F496702

General Info

Members Datasets Scaffolds Average Seq Length
2335 844 4670 115

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0030612|Ga0495653_0030612_3353_3709
Length 118
Sequence MTPRMAAGGFVDLKLGHYNKDGIEVVDVEGEIDVYTAPRLRELLIDLVNKNNMEKVEFLDSTGLGVLVGGLKRVRAHDGSLDLVCTQERILKIFRITGLTKVFGIHNTVDEAIAAKDK

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
140 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
141 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
142 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
146 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
147 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
148 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
149 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
150 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
151 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
152 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
153 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
154 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
155 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
156 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
157 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
176 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
177 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
178 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
192 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
198 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
199 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
200 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
201 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
202 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
205 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
206 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
207 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
278 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
279 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
284 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
285 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
286 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
287 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
288 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
289 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
290 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
291 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
292 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
293 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
294 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
295 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
304 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
305 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
306 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
307 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
308 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
309 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
314 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
315 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
316 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
317 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
318 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
319 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
320 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
321 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
322 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
323 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
324 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
325 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
326 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
327 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
328 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
329 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
330 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
331 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
332 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
333 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
334 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
335 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
336 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
337 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
338 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
340 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
341 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
342 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
343 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
344 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
345 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
346 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
347 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
348 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
349 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
350 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
351 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
352 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
353 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
354 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
355 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
356 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
357 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
358 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
359 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
360 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
362 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
363 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
364 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
365 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
366 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
367 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
368 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
369 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
370 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
371 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
372 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
373 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
374 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
375 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
376 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
377 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
378 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
379 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
380 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
381 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
382 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
383 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
384 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
385 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
386 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
387 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
388 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
389 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
390 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
391 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
392 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
393 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
394 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
395 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
396 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
397 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
398 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
399 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
400 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
401 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
402 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
403 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
404 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
405 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
406 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
407 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
408 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
409 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
410 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
411 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
412 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
413 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
414 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
415 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
416 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
417 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
418 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
419 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
420 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
421 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
422 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
423 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
424 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
425 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
426 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
