Ga0105245_10266157 Ga0105245_102661572 79
963 3300009098 Ga0105245_10708773 Ga0105245_107087731 79
964 3300009098 Ga0105245_10921376 Ga0105245_109213762 79
965 3300009098 Ga0105245_11047423 Ga0105245_110474232 79
966 3300009101 Ga0105247_10038702 Ga0105247_100387022 79
967 3300009101 Ga0105247_10354110 Ga0105247_103541101 79
968 3300009101 Ga0105247_10401247 Ga0105247_104012471 79
969 3300009101 Ga0105247_10450621 Ga0105247_104506211 79
970 3300009101 Ga0105247_10554773 Ga0105247_105547732 79
971 3300009147 Ga0114129_10073649 Ga0114129_100736496 79
972 3300009147 Ga0114129_10176049 Ga0114129_101760492 79
973 3300009147 Ga0114129_10266858 Ga0114129_102668583 79
974 3300009147 Ga0114129_10463461 Ga0114129_104634612 79
975 3300009147 Ga0114129_11296646 Ga0114129_112966461 79
976 3300009148 Ga0105243_10680061 Ga0105243_106800612 79
977 3300009148 Ga0105243_10809845 Ga0105243_108098452 79
978 3300009148 Ga0105243_11031109 Ga0105243_110311092 79
979 3300009174 Ga0105241_10454042 Ga0105241_104540422 79
980 3300009174 Ga0105241_10686137 Ga0105241_106861372 79
981 3300009174 Ga0105241_10865278 Ga0105241_108652781 79
982 3300009174 Ga0105241_11998448 Ga0105241_119984482 79
983 3300009174 Ga0105241_12047381 Ga0105241_120473812 79
984 3300009174 Ga0105241_12400629 Ga0105241_124006292 79
985 3300009174 Ga0105241_12634194 Ga0105241_126341941 79
986 3300009176 Ga0105242_10048474 Ga0105242_100484743 79
987 3300009176 Ga0105242_10600705 Ga0105242_106007052 79
988 3300009176 Ga0105242_10939642 Ga0105242_109396422 79
989 3300009176 Ga0105242_11052480 Ga0105242_110524802 79
990 3300009176 Ga0105242_12758580 Ga0105242_127585802 79
991 3300009176 Ga0105242_13277019 Ga0105242_132770192 79
992 3300009177 Ga0105248_10016076 Ga0105248_100160765 79
993 3300009177 Ga0105248_10025777 Ga0105248_100257773 79
994 3300009177 Ga0105248_10131761 Ga0105248_101317614 79
995 3300009177 Ga0105248_10229703 Ga0105248_102297031 79
996 3300009177 Ga0105248_10244852 Ga0105248_102448521 79
997 3300009177 Ga0105248_10337257 Ga0105248_103372572 79
998 3300009177 Ga0105248_10449402 Ga0105248_104494021 79
999 3300009177 Ga0105248_10461455 Ga0105248_104614552 79
1000 3300009177 Ga0105248_10462350 Ga0105248_104623502 79
1001 3300009177 Ga0105248_10824941 Ga0105248_108249412 79
1002 3300009177 Ga0105248_12003788 Ga0105248_120037882 79
1003 3300009545 Ga0105237_10016866 Ga0105237_100168669 79
1004 3300009545 Ga0105237_10109071 Ga0105237_101090712 79
1005 3300009545 Ga0105237_10503605 Ga0105237_105036052 79
1006 3300009545 Ga0105237_12592990 Ga0105237_125929901 79
1007 3300009551 Ga0105238_10061407 Ga0105238_100614072 79
1008 3300009551 Ga0105238_10199494 Ga0105238_101994942 79
1009 3300009551 Ga0105238_10440258 Ga0105238_104402582 79
1010 3300009551 Ga0105238_10906076 Ga0105238_109060762 79
1011 3300009551 Ga0105238_11708828 Ga0105238_117088281 79
1012 3300009553 Ga0105249_10157990 Ga0105249_101579903 79
1013 3300009553 Ga0105249_10419172 Ga0105249_104191722 79
1014 3300009553 Ga0105249_10430074 Ga0105249_104300742 79
1015 3300009553 Ga0105249_10454791 Ga0105249_104547912 79
1016 3300009553 Ga0105249_11030256 Ga0105249_110302562 79
1017 3300009553 Ga0105249_11998372 Ga0105249_119983721 79
1018 3300009987 Ga0105030_102507 Ga0105030_1025072 79
1019 3300010159 Ga0099796_10006145 Ga0099796_100061453 79
1020 3300010159 Ga0099796_10117601 Ga0099796_101176012 79
1021 3300010375 Ga0105239_10020010 Ga0105239_100200102 79
1022 3300010375 Ga0105239_10028127 Ga0105239_100281273 79
1023 3300010375 Ga0105239_10051990 Ga0105239_100519907 79
1024 3300010375 Ga0105239_10527288 Ga0105239_105272882 79
1025 3300010375 Ga0105239_10939594 Ga0105239_109395942 79
1026 3300010375 Ga0105239_11117850 Ga0105239_111178501 79
1027 3300010375 Ga0105239_12636220 Ga0105239_126362202 79
1028 3300011119 Ga0105246_10096715 Ga0105246_100967153 79
1029 3300011119 Ga0105246_10141576 Ga0105246_101415762 79
1030 3300011119 Ga0105246_10186359 Ga0105246_101863592 79
1031 3300011119 Ga0105246_10352570 Ga0105246_103525702 79
1032 3300011119 Ga0105246_11216602 Ga0105246_112166021 79
1033 3300011119 Ga0105246_11277016 Ga0105246_112770161 79
1034 3300011119 Ga0105246_11306373 Ga0105246_113063732 79
1035 3300011119 Ga0105246_12111659 Ga0105246_121116592 79
1036 3300012477 Ga0157336_1019145 Ga0157336_10191452 79
1037 3300012495 Ga0157323_1007831 Ga0157323_10078311 79
1038 3300012506 Ga0157324_1004315 Ga0157324_10043152 79
1039 3300012513 Ga0157326_1072480 Ga0157326_10724801 79
1040 3300013100 Ga0157373_10006519 Ga0157373_100065192 79
1041 3300013100 Ga0157373_10122418 Ga0157373_101224182 79
1042 3300013100 Ga0157373_10954244 Ga0157373_109542442 79
1043 3300013102 Ga0157371_10020554 Ga0157371_100205544 79
1044 3300013102 Ga0157371_10178320 Ga0157371_101783202 79
1045 3300013102 Ga0157371_10955576 Ga0157371_109555761 79
1046 3300013102 Ga0157371_11296152 Ga0157371_112961522 79
1047 3300013104 Ga0157370_10000928 Ga0157370_1000092815 79
1048 3300013104 Ga0157370_10025433 Ga0157370_100254331 79
1049 3300013104 Ga0157370_10096777 Ga0157370_100967774 79
1050 3300013104 Ga0157370_10098108 Ga0157370_100981082 79
1051 3300013104 Ga0157370_10115999 Ga0157370_101159993 79
1052 3300013104 Ga0157370_10931901 Ga0157370_109319011 79
1053 3300013105 Ga0157369_10000252 Ga0157369_1000025242 79
1054 3300013105 Ga0157369_10000799 Ga0157369_1000079921 79
1055 3300013105 Ga0157369_10002799 Ga0157369_1000279920 79
1056 3300013105 Ga0157369_10046953 Ga0157369_100469535 79
1057 3300013105 Ga0157369_10284156 Ga0157369_102841562 79
1058 3300013105 Ga0157369_10298161 Ga0157369_102981612 79
1059 3300013105 Ga0157369_10980377 Ga0157369_109803772 79
1060 3300013105 Ga0157369_11156758 Ga0157369_111567582 79
1061 3300013296 Ga0157374_10000419 Ga0157374_1000041924 79
1062 3300013296 Ga0157374_10004205 Ga0157374_100042053 79
1063 3300013296 Ga0157374_10086791 Ga0157374_100867914 79
1064 3300013296 Ga0157374_10439267 Ga0157374_104392672 79
1065 3300013296 Ga0157374_10561454 Ga0157374_105614541 79
1066 3300013296 Ga0157374_11423310 Ga0157374_114233101 79
1067 3300013296 Ga0157374_12141960 Ga0157374_121419601 79
1068 3300013296 Ga0157374_12153665 Ga0157374_121536652 79
1069 3300013296 Ga0157374_12495585 Ga0157374_124955851 79
1070 3300013297 Ga0157378_10025093 Ga0157378_100250933 79
1071 3300013297 Ga0157378_10036206 Ga0157378_100362064 79
1072 3300013297 Ga0157378_10077918 Ga0157378_100779182 79
1073 3300013297 Ga0157378_10114262 Ga0157378_101142622 79
1074 3300013297 Ga0157378_10193934 Ga0157378_101939341 79
1075 3300013297 Ga0157378_10247568 Ga0157378_102475681 79
1076 3300013297 Ga0157378_10967528 Ga0157378_109675282 79
1077 3300013297 Ga0157378_11322296 Ga0157378_113222962 79
1078 3300013297 Ga0157378_11523830 Ga0157378_115238301 79
1079 3300013297 Ga0157378_11811739 Ga0157378_118117391 79
1080 3300013297 Ga0157378_11903869 Ga0157378_119038692 79
1081 3300013306 Ga0163162_10002139 Ga0163162_100021393 79
1082 3300013306 Ga0163162_10005749 Ga0163162_1000574913 79
1083 3300013306 Ga0163162_10033754 Ga0163162_100337546 79
1084 3300013306 Ga0163162_10103173 Ga0163162_101031733 79
1085 3300013306 Ga0163162_10148494 Ga0163162_101484942 79
1086 3300013306 Ga0163162_10220704 Ga0163162_102207043 79
1087 3300013306 Ga0163162_10864738 Ga0163162_108647382 79
1088 3300013306 Ga0163162_11156106 Ga0163162_111561061 79
1089 3300013306 Ga0163162_11167445 Ga0163162_111674452 79
1090 3300013306 Ga0163162_11325029 Ga0163162_113250292 79
1091 3300013306 Ga0163162_11726759 Ga0163162_117267591 79
1092 3300013307 Ga0157372_10001701 Ga0157372_100017013 79
1093 3300013307 Ga0157372_10023895 Ga0157372_100238953 79
1094 3300013307 Ga0157372_10118475 Ga0157372_101184753 79
1095 3300013307 Ga0157372_10753380 Ga0157372_107533802 79
1096 3300013307 Ga0157372_10958458 Ga0157372_109584582 79
1097 3300013307 Ga0157372_11085941 Ga0157372_110859411 79
1098 3300013307 Ga0157372_11572176 Ga0157372_115721762 79
1099 3300013308 Ga0157375_10008010 Ga0157375_100080103 79
1100 3300013308 Ga0157375_10009300 Ga0157375_100093003 79
1101 3300013308 Ga0157375_10051109 Ga0157375_100511092 79
1102 3300013308 Ga0157375_10059025 Ga0157375_100590253 79
1103 3300013308 Ga0157375_10084253 Ga0157375_100842533 79
1104 3300013308 Ga0157375_10212389 Ga0157375_102123892 79
1105 3300013308 Ga0157375_10471462 Ga0157375_104714622 79
1106 3300013308 Ga0157375_10624193 Ga0157375_106241932 79
1107 3300013308 Ga0157375_10978892 Ga0157375_109788922 79
1108 3300013308 Ga0157375_11087914 Ga0157375_110879142 79
1109 3300013308 Ga0157375_11228508 Ga0157375_112285082 79
1110 3300013308 Ga0157375_11233448 Ga0157375_112334482 79
1111 3300013308 Ga0157375_12234413 Ga0157375_122344131 79
1112 3300013308 Ga0157375_12508856 Ga0157375_125088562 79
1113 3300013308 Ga0157375_12903488 Ga0157375_129034882 79
1114 3300013874 Ga0157514_100622 Ga0157514_1006222 79
1115 3300014325 Ga0163163_10000233 Ga0163163_1000023331 79
1116 3300014325 Ga0163163_10011827 Ga0163163_100118275 79
1117 3300014325 Ga0163163_10023409 Ga0163163_100234092 79
1118 3300014325 Ga0163163_10042671 Ga0163163_100426714 79
1119 3300014325 Ga0163163_10064936 Ga0163163_100649362 79
1120 3300014325 Ga0163163_10097611 Ga0163163_100976114 79
1121 3300014325 Ga0163163_11366663 Ga0163163_113666632 79
1122 3300014325 Ga0163163_11656916 Ga0163163_116569162 79
1123 3300014325 Ga0163163_11817015 Ga0163163_118170152 79
1124 3300014325 Ga0163163_11818434 Ga0163163_118184342 79
1125 3300014325 Ga0163163_12067957 Ga0163163_120679572 79
1126 3300014325 Ga0163163_12255717 Ga0163163_122557172 79
1127 3300014325 Ga0163163_12318315 Ga0163163_123183151 79
1128 3300014326 Ga0157380_10018325 Ga0157380_100183255 79
1129 3300014326 Ga0157380_10045572 Ga0157380_100455723 79
1130 3300014326 Ga0157380_10084164 Ga0157380_100841642 79
1131 3300014326 Ga0157380_10201604 Ga0157380_102016042 79
1132 3300014326 Ga0157380_10600227 Ga0157380_106002272 79
1133 3300014326 Ga0157380_10640246 Ga0157380_106402462 79
1134 3300014326 Ga0157380_11090363 Ga0157380_110903632 79
1135 3300014326 Ga0157380_11113528 Ga0157380_111135282 79
1136 3300014326 Ga0157380_11813109 Ga0157380_118131092 79
1137 3300014497 Ga0182008_10001189 Ga0182008_100011896 79
1138 3300014497 Ga0182008_10255795 Ga0182008_102557952 79
1139 3300014497 Ga0182008_10355960 Ga0182008_103559602 79
1140 3300014745 Ga0157377_10020450 Ga0157377_100204503 79
1141 3300014745 Ga0157377_10254735 Ga0157377_102547352 79
1142 3300014968 Ga0157379_10000246 Ga0157379_1000024610 79
1143 3300014968 Ga0157379_10002212 Ga0157379_1000221217 79
1144 3300014968 Ga0157379_10044671 Ga0157379_100446712 79
1145 3300014968 Ga0157379_10054532 Ga0157379_100545322 79
1146 3300014968 Ga0157379_10204127 Ga0157379_102041273 79
1147 3300014968 Ga0157379_10208165 Ga0157379_102081652 79
1148 3300014968 Ga0157379_10282485 Ga0157379_102824852 79
1149 3300014968 Ga0157379_10466232 Ga0157379_104662322 79
1150 3300014968 Ga0157379_10566973 Ga0157379_105669731 79
1151 3300014968 Ga0157379_11168841 Ga0157379_111688412 79
1152 3300014968 Ga0157379_12289043 Ga0157379_122890432 79
1153 3300014969 Ga0157376_10024704 Ga0157376_100247042 79
1154 3300014969 Ga0157376_10047230 Ga0157376_100472303 79
1155 3300014969 Ga0157376_10054971 Ga0157376_100549713 79
1156 3300014969 Ga0157376_10219838 Ga0157376_102198382 79
1157 3300014969 Ga0157376_10270027 Ga0157376_102700273 79
1158 3300014969 Ga0157376_10366003 Ga0157376_103660032 79
1159 3300014969 Ga0157376_10488867 Ga0157376_104888671 79
1160 3300014969 Ga0157376_10576417 Ga0157376_105764172 79
1161 3300014969 Ga0157376_10980098 Ga0157376_109800982 79
1162 3300014969 Ga0157376_11953169 Ga0157376_119531691 79
1163 3300015261 Ga0182006_1079587 Ga0182006_10795872 79
1164 3300015261 Ga0182006_1106857 Ga0182006_11068572 79
1165 3300015262 Ga0182007_10019435 Ga0182007_100194353 79
1166 3300015262 Ga0182007_10275444 Ga0182007_102754441 79
1167 3300015265 Ga0182005_1047696 Ga0182005_10476962 79
1168 3300016635 Ga0183361_10025 Ga0183361_1002517 79
1169 3300017792 Ga0163161_10045466 Ga0163161_100454663 79
1170 3300017792 Ga0163161_10155402 Ga0163161_101554022 79
1171 3300017792 Ga0163161_10782133 Ga0163161_107821332 79
1172 3300017792 Ga0163161_10982481 Ga0163161_109824812 79
1173 3300017792 Ga0163161_11720695 Ga0163161_117206952 79
1174 3300020069 Ga0197907_10892649 Ga0197907_108926492 79
1175 3300020070 Ga0206356_11455669 Ga0206356_114556691 79
1176 3300020075 Ga0206349_1580423 Ga0206349_15804231 79
1177 3300020075 Ga0206349_1874314 Ga0206349_18743141 79
1178 3300020076 Ga0206355_1017993 Ga0206355_10179932 79
1179 3300020076 Ga0206355_1595245 Ga0206355_15952452 79
1180 3300020077 Ga0206351_10877725 Ga0206351_108777251 79
1181 3300020078 Ga0206352_10273038 Ga0206352_102730382 79
1182 3300020078 Ga0206352_10468945 Ga0206352_104689452 79
1183 3300020078 Ga0206352_10807075 Ga0206352_108070751 79
1184 3300020080 Ga0206350_10341210 Ga0206350_103412102 79
1185 3300020080 Ga0206350_11415002 Ga0206350_114150021 79
1186 3300020080 Ga0206350_11558051 Ga0206350_115580512 79
1187 3300020081 Ga0206354_10229861 Ga0206354_102298612 79
1188 3300020081 Ga0206354_10913120 Ga0206354_109131201 79
1189 3300020081 Ga0206354_11341774 Ga0206354_113417741 79
1190 3300020082 Ga0206353_10126844 Ga0206353_101268447 79
1191 3300020082 Ga0206353_10909448 Ga0206353_109094482 79
1192 3300020082 Ga0206353_11941909 Ga0206353_119419092 79
1193 3300020610 Ga0154015_1575671 Ga0154015_15756711 79
1194 3300021361 Ga0213872_10000957 Ga0213872_1000095715 79
1195 3300021361 Ga0213872_10021426 Ga0213872_100214261 79
1196 3300021361 Ga0213872_10395719 Ga0213872_103957191 79
1197 3300021388 Ga0213875_10272832 Ga0213875_102728322 79
1198 3300022467 Ga0224712_10000008 Ga0224712_100000088 79
1199 3300025206 Ga0209435_102935 Ga0209435_1029352 79
1200 3300025225 Ga0209566_100896 Ga0209566_10089610 79
1201 3300025226 Ga0209674_100013 Ga0209674_100013224 79
1202 3300025228 Ga0209672_100010 Ga0209672_100010268 79
1203 3300025228 Ga0209672_100019 Ga0209672_100019314 79
1204 3300025228 Ga0209672_100051 Ga0209672_10005110 79
1205 3300025228 Ga0209672_101777 Ga0209672_1017773 79
1206 3300025229 Ga0209147_100006 Ga0209147_100006268 79
1207 3300025229 Ga0209147_100026 Ga0209147_100026314 79
1208 3300025229 Ga0209147_101674 Ga0209147_1016745 79
1209 3300025230 Ga0209563_101563 Ga0209563_1015633 79
1210 3300025231 Ga0207427_101131 Ga0207427_1011313 79
1211 3300025242 Ga0209258_100010 Ga0209258_100010268 79
1212 3300025242 Ga0209258_100031 Ga0209258_100031354 79
1213 3300025242 Ga0209258_100253 Ga0209258_10025380 79
1214 3300025246 Ga0209646_1006525 Ga0209646_10065252 79
1215 3300025246 Ga0209646_1011658 Ga0209646_10116581 79
1216 3300025254 Ga0209148_1000018 Ga0209148_1000018268 79
1217 3300025254 Ga0209148_1000027 Ga0209148_1000027354 79
1218 3300025254 Ga0209148_1006738 Ga0209148_10067383 79
1219 3300025256 Ga0209759_1000327 Ga0209759_100032750 79
1220 3300025256 Ga0209759_1000804 Ga0209759_100080425 79
1221 3300025256 Ga0209759_1001294 Ga0209759_10012942 79
1222 3300025256 Ga0209759_1003179 Ga0209759_10031797 79
1223 3300025261 Ga0209233_1000135 Ga0209233_1000135125 79
1224 3300025272 Ga0209455_1000015 Ga0209455_1000015268 79
1225 3300025272 Ga0209455_1000213 Ga0209455_10002136 79
1226 3300025273 Ga0209673_1000201 Ga0209673_100020162 79
1227 3300025284 Ga0209130_1023870 Ga0209130_10238703 79
1228 3300025295 Ga0209564_1002800 Ga0209564_10028008 79
1229 3300025302 Ga0207426_1000240 Ga0207426_100024062 79
1230 3300025302 Ga0207426_1003279 Ga0207426_10032792 79
1231 3300025315 Ga0207697_10095477 Ga0207697_100954772 79
1232 3300025315 Ga0207697_10221012 Ga0207697_102210122 79
1233 3300025315 Ga0207697_10332004 Ga0207697_103320041 79
1234 3300025321 Ga0207656_10004225 Ga0207656_100042253 79
1235 3300025321 Ga0207656_10267178 Ga0207656_102671781 79
1236 3300025321 Ga0207656_10355207 Ga0207656_103552072 79
1237 3300025321 Ga0207656_10538468 Ga0207656_105384681 79
1238 3300025711 Ga0207696_1020681 Ga0207696_10206813 79
1239 3300025711 Ga0207696_1157107 Ga0207696_11571071 79
1240 3300025728 Ga0207655_1068184 Ga0207655_10681842 79
1241 3300025728 Ga0207655_1100383 Ga0207655_11003832 79
1242 3300025735 Ga0207713_1001188 Ga0207713_100118813 79
1243 3300025735 Ga0207713_1003181 Ga0207713_10031819 79
1244 3300025735 Ga0207713_1104041 Ga0207713_11040411 79
1245 3300025735 Ga0207713_1259058 Ga0207713_12590582 79
1246 3300025885 Ga0207653_10050773 Ga0207653_100507732 79
1247 3300025893 Ga0207682_10000600 Ga0207682_1000060011 79
1248 3300025893 Ga0207682_10042063 Ga0207682_100420632 79
1249 3300025893 Ga0207682_10043259 Ga0207682_100432592 79
1250 3300025893 Ga0207682_10133892 Ga0207682_101338922 79
1251 3300025893 Ga0207682_10151698 Ga0207682_101516981 79
1252 3300025893 Ga0207682_10230781 Ga0207682_102307811 79
1253 3300025898 Ga0207692_10261941 Ga0207692_102619412 79
1254 3300025898 Ga0207692_10308955 Ga0207692_103089552 79
1255 3300025898 Ga0207692_10536588 Ga0207692_105365882 79
1256 3300025898 Ga0207692_10999335 Ga0207692_109993351 79
1257 3300025899 Ga0207642_10639176 Ga0207642_106391762 79
1258 3300025899 Ga0207642_11140648 Ga0207642_111406482 79
1259 3300025900 Ga0207710_10067012 Ga0207710_100670122 79
1260 3300025900 Ga0207710_10120180 Ga0207710_101201802 79
1261 3300025900 Ga0207710_10231807 Ga0207710_102318071 79
1262 3300025900 Ga0207710_10700960 Ga0207710_107009601 79
1263 3300025901 Ga0207688_10127428 Ga0207688_101274282 79
1264 3300025901 Ga0207688_10164505 Ga0207688_101645052 79
1265 3300025901 Ga0207688_10420039 Ga0207688_104200392 79
1266 3300025903 Ga0207680_10000573 Ga0207680_1000057315 79
1267 3300025903 Ga0207680_10008494 Ga0207680_100084943 79
1268 3300025903 Ga0207680_10041684 Ga0207680_100416842 79
1269 3300025903 Ga0207680_10115095 Ga0207680_101150952 79
1270 3300025903 Ga0207680_10117934 Ga0207680_101179342 79
1271 3300025903 Ga0207680_10129161 Ga0207680_101291612 79
1272 3300025903 Ga0207680_10339211 Ga0207680_103392112 79
1273 3300025903 Ga0207680_10403014 Ga0207680_104030142 79
1274 3300025903 Ga0207680_10431713 Ga0207680_104317132 79
1275 3300025903 Ga0207680_10497584 Ga0207680_104975842 79
1276 3300025903 Ga0207680_10533256 Ga0207680_105332562 79
1277 3300025903 Ga0207680_10789411 Ga0207680_107894111 79
1278 3300025904 Ga0207647_10000835 Ga0207647_1000083511 79
1279 3300025904 Ga0207647_10007495 Ga0207647_100074955 79
1280 3300025904 Ga0207647_10009886 Ga0207647_100098864 79
1281 3300025904 Ga0207647_10015486 Ga0207647_100154862 79
1282 3300025904 Ga0207647_10022436 Ga0207647_100224362 79
1283 3300025904 Ga0207647_10029595 Ga0207647_100295951 79
1284 3300025904 Ga0207647_10253571 Ga0207647_102535712 79
1285 3300025904 Ga0207647_10477253 Ga0207647_104772531 79
1286 3300025906 Ga0207699_10378573 Ga0207699_103785732 79
1287 3300025906 Ga0207699_10981656 Ga0207699_109816562 79
1288 3300025907 Ga0207645_10004697 Ga0207645_1000469711 79
1289 3300025907 Ga0207645_10127862 Ga0207645_101278622 79
1290 3300025907 Ga0207645_10174486 Ga0207645_101744862 79
1291 3300025907 Ga0207645_10247802 Ga0207645_102478021 79
1292 3300025907 Ga0207645_10306374 Ga0207645_103063742 79
1293 3300025907 Ga0207645_10327248 Ga0207645_103272482 79
1294 3300025908 Ga0207643_10006465 Ga0207643_100064654 79
1295 3300025908 Ga0207643_10103188 Ga0207643_101031882 79
1296 3300025908 Ga0207643_10119999 Ga0207643_101199993 79
1297 3300025908 Ga0207643_10158788 Ga0207643_101587882 79
1298 3300025908 Ga0207643_10844815 Ga0207643_108448151 79
1299 3300025908 Ga0207643_10881654 Ga0207643_108816541 79
1300 3300025909 Ga0207705_10003399 Ga0207705_100033997 79
1301 3300025909 Ga0207705_10059351 Ga0207705_100593513 79
1302 3300025909 Ga0207705_10106604 Ga0207705_101066043 79
1303 3300025909 Ga0207705_10126994 Ga0207705_101269942 79
1304 3300025909 Ga0207705_10975620 Ga0207705_109756202 79
1305 3300025910 Ga0207684_10361746 Ga0207684_103617462 79
1306 3300025910 Ga0207684_10413142 Ga0207684_104131422 79
1307 3300025910 Ga0207684_10651679 Ga0207684_106516792 79
1308 3300025910 Ga0207684_11119150 Ga0207684_111191501 79
1309 3300025910 Ga0207684_11416434 Ga0207684_114164342 79
1310 3300025911 Ga0207654_10006792 Ga0207654_100067921 79
1311 3300025911 Ga0207654_10173299 Ga0207654_101732992 79
1312 3300025911 Ga0207654_10387167 Ga0207654_103871671 79
1313 3300025911 Ga0207654_11190603 Ga0207654_111906031 79
1314 3300025912 Ga0207707_10012029 Ga0207707_100120297 79
1315 3300025912 Ga0207707_10121019 Ga0207707_101210191 79
1316 3300025912 Ga0207707_10173235 Ga0207707_101732352 79
1317 3300025912 Ga0207707_10287340 Ga0207707_102873402 79
1318 3300025912 Ga0207707_10682440 Ga0207707_106824402 79
1319 3300025913 Ga0207695_10000295 Ga0207695_10000295100 79
1320 3300025913 Ga0207695_10011620 Ga0207695_100116205 79
1321 3300025913 Ga0207695_10036204 Ga0207695_100362042 79
1322 3300025913 Ga0207695_10043035 Ga0207695_100430355 79
1323 3300025913 Ga0207695_10125853 Ga0207695_101258533 79
1324 3300025913 Ga0207695_10134250 Ga0207695_101342502 79
1325 3300025913 Ga0207695_10328114 Ga0207695_103281143 79
1326 3300025913 Ga0207695_10331147 Ga0207695_103311472 79
1327 3300025913 Ga0207695_10446447 Ga0207695_104464472 79
1328 3300025913 Ga0207695_10960275 Ga0207695_109602751 79
1329 3300025914 Ga0207671_10016929 Ga0207671_100169293 79
1330 3300025914 Ga0207671_10063970 Ga0207671_100639702 79
1331 3300025914 Ga0207671_10120577 Ga0207671_101205772 79
1332 3300025914 Ga0207671_10124643 Ga0207671_101246432 79
1333 3300025915 Ga0207693_10001071 Ga0207693_1000107121 79
1334 3300025915 Ga0207693_10010413 Ga0207693_100104132 79
1335 3300025915 Ga0207693_10639411 Ga0207693_106394112 79
1336 3300025916 Ga0207663_10003519 Ga0207663_1000351910 79
1337 3300025916 Ga0207663_10230338 Ga0207663_102303382 79
1338 3300025916 Ga0207663_10293141 Ga0207663_102931412 79
1339 3300025916 Ga0207663_10404723 Ga0207663_104047232 79
1340 3300025917 Ga0207660_10238920 Ga0207660_102389202 79
1341 3300025917 Ga0207660_10698845 Ga0207660_106988452 79
1342 3300025917 Ga0207660_10806828 Ga0207660_108068281 79
1343 3300025917 Ga0207660_11075554 Ga0207660_110755542 79
1344 3300025918 Ga0207662_10051494 Ga0207662_100514943 79
1345 3300025918 Ga0207662_10219651 Ga0207662_102196512 79
1346 3300025918 Ga0207662_10297060 Ga0207662_102970602 79
1347 3300025918 Ga0207662_10438740 Ga0207662_104387402 79
1348 3300025918 Ga0207662_10543806 Ga0207662_105438062 79
1349 3300025919 Ga0207657_10000001 Ga0207657_10000001335 79
1350 3300025919 Ga0207657_10004018 Ga0207657_1000401815 79
1351 3300025919 Ga0207657_10011501 Ga0207657_1001150111 79
1352 3300025919 Ga0207657_10019179 Ga0207657_100191796 79
1353 3300025919 Ga0207657_10376247 Ga0207657_103762472 79
1354 3300025920 Ga0207649_10007431 Ga0207649_100074314 79
1355 3300025920 Ga0207649_10082869 Ga0207649_100828692 79
1356 3300025920 Ga0207649_10160663 Ga0207649_101606632 79
1357 3300025920 Ga0207649_10341982 Ga0207649_103419822 79
1358 3300025920 Ga0207649_10395570 Ga0207649_103955702 79
1359 3300025920 Ga0207649_10842209 Ga0207649_108422091 79
1360 3300025920 Ga0207649_11058742 Ga0207649_110587421 79
1361 3300025920 Ga0207649_11210202 Ga0207649_112102022 79
1362 3300025921 Ga0207652_10068590 Ga0207652_100685902 79
1363 3300025921 Ga0207652_10292895 Ga0207652_102928952 79
1364 3300025921 Ga0207652_10964425 Ga0207652_109644252 79
1365 3300025922 Ga0207646_10329052 Ga0207646_103290522 79
1366 3300025923 Ga0207681_10019593 Ga0207681_100195934 79
1367 3300025923 Ga0207681_10043508 Ga0207681_100435082 79
1368 3300025923 Ga0207681_10060616 Ga0207681_100606163 79
1369 3300025923 Ga0207681_10106257 Ga0207681_101062572 79
1370 3300025923 Ga0207681_10349848 Ga0207681_103498482 79
1371 3300025923 Ga0207681_10461862 Ga0207681_104618622 79
1372 3300025923 Ga0207681_10795144 Ga0207681_107951442 79
1373 3300025923 Ga0207681_10899162 Ga0207681_108991621 79
1374 3300025924 Ga0207694_10021170 Ga0207694_100211703 79
1375 3300025924 Ga0207694_10022298 Ga0207694_100222984 79
1376 3300025924 Ga0207694_10175693 Ga0207694_101756932 79
1377 3300025924 Ga0207694_10220409 Ga0207694_102204092 79
1378 3300025924 Ga0207694_10436466 Ga0207694_104364661 79
1379 3300025924 Ga0207694_10684056 Ga0207694_106840561 79
1380 3300025924 Ga0207694_10943521 Ga0207694_109435212 79
1381 3300025924 Ga0207694_11148950 Ga0207694_111489502 79
1382 3300025925 Ga0207650_10004702 Ga0207650_100047029 79
1383 3300025925 Ga0207650_10017867 Ga0207650_100178671 79
1384 3300025925 Ga0207650_10097653 Ga0207650_100976533 79
1385 3300025925 Ga0207650_10116911 Ga0207650_101169111 79
1386 3300025925 Ga0207650_10219846 Ga0207650_102198463 79
1387 3300025925 Ga0207650_10566613 Ga0207650_105666132 79
1388 3300025925 Ga0207650_10808513 Ga0207650_108085131 79
1389 3300025925 Ga0207650_10818117 Ga0207650_108181172 79
1390 3300025925 Ga0207650_11110663 Ga0207650_111106631 79
1391 3300025926 Ga0207659_10018959 Ga0207659_100189592 79
1392 3300025926 Ga0207659_10032891 Ga0207659_100328914 79
1393 3300025926 Ga0207659_10033204 Ga0207659_100332043 79
1394 3300025926 Ga0207659_10072091 Ga0207659_100720914 79
1395 3300025926 Ga0207659_10106090 Ga0207659_101060903 79
1396 3300025926 Ga0207659_10527489 Ga0207659_105274891 79
1397 3300025926 Ga0207659_10746805 Ga0207659_107468052 79
1398 3300025926 Ga0207659_10886310 Ga0207659_108863101 79
1399 3300025926 Ga0207659_11232731 Ga0207659_112327312 79
1400 3300025926 Ga0207659_11349021 Ga0207659_113490211 79
1401 3300025927 Ga0207687_10010306 Ga0207687_100103063 79
1402 3300025927 Ga0207687_10199412 Ga0207687_101994122 79
1403 3300025927 Ga0207687_10360826 Ga0207687_103608262 79
1404 3300025927 Ga0207687_10502354 Ga0207687_105023542 79
1405 3300025927 Ga0207687_10843075 Ga0207687_108430751 79
1406 3300025927 Ga0207687_11928080 Ga0207687_119280802 79
1407 3300025928 Ga0207700_10051359 Ga0207700_100513593 79
1408 3300025928 Ga0207700_10147438 Ga0207700_101474382 79