427 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
428 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
429 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
430 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
431 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
432 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
433 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
434 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
435 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
436 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
437 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
438 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
439 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
440 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
441 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
442 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
443 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
444 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
445 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
446 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
447 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
448 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
449 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
450 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
451 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
452 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
453 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
454 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
457 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
458 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
459 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
460 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
461 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
462 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
463 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
464 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
465 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
466 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
467 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
468 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
469 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
470 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
471 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
472 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
473 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
474 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
475 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
476 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
477 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
478 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
479 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
480 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
481 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
482 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
483 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
484 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
485 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
486 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
487 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
488 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
489 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
490 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
491 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
492 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
493 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
494 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
495 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
496 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
497 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
498 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
499 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
500 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
501 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
502 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
503 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
504 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
505 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
506 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
507 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
508 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
509 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
510 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
511 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
512 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
513 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
514 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
515 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
516 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
517 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
518 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
519 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
520 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
521 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
522 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
523 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
524 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
525 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
526 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
527 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
528 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
529 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
530 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
531 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
532 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
533 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
534 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
535 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
536 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
537 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
538 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
539 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
540 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
541 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
542 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
543 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
544 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
545 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
546 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
547 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
548 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
549 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
550 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
551 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
552 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
553 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
554 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
555 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
556 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
557 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
558 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
559 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
560 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
561 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
562 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
563 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
564 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
565 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
573 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
574 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
593 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
594 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
597 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
598 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
599 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
600 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
605 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
606 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
607 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
608 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
609 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
610 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
611 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
612 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
613 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
614 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
615 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
616 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
617 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
618 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
619 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
620 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
621 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
622 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