1409 3300025928 Ga0207700_10729243 Ga0207700_107292431 79
1410 3300025928 Ga0207700_11100419 Ga0207700_111004192 79
1411 3300025928 Ga0207700_11434543 Ga0207700_114345431 79
1412 3300025928 Ga0207700_11609433 Ga0207700_116094331 79
1413 3300025929 Ga0207664_10010925 Ga0207664_100109253 79
1414 3300025929 Ga0207664_11484866 Ga0207664_114848661 79
1415 3300025931 Ga0207644_10005182 Ga0207644_100051825 79
1416 3300025931 Ga0207644_10023304 Ga0207644_100233043 79
1417 3300025931 Ga0207644_10064495 Ga0207644_100644953 79
1418 3300025931 Ga0207644_10180156 Ga0207644_101801563 79
1419 3300025931 Ga0207644_10186482 Ga0207644_101864822 79
1420 3300025931 Ga0207644_10267490 Ga0207644_102674901 79
1421 3300025931 Ga0207644_10292083 Ga0207644_102920832 79
1422 3300025931 Ga0207644_10671212 Ga0207644_106712121 79
1423 3300025931 Ga0207644_11064226 Ga0207644_110642261 79
1424 3300025931 Ga0207644_11251714 Ga0207644_112517142 79
1425 3300025932 Ga0207690_10000006 Ga0207690_10000006319 79
1426 3300025932 Ga0207690_10065938 Ga0207690_100659382 79
1427 3300025932 Ga0207690_10704511 Ga0207690_107045112 79
1428 3300025932 Ga0207690_10944330 Ga0207690_109443301 79
1429 3300025933 Ga0207706_10079848 Ga0207706_100798482 79
1430 3300025933 Ga0207706_10094244 Ga0207706_100942441 79
1431 3300025933 Ga0207706_10160814 Ga0207706_101608142 79
1432 3300025933 Ga0207706_10184016 Ga0207706_101840163 79
1433 3300025933 Ga0207706_10242497 Ga0207706_102424972 79
1434 3300025933 Ga0207706_10666186 Ga0207706_106661861 79
1435 3300025933 Ga0207706_11063587 Ga0207706_110635872 79
1436 3300025934 Ga0207686_10037331 Ga0207686_100373313 79
1437 3300025934 Ga0207686_10157435 Ga0207686_101574351 79
1438 3300025934 Ga0207686_10499645 Ga0207686_104996452 79
1439 3300025935 Ga0207709_10762405 Ga0207709_107624052 79
1440 3300025935 Ga0207709_11826780 Ga0207709_118267801 79
1441 3300025936 Ga0207670_10011332 Ga0207670_100113325 79
1442 3300025936 Ga0207670_10364698 Ga0207670_103646982 79
1443 3300025936 Ga0207670_10730361 Ga0207670_107303611 79
1444 3300025936 Ga0207670_11357593 Ga0207670_113575931 79
1445 3300025937 Ga0207669_10050337 Ga0207669_100503373 79
1446 3300025937 Ga0207669_10061129 Ga0207669_100611292 79
1447 3300025937 Ga0207669_10107091 Ga0207669_101070912 79
1448 3300025937 Ga0207669_10431641 Ga0207669_104316412 79
1449 3300025937 Ga0207669_10433371 Ga0207669_104333711 79
1450 3300025937 Ga0207669_10909730 Ga0207669_109097302 79
1451 3300025937 Ga0207669_11004209 Ga0207669_110042092 79
1452 3300025938 Ga0207704_10091711 Ga0207704_100917111 79
1453 3300025938 Ga0207704_10561486 Ga0207704_105614862 79
1454 3300025938 Ga0207704_10590992 Ga0207704_105909921 79
1455 3300025938 Ga0207704_10800568 Ga0207704_108005682 79
1456 3300025939 Ga0207665_10013769 Ga0207665_100137696 79
1457 3300025939 Ga0207665_10041678 Ga0207665_100416783 79
1458 3300025939 Ga0207665_10924696 Ga0207665_109246962 79
1459 3300025940 Ga0207691_10008356 Ga0207691_100083564 79
1460 3300025940 Ga0207691_10014472 Ga0207691_100144727 79
1461 3300025940 Ga0207691_10019284 Ga0207691_100192847 79
1462 3300025940 Ga0207691_10075428 Ga0207691_100754282 79
1463 3300025940 Ga0207691_10229296 Ga0207691_102292962 79
1464 3300025940 Ga0207691_10270932 Ga0207691_102709322 79
1465 3300025940 Ga0207691_10340622 Ga0207691_103406221 79
1466 3300025940 Ga0207691_10452051 Ga0207691_104520512 79
1467 3300025940 Ga0207691_11657638 Ga0207691_116576381 79
1468 3300025941 Ga0207711_10000654 Ga0207711_1000065427 79
1469 3300025941 Ga0207711_10062960 Ga0207711_100629602 79
1470 3300025941 Ga0207711_10175461 Ga0207711_101754612 79
1471 3300025941 Ga0207711_10183684 Ga0207711_101836841 79
1472 3300025941 Ga0207711_10216730 Ga0207711_102167303 79
1473 3300025941 Ga0207711_10219887 Ga0207711_102198873 79
1474 3300025941 Ga0207711_10224577 Ga0207711_102245773 79
1475 3300025941 Ga0207711_10344939 Ga0207711_103449392 79
1476 3300025941 Ga0207711_10377045 Ga0207711_103770452 79
1477 3300025941 Ga0207711_11014897 Ga0207711_110148971 79
1478 3300025942 Ga0207689_10001032 Ga0207689_1000103224 79
1479 3300025942 Ga0207689_10030304 Ga0207689_100303045 79
1480 3300025942 Ga0207689_10145956 Ga0207689_101459562 79
1481 3300025942 Ga0207689_10161513 Ga0207689_101615132 79
1482 3300025942 Ga0207689_10300526 Ga0207689_103005262 79
1483 3300025942 Ga0207689_11233375 Ga0207689_112333752 79
1484 3300025942 Ga0207689_11318536 Ga0207689_113185361 79
1485 3300025944 Ga0207661_10118477 Ga0207661_101184773 79
1486 3300025944 Ga0207661_10667822 Ga0207661_106678222 79
1487 3300025944 Ga0207661_10730493 Ga0207661_107304932 79
1488 3300025945 Ga0207679_10074737 Ga0207679_100747373 79
1489 3300025945 Ga0207679_10197584 Ga0207679_101975842 79
1490 3300025945 Ga0207679_10644666 Ga0207679_106446661 79
1491 3300025945 Ga0207679_11070773 Ga0207679_110707732 79
1492 3300025945 Ga0207679_11096889 Ga0207679_110968891 79
1493 3300025945 Ga0207679_11383410 Ga0207679_113834102 79
1494 3300025945 Ga0207679_11692798 Ga0207679_116927982 79
1495 3300025949 Ga0207667_10004361 Ga0207667_100043617 79
1496 3300025949 Ga0207667_10016348 Ga0207667_100163488 79
1497 3300025949 Ga0207667_10016707 Ga0207667_100167074 79
1498 3300025949 Ga0207667_10040404 Ga0207667_100404047 79
1499 3300025949 Ga0207667_10172585 Ga0207667_101725852 79
1500 3300025949 Ga0207667_10282754 Ga0207667_102827542 79
1501 3300025949 Ga0207667_10325058 Ga0207667_103250583 79
1502 3300025949 Ga0207667_10668248 Ga0207667_106682482 79
1503 3300025949 Ga0207667_11591708 Ga0207667_115917081 79
1504 3300025960 Ga0207651_10004079 Ga0207651_100040793 79
1505 3300025960 Ga0207651_10005657 Ga0207651_100056574 79
1506 3300025960 Ga0207651_10015937 Ga0207651_100159372 79
1507 3300025960 Ga0207651_10025885 Ga0207651_100258852 79
1508 3300025960 Ga0207651_10154501 Ga0207651_101545013 79
1509 3300025960 Ga0207651_10944893 Ga0207651_109448932 79
1510 3300025961 Ga0207712_10202238 Ga0207712_102022382 79
1511 3300025961 Ga0207712_10611623 Ga0207712_106116232 79
1512 3300025961 Ga0207712_10754960 Ga0207712_107549601 79
1513 3300025961 Ga0207712_11182584 Ga0207712_111825842 79
1514 3300025972 Ga0207668_10002227 Ga0207668_100022274 79
1515 3300025972 Ga0207668_10036167 Ga0207668_100361673 79
1516 3300025972 Ga0207668_10036725 Ga0207668_100367253 79
1517 3300025972 Ga0207668_10052552 Ga0207668_100525522 79
1518 3300025972 Ga0207668_10087447 Ga0207668_100874471 79
1519 3300025972 Ga0207668_10090834 Ga0207668_100908342 79
1520 3300025972 Ga0207668_10655097 Ga0207668_106550971 79
1521 3300025972 Ga0207668_11030841 Ga0207668_110308412 79
1522 3300025972 Ga0207668_11157620 Ga0207668_111576202 79
1523 3300025981 Ga0207640_10201269 Ga0207640_102012692 79
1524 3300025981 Ga0207640_10273799 Ga0207640_102737992 79
1525 3300025981 Ga0207640_10433999 Ga0207640_104339991 79
1526 3300025981 Ga0207640_10435060 Ga0207640_104350602 79
1527 3300025981 Ga0207640_11472421 Ga0207640_114724212 79
1528 3300025981 Ga0207640_11649695 Ga0207640_116496951 79
1529 3300025986 Ga0207658_10004931 Ga0207658_100049317 79
1530 3300025986 Ga0207658_10014362 Ga0207658_100143622 79
1531 3300025986 Ga0207658_10081580 Ga0207658_100815802 79
1532 3300025986 Ga0207658_10278248 Ga0207658_102782482 79
1533 3300025986 Ga0207658_10361790 Ga0207658_103617902 79
1534 3300025986 Ga0207658_10485459 Ga0207658_104854592 79
1535 3300025986 Ga0207658_10532564 Ga0207658_105325641 79
1536 3300025986 Ga0207658_10542800 Ga0207658_105428002 79
1537 3300025986 Ga0207658_10618250 Ga0207658_106182502 79
1538 3300025986 Ga0207658_11547663 Ga0207658_115476631 79
1539 3300025986 Ga0207658_11889735 Ga0207658_118897351 79
1540 3300026023 Ga0207677_10000162 Ga0207677_1000016247 79
1541 3300026023 Ga0207677_10048568 Ga0207677_100485683 79
1542 3300026023 Ga0207677_10117757 Ga0207677_101177572 79
1543 3300026023 Ga0207677_10260857 Ga0207677_102608572 79
1544 3300026023 Ga0207677_10347127 Ga0207677_103471271 79
1545 3300026023 Ga0207677_10393675 Ga0207677_103936752 79
1546 3300026023 Ga0207677_10483471 Ga0207677_104834712 79
1547 3300026023 Ga0207677_10521638 Ga0207677_105216382 79
1548 3300026023 Ga0207677_10730582 Ga0207677_107305821 79
1549 3300026035 Ga0207703_10007505 Ga0207703_100075054 79
1550 3300026035 Ga0207703_10008217 Ga0207703_100082175 79
1551 3300026035 Ga0207703_10328884 Ga0207703_103288842 79
1552 3300026035 Ga0207703_10360445 Ga0207703_103604453 79
1553 3300026035 Ga0207703_10388901 Ga0207703_103889012 79
1554 3300026035 Ga0207703_10435773 Ga0207703_104357731 79
1555 3300026035 Ga0207703_10446774 Ga0207703_104467741 79
1556 3300026035 Ga0207703_10449791 Ga0207703_104497912 79
1557 3300026035 Ga0207703_10681946 Ga0207703_106819462 79
1558 3300026041 Ga0207639_10005858 Ga0207639_100058582 79
1559 3300026041 Ga0207639_10060867 Ga0207639_100608673 79
1560 3300026041 Ga0207639_10246661 Ga0207639_102466612 79
1561 3300026041 Ga0207639_10287186 Ga0207639_102871862 79
1562 3300026041 Ga0207639_10386797 Ga0207639_103867972 79
1563 3300026041 Ga0207639_10421851 Ga0207639_104218512 79
1564 3300026041 Ga0207639_10946441 Ga0207639_109464411 79
1565 3300026041 Ga0207639_11004550 Ga0207639_110045502 79
1566 3300026041 Ga0207639_11982576 Ga0207639_119825761 79
1567 3300026067 Ga0207678_10000167 Ga0207678_1000016744 79
1568 3300026067 Ga0207678_10087685 Ga0207678_100876852 79
1569 3300026067 Ga0207678_10142424 Ga0207678_101424242 79
1570 3300026067 Ga0207678_10264738 Ga0207678_102647382 79
1571 3300026067 Ga0207678_10273267 Ga0207678_102732671 79
1572 3300026067 Ga0207678_10441543 Ga0207678_104415432 79
1573 3300026067 Ga0207678_10502333 Ga0207678_105023331 79
1574 3300026067 Ga0207678_10612316 Ga0207678_106123162 79
1575 3300026067 Ga0207678_11287258 Ga0207678_112872581 79
1576 3300026075 Ga0207708_10167723 Ga0207708_101677232 79
1577 3300026075 Ga0207708_10399225 Ga0207708_103992251 79
1578 3300026075 Ga0207708_10679880 Ga0207708_106798802 79
1579 3300026075 Ga0207708_10770817 Ga0207708_107708171 79
1580 3300026075 Ga0207708_11560205 Ga0207708_115602052 79
1581 3300026075 Ga0207708_11813945 Ga0207708_118139451 79
1582 3300026075 Ga0207708_11959896 Ga0207708_119598961 79
1583 3300026078 Ga0207702_10007090 Ga0207702_100070901 79
1584 3300026078 Ga0207702_10113744 Ga0207702_101137442 79
1585 3300026078 Ga0207702_10115481 Ga0207702_101154814 79
1586 3300026078 Ga0207702_10271337 Ga0207702_102713373 79
1587 3300026078 Ga0207702_10345543 Ga0207702_103455432 79
1588 3300026078 Ga0207702_10847855 Ga0207702_108478551 79
1589 3300026078 Ga0207702_10954301 Ga0207702_109543011 79
1590 3300026078 Ga0207702_11762533 Ga0207702_117625331 79
1591 3300026088 Ga0207641_10004151 Ga0207641_1000415112 79
1592 3300026088 Ga0207641_10011107 Ga0207641_100111071 79
1593 3300026088 Ga0207641_10013613 Ga0207641_100136138 79
1594 3300026088 Ga0207641_10035367 Ga0207641_100353671 79
1595 3300026088 Ga0207641_10037526 Ga0207641_100375263 79
1596 3300026088 Ga0207641_10043578 Ga0207641_100435782 79
1597 3300026088 Ga0207641_10102166 Ga0207641_101021663 79
1598 3300026088 Ga0207641_10167505 Ga0207641_101675052 79
1599 3300026088 Ga0207641_10846487 Ga0207641_108464872 79
1600 3300026088 Ga0207641_11018968 Ga0207641_110189682 79
1601 3300026088 Ga0207641_11452295 Ga0207641_114522952 79
1602 3300026089 Ga0207648_10004696 Ga0207648_1000469612 79
1603 3300026089 Ga0207648_10025450 Ga0207648_100254503 79
1604 3300026089 Ga0207648_10034975 Ga0207648_100349751 79
1605 3300026089 Ga0207648_10053682 Ga0207648_100536822 79
1606 3300026089 Ga0207648_10068494 Ga0207648_100684941 79
1607 3300026089 Ga0207648_10154746 Ga0207648_101547463 79
1608 3300026089 Ga0207648_10200423 Ga0207648_102004232 79
1609 3300026089 Ga0207648_10410248 Ga0207648_104102483 79
1610 3300026089 Ga0207648_10670582 Ga0207648_106705822 79
1611 3300026089 Ga0207648_10777652 Ga0207648_107776522 79
1612 3300026089 Ga0207648_10869957 Ga0207648_108699572 79
1613 3300026089 Ga0207648_11858176 Ga0207648_118581762 79
1614 3300026095 Ga0207676_10000451 Ga0207676_1000045136 79
1615 3300026095 Ga0207676_10001747 Ga0207676_100017478 79
1616 3300026095 Ga0207676_10007467 Ga0207676_100074672 79
1617 3300026095 Ga0207676_10049757 Ga0207676_100497572 79
1618 3300026095 Ga0207676_10079044 Ga0207676_100790442 79
1619 3300026095 Ga0207676_10131379 Ga0207676_101313792 79
1620 3300026095 Ga0207676_10485811 Ga0207676_104858112 79
1621 3300026095 Ga0207676_10624228 Ga0207676_106242281 79
1622 3300026095 Ga0207676_11222189 Ga0207676_112221892 79
1623 3300026095 Ga0207676_11631282 Ga0207676_116312821 79
1624 3300026116 Ga0207674_10003529 Ga0207674_100035292 79
1625 3300026116 Ga0207674_10099176 Ga0207674_100991763 79
1626 3300026116 Ga0207674_10117508 Ga0207674_101175082 79
1627 3300026116 Ga0207674_10224931 Ga0207674_102249312 79
1628 3300026116 Ga0207674_10269455 Ga0207674_102694553 79
1629 3300026116 Ga0207674_10849781 Ga0207674_108497812 79
1630 3300026116 Ga0207674_11490641 Ga0207674_114906412 79
1631 3300026116 Ga0207674_12244361 Ga0207674_122443611 79
1632 3300026118 Ga0207675_100006036 Ga0207675_1000060364 79
1633 3300026118 Ga0207675_100067821 Ga0207675_1000678213 79
1634 3300026118 Ga0207675_100096866 Ga0207675_1000968663 79
1635 3300026118 Ga0207675_100150043 Ga0207675_1001500432 79
1636 3300026118 Ga0207675_100554570 Ga0207675_1005545702 79
1637 3300026118 Ga0207675_100598291 Ga0207675_1005982912 79
1638 3300026118 Ga0207675_100657482 Ga0207675_1006574822 79
1639 3300026118 Ga0207675_100713683 Ga0207675_1007136832 79
1640 3300026121 Ga0207683_10006461 Ga0207683_100064614 79
1641 3300026121 Ga0207683_10033759 Ga0207683_100337593 79
1642 3300026121 Ga0207683_10200175 Ga0207683_102001752 79
1643 3300026121 Ga0207683_10307488 Ga0207683_103074882 79
1644 3300026121 Ga0207683_10438636 Ga0207683_104386362 79
1645 3300026121 Ga0207683_10552178 Ga0207683_105521782 79
1646 3300026121 Ga0207683_10854190 Ga0207683_108541901 79
1647 3300026121 Ga0207683_11383370 Ga0207683_113833701 79
1648 3300026121 Ga0207683_11418563 Ga0207683_114185631 79
1649 3300026142 Ga0207698_10025847 Ga0207698_100258473 79
1650 3300026142 Ga0207698_10026274 Ga0207698_100262743 79
1651 3300026142 Ga0207698_10094050 Ga0207698_100940504 79
1652 3300026142 Ga0207698_10151169 Ga0207698_101511693 79
1653 3300026142 Ga0207698_10178520 Ga0207698_101785202 79
1654 3300026142 Ga0207698_10313535 Ga0207698_103135352 79
1655 3300026142 Ga0207698_10779177 Ga0207698_107791772 79
1656 3300026142 Ga0207698_10834999 Ga0207698_108349992 79
1657 3300026142 Ga0207698_10842720 Ga0207698_108427202 79
1658 3300026142 Ga0207698_10858544 Ga0207698_108585441 79
1659 3300026142 Ga0207698_11788398 Ga0207698_117883981 79
1660 3300027312 Ga0209371_1000297 Ga0209371_100029743 79
1661 3300027312 Ga0209371_1014528 Ga0209371_10145283 79
1662 3300027360 Ga0209969_1004652 Ga0209969_10046522 79
1663 3300027360 Ga0209969_1022702 Ga0209969_10227022 79
1664 3300027364 Ga0209967_1000890 Ga0209967_10008903 79
1665 3300027364 Ga0209967_1017888 Ga0209967_10178882 79
1666 3300027364 Ga0209967_1071006 Ga0209967_10710061 79
1667 3300027378 Ga0209981_1001970 Ga0209981_10019702 79
1668 3300027378 Ga0209981_1016193 Ga0209981_10161932 79
1669 3300027395 Ga0209996_1005820 Ga0209996_10058201 79
1670 3300027424 Ga0209984_1007553 Ga0209984_10075532 79
1671 3300027424 Ga0209984_1046486 Ga0209984_10464861 79
1672 3300027462 Ga0210000_1000628 Ga0210000_10006286 79
1673 3300027462 Ga0210000_1003114 Ga0210000_10031142 79
1674 3300027471 Ga0209995_1000831 Ga0209995_10008314 79
1675 3300027526 Ga0209968_1022603 Ga0209968_10226032 79
1676 3300027526 Ga0209968_1040753 Ga0209968_10407532 79
1677 3300027543 Ga0209999_1001887 Ga0209999_10018876 79
1678 3300027543 Ga0209999_1025950 Ga0209999_10259501 79
1679 3300027552 Ga0209982_1001464 Ga0209982_10014645 79
1680 3300027552 Ga0209982_1003265 Ga0209982_10032652 79
1681 3300027614 Ga0209970_1015429 Ga0209970_10154292 79
1682 3300027614 Ga0209970_1017888 Ga0209970_10178882 79
1683 3300027617 Ga0210002_1028995 Ga0210002_10289952 79
1684 3300027665 Ga0209983_1014893 Ga0209983_10148933 79
1685 3300027665 Ga0209983_1028000 Ga0209983_10280002 79
1686 3300027665 Ga0209983_1039414 Ga0209983_10394141 79
1687 3300027665 Ga0209983_1151829 Ga0209983_11518291 79
1688 3300027671 Ga0209588_1032443 Ga0209588_10324432 79
1689 3300027671 Ga0209588_1121063 Ga0209588_11210632 79
1690 3300027682 Ga0209971_1001915 Ga0209971_10019153 79
1691 3300027682 Ga0209971_1032910 Ga0209971_10329102 79
1692 3300027682 Ga0209971_1053610 Ga0209971_10536102 79
1693 3300027695 Ga0209966_1023126 Ga0209966_10231262 79
1694 3300027695 Ga0209966_1050960 Ga0209966_10509602 79
1695 3300027695 Ga0209966_1060882 Ga0209966_10608822 79
1696 3300027876 Ga0209974_10003639 Ga0209974_100036397 79
1697 3300027876 Ga0209974_10005991 Ga0209974_100059915 79
1698 3300027876 Ga0209974_10018146 Ga0209974_100181462 79
1699 3300027907 Ga0207428_10043638 Ga0207428_100436382 79
1700 3300027907 Ga0207428_10632574 Ga0207428_106325742 79
1701 3300028379 Ga0268266_10009629 Ga0268266_100096294 79
1702 3300028379 Ga0268266_10114058 Ga0268266_101140583 79
1703 3300028379 Ga0268266_10115607 Ga0268266_101156073 79
1704 3300028379 Ga0268266_10199657 Ga0268266_101996572 79
1705 3300028379 Ga0268266_10254204 Ga0268266_102542042 79
1706 3300028379 Ga0268266_10460789 Ga0268266_104607892 79
1707 3300028379 Ga0268266_10645931 Ga0268266_106459311 79
1708 3300028379 Ga0268266_11123081 Ga0268266_111230812 79
1709 3300028379 Ga0268266_11665048 Ga0268266_116650481 79
1710 3300028379 Ga0268266_12051178 Ga0268266_120511781 79
1711 3300028380 Ga0268265_10042652 Ga0268265_100426522 79
1712 3300028380 Ga0268265_10264736 Ga0268265_102647362 79
1713 3300028380 Ga0268265_10328407 Ga0268265_103284072 79
1714 3300028380 Ga0268265_10358848 Ga0268265_103588481 79
1715 3300028380 Ga0268265_10702497 Ga0268265_107024972 79
1716 3300028380 Ga0268265_10821593 Ga0268265_108215932 79
1717 3300028380 Ga0268265_11240709 Ga0268265_112407092 79
1718 3300028381 Ga0268264_10002760 Ga0268264_1000276019 79
1719 3300028381 Ga0268264_10005591 Ga0268264_100055915 79
1720 3300028381 Ga0268264_10011193 Ga0268264_100111933 79
1721 3300028381 Ga0268264_10074061 Ga0268264_100740613 79
1722 3300028381 Ga0268264_10193300 Ga0268264_101933002 79
1723 3300028381 Ga0268264_10360459 Ga0268264_103604591 79
1724 3300028381 Ga0268264_10452669 Ga0268264_104526691 79
1725 3300028381 Ga0268264_10618414 Ga0268264_106184142 79
1726 3300028381 Ga0268264_11040045 Ga0268264_110400452 79
1727 3300028381 Ga0268264_11756236 Ga0268264_117562361 79
1728 3300028381 Ga0268264_11777998 Ga0268264_117779982 79
1729 3300028563 Ga0265319_1168789 Ga0265319_11687892 79
1730 3300028577 Ga0265318_10137665 Ga0265318_101376652 79
1731 3300028786 Ga0307517_10370830 Ga0307517_103708301 79
1732 3300028800 Ga0265338_10000104 Ga0265338_1000010437 79
1733 3300028800 Ga0265338_10002059 Ga0265338_1000205927 79
1734 3300029957 Ga0265324_10232921 Ga0265324_102329212 79
1735 3300030500 Ga0268256_1000261 Ga0268256_100026120 79
1736 3300030500 Ga0268256_1016085 Ga0268256_10160852 79
1737 3300030863 Ga0265766_1014920 Ga0265766_10149201 79
1738 3300030863 Ga0265766_1022216 Ga0265766_10222161 79
1739 3300030888 Ga0265769_109769 Ga0265769_1097691 79
1740 3300031235 Ga0265330_10009093 Ga0265330_100090935 79
1741 3300031238 Ga0265332_10000824 Ga0265332_100008241 79
1742 3300031239 Ga0265328_10008589 Ga0265328_100085892 79
1743 3300031240 Ga0265320_10121715 Ga0265320_101217152 79
1744 3300031241 Ga0265325_10090302 Ga0265325_100903022 79
1745 3300031242 Ga0265329_10004859 Ga0265329_100048594 79
1746 3300031250 Ga0265331_10000305 Ga0265331_1000030549 79
1747 3300031251 Ga0265327_10004446 Ga0265327_100044463 79
1748 3300031344 Ga0265316_10015795 Ga0265316_100157954 79
1749 3300031344 Ga0265316_10247381 Ga0265316_102473812 79
1750 3300031344 Ga0265316_10394771 Ga0265316_103947712 79
1751 3300031548 Ga0307408_100029481 Ga0307408_1000294814 79
1752 3300031548 Ga0307408_100145866 Ga0307408_1001458662 79
1753 3300031548 Ga0307408_100569474 Ga0307408_1005694742 79
1754 3300031548 Ga0307408_100767607 Ga0307408_1007676072 79
1755 3300031548 Ga0307408_101112395 Ga0307408_1011123952 79
1756 3300031665 Ga0316575_10002071 Ga0316575_100020712 79
1757 3300031665 Ga0316575_10007475 Ga0316575_100074751 79
1758 3300031665 Ga0316575_10009398 Ga0316575_100093985 79
1759 3300031665 Ga0316575_10069068 Ga0316575_100690682 79
1760 3300031691 Ga0316579_10089832 Ga0316579_100898322 79
1761 3300031711 Ga0265314_10115968 Ga0265314_101159682 79
1762 3300031712 Ga0265342_10091945 Ga0265342_100919451 79
1763 3300031712 Ga0265342_10641431 Ga0265342_106414312 79
1764 3300031727 Ga0316576_10006590 Ga0316576_100065904 79
1765 3300031728 Ga0316578_10018579 Ga0316578_100185794 79
1766 3300031728 Ga0316578_10748156 Ga0316578_107481562 79
1767 3300031731 Ga0307405_10010971 Ga0307405_100109712 79
1768 3300031731 Ga0307405_10207011 Ga0307405_102070112 79
1769 3300031731 Ga0307405_11320174 Ga0307405_113201742 79
1770 3300031731 Ga0307405_11499036 Ga0307405_114990361 79
1771 3300031814 Ga0247548_102195 Ga0247548_1021952 79
1772 3300031824 Ga0307413_10020134 Ga0307413_100201342 79
1773 3300031824 Ga0307413_10314636 Ga0307413_103146362 79
1774 3300031824 Ga0307413_11455851 Ga0307413_114558512 79
1775 3300031852 Ga0307410_10089068 Ga0307410_100890682 79
1776 3300031852 Ga0307410_10114262 Ga0307410_101142623 79
1777 3300031852 Ga0307410_10116672 Ga0307410_101166723 79
1778 3300031852 Ga0307410_10128268 Ga0307410_101282683 79
1779 3300031901 Ga0307406_10007130 Ga0307406_100071304 79
1780 3300031901 Ga0307406_10063403 Ga0307406_100634033 79
1781 3300031901 Ga0307406_10117253 Ga0307406_101172533 79
1782 3300031903 Ga0307407_10001249 Ga0307407_100012495 79
1783 3300031903 Ga0307407_10067954 Ga0307407_100679542 79
1784 3300031903 Ga0307407_10335608 Ga0307407_103356082 79
1785 3300031911 Ga0307412_10000008 Ga0307412_10000008336 79
1786 3300031911 Ga0307412_10023363 Ga0307412_100233632 79
1787 3300031911 Ga0307412_10092788 Ga0307412_100927882 79
1788 3300031911 Ga0307412_10109182 Ga0307412_101091822 79
1789 3300031911 Ga0307412_10368925 Ga0307412_103689252 79
1790 3300031995 Ga0307409_100041499 Ga0307409_1000414994 79
1791 3300031995 Ga0307409_100604805 Ga0307409_1006048052 79
1792 3300031995 Ga0307409_100779299 Ga0307409_1007792992 79
1793 3300031995 Ga0307409_101059768 Ga0307409_1010597682 79
1794 3300032002 Ga0307416_100004433 Ga0307416_1000044338 79
1795 3300032002 Ga0307416_100020107 Ga0307416_1000201073 79
1796 3300032002 Ga0307416_100023587 Ga0307416_1000235873 79
1797 3300032002 Ga0307416_100475719 Ga0307416_1004757192 79
1798 3300032002 Ga0307416_101645891 Ga0307416_1016458912 79
1799 3300032002 Ga0307416_103767607 Ga0307416_1037676072 79
1800 3300032004 Ga0307414_10007240 Ga0307414_100072402 79
1801 3300032004 Ga0307414_10200312 Ga0307414_102003122 79
1802 3300032004 Ga0307414_10524409 Ga0307414_105244092 79
1803 3300032004 Ga0307414_10561373 Ga0307414_105613731 79
1804 3300032005 Ga0307411_10012879 Ga0307411_100128792 79
1805 3300032005 Ga0307411_10318278 Ga0307411_103182781 79
1806 3300032005 Ga0307411_10932152 Ga0307411_109321522 79
1807 3300032005 Ga0307411_12160475 Ga0307411_121604752 79
1808 3300032126 Ga0307415_100030356 Ga0307415_1000303562 79
1809 3300032126 Ga0307415_101769527 Ga0307415_1017695271 79
1810 3300032133 Ga0316583_10001269 Ga0316583_100012693 79
1811 3300032133 Ga0316583_10005979 Ga0316583_100059794 79
1812 3300032133 Ga0316583_10010915 Ga0316583_100109153 79
1813 3300032139 Ga0316580_10026428 Ga0316580_100264282 79
1814 3300032168 Ga0316593_10080302 Ga0316593_100803022 79
1815 3300033527 Ga0316586_1091140 Ga0316586_10911402 79
1816 3300033547 Ga0316212_1057993 Ga0316212_10579931 79
1817 3300034816 Ga0373930_0111087 Ga0373930_0111087_68_346 79
1818 3300034820 Ga0373959_0046960 Ga0373959_0046960_401_658 79
1819 3300035084 Ga0373928_0020488 Ga0373928_0020488_164_421 79
1820 3300035084 Ga0373928_0123844 Ga0373928_0123844_289_528 79
1821 3300035085 Ga0373929_0008628 Ga0373929_0008628_1608_1865 79
1822 3300035086 Ga0373934_0010703 Ga0373934_0010703_386_625 79
1823 3300035089 Ga0373944_0258699 Ga0373944_0258699_338_577 79
1824 3300035090 Ga0373949_0059598 Ga0373949_0059598_228_467 79
1825 3300035111 Ga0373923_0023084 Ga0373923_0023084_301_540 79
1826 3300035113 Ga0373936_0598101 Ga0373936_0598101_36_275 79
1827 3300035114 Ga0373939_0072159 Ga0373939_0072159_71_310 79
1828 3300035114 Ga0373939_0180533 Ga0373939_0180533_303_542 79
1829 3300035114 Ga0373939_0363524 Ga0373939_0363524_256_495 79
1830 3300035114 Ga0373939_0413447 Ga0373939_0413447_86_328 79
1831 3300035117 Ga0373953_0001744 Ga0373953_0001744_6076_6315 79
1832 3300035118 Ga0373954_0002279 Ga0373954_0002279_436_675 79
1833 3300035170 Ga0373943_0048322 Ga0373943_0048322_663_902 79
1834 3300035171 Ga0373946_0614035 Ga0373946_0614035_294_533 79
1835 3300035172 Ga0373955_0007947 Ga0373955_0007947_4357_4596 79
1836 3300035172 Ga0373955_0627946 Ga0373955_0627946_161_400 79
1837 3300035207 Ga0373942_0010434 Ga0373942_0010434_1804_2043 79
1838 3300035207 Ga0373942_0234637 Ga0373942_0234637_192_431 79
1839 3300035398 Ga0316574_0064950 Ga0316574_0064950_414_656 79
1840 3300035398 Ga0316574_0261170 Ga0316574_0261170_82_324 79
1841 3300035398 Ga0316574_0404562 Ga0316574_0404562_506_745 79
1842 3300035691 Ga0373931_0293893 Ga0373931_0293893_527_766 79
1843 3300035691 Ga0373931_0824205 Ga0373931_0824205_254_493 79
1844 3300035691 Ga0373931_1163084 Ga0373931_1163084_153_431 79
1845 3300035692 Ga0373935_0141319 Ga0373935_0141319_1142_1381 79
1846 3300035695 Ga0373927_0049863 Ga0373927_0049863_2253_2492 79
1847 3300035695 Ga0373927_0306027 Ga0373927_0306027_27_281 79
1848 3300035724 Ga0373933_0297291 Ga0373933_0297291_425_667 79
1849 3300035724 Ga0373933_0326774 Ga0373933_0326774_12_251 79
1850 3300035724 Ga0373933_0441592 Ga0373933_0441592_457_696 79