624 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
625 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
626 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
627 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
628 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
629 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
630 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
631 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
632 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
633 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
634 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
635 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
636 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
637 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
638 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
639 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
640 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
641 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
642 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
643 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
644 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
645 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
646 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
647 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
648 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
649 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
650 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
651 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
652 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
653 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
654 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
655 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
656 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
657 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
658 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
659 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
660 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
661 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
662 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
663 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
664 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
665 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
666 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
667 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
668 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
669 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
670 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
671 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
672 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
673 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
674 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
675 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
676 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
677 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
678 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
679 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
680 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
681 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
684 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
685 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
726 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
728 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
730 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
731 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
732 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
733 2508501039 Frankia saprophytica CN3 Isolate Nodule
734 2517572101 Frankia sp. DC12 Isolate Nodule
735 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
736 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
737 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
738 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
739 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
740 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
741 2643221548 Streptomyces sp. Root55 Isolate Unclassified
742 2643221561 Nocardioides sp. Root151 Isolate Unclassified
743 2643221578 Streptomyces sp. Root63 Isolate Unclassified
744 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
745 2643221615 Nocardioides sp. Root224 Isolate Unclassified
746 2643221647 Streptomyces sp. Root369 Isolate Unclassified
747 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
748 2643221670 Streptomyces sp. Root431 Isolate Unclassified
749 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
750 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
751 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
752 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
753 2643221696 Nocardioides sp. Root140 Isolate Unclassified
754 2643221714 Streptomyces sp. Root264 Isolate Unclassified
755 2671180195 Frankia sp. CcI49 Isolate Nodule
756 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
757 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
758 2687453737 Frankia sp. BMG5.36 Isolate Nodule
759 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
760 2710264753 Frankia sp. KB5 Isolate Nodule
761 2739367898 Nocardioides sp. CF479 Isolate Unclassified
762 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
763 2773857922 Frankia sp. CcI49 Isolate Nodule
764 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
765 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
766 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
767 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
768 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
769 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
770 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
771 2808606448 Streptomyces sp. 193411 Isolate Unclassified
772 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
773 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
774 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
775 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
776 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
777 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
778 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
779 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
780 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
781 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
782 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
783 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
784 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
785 2862574272 Streptomyces sp. AcE210 Isolate Nodule
786 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
787 2867369537 Streptomyces sp. Z26 Isolate Unclassified
788 2867428634 Streptomyces sp. RP5T Isolate Unclassified
789 2867475112 Streptomyces sp. TM32 Isolate Unclassified
790 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
791 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
792 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
793 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
794 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
795 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
796 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
797 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
798 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
799 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
800 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
801 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
802 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
803 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
804 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
805 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
806 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
807 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
808 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
809 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
810 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
811 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
812 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
813 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
814 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
815 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
816 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
817 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
818 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
819 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
820 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
821 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
822 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
823 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
824 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
825 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
826 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
827 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
828 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
829 8002784119 Frankia sp. AgB1.9 Isolate Nodule
830 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
831 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
832 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