1851 3300035724 Ga0373933_0849958 Ga0373933_0849958_251_490 79
1852 3300035724 Ga0373933_1106112 Ga0373933_1106112_193_432 79
1853 3300035725 Ga0373947_0153700 Ga0373947_0153700_920_1159 79
1854 3300035725 Ga0373947_0879496 Ga0373947_0879496_81_320 79
1855 3300036401 Ga0373937_0057219 Ga0373937_0057219_603_842 79
1856 3300036401 Ga0373937_0334657 Ga0373937_0334657_848_1087 79
1857 3300036401 Ga0373937_0364493 Ga0373937_0364493_666_908 79
1858 3300036457 Ga0265778_065979 Ga0265778_065979_134_373 79
1859 3300036647 Ga0316582_0014186 Ga0316582_0014186_2319_2558 79
1860 3300037068 Ga0373925_0057755 Ga0373925_0057755_1977_2231 79
1861 3300037068 Ga0373925_0082947 Ga0373925_0082947_842_1081 79
1862 3300037312 Ga0395899_0000041 Ga0395899_0000041_74546_74785 79
1863 3300037312 Ga0395899_0080162 Ga0395899_0080162_1603_1842 79
1864 3300037418 Ga0395900_0000797 Ga0395900_0000797_36796_37035 79
1865 3300037418 Ga0395900_0001690 Ga0395900_0001690_22851_23090 79
1866 3300037418 Ga0395900_0101488 Ga0395900_0101488_432_671 79
1867 3300037418 Ga0395900_0230840 Ga0395900_0230840_175_414 79
1868 3300037418 Ga0395900_0312542 Ga0395900_0312542_896_1135 79
1869 3300037466 Ga0395898_0000220 Ga0395898_0000220_71643_71882 79
1870 3300037466 Ga0395898_0000947 Ga0395898_0000947_4595_4834 79
1871 3300037466 Ga0395898_0005227 Ga0395898_0005227_9247_9486 79
1872 3300037466 Ga0395898_0098763 Ga0395898_0098763_1946_2185 79
1873 3300037466 Ga0395898_0997774 Ga0395898_0997774_20_259 79
1874 3300037471 Ga0395905_0000098 Ga0395905_0000098_64268_64507 79
1875 3300037471 Ga0395905_0031587 Ga0395905_0031587_3914_4153 79
1876 3300037588 Ga0316581_0001344 Ga0316581_0001344_897_1136 79
1877 3300037853 Ga0436364_0882767 Ga0436364_0882767_390_632 79
1878 3300038443 Ga0395901_0000011 Ga0395901_0000011_67815_68054 79
1879 3300038443 Ga0395901_0000106 Ga0395901_0000106_58381_58620 79
1880 3300038443 Ga0395901_0000423 Ga0395901_0000423_3268_3507 79
1881 3300038443 Ga0395901_0506561 Ga0395901_0506561_562_801 79
1882 3300039437 Ga0436365_0200015 Ga0436365_0200015_103_342 79
1883 3300039437 Ga0436365_0661281 Ga0436365_0661281_506_745 79
1884 3300039437 Ga0436365_1306082 Ga0436365_1306082_2109_2348 79
1885 3300039438 Ga0436360_0638761 Ga0436360_0638761_101_340 79
1886 3300039438 Ga0436360_0767044 Ga0436360_0767044_488_727 79
1887 3300039438 Ga0436360_1321577 Ga0436360_1321577_918_1157 79
1888 3300039447 Ga0436361_0360842 Ga0436361_0360842_7195_7434 79
1889 3300039447 Ga0436361_0380284 Ga0436361_0380284_87_326 79
1890 3300039447 Ga0436361_0779041 Ga0436361_0779041_1025_1267 79
1891 3300039447 Ga0436361_0781847 Ga0436361_0781847_1247_1486 79
1892 3300039447 Ga0436361_1162453 Ga0436361_1162453_1035_1274 79
1893 3300041404 Ga0439436_0148006 Ga0439436_0148006_131_373 79
1894 3300041406 Ga0439439_0060116 Ga0439439_0060116_743_982 79
1895 3300041406 Ga0439439_0138629 Ga0439439_0138629_222_461 79
1896 3300041407 Ga0439447_129618 Ga0439447_129618_166_408 79
1897 3300041410 Ga0439461_0225447 Ga0439461_0225447_190_432 79
1898 3300041452 Ga0451793_1085242 Ga0451793_1085242_192_431 79
1899 3300041492 Ga0451835_0482549 Ga0451835_0482549_228_467 79
1900 3300041496 Ga0451839_1417856 Ga0451839_1417856_146_385 79
1901 3300041512 Ga0451853_1934416 Ga0451853_1934416_356_595 79
1902 3300041512 Ga0451853_2569216 Ga0451853_2569216_161_400 79
1903 3300042001 Ga0439441_036553 Ga0439441_036553_499_741 79
1904 3300042002 Ga0439442_050104 Ga0439442_050104_176_418 79
1905 3300042003 Ga0439443_005158 Ga0439443_005158_1460_1702 79
1906 3300042003 Ga0439443_062206 Ga0439443_062206_236_475 79
1907 3300042005 Ga0439448_0000799 Ga0439448_0000799_2130_2369 79
1908 3300042009 Ga0439451_038169 Ga0439451_038169_295_537 79
1909 3300042013 Ga0439456_108678 Ga0439456_108678_332_574 79
1910 3300042117 Ga0450913_009229 Ga0450913_009229_404_643 79
1911 3300042124 Ga0450922_023106 Ga0450922_023106_13_255 79
1912 3300042125 Ga0450923_000546 Ga0450923_000546_1912_2154 79
1913 3300042126 Ga0450888_015898 Ga0450888_015898_133_375 79
1914 3300042126 Ga0450888_047687 Ga0450888_047687_314_553 79
1915 3300042126 Ga0450888_068920 Ga0450888_068920_148_390 79
1916 3300042128 Ga0450897_010779 Ga0450897_010779_165_404 79
1917 3300042128 Ga0450897_036016 Ga0450897_036016_284_526 79
1918 3300042131 Ga0450894_004246 Ga0450894_004246_182_424 79
1919 3300042134 Ga0450898_017167 Ga0450898_017167_661_903 79
1920 3300042134 Ga0450898_049929 Ga0450898_049929_63_311 79
1921 3300042147 Ga0450910_004089 Ga0450910_004089_1422_1664 79
1922 3300042156 Ga0439446_0000630 Ga0439446_0000630_5260_5502 79
1923 3300042156 Ga0439446_0003297 Ga0439446_0003297_1908_2147 79
1924 3300042184 Ga0450908_005760 Ga0450908_005760_1598_1840 79
1925 3300042185 Ga0450909_028872 Ga0450909_028872_494_736 79
1926 3300042435 Ga0439434_0028425 Ga0439434_0028425_210_452 79
1927 3300042435 Ga0439434_0055560 Ga0439434_0055560_748_987 79
1928 3300042436 Ga0439435_0000294 Ga0439435_0000294_77_319 79
1929 3300042436 Ga0439435_0072035 Ga0439435_0072035_183_422 79
1930 3300042436 Ga0439435_0078151 Ga0439435_0078151_165_404 79
1931 3300042437 Ga0439444_0000596 Ga0439444_0000596_1727_1969 79
1932 3300042461 Ga0439460_0014563 Ga0439460_0014563_1258_1497 79
1933 3300042461 Ga0439460_0017305 Ga0439460_0017305_203_445 79
1934 3300042461 Ga0439460_0109199 Ga0439460_0109199_26_268 79
1935 3300042530 Ga0450916_066143 Ga0450916_066143_305_547 79
1936 3300042531 Ga0450918_008432 Ga0450918_008432_141_383 79
1937 3300042532 Ga0450893_0107581 Ga0450893_0107581_104_346 79
1938 3300042876 Ga0451577_0006944 Ga0451577_0006944_1312_1554 79
1939 3300042876 Ga0451577_0030634 Ga0451577_0030634_3390_3629 79
1940 3300042876 Ga0451577_0034347 Ga0451577_0034347_3798_4040 79
1941 3300042876 Ga0451577_0034644 Ga0451577_0034644_1326_1565 79
1942 3300042876 Ga0451577_0043761 Ga0451577_0043761_1612_1854 79
1943 3300042876 Ga0451577_0044644 Ga0451577_0044644_591_830 79
1944 3300042876 Ga0451577_0063910 Ga0451577_0063910_404_646 79
1945 3300042876 Ga0451577_1871569 Ga0451577_1871569_71_310 79
1946 3300042876 Ga0451577_1930707 Ga0451577_1930707_115_357 79
1947 3300042876 Ga0451577_1967274 Ga0451577_1967274_139_381 79
1948 3300044656 Ga0466969_0000212 Ga0466969_0000212_23590_23829 79
1949 3300044656 Ga0466969_0002954 Ga0466969_0002954_8633_8872 79
1950 3300044656 Ga0466969_0004471 Ga0466969_0004471_5925_6164 79
1951 3300044656 Ga0466969_0167284 Ga0466969_0167284_653_895 79
1952 3300044658 Ga0466972_0020242 Ga0466972_0020242_665_904 79
1953 3300044659 Ga0466973_0017092 Ga0466973_0017092_1528_1767 79
1954 3300044666 Ga0466977_0003512 Ga0466977_0003512_2902_3144 79
1955 3300044672 Ga0466982_0408480 Ga0466982_0408480_475_714 79
1956 3300044673 Ga0453683_0011624 Ga0453683_0011624_4296_4535 79
1957 3300044673 Ga0453683_0044511 Ga0453683_0044511_2416_2655 79
1958 3300044673 Ga0453683_0325319 Ga0453683_0325319_290_529 79
1959 3300044683 Ga0466965_0003246 Ga0466965_0003246_6763_7002 79
1960 3300044683 Ga0466965_0018893 Ga0466965_0018893_2143_2382 79
1961 3300044684 Ga0466966_0000244 Ga0466966_0000244_35747_35986 79
1962 3300044684 Ga0466966_0018072 Ga0466966_0018072_1078_1317 79
1963 3300044684 Ga0466966_0028514 Ga0466966_0028514_369_608 79
1964 3300044684 Ga0466966_0202153 Ga0466966_0202153_495_734 79
1965 3300044684 Ga0466966_0346698 Ga0466966_0346698_307_546 79
1966 3300044693 Ga0466961_0000037 Ga0466961_0000037_6682_6921 79
1967 3300044693 Ga0466961_0003134 Ga0466961_0003134_7644_7883 79
1968 3300044693 Ga0466961_0028625 Ga0466961_0028625_1049_1288 79
1969 3300044693 Ga0466961_0097182 Ga0466961_0097182_1265_1504 79
1970 3300044694 Ga0466963_0001278 Ga0466963_0001278_6332_6571 79
1971 3300044694 Ga0466963_0017736 Ga0466963_0017736_2575_2814 79
1972 3300044694 Ga0466963_0026281 Ga0466963_0026281_2910_3149 79
1973 3300044706 Ga0466964_0000841 Ga0466964_0000841_3180_3419 79
1974 3300044712 Ga0453684_0000816 Ga0453684_0000816_72449_72688 79
1975 3300044712 Ga0453684_0179144 Ga0453684_0179144_1675_1914 79
1976 3300044712 Ga0453684_0179370 Ga0453684_0179370_1493_1735 79
1977 3300044712 Ga0453684_0339420 Ga0453684_0339420_959_1201 79
1978 3300044712 Ga0453684_0752183 Ga0453684_0752183_436_675 79
1979 3300044712 Ga0453684_1994803 Ga0453684_1994803_192_434 79
1980 3300044719 Ga0466971_0001557 Ga0466971_0001557_1627_1866 79
1981 3300044719 Ga0466971_0007613 Ga0466971_0007613_2897_3136 79
1982 3300044719 Ga0466971_0025660 Ga0466971_0025660_393_632 79
1983 3300044735 Ga0466968_0009829 Ga0466968_0009829_1486_1782 79
1984 3300044735 Ga0466968_0037762 Ga0466968_0037762_926_1165 79
1985 3300044735 Ga0466968_0358432 Ga0466968_0358432_42_281 79
1986 3300044735 Ga0466968_0682095 Ga0466968_0682095_23_262 79
1987 3300044765 Ga0466970_0021582 Ga0466970_0021582_1712_1951 79
1988 3300044765 Ga0466970_0029366 Ga0466970_0029366_79_318 79
1989 3300044765 Ga0466970_0253667 Ga0466970_0253667_423_662 79
1990 3300044842 Ga0466957_0003208 Ga0466957_0003208_2023_2262 79
1991 3300044842 Ga0466957_0003616 Ga0466957_0003616_1552_1791 79
1992 3300044842 Ga0466957_0025105 Ga0466957_0025105_1115_1354 79
1993 3300044842 Ga0466957_0036894 Ga0466957_0036894_123_362 79
1994 3300044842 Ga0466957_0254157 Ga0466957_0254157_317_556 79
1995 3300044842 Ga0466957_1375772 Ga0466957_1375772_262_501 79
1996 3300044901 Ga0466960_0207076 Ga0466960_0207076_12_251 79
1997 3300044901 Ga0466960_0579951 Ga0466960_0579951_64_303 79
1998 3300044901 Ga0466960_0768045 Ga0466960_0768045_45_284 79
1999 3300045049 Ga0466959_0002658 Ga0466959_0002658_4949_5188 79
2000 3300045049 Ga0466959_0007503 Ga0466959_0007503_5887_6126 79
2001 3300045049 Ga0466959_0099886 Ga0466959_0099886_813_1052 79
2002 3300045049 Ga0466959_0119194 Ga0466959_0119194_48_287 79
2003 3300045049 Ga0466959_0403446 Ga0466959_0403446_346_585 79
2004 3300045051 Ga0451576_0001131 Ga0451576_0001131_19908_20150 79
2005 3300045051 Ga0451576_0002798 Ga0451576_0002798_15392_15631 79
2006 3300045051 Ga0451576_0055941 Ga0451576_0055941_3308_3547 79
2007 3300045051 Ga0451576_0062050 Ga0451576_0062050_2347_2586 79
2008 3300045051 Ga0451576_0069357 Ga0451576_0069357_1198_1437 79
2009 3300045051 Ga0451576_0144085 Ga0451576_0144085_2202_2441 79
2010 3300045051 Ga0451576_0282593 Ga0451576_0282593_1082_1324 79
2011 3300045051 Ga0451576_0761337 Ga0451576_0761337_535_774 79
2012 3300045836 Ga0466958_0013842 Ga0466958_0013842_2779_3018 79
2013 3300045836 Ga0466958_0016955 Ga0466958_0016955_1987_2226 79
2014 3300045836 Ga0466958_0047389 Ga0466958_0047389_2295_2534 79
2015 3300045836 Ga0466958_0063773 Ga0466958_0063773_1990_2229 79
2016 3300045976 Ga0466967_0528918 Ga0466967_0528918_287_526 79
2017 3300046454 Ga0495592_0024962 Ga0495592_0024962_1674_1913 79
2018 3300046454 Ga0495592_0409514 Ga0495592_0409514_315_554 79
2019 3300046454 Ga0495592_0507634 Ga0495592_0507634_17_256 79
2020 3300046455 Ga0495603_0001200 Ga0495603_0001200_11867_12106 79
2021 3300046455 Ga0495603_0125873 Ga0495603_0125873_716_955 79
2022 3300046455 Ga0495603_0261592 Ga0495603_0261592_307_549 79
2023 3300046457 Ga0495590_0005835 Ga0495590_0005835_2266_2550 79
2024 3300046457 Ga0495590_0036297 Ga0495590_0036297_855_1094 79
2025 3300046457 Ga0495590_0191829 Ga0495590_0191829_213_452 79
2026 3300046458 Ga0495591_093532 Ga0495591_093532_418_657 79
2027 3300046459 Ga0495629_0000293 Ga0495629_0000293_4787_5026 79
2028 3300046459 Ga0495629_0292568 Ga0495629_0292568_814_1053 79
2029 3300046459 Ga0495629_0389986 Ga0495629_0389986_98_382 79
2030 3300046459 Ga0495629_1123723 Ga0495629_1123723_252_491 79
2031 3300046460 Ga0495638_0043896 Ga0495638_0043896_170_409 79
2032 3300046462 Ga0495651_0105865 Ga0495651_0105865_243_482 79
2033 3300046462 Ga0495651_0232060 Ga0495651_0232060_160_399 79
2034 3300046462 Ga0495651_0810927 Ga0495651_0810927_31_315 79
2035 3300046463 Ga0495653_0144315 Ga0495653_0144315_1215_1499 79
2036 3300046463 Ga0495653_0647682 Ga0495653_0647682_76_315 79
2037 3300046471 Ga0495650_0006614 Ga0495650_0006614_5610_5849 79
2038 3300046471 Ga0495650_0062836 Ga0495650_0062836_444_683 79
2039 3300046471 Ga0495650_0179921 Ga0495650_0179921_130_369 79
2040 3300046472 Ga0495580_0003989 Ga0495580_0003989_12039_12278 79
2041 3300046472 Ga0495580_0012359 Ga0495580_0012359_1305_1544 79
2042 3300046472 Ga0495580_0130378 Ga0495580_0130378_1492_1731 79
2043 3300046472 Ga0495580_0312192 Ga0495580_0312192_715_954 79
2044 3300046473 Ga0495582_0055801 Ga0495582_0055801_1609_1848 79
2045 3300046473 Ga0495582_0180170 Ga0495582_0180170_709_948 79
2046 3300046473 Ga0495582_0191729 Ga0495582_0191729_336_575 79
2047 3300046473 Ga0495582_0639090 Ga0495582_0639090_246_485 79
2048 3300046474 Ga0495605_0003987 Ga0495605_0003987_1587_1826 79
2049 3300046474 Ga0495605_0015985 Ga0495605_0015985_587_826 79
2050 3300046474 Ga0495605_0059792 Ga0495605_0059792_276_560 79
2051 3300046474 Ga0495605_0125912 Ga0495605_0125912_701_940 79
2052 3300046474 Ga0495605_0364844 Ga0495605_0364844_321_560 79
2053 3300046475 Ga0495639_0128668 Ga0495639_0128668_485_724 79
2054 3300046476 Ga0495662_0031906 Ga0495662_0031906_948_1187 79
2055 3300046476 Ga0495662_0148208 Ga0495662_0148208_471_710 79
2056 3300046476 Ga0495662_0163900 Ga0495662_0163900_581_820 79
2057 3300046476 Ga0495662_0226355 Ga0495662_0226355_666_905 79
2058 3300046477 Ga0495664_0003554 Ga0495664_0003554_6664_6948 79
2059 3300046477 Ga0495664_0028280 Ga0495664_0028280_2808_3047 79
2060 3300046477 Ga0495664_0048678 Ga0495664_0048678_1962_2201 79
2061 3300046491 Ga0495584_0050865 Ga0495584_0050865_315_599 79
2062 3300046491 Ga0495584_0375490 Ga0495584_0375490_196_435 79
2063 3300046492 Ga0495585_0188441 Ga0495585_0188441_96_335 79
2064 3300046500 Ga0495596_0017515 Ga0495596_0017515_2417_2656 79
2065 3300046500 Ga0495596_0137831 Ga0495596_0137831_608_847 79
2066 3300046500 Ga0495596_0142897 Ga0495596_0142897_503_742 79
2067 3300046500 Ga0495596_0201660 Ga0495596_0201660_324_563 79
2068 3300046501 Ga0495607_0070613 Ga0495607_0070613_1191_1430 79
2069 3300046506 Ga0495583_0001256 Ga0495583_0001256_6557_6796 79
2070 3300046507 Ga0495606_0033594 Ga0495606_0033594_2712_2996 79
2071 3300046507 Ga0495606_0069892 Ga0495606_0069892_726_965 79
2072 3300046507 Ga0495606_0273392 Ga0495606_0273392_216_458 79
2073 3300046507 Ga0495606_0342057 Ga0495606_0342057_29_268 79
2074 3300046507 Ga0495606_0441435 Ga0495606_0441435_317_556 79
2075 3300046507 Ga0495606_0544593 Ga0495606_0544593_129_368 79
2076 3300046511 Ga0495608_0048972 Ga0495608_0048972_718_957 79
2077 3300046512 Ga0495610_0003920 Ga0495610_0003920_7054_7293 79
2078 3300046512 Ga0495610_0227035 Ga0495610_0227035_375_614 79
2079 3300046513 Ga0495616_0028857 Ga0495616_0028857_461_700 79
2080 3300046514 Ga0495618_0012902 Ga0495618_0012902_3188_3427 79
2081 3300046515 Ga0495620_0210625 Ga0495620_0210625_328_567 79
2082 3300046516 Ga0495628_0011133 Ga0495628_0011133_3576_3815 79
2083 3300046516 Ga0495628_0027015 Ga0495628_0027015_2156_2395 79
2084 3300046516 Ga0495628_0116858 Ga0495628_0116858_654_938 79
2085 3300046516 Ga0495628_0354493 Ga0495628_0354493_612_851 79
2086 3300046516 Ga0495628_0817679 Ga0495628_0817679_204_443 79
2087 3300046517 Ga0495630_0013181 Ga0495630_0013181_2278_2517 79
2088 3300046517 Ga0495630_0100495 Ga0495630_0100495_1341_1625 79
2089 3300046517 Ga0495630_1230893 Ga0495630_1230893_164_403 79
2090 3300046518 Ga0495631_0043238 Ga0495631_0043238_633_872 79
2091 3300046518 Ga0495631_0248761 Ga0495631_0248761_492_731 79
2092 3300046522 Ga0495643_0098924 Ga0495643_0098924_65_304 79
2093 3300046523 Ga0495644_0179837 Ga0495644_0179837_389_628 79
2094 3300046524 Ga0495648_0038507 Ga0495648_0038507_80_319 79
2095 3300046526 Ga0495666_0027558 Ga0495666_0027558_819_1058 79
2096 3300046526 Ga0495666_0033321 Ga0495666_0033321_1962_2201 79
2097 3300046526 Ga0495666_0075817 Ga0495666_0075817_795_1079 79
2098 3300046526 Ga0495666_0134946 Ga0495666_0134946_639_878 79
2099 3300046528 Ga0495642_0010355 Ga0495642_0010355_1819_2058 79
2100 3300046528 Ga0495642_0038170 Ga0495642_0038170_553_792 79
2101 3300046528 Ga0495642_0116633 Ga0495642_0116633_122_361 79
2102 3300046528 Ga0495642_0450247 Ga0495642_0450247_177_416 79
2103 3300046528 Ga0495642_0497050 Ga0495642_0497050_227_466 79
2104 3300046529 Ga0495652_0011413 Ga0495652_0011413_5069_5308 79
2105 3300046529 Ga0495652_0162928 Ga0495652_0162928_1323_1607 79
2106 3300046529 Ga0495652_0214169 Ga0495652_0214169_752_991 79
2107 3300046529 Ga0495652_1017360 Ga0495652_1017360_192_431 79
2108 3300046529 Ga0495652_1154847 Ga0495652_1154847_24_263 79
2109 3300046530 Ga0495654_0110603 Ga0495654_0110603_510_749 79
2110 3300046531 Ga0495665_0019322 Ga0495665_0019322_1912_2151 79
2111 3300046531 Ga0495665_0056112 Ga0495665_0056112_1741_2025 79
2112 3300046531 Ga0495665_0070494 Ga0495665_0070494_1319_1558 79
2113 3300046533 Ga0495640_0011260 Ga0495640_0011260_5559_5798 79
2114 3300046533 Ga0495640_0012380 Ga0495640_0012380_4607_4846 79
2115 3300046535 Ga0495586_0063317 Ga0495586_0063317_652_891 79
2116 3300046535 Ga0495586_0084228 Ga0495586_0084228_1352_1636 79
2117 3300046535 Ga0495586_0865591 Ga0495586_0865591_56_295 79
2118 3300046536 Ga0495587_0093053 Ga0495587_0093053_182_466 79
2119 3300046539 Ga0495621_0068013 Ga0495621_0068013_794_1033 79
2120 3300046542 Ga0495597_0006296 Ga0495597_0006296_464_748 79
2121 3300046543 Ga0495645_0057084 Ga0495645_0057084_2207_2446 79
2122 3300046543 Ga0495645_0063297 Ga0495645_0063297_230_472 79
2123 3300046543 Ga0495645_0086523 Ga0495645_0086523_829_1068 79
2124 3300046543 Ga0495645_0149107 Ga0495645_0149107_449_733 79
2125 3300046543 Ga0495645_0156241 Ga0495645_0156241_36_275 79
2126 3300046543 Ga0495645_0180135 Ga0495645_0180135_497_736 79
2127 3300046557 Ga0495622_0214370 Ga0495622_0214370_144_383 79
2128 3300046558 Ga0495633_0221107 Ga0495633_0221107_250_492 79
2129 3300046559 Ga0495667_0092270 Ga0495667_0092270_1518_1757 79
2130 3300046559 Ga0495667_0145306 Ga0495667_0145306_408_647 79
2131 3300046616 Ga0495668_0293941 Ga0495668_0293941_255_494 79
2132 3300046642 Ga0495634_0015541 Ga0495634_0015541_2497_2736 79
2133 3300046648 Ga0495611_0250231 Ga0495611_0250231_281_520 79
2134 3300046648 Ga0495611_0267381 Ga0495611_0267381_386_625 79
2135 3300046648 Ga0495611_0582137 Ga0495611_0582137_36_275 79
2136 3300046660 Ga0495625_0349939 Ga0495625_0349939_433_672 79
2137 3300046663 Ga0495635_0010140 Ga0495635_0010140_2119_2358 79
2138 3300046663 Ga0495635_0039843 Ga0495635_0039843_1506_1745 79
2139 3300046663 Ga0495635_0112766 Ga0495635_0112766_1143_1427 79
2140 3300046663 Ga0495635_0590303 Ga0495635_0590303_447_686 79
2141 3300046663 Ga0495635_0625382 Ga0495635_0625382_312_551 79
2142 3300046663 Ga0495635_0776508 Ga0495635_0776508_201_440 79
2143 3300046665 Ga0495661_0421779 Ga0495661_0421779_27_266 79
2144 3300046674 Ga0495588_0377354 Ga0495588_0377354_160_399 79
2145 3300046675 Ga0495657_0042791 Ga0495657_0042791_1609_1848 79
2146 3300046678 Ga0495599_0447222 Ga0495599_0447222_100_339 79
2147 3300046679 Ga0495623_0007364 Ga0495623_0007364_6575_6814 79
2148 3300046679 Ga0495623_0157114 Ga0495623_0157114_303_542 79
2149 3300046680 Ga0495646_0036392 Ga0495646_0036392_2135_2374 79
2150 3300046680 Ga0495646_0066620 Ga0495646_0066620_1323_1607 79
2151 3300046680 Ga0495646_0180727 Ga0495646_0180727_79_318 79
2152 3300046683 Ga0495658_0237057 Ga0495658_0237057_804_1043 79
2153 3300046683 Ga0495658_0761980 Ga0495658_0761980_105_344 79
2154 3300046684 Ga0495669_0101547 Ga0495669_0101547_754_993 79
2155 3300046684 Ga0495669_0118953 Ga0495669_0118953_258_497 79
2156 3300046684 Ga0495669_0192909 Ga0495669_0192909_259_498 79
2157 3300046684 Ga0495669_0305537 Ga0495669_0305537_491_730 79
2158 3300046689 Ga0495613_0574021 Ga0495613_0574021_258_497 79
2159 3300046690 Ga0495624_0079871 Ga0495624_0079871_1713_1952 79
2160 3300046690 Ga0495624_0103282 Ga0495624_0103282_1011_1250 79
2161 3300046690 Ga0495624_0931691 Ga0495624_0931691_85_324 79
2162 3300046691 Ga0495670_0090193 Ga0495670_0090193_431_670 79
2163 3300046692 Ga0495671_0476915 Ga0495671_0476915_217_456 79
2164 3300046694 Ga0495649_0011595 Ga0495649_0011595_1230_1469 79
2165 3300046694 Ga0495649_0012013 Ga0495649_0012013_1561_1800 79
2166 3300046694 Ga0495649_0200525 Ga0495649_0200525_382_666 79
2167 3300046694 Ga0495649_0216101 Ga0495649_0216101_555_794 79
2168 3300046794 Ga0495589_0022891 Ga0495589_0022891_438_677 79
2169 3300046794 Ga0495589_0079628 Ga0495589_0079628_1153_1392 79
2170 3300046794 Ga0495589_0301541 Ga0495589_0301541_370_609 79
2171 3300046794 Ga0495589_0338715 Ga0495589_0338715_33_272 79
2172 3300046809 Ga0495600_0047351 Ga0495600_0047351_1556_1795 79
2173 3300046809 Ga0495600_0302308 Ga0495600_0302308_221_460 79
2174 3300046809 Ga0495600_0922047 Ga0495600_0922047_41_280 79
2175 3300046810 Ga0495660_0147657 Ga0495660_0147657_530_769 79
2176 3300047315 Ga0495581_0068856 Ga0495581_0068856_313_552 79
2177 3300047315 Ga0495581_0152823 Ga0495581_0152823_527_766 79
2178 3300047317 Ga0495604_0136964 Ga0495604_0136964_559_843 79
2179 3300047317 Ga0495604_0696019 Ga0495604_0696019_76_315 79
2180 3300047318 Ga0495636_0007298 Ga0495636_0007298_2478_2717 79
2181 3300047319 Ga0495674_0006962 Ga0495674_0006962_9089_9373 79
2182 3300047319 Ga0495674_0019748 Ga0495674_0019748_3576_3815 79
2183 3300047319 Ga0495674_0087712 Ga0495674_0087712_1844_2083 79
2184 3300047319 Ga0495674_0119292 Ga0495674_0119292_204_443 79
2185 3300047319 Ga0495674_0219415 Ga0495674_0219415_444_683 79
2186 3300047319 Ga0495674_0354311 Ga0495674_0354311_417_656 79
2187 3300047320 Ga0495672_0007237 Ga0495672_0007237_5446_5685 79
2188 3300047320 Ga0495672_0124050 Ga0495672_0124050_842_1081 79
2189 3300047321 Ga0495676_0023779 Ga0495676_0023779_4725_4964 79
2190 3300047322 Ga0495680_0013833 Ga0495680_0013833_331_570 79
2191 3300047322 Ga0495680_0053845 Ga0495680_0053845_700_984 79
2192 3300047322 Ga0495680_0139763 Ga0495680_0139763_118_357 79
2193 3300047322 Ga0495680_0734601 Ga0495680_0734601_14_253 79
2194 3300047323 Ga0495683_0012145 Ga0495683_0012145_4031_4315 79
2195 3300047323 Ga0495683_0026601 Ga0495683_0026601_1786_2025 79
2196 3300047323 Ga0495683_0138949 Ga0495683_0138949_684_923 79
2197 3300047323 Ga0495683_0339381 Ga0495683_0339381_298_537 79
2198 3300047443 Ga0495687_000025 Ga0495687_000025_225785_226024 79
2199 3300047443 Ga0495687_009941 Ga0495687_009941_1627_1866 79
2200 3300047443 Ga0495687_091654 Ga0495687_091654_345_584 79
2201 3300047444 Ga0495675_0002828 Ga0495675_0002828_8390_8629 79
2202 3300047444 Ga0495675_0478294 Ga0495675_0478294_385_624 79
2203 3300047445 Ga0495677_0233145 Ga0495677_0233145_301_540 79
2204 3300047445 Ga0495677_0344996 Ga0495677_0344996_25_264 79
2205 3300047447 Ga0495685_092903 Ga0495685_092903_101_340 79
2206 3300047447 Ga0495685_227755 Ga0495685_227755_10_249 79
2207 3300047469 Ga0495673_0002104 Ga0495673_0002104_12801_13040 79
2208 3300047469 Ga0495673_0078649 Ga0495673_0078649_835_1074 79
2209 3300047469 Ga0495673_0286001 Ga0495673_0286001_51_290 79
2210 3300047470 Ga0495681_0105438 Ga0495681_0105438_941_1180 79
2211 3300047470 Ga0495681_0214625 Ga0495681_0214625_377_616 79
2212 3300047471 Ga0495684_1025799 Ga0495684_1025799_267_506 79
2213 3300047472 Ga0495686_0000032 Ga0495686_0000032_156250_156489 79
2214 3300047673 Ga0495593_0007279 Ga0495593_0007279_3719_3958 79
2215 3300047673 Ga0495593_0147541 Ga0495593_0147541_882_1121 79
2216 3300047673 Ga0495593_0227462 Ga0495593_0227462_352_636 79
2217 3300048088 Ga0495602_0038407 Ga0495602_0038407_2725_2964 79
2218 3300048088 Ga0495602_0305588 Ga0495602_0305588_249_533 79
2219 3300048088 Ga0495602_1083210 Ga0495602_1083210_101_340 79
2220 3300048089 Ga0495614_0029314 Ga0495614_0029314_1479_1718 79
2221 3300048089 Ga0495614_0256756 Ga0495614_0256756_493_732 79
2222 3300048091 Ga0495626_0085944 Ga0495626_0085944_1018_1257 79
2223 3300048091 Ga0495626_0146423 Ga0495626_0146423_290_529 79
2224 3300048903 Ga0496100_0001564 Ga0496100_0001564_5033_5317 79
2225 3300048903 Ga0496100_0328768 Ga0496100_0328768_231_470 79
2226 3300048903 Ga0496100_0355804 Ga0496100_0355804_100_339 79
2227 3300048903 Ga0496100_1162315 Ga0496100_1162315_19_258 79
2228 3300048904 Ga0496101_0004610 Ga0496101_0004610_7946_8230 79
2229 3300048904 Ga0496101_0017506 Ga0496101_0017506_31_270 79
2230 3300048904 Ga0496101_0032663 Ga0496101_0032663_483_722 79
2231 3300048904 Ga0496101_0186763 Ga0496101_0186763_492_731 79
2232 3300048904 Ga0496101_0263281 Ga0496101_0263281_786_1025 79
2233 3300048904 Ga0496101_1010642 Ga0496101_1010642_310_549 79
2234 3300048905 Ga0496102_0004786 Ga0496102_0004786_6970_7209 79
2235 3300048905 Ga0496102_0008702 Ga0496102_0008702_2139_2423 79
2236 3300048905 Ga0496102_0068560 Ga0496102_0068560_2196_2435 79
2237 3300048905 Ga0496102_0073083 Ga0496102_0073083_2620_2859 79
2238 3300048905 Ga0496102_1696966 Ga0496102_1696966_207_479 79
2239 3300048906 Ga0496103_0000337 Ga0496103_0000337_16645_16884 79
2240 3300048906 Ga0496103_0020377 Ga0496103_0020377_823_1107 79
2241 3300048906 Ga0496103_0108081 Ga0496103_0108081_1171_1410 79
2242 3300048907 Ga0496104_0022440 Ga0496104_0022440_5236_5475 79
2243 3300048907 Ga0496104_0186818 Ga0496104_0186818_1511_1750 79
2244 3300048907 Ga0496104_0200509 Ga0496104_0200509_1492_1731 79
2245 3300048907 Ga0496104_0305418 Ga0496104_0305418_598_882 79
2246 3300048907 Ga0496104_0327094 Ga0496104_0327094_568_807 79
2247 3300048907 Ga0496104_0469788 Ga0496104_0469788_558_797 79
2248 3300048907 Ga0496104_0861095 Ga0496104_0861095_557_796 79
2249 3300048907 Ga0496104_1564919 Ga0496104_1564919_44_283 79
2250 3300048908 Ga0496105_0024699 Ga0496105_0024699_3652_3891 79
2251 3300048908 Ga0496105_0089855 Ga0496105_0089855_954_1238 79
2252 3300048908 Ga0496105_0098075 Ga0496105_0098075_1109_1348 79
2253 3300048908 Ga0496105_0224494 Ga0496105_0224494_879_1118 79
2254 3300048908 Ga0496105_0264974 Ga0496105_0264974_772_1011 79
2255 3300048908 Ga0496105_0701875 Ga0496105_0701875_523_762 79
2256 3300048908 Ga0496105_0718058 Ga0496105_0718058_213_452 79
2257 3300048908 Ga0496105_0742420 Ga0496105_0742420_217_456 79
2258 3300048909 Ga0496106_0000019 Ga0496106_0000019_81308_81547 79
2259 3300048909 Ga0496106_0059660 Ga0496106_0059660_2058_2342 79
2260 3300048909 Ga0496106_0062504 Ga0496106_0062504_2285_2524 79
2261 3300048909 Ga0496106_0091780 Ga0496106_0091780_1570_1809 79
2262 3300048909 Ga0496106_0105294 Ga0496106_0105294_1808_2080 79
2263 3300048909 Ga0496106_0203457 Ga0496106_0203457_1042_1281 79
2264 3300048909 Ga0496106_0433970 Ga0496106_0433970_342_581 79
2265 3300048910 Ga0496107_0107310 Ga0496107_0107310_697_936 79
2266 3300048910 Ga0496107_0168090 Ga0496107_0168090_280_564 79
2267 3300048910 Ga0496107_0318260 Ga0496107_0318260_297_536 79
2268 3300048910 Ga0496107_0330392 Ga0496107_0330392_388_627 79
2269 3300048910 Ga0496107_0616400 Ga0496107_0616400_255_527 79
2270 3300048910 Ga0496107_1024163 Ga0496107_1024163_64_303 79
2271 3300048910 Ga0496107_1255398 Ga0496107_1255398_107_346 79
2272 3300048911 Ga0496108_0035074 Ga0496108_0035074_1351_1590 79
2273 3300048911 Ga0496108_0097513 Ga0496108_0097513_1941_2180 79
2274 3300048911 Ga0496108_0482064 Ga0496108_0482064_500_784 79
2275 3300048911 Ga0496108_0602987 Ga0496108_0602987_646_885 79
2276 3300048911 Ga0496108_0723940 Ga0496108_0723940_203_442 79
2277 3300048911 Ga0496108_1349101 Ga0496108_1349101_205_444 79
2278 3300048912 Ga0496109_0137879 Ga0496109_0137879_1945_2184 79
2279 3300048912 Ga0496109_0191473 Ga0496109_0191473_1161_1400 79
2280 3300048912 Ga0496109_0644351 Ga0496109_0644351_222_506 79
2281 3300048912 Ga0496109_0973305 Ga0496109_0973305_133_372 79
2282 3300048913 Ga0496110_0005432 Ga0496110_0005432_5491_5775 79
2283 3300048913 Ga0496110_0191437 Ga0496110_0191437_393_632 79
2284 3300048913 Ga0496110_0708890 Ga0496110_0708890_614_853 79
2285 3300048913 Ga0496110_0732920 Ga0496110_0732920_615_854 79
2286 3300048913 Ga0496110_1021898 Ga0496110_1021898_480_719 79
2287 3300048914 Ga0496111_0059171 Ga0496111_0059171_1218_1502 79
2288 3300048914 Ga0496111_0206982 Ga0496111_0206982_434_673 79
2289 3300048915 Ga0496112_0000241 Ga0496112_0000241_4330_4569 79
2290 3300048915 Ga0496112_0016052 Ga0496112_0016052_4159_4443 79
2291 3300048915 Ga0496112_0110203 Ga0496112_0110203_685_924 79
2292 3300048915 Ga0496112_0113356 Ga0496112_0113356_822_1061 79
2293 3300048915 Ga0496112_0252525 Ga0496112_0252525_1233_1472 79
2294 3300048915 Ga0496112_0900822 Ga0496112_0900822_542_781 79
2295 3300048916 Ga0496113_0049457 Ga0496113_0049457_892_1131 79
2296 3300048916 Ga0496113_0056511 Ga0496113_0056511_1874_2113 79
2297 3300048916 Ga0496113_0517088 Ga0496113_0517088_302_541 79
2298 3300048916 Ga0496113_0701692 Ga0496113_0701692_558_797 79
2299 3300048916 Ga0496113_0720260 Ga0496113_0720260_397_681 79
2300 3300048916 Ga0496113_1013503 Ga0496113_1013503_96_335 79
2301 3300048917 Ga0496114_0072946 Ga0496114_0072946_1287_1526 79
2302 3300048917 Ga0496114_0390780 Ga0496114_0390780_851_1090 79
2303 3300048917 Ga0496114_0426301 Ga0496114_0426301_258_542 79
2304 3300048917 Ga0496114_0541336 Ga0496114_0541336_489_728 79
2305 3300048917 Ga0496114_0799938 Ga0496114_0799938_200_439 79
2306 3300048917 Ga0496114_1319769 Ga0496114_1319769_196_435 79
2307 3300048918 Ga0496115_0039159 Ga0496115_0039159_411_650 79
2308 3300048918 Ga0496115_0114641 Ga0496115_0114641_1402_1686 79
2309 3300048918 Ga0496115_0126003 Ga0496115_0126003_565_804 79
2310 3300048918 Ga0496115_0162425 Ga0496115_0162425_387_626 79
2311 3300048918 Ga0496115_0520153 Ga0496115_0520153_435_674 79
2312 3300048918 Ga0496115_1054315 Ga0496115_1054315_74_313 79
2313 3300048918 Ga0496115_1299567 Ga0496115_1299567_86_325 79
2314 3300048919 Ga0496116_0012470 Ga0496116_0012470_76_360 79
2315 3300048919 Ga0496116_0022873 Ga0496116_0022873_3748_3987 79
2316 3300048919 Ga0496116_0125474 Ga0496116_0125474_1212_1451 79
2317 3300048919 Ga0496116_0216453 Ga0496116_0216453_296_535 79
2318 3300048919 Ga0496116_0315894 Ga0496116_0315894_472_711 79
2319 3300048920 Ga0496117_0002161 Ga0496117_0002161_10356_10595 79
2320 3300048920 Ga0496117_0004960 Ga0496117_0004960_11293_11532 79
2321 3300048920 Ga0496117_0015919 Ga0496117_0015919_4629_4913 79
2322 3300048920 Ga0496117_0019854 Ga0496117_0019854_162_401 79
2323 3300048920 Ga0496117_0023308 Ga0496117_0023308_196_435 79
2324 3300048920 Ga0496117_0074066 Ga0496117_0074066_924_1163 79
2325 3300048921 Ga0496118_0000420 Ga0496118_0000420_34625_34864 79
2326 3300048921 Ga0496118_0013056 Ga0496118_0013056_6470_6709 79
2327 3300048921 Ga0496118_0036943 Ga0496118_0036943_940_1224 79
2328 3300048921 Ga0496118_0112271 Ga0496118_0112271_548_787 79
2329 3300048921 Ga0496118_0156691 Ga0496118_0156691_346_585 79
2330 3300048921 Ga0496118_0184665 Ga0496118_0184665_284_523 79
2331 3300048921 Ga0496118_0314047 Ga0496118_0314047_592_831 79
2332 3300048922 Ga0496119_0039205 Ga0496119_0039205_2230_2469 79
2333 3300048922 Ga0496119_0261245 Ga0496119_0261245_57_341 79
2334 3300048923 Ga0496120_0072272 Ga0496120_0072272_679_918 79
2335 3300048923 Ga0496120_0202992 Ga0496120_0202992_249_533 79
2336 3300048923 Ga0496120_0527672 Ga0496120_0527672_246_485 79
2337 3300048924 Ga0496121_0000310 Ga0496121_0000310_93037_93276 79
2338 3300048924 Ga0496121_0004537 Ga0496121_0004537_13115_13399 79
2339 3300048924 Ga0496121_0025157 Ga0496121_0025157_2479_2718 79
2340 3300048924 Ga0496121_0299808 Ga0496121_0299808_367_606 79
2341 3300048924 Ga0496121_0353020 Ga0496121_0353020_50_289 79
2342 3300048924 Ga0496121_0440423 Ga0496121_0440423_582_821 79
2343 3300048925 Ga0496122_0004387 Ga0496122_0004387_14095_14379 79
2344 3300048925 Ga0496122_0231869 Ga0496122_0231869_514_753 79
2345 3300048925 Ga0496122_0363954 Ga0496122_0363954_243_482 79
2346 3300048926 Ga0496123_0021267 Ga0496123_0021267_155_439 79
2347 3300048926 Ga0496123_0081134 Ga0496123_0081134_987_1226 79
2348 3300048926 Ga0496123_0239360 Ga0496123_0239360_236_475 79
2349 3300048927 Ga0496124_0050016 Ga0496124_0050016_3249_3488 79
2350 3300048927 Ga0496124_0239991 Ga0496124_0239991_504_788 79
2351 3300048927 Ga0496124_0371268 Ga0496124_0371268_552_791 79
2352 3300048928 Ga0496125_0022845 Ga0496125_0022845_3227_3511 79
2353 3300048928 Ga0496125_0207457 Ga0496125_0207457_184_423 79
2354 3300048928 Ga0496125_0434521 Ga0496125_0434521_42_281 79
2355 3300048929 Ga0496126_0000034 Ga0496126_0000034_142092_142331 79
2356 3300048929 Ga0496126_0003687 Ga0496126_0003687_12130_12369 79
2357 3300048929 Ga0496126_0192584 Ga0496126_0192584_795_1079 79
2358 3300048929 Ga0496126_0452152 Ga0496126_0452152_749_988 79
2359 3300048929 Ga0496126_0465519 Ga0496126_0465519_444_683 79
2360 3300048986 Ga0466983_0411850 Ga0466983_0411850_419_658 79
2361 3300049130 Ga0501310_048552 Ga0501310_048552_19_258 79
2362 3300049459 Ga0495678_007415 Ga0495678_007415_1919_2158 79
2363 3300049459 Ga0495678_100022 Ga0495678_100022_133_417 79
2364 3300049459 Ga0495678_164804 Ga0495678_164804_125_364 79
2365 3300049460 Ga0495682_0081796 Ga0495682_0081796_267_506 79
2366 3300049460 Ga0495682_0146788 Ga0495682_0146788_339_623 79
2367 3300049523 Ga0501300_012317 Ga0501300_012317_126_371 79
2368 3300049568 Ga0501031_0057086 Ga0501031_0057086_1220_1462 79
2369 3300049568 Ga0501031_0078286 Ga0501031_0078286_122_364 79
2370 3300049568 Ga0501031_0462307 Ga0501031_0462307_80_319 79
2371 3300049568 Ga0501031_0994534 Ga0501031_0994534_259_498 79
2372 3300049569 Ga0501032_0579590 Ga0501032_0579590_140_382 79
2373 3300049570 Ga0501033_0007290 Ga0501033_0007290_5065_5304 79
2374 3300049570 Ga0501033_0261643 Ga0501033_0261643_910_1152 79
2375 3300049570 Ga0501033_0382862 Ga0501033_0382862_35_277 79
2376 3300049570 Ga0501033_0399487 Ga0501033_0399487_49_291 79
2377 3300049570 Ga0501033_0582917 Ga0501033_0582917_474_716 79
2378 3300049570 Ga0501033_0950022 Ga0501033_0950022_18_257 79
2379 3300049571 Ga0501034_0028843 Ga0501034_0028843_4175_4414 79
2380 3300049571 Ga0501034_0326579 Ga0501034_0326579_16_255 79
2381 3300049571 Ga0501034_1697975 Ga0501034_1697975_239_481 79
2382 3300049572 Ga0501036_0000381 Ga0501036_0000381_15504_15743 79
2383 3300049572 Ga0501036_0054298 Ga0501036_0054298_2394_2636 79
2384 3300049572 Ga0501036_0281722 Ga0501036_0281722_457_696 79
2385 3300049572 Ga0501036_0666247 Ga0501036_0666247_595_834 79
2386 3300049572 Ga0501036_0784796 Ga0501036_0784796_416_658 79
2387 3300049573 Ga0501037_0067484 Ga0501037_0067484_1855_2094 79
2388 3300049573 Ga0501037_0831571 Ga0501037_0831571_177_419 79
2389 3300049573 Ga0501037_1071940 Ga0501037_1071940_230_469 79
2390 3300049574 Ga0501038_0001967 Ga0501038_0001967_18701_18943 79
2391 3300049574 Ga0501038_0002645 Ga0501038_0002645_6969_7208 79
2392 3300049574 Ga0501038_1149577 Ga0501038_1149577_223_465 79
2393 3300049575 Ga0501039_0000492 Ga0501039_0000492_15284_15523 79
2394 3300049575 Ga0501039_0155662 Ga0501039_0155662_169_444 79
2395 3300049575 Ga0501039_0187835 Ga0501039_0187835_904_1143 79
2396 3300049575 Ga0501039_0258486 Ga0501039_0258486_263_502 79
2397 3300049575 Ga0501039_0365826 Ga0501039_0365826_774_1013 79
2398 3300049576 Ga0501040_0000262 Ga0501040_0000262_13466_13705 79
2399 3300049576 Ga0501040_0008180 Ga0501040_0008180_4844_5119 79
2400 3300049576 Ga0501040_0039045 Ga0501040_0039045_2289_2531 79
2401 3300049576 Ga0501040_0057853 Ga0501040_0057853_1503_1745 79
2402 3300049576 Ga0501040_0321188 Ga0501040_0321188_504_743 79
2403 3300049576 Ga0501040_1199090 Ga0501040_1199090_279_521 79
2404 3300049576 Ga0501040_1226237 Ga0501040_1226237_109_351 79
2405 3300049577 Ga0501041_0000582 Ga0501041_0000582_16199_16438 79
2406 3300049577 Ga0501041_0007725 Ga0501041_0007725_4724_4966 79
2407 3300049577 Ga0501041_0009158 Ga0501041_0009158_2913_3188 79
2408 3300049577 Ga0501041_0105469 Ga0501041_0105469_542_781 79
2409 3300049577 Ga0501041_0430649 Ga0501041_0430649_462_701 79
2410 3300049577 Ga0501041_0441216 Ga0501041_0441216_61_303 79
2411 3300049577 Ga0501041_0483339 Ga0501041_0483339_529_768 79
2412 3300049577 Ga0501041_1072744 Ga0501041_1072744_113_352 79
2413 3300049578 Ga0501042_0003650 Ga0501042_0003650_3721_3960 79
2414 3300049578 Ga0501042_0027726 Ga0501042_0027726_2124_2399 79
2415 3300049578 Ga0501042_0065145 Ga0501042_0065145_1049_1291 79
2416 3300049578 Ga0501042_0244901 Ga0501042_0244901_19_258 79
2417 3300049578 Ga0501042_0385345 Ga0501042_0385345_705_944 79
2418 3300049578 Ga0501042_0555686 Ga0501042_0555686_518_757 79
2419 3300049578 Ga0501042_1110550 Ga0501042_1110550_92_331 79
2420 3300049579 Ga0501043_0119430 Ga0501043_0119430_1284_1523 79
2421 3300049579 Ga0501043_0247476 Ga0501043_0247476_846_1085 79
2422 3300049579 Ga0501043_0429496 Ga0501043_0429496_285_524 79
2423 3300049579 Ga0501043_1216640 Ga0501043_1216640_159_401 79
2424 3300049580 Ga0501046_0000630 Ga0501046_0000630_18537_18776 79
2425 3300049580 Ga0501046_0322345 Ga0501046_0322345_162_401 79
2426 3300049581 Ga0501047_0515816 Ga0501047_0515816_486_725 79
2427 3300049582 Ga0501048_0000975 Ga0501048_0000975_5789_6028 79
2428 3300049582 Ga0501048_0509313 Ga0501048_0509313_240_482 79
2429 3300049582 Ga0501048_0520054 Ga0501048_0520054_86_325 79
2430 3300049582 Ga0501048_0775491 Ga0501048_0775491_436_678 79
2431 3300049582 Ga0501048_1255569 Ga0501048_1255569_193_435 79
2432 3300049582 Ga0501048_1286721 Ga0501048_1286721_241_480 79
2433 3300049583 Ga0501067_0022921 Ga0501067_0022921_1797_2039 79
2434 3300049584 Ga0501068_0018668 Ga0501068_0018668_42_284 79
2435 3300049584 Ga0501068_0031007 Ga0501068_0031007_814_1053 79
2436 3300049584 Ga0501068_0058736 Ga0501068_0058736_1996_2235 79
2437 3300049584 Ga0501068_0188950 Ga0501068_0188950_471_713 79
2438 3300049584 Ga0501068_0342839 Ga0501068_0342839_128_367 79
2439 3300049586 Ga0501070_0117662 Ga0501070_0117662_1245_1484 79
2440 3300049586 Ga0501070_0372200 Ga0501070_0372200_412_651 79
2441 3300049586 Ga0501070_0586598 Ga0501070_0586598_597_842 79
2442 3300049586 Ga0501070_0872949 Ga0501070_0872949_38_277 79
2443 3300049587 Ga0501071_0000815 Ga0501071_0000815_4329_4571 79
2444 3300049587 Ga0501071_0005516 Ga0501071_0005516_577_816 79
2445 3300049587 Ga0501071_0008606 Ga0501071_0008606_467_706 79
2446 3300049587 Ga0501071_0017826 Ga0501071_0017826_995_1234 79
2447 3300049587 Ga0501071_0103687 Ga0501071_0103687_1744_1986 79
2448 3300049587 Ga0501071_0404073 Ga0501071_0404073_789_1031 79
2449 3300049587 Ga0501071_0535278 Ga0501071_0535278_523_762 79
2450 3300049587 Ga0501071_0735501 Ga0501071_0735501_38_277 79
2451 3300049587 Ga0501071_0945310 Ga0501071_0945310_336_578 79
2452 3300049587 Ga0501071_1257219 Ga0501071_1257219_238_477 79
2453 3300049588 Ga0501072_0002061 Ga0501072_0002061_5650_5889 79
2454 3300049588 Ga0501072_0008844 Ga0501072_0008844_4968_5207 79
2455 3300049588 Ga0501072_0029125 Ga0501072_0029125_3623_3898 79
2456 3300049588 Ga0501072_0038872 Ga0501072_0038872_3417_3656 79
2457 3300049588 Ga0501072_0078611 Ga0501072_0078611_113_355 79
2458 3300049588 Ga0501072_0267121 Ga0501072_0267121_98_337 79
2459 3300049588 Ga0501072_0310657 Ga0501072_0310657_995_1237 79
2460 3300049588 Ga0501072_0801123 Ga0501072_0801123_362_601 79
2461 3300049588 Ga0501072_0827648 Ga0501072_0827648_393_632 79
2462 3300049588 Ga0501072_1156324 Ga0501072_1156324_156_398 79
2463 3300049589 Ga0501073_0004210 Ga0501073_0004210_1244_1483 79
2464 3300049589 Ga0501073_0011761 Ga0501073_0011761_4452_4694 79
2465 3300049589 Ga0501073_0016618 Ga0501073_0016618_4856_5095 79
2466 3300049589 Ga0501073_0094955 Ga0501073_0094955_1191_1466 79
2467 3300049589 Ga0501073_0176212 Ga0501073_0176212_211_450 79
2468 3300049590 Ga0501074_0031593 Ga0501074_0031593_2463_2705 79
2469 3300049590 Ga0501074_0084102 Ga0501074_0084102_936_1175 79
2470 3300049590 Ga0501074_0088777 Ga0501074_0088777_1911_2150 79
2471 3300049590 Ga0501074_0114695 Ga0501074_0114695_518_757 79
2472 3300049590 Ga0501074_0324352 Ga0501074_0324352_117_356 79
2473 3300049590 Ga0501074_0544697 Ga0501074_0544697_360_599 79
2474 3300049591 Ga0501075_0001050 Ga0501075_0001050_9670_9909 79
2475 3300049591 Ga0501075_0008966 Ga0501075_0008966_2773_3048 79
2476 3300049591 Ga0501075_0087597 Ga0501075_0087597_1480_1722 79
2477 3300049591 Ga0501075_0161388 Ga0501075_0161388_1276_1518 79
2478 3300049591 Ga0501075_1368257 Ga0501075_1368257_131_370 79
2479 3300049591 Ga0501075_1514595 Ga0501075_1514595_233_472 79
2480 3300049592 Ga0501076_0000475 Ga0501076_0000475_15723_15962 79
2481 3300049592 Ga0501076_0019529 Ga0501076_0019529_4608_4847 79
2482 3300049592 Ga0501076_0047763 Ga0501076_0047763_3050_3325 79
2483 3300049592 Ga0501076_0076915 Ga0501076_0076915_2057_2296 79
2484 3300049592 Ga0501076_0135873 Ga0501076_0135873_34_276 79
2485 3300049592 Ga0501076_0529739 Ga0501076_0529739_180_419 79
2486 3300049592 Ga0501076_0596708 Ga0501076_0596708_363_605 79
2487 3300049592 Ga0501076_0691836 Ga0501076_0691836_562_804 79
2488 3300049592 Ga0501076_0725756 Ga0501076_0725756_297_536 79
2489 3300049593 Ga0501077_0028843 Ga0501077_0028843_388_627 79
2490 3300049593 Ga0501077_0222922 Ga0501077_0222922_445_687 79
2491 3300049593 Ga0501077_0407379 Ga0501077_0407379_357_596 79
2492 3300049682 Ga0501252_082846 Ga0501252_082846_144_383 79
2493 3300049688 Ga0501259_101847 Ga0501259_101847_406_645 79
2494 3300049741 Ga0501079_0001439 Ga0501079_0001439_15073_15312 79
2495 3300049741 Ga0501079_0012051 Ga0501079_0012051_3938_4213 79
2496 3300049741 Ga0501079_0070222 Ga0501079_0070222_548_787 79
2497 3300049741 Ga0501079_0309751 Ga0501079_0309751_69_308 79
2498 3300049741 Ga0501079_1228925 Ga0501079_1228925_299_538 79
2499 3300049742 Ga0501080_0001393 Ga0501080_0001393_7418_7657 79
2500 3300049742 Ga0501080_0001490 Ga0501080_0001490_5249_5488 79
2501 3300049742 Ga0501080_0010032 Ga0501080_0010032_857_1096 79
2502 3300049742 Ga0501080_0044335 Ga0501080_0044335_874_1116 79
2503 3300049742 Ga0501080_0262742 Ga0501080_0262742_1263_1502 79
2504 3300049742 Ga0501080_0667089 Ga0501080_0667089_474_716 79
2505 3300049743 Ga0501081_0000755 Ga0501081_0000755_15219_15458 79
2506 3300049743 Ga0501081_0010137 Ga0501081_0010137_3514_3789 79
2507 3300049743 Ga0501081_0021871 Ga0501081_0021871_707_949 79
2508 3300049743 Ga0501081_0084845 Ga0501081_0084845_1852_2091 79
2509 3300049743 Ga0501081_0100441 Ga0501081_0100441_1052_1294 79
2510 3300049743 Ga0501081_0197489 Ga0501081_0197489_632_871 79
2511 3300049743 Ga0501081_0943623 Ga0501081_0943623_251_493 79
2512 3300049744 Ga0501083_0020059 Ga0501083_0020059_1610_1849 79
2513 3300049744 Ga0501083_0085921 Ga0501083_0085921_442_684 79
2514 3300049744 Ga0501083_0223531 Ga0501083_0223531_882_1121 79
2515 3300049744 Ga0501083_0432175 Ga0501083_0432175_421_660 79
2516 3300049744 Ga0501083_0520430 Ga0501083_0520430_149_388 79
2517 3300049776 Ga0501280_000952 Ga0501280_000952_2611_2856 79
2518 3300049778 Ga0501282_001509 Ga0501282_001509_605_850 79
2519 3300049822 Ga0501035_0003745 Ga0501035_0003745_4642_4881 79
2520 3300049822 Ga0501035_0122766 Ga0501035_0122766_41_283 79
2521 3300049822 Ga0501035_0919994 Ga0501035_0919994_123_362 79
2522 3300049822 Ga0501035_1244605 Ga0501035_1244605_301_540 79
2523 3300049822 Ga0501035_1304379 Ga0501035_1304379_303_545 79
2524 3300049822 Ga0501035_1392694 Ga0501035_1392694_60_299 79
2525 3300049823 Ga0501044_0031331 Ga0501044_0031331_1486_1725 79
2526 3300049823 Ga0501044_1261836 Ga0501044_1261836_235_477 79
2527 3300049824 Ga0501045_0000167 Ga0501045_0000167_23232_23471 79
2528 3300049824 Ga0501045_0108142 Ga0501045_0108142_407_649 79
2529 3300049824 Ga0501045_0133162 Ga0501045_0133162_277_516 79
2530 3300049824 Ga0501045_0145604 Ga0501045_0145604_500_739 79
2531 3300049824 Ga0501045_0321547 Ga0501045_0321547_164_403 79
2532 3300049824 Ga0501045_0455346 Ga0501045_0455346_286_528 79
2533 3300049824 Ga0501045_0655878 Ga0501045_0655878_482_757 79
2534 3300049824 Ga0501045_1254041 Ga0501045_1254041_30_269 79
2535 3300050507 nmdc:mga05p37_1121930_c1 nmdc:mga05p37_1121930_c1_272_511 79
2536 3300050507 nmdc:mga05p37_1667_c1 nmdc:mga05p37_1667_c1_10529_10768 79
2537 3300050507 nmdc:mga05p37_219146_c1 nmdc:mga05p37_219146_c1_463_705 79
2538 3300050507 nmdc:mga05p37_561405_c1 nmdc:mga05p37_561405_c1_92_331 79
2539 3300050507 nmdc:mga05p37_914730_c1 nmdc:mga05p37_914730_c1_611_850 79
2540 3300050508 nmdc:mga09592_1054_c1 nmdc:mga09592_1054_c1_10377_10616 79
2541 3300050508 nmdc:mga09592_116100_c1 nmdc:mga09592_116100_c1_1242_1481 79
2542 3300050509 nmdc:mga0qj67_514567_c1 nmdc:mga0qj67_514567_c1_577_816 79
2543 3300050509 nmdc:mga0qj67_722529_c1 nmdc:mga0qj67_722529_c1_188_445 79
2544 3300050510 nmdc:mga06r32_115722_c1 nmdc:mga06r32_115722_c1_383_622 79
2545 3300050510 nmdc:mga06r32_1630396_c1 nmdc:mga06r32_1630396_c1_191_430 79
2546 3300050510 nmdc:mga06r32_469093_c1 nmdc:mga06r32_469093_c1_308_547 79
2547 3300050510 nmdc:mga06r32_545809_c1 nmdc:mga06r32_545809_c1_406_645 79
2548 3300050510 nmdc:mga06r32_819457_c1 nmdc:mga06r32_819457_c1_265_507 79
2549 3300050511 nmdc:mga08y16_1088953_c1 nmdc:mga08y16_1088953_c1_209_448 79
2550 3300050511 nmdc:mga08y16_1646796_c1 nmdc:mga08y16_1646796_c1_11_250 79
2551 3300050511 nmdc:mga08y16_1684428_c1 nmdc:mga08y16_1684428_c1_282_521 79
2552 3300050511 nmdc:mga08y16_188292_c1 nmdc:mga08y16_188292_c1_616_855 79
2553 3300050511 nmdc:mga08y16_62381_c1 nmdc:mga08y16_62381_c1_87_329 79
2554 3300050512 nmdc:mga0n895_1514874_c1 nmdc:mga0n895_1514874_c1_112_351 79
2555 3300050512 nmdc:mga0n895_20653_c1 nmdc:mga0n895_20653_c1_5543_5785 79
2556 3300050512 nmdc:mga0n895_298647_c1 nmdc:mga0n895_298647_c1_111_350 79
2557 3300050512 nmdc:mga0n895_312021_c1 nmdc:mga0n895_312021_c1_982_1221 79
2558 3300050512 nmdc:mga0n895_497055_c1 nmdc:mga0n895_497055_c1_676_915 79
2559 3300050512 nmdc:mga0n895_87081_c1 nmdc:mga0n895_87081_c1_73_312 79
2560 3300050512 nmdc:mga0n895_912325_c1 nmdc:mga0n895_912325_c1_228_467 79
2561 3300050513 nmdc:mga0rr50_1104355_c1 nmdc:mga0rr50_1104355_c1_304_543 79
2562 3300050513 nmdc:mga0rr50_223029_c1 nmdc:mga0rr50_223029_c1_493_735 79
2563 3300050513 nmdc:mga0rr50_393592_c1 nmdc:mga0rr50_393592_c1_413_652 79
2564 3300050513 nmdc:mga0rr50_90742_c1 nmdc:mga0rr50_90742_c1_1588_1830 79
2565 3300050513 nmdc:mga0rr50_960522_c1 nmdc:mga0rr50_960522_c1_96_335 79
2566 3300050513 nmdc:mga0rr50_991159_c1 nmdc:mga0rr50_991159_c1_447_686 79
2567 3300050514 nmdc:mga08x19_1172376_c1 nmdc:mga08x19_1172376_c1_181_423 79
2568 3300050514 nmdc:mga08x19_156563_c1 nmdc:mga08x19_156563_c1_1014_1286 79
2569 3300050514 nmdc:mga08x19_17024_c2 nmdc:mga08x19_17024_c2_318_560 79
2570 3300050514 nmdc:mga08x19_297230_c1 nmdc:mga08x19_297230_c1_859_1098 79
2571 3300050515 nmdc:mga0a205_1054899_c1 nmdc:mga0a205_1054899_c1_345_584 79
2572 3300050515 nmdc:mga0a205_144832_c1 nmdc:mga0a205_144832_c1_1646_1885 79
2573 3300050515 nmdc:mga0a205_1585761_c1 nmdc:mga0a205_1585761_c1_131_370 79
2574 3300050515 nmdc:mga0a205_202_c1 nmdc:mga0a205_202_c1_13607_13849 79
2575 3300050515 nmdc:mga0a205_251578_c1 nmdc:mga0a205_251578_c1_641_880 79
2576 3300053077 Ga0495601_0160947 Ga0495601_0160947_505_744 79
2577 3300053084 Ga0495595_0508199 Ga0495595_0508199_108_347 79
2578 3300053084 Ga0495595_0697914 Ga0495595_0697914_185_424 79
2579 3300053085 Ga0495619_0042231 Ga0495619_0042231_1328_1567 79
2580 3300053085 Ga0495619_0079770 Ga0495619_0079770_1637_1876 79
2581 3300053085 Ga0495619_0718181 Ga0495619_0718181_140_379 79
2582 3300053093 Ga0500651_0000033 Ga0500651_0000033_35473_35829 79
2583 3300053125 Ga0500618_003380 Ga0500618_003380_4404_4643 79
2584 3300053139 Ga0500568_0294028 Ga0500568_0294028_179_445 79
2585 3300054114 Ga0501084_0001772 Ga0501084_0001772_16482_16721 79
2586 3300054114 Ga0501084_0030490 Ga0501084_0030490_2832_3107 79
2587 3300054114 Ga0501084_0066368 Ga0501084_0066368_1770_2012 79
2588 3300054114 Ga0501084_0178067 Ga0501084_0178067_695_937 79
2589 3300054114 Ga0501084_0596411 Ga0501084_0596411_546_785 79
2590 3300054114 Ga0501084_0876072 Ga0501084_0876072_505_744 79
2591 3300054114 Ga0501084_0950323 Ga0501084_0950323_192_431 79
2592 3300054114 Ga0501084_1242060 Ga0501084_1242060_104_346 79
2593 3300054114 Ga0501084_1391769 Ga0501084_1391769_295_534 79
2594 3300059426 Ga0590077_118185 Ga0590077_118185_99_338 79
2595 3300059477 Ga0587084_011754 Ga0587084_011754_384_623 79
2596 3300059504 Ga0587082_133245 Ga0587082_133245_114_353 79
2597 3300059508 Ga0587088_146522 Ga0587088_146522_138_377 79
2598 3300059510 Ga0587090_084556 Ga0587090_084556_240_524 79
2599 3300059513 Ga0587094_034035 Ga0587094_034035_50_289 79
2600 3300059513 Ga0587094_113420 Ga0587094_113420_168_407 79
2601 3300059623 Ga0587101_104744 Ga0587101_104744_169_408 79
2602 3300059624 Ga0587109_198398 Ga0587109_198398_170_409 79
2603 3300059641 Ga0587068_115413 Ga0587068_115413_272_511 79
2604 3300059644 Ga0587075_106534 Ga0587075_106534_120_359 79
2605 3300059648 Ga0587100_020608 Ga0587100_020608_330_569 79
2606 3300060344 Ga0587071_047986 Ga0587071_047986_547_786 79
2607 3300060344 Ga0587071_220570 Ga0587071_220570_123_362 79
2608 3300060346 Ga0587111_0210261 Ga0587111_0210261_198_437 79
2609 3300060353 Ga0501082_0003622 Ga0501082_0003622_9843_10118 79
2610 3300060353 Ga0501082_0004013 Ga0501082_0004013_3349_3588 79
2611 3300060353 Ga0501082_0006976 Ga0501082_0006976_6692_6934 79
2612 3300060353 Ga0501082_0038853 Ga0501082_0038853_2628_2867 79
2613 3300060353 Ga0501082_0289095 Ga0501082_0289095_87_329 79
2614 3300060353 Ga0501082_0489497 Ga0501082_0489497_434_673 79
2615 3300060353 Ga0501082_0818103 Ga0501082_0818103_400_642 79
2616 3300060353 Ga0501082_0844112 Ga0501082_0844112_434_673 79
2617 3300060353 Ga0501082_1484331 Ga0501082_1484331_234_476 79
2618 3300060353 Ga0501082_1499301 Ga0501082_1499301_141_380 79
2619 3300061719 Ga0466962_0001388 Ga0466962_0001388_8614_8853 79
2620 3300061719 Ga0466962_0014487 Ga0466962_0014487_1814_2053 79
2621 3300061734 Ga0530510_0001699 Ga0530510_0001699_3349_3588 79
2622 3300061734 Ga0530510_0056587 Ga0530510_0056587_890_1165 79
2623 3300061734 Ga0530510_0108288 Ga0530510_0108288_1763_2005 79
2624 3300061734 Ga0530510_0169051 Ga0530510_0169051_531_770 79
2625 3300061734 Ga0530510_0559543 Ga0530510_0559543_265_504 79
2626 3300061734 Ga0530510_1586865 Ga0530510_1586865_86_325 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

25

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pdi-assembly1.cif.gz_A crystal structure of the holo-acyl carrier protein (holo-acpp) from pseudomonas putida kt2440. produced as an apo/holo mixture. 1.001 1 75
1l0i-assembly1.cif.gz_A crystal structure of butyryl-acp i62m mutant 0.9967 2 78
6u0j-assembly1.cif.gz_B crosslinked crystal structure of malonyl-coa acyl carrier protein transacylase, fabd, and acyl carrier protein, acpp 0.9942 2 74
2fac-assembly1.cif.gz_A crystal structure of e. coli hexanoyl-acp 0.9918 2 78
4ihg-assembly1.cif.gz_H chasing acyl carrier protein through a catalytic cycle of lipid a production 0.99 5 74
ID Description Score Start End Superfamily
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 1.01 1 75 1.10.1200.10
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9982 4 75 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9924 4 77 1.10.1200.10
3ejeA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9822 1 76 1.10.1200.10
1f80E00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9773 5 74 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A1E4XCL3-F1-model_v4 Acyl carrier protein (ACP) 1.011 1 75 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
GO:0036104
AF-A0A3M3SAP5-F1-model_v4 deleted 1.011 1 75
AF-A0A3D9K4E5-F1-model_v4 deleted 1.011 1 75
AF-A0A3D2ANN1-F1-model_v4 Acyl carrier protein (ACP) 1.011 2 75 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
GO:0031177
GO:0036104
AF-A0A800IEL1-F1-model_v4 Acyl carrier protein (ACP) 1.011 2 75 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
GO:0031177
GO:0036104

Feature Viewer

pLDDT pTM Quality
91.12 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map