833 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
834 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
835 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
836 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
837 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
838 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
839 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
840 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
841 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
842 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
843 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
844 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.48
Metatranscriptomes 9.72
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 3.98
Nodule 0.64
Rhizoplane 4.75
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0030612 3300046463 Bacteria 4284
2 JGI24739J22299_10012246 3300001989 Bacteria 3150
3 JGI24737J22298_10019105 3300001990 Bacteria 2192
4 JGI24737J22298_10192344 3300001990 Bacteria 602
5 JGI24743J22301_10161148 3300001991 Bacteria 506
6 JGI24735J21928_10045879 3300002067 Bacteria 1268
7 JGI24735J21928_10046425 3300002067 Bacteria 1260
8 JGI24735J21928_10137400 3300002067 Bacteria 705
9 JGI24738J21930_10009224 3300002075 Bacteria 2226
10 Ga0006778J45830_1049852 3300003162 Bacteria 1083
11 Ga0006759J45824_1020748 3300003163 Bacteria 1220
12 JGI25406J46586_10007643 3300003203 Bacteria 4920
13 JGI25153J46596_10101033 3300003215 Bacteria 678
14 Ga0006758J48902_1016223 3300003300 Bacteria 1097
15 Ga0006777J48905_1018870 3300003308 Bacteria 786
16 rootH1_10072002 3300003316 Bacteria 3813
17 rootH2_10022780 3300003320 Bacteria 4656
18 rootH2_10108428 3300003320 Bacteria 1526
19 rootH1_10031505 3300003323 Bacteria 3992
20 JGI25160J50197_1022315 3300003354 Bacteria 1859
21 JGI25160J50197_1039249 3300003354 Bacteria 1110
22 JGI25407J50210_10018107 3300003373 Bacteria 1831
23 JGI25407J50210_10037302 3300003373 Bacteria 1249
24 Ga0007427J51700_111976 3300003559 Bacteria 799
25 Ga0006781J51513_1031642 3300003568 Bacteria 622
26 Ga0007409J51694_1021866 3300003575 Bacteria 1194
27 Ga0006562J51391_1046289 3300003578 Bacteria 1750
28 Ga0007429J51699_1015173 3300003579 Bacteria 1167
29 Ga0007429J51699_1022622 3300003579 Bacteria 1083
30 JGI25404J52841_10003762 3300003659 Bacteria 3025
31 Ga0032354_1015897 3300003693 Bacteria 1215
32 Ga0032354_1034030 3300003693 Bacteria 908
33 Ga0032354_1078986 3300003693 Bacteria 688
34 Ga0006780_1022200 3300003735 Bacteria 1188
35 Ga0058692_1043303 3300003856 Bacteria 777
36 Ga0058859_10015040 3300004798 Bacteria 595
37 Ga0058859_10049176 3300004798 Bacteria 642
38 Ga0058863_10065640 3300004799 Bacteria 1182
39 Ga0058863_11976483 3300004799 Bacteria 1222
40 Ga0058861_10164303 3300004800 Bacteria 779
41 Ga0058861_10176188 3300004800 Bacteria 923
42 Ga0058860_10007162 3300004801 Bacteria 749
43 Ga0058860_10028903 3300004801 Bacteria 559
44 Ga0058860_10033454 3300004801 Bacteria 705
45 Ga0058860_12110909 3300004801 Bacteria 516
46 Ga0058860_12209150 3300004801 Bacteria 701
47 Ga0058862_10234175 3300004803 Bacteria 540
48 Ga0058862_12842049 3300004803 Bacteria 940
49 Ga0070658_10057941 3300005327 Bacteria 3151
50 Ga0070658_11647721 3300005327 Bacteria 556
51 Ga0070683_100046631 3300005329 Bacteria 4004
52 Ga0070683_100072608 3300005329 Bacteria 3212
53 Ga0070683_100190097 3300005329 Bacteria 1949
54 Ga0070683_100202004 3300005329 Bacteria 1887
55 Ga0070683_100396927 3300005329 Bacteria 1315
56 Ga0070683_100563340 3300005329 Bacteria 1090
57 Ga0070670_100578960 3300005331 Bacteria 1003
58 Ga0070670_101515613 3300005331 Bacteria 616
59 Ga0070677_10529932 3300005333 Bacteria 643
60 Ga0068869_100122565 3300005334 Bacteria 1990
61 Ga0068869_100504708 3300005334 Bacteria 1010
62 Ga0070680_100608737 3300005336 Bacteria 938
63 Ga0070682_100003432 3300005337 Bacteria 8784
64 Ga0070682_100117787 3300005337 Bacteria 1778
65 Ga0070682_100284955 3300005337 Bacteria 1206
66 Ga0070682_100449172 3300005337 Bacteria 987
67 Ga0068868_100178637 3300005338 Bacteria 1760
68 Ga0068868_100542817 3300005338 Bacteria 1024
69 Ga0070660_100032354 3300005339 Bacteria 3935
70 Ga0070660_100064698 3300005339 Bacteria 2845
71 Ga0070660_100080638 3300005339 Bacteria 2554
72 Ga0070660_100099506 3300005339 Bacteria 2302
73 Ga0070687_100026149 3300005343 Bacteria 2808
74 Ga0070687_100727747 3300005343 Bacteria 696
75 Ga0070661_100067814 3300005344 Bacteria 2622
76 Ga0070661_100224898 3300005344 Bacteria 1440
77 Ga0070692_10029363 3300005345 Bacteria 2740
78 Ga0070692_10117879 3300005345 Bacteria 1477
79 Ga0070668_100005274 3300005347 Bacteria 9587
80 Ga0070668_100323680 3300005347 Bacteria 1298
81 Ga0070668_101343155 3300005347 Bacteria 650
82 Ga0070668_101377431 3300005347 Bacteria 643
83 Ga0070668_101646027 3300005347 Bacteria 589
84 Ga0070671_100119704 3300005355 Bacteria 2215
85 Ga0070671_100385026 3300005355 Bacteria 1199
86 Ga0070671_100438242 3300005355 Bacteria 1120
87 Ga0070674_100123743 3300005356 Bacteria 1918
88 Ga0070674_100160241 3300005356 Bacteria 1707
89 Ga0070673_100113602 3300005364 Bacteria 2249
90 Ga0070673_100786336 3300005364 Bacteria 878
91 Ga0070673_102039575 3300005364 Bacteria 545
92 Ga0070659_100037012 3300005366 Bacteria 3804
93 Ga0070659_100652007 3300005366 Bacteria 908
94 Ga0070703_10006853 3300005406 Bacteria 3198
95 Ga0070709_10071599 3300005434 Bacteria 2239
96 Ga0070709_10349223 3300005434 Bacteria 1092
97 Ga0070714_100307734 3300005435 Bacteria 1479
98 Ga0070714_101061487 3300005435 Bacteria 789
99 Ga0070713_100016958 3300005436 Bacteria 5492
100 Ga0070710_10049761 3300005437 Bacteria 2345
101 Ga0070711_100347531 3300005439 Bacteria 1192
102 Ga0070711_101219286 3300005439 Bacteria 651
103 Ga0070705_101717572 3300005440 Bacteria 531
104 Ga0070700_100306162 3300005441 Bacteria 1162
105 Ga0070700_100382422 3300005441 Bacteria 1053
106 Ga0070708_100029105 3300005445 Bacteria 4761
107 Ga0070708_100191338 3300005445 Bacteria 1913
108 Ga0070708_100224162 3300005445 Bacteria 1763
109 Ga0070663_100180106 3300005455 Bacteria 1639
110 Ga0070663_100242842 3300005455 Bacteria 1422
111 Ga0070663_100365984 3300005455 Bacteria 1171
112 Ga0070663_100612767 3300005455 Bacteria 917
113 Ga0070678_100148612 3300005456 Bacteria 1884
114 Ga0070678_100369594 3300005456 Bacteria 1238
115 Ga0070662_100033040 3300005457 Bacteria 3641
116 Ga0070662_100091588 3300005457 Bacteria 2284
117 Ga0070662_100140800 3300005457 Bacteria 1869
118 Ga0070681_10041790 3300005458 Bacteria 4596
119 Ga0070681_10301002 3300005458 Bacteria 1513
120 Ga0068867_100173855 3300005459 Bacteria 1708
121 Ga0070685_10121605 3300005466 Bacteria 1622
122 Ga0070685_10219788 3300005466 Bacteria 1244
123 Ga0070706_100002754 3300005467 Bacteria 17588
124 Ga0070706_100003951 3300005467 Bacteria 14437
125 Ga0070706_100050706 3300005467 Bacteria 3830
126 Ga0070706_100230597 3300005467 Bacteria 1728
127 Ga0070707_100001503 3300005468 Bacteria 22738
128 Ga0070707_100049280 3300005468 Bacteria 4037
129 Ga0070707_100051048 3300005468 Bacteria 3964
130 Ga0070707_100098856 3300005468 Bacteria 2827
131 Ga0070698_100000665 3300005471 Bacteria 36678
132 Ga0070698_100005898 3300005471 Bacteria 13363
133 Ga0070698_100022580 3300005471 Bacteria 6581
134 Ga0070698_100055599 3300005471 Bacteria 4011
135 Ga0070698_100421835 3300005471 Bacteria 1269
136 Ga0070698_101679557 3300005471 Bacteria 587
137 Ga0070699_100321904 3300005518 Bacteria 1390
138 Ga0070699_100540722 3300005518 Bacteria 1060
139 Ga0070679_100019803 3300005530 Bacteria 6551
140 Ga0070679_100104922 3300005530 Bacteria 2812
141 Ga0070679_100605866 3300005530 Bacteria 1038
142 Ga0070684_100001778 3300005535 Bacteria 15736
143 Ga0070684_100112941 3300005535 Bacteria 2437
144 Ga0070684_100187049 3300005535 Bacteria 1884
145 Ga0070684_100266179 3300005535 Bacteria 1568
146 Ga0070684_100545705 3300005535 Bacteria 1076
147 Ga0070697_100037989 3300005536 Bacteria 3889
148 Ga0070697_101046319 3300005536 Bacteria 726
149 Ga0070697_102030489 3300005536 Bacteria 515
150 Ga0068853_100074255 3300005539 Bacteria 2967
151 Ga0068853_100194347 3300005539 Bacteria 1844
152 Ga0070672_100160740 3300005543 Bacteria 1863
153 Ga0070672_100458414 3300005543 Bacteria 1099
154 Ga0070686_100238808 3300005544 Bacteria 1322
155 Ga0070686_101494516 3300005544 Bacteria 569
156 Ga0070695_100081265 3300005545 Bacteria 2144
157 Ga0070693_100077237 3300005547 Bacteria 1976
158 Ga0070665_100319651 3300005548 Bacteria 1556
159 Ga0070665_100665089 3300005548 Bacteria 1055
160 Ga0070665_101998709 3300005548 Bacteria 585
161 Ga0070704_100123917 3300005549 Bacteria 1990
162 Ga0070704_100455370 3300005549 Bacteria 1102
163 Ga0068855_100164436 3300005563 Bacteria 2516
164 Ga0068855_100386020 3300005563 Bacteria 1537
165 Ga0068855_100493428 3300005563 Bacteria 1332
166 Ga0070664_100045018 3300005564 Bacteria 3726
167 Ga0070664_100078162 3300005564 Bacteria 2846
168 Ga0068857_100116012 3300005577 Bacteria 2409
169 Ga0068857_101740702 3300005577 Bacteria 610
170 Ga0068854_100215677 3300005578 Bacteria 1516
171 Ga0068854_100343671 3300005578 Bacteria 1219
172 Ga0068854_100512768 3300005578 Bacteria 1012
173 Ga0068856_100259101 3300005614 Bacteria 1754
174 Ga0068856_100354654 3300005614 Bacteria 1485
175 Ga0068856_100470378 3300005614 Bacteria 1278
176 Ga0070702_100075402 3300005615 Bacteria 2004
177 Ga0070702_100094259 3300005615 Bacteria 1822
178 Ga0070702_100333963 3300005615 Bacteria 1061
179 Ga0070702_100974962 3300005615 Bacteria 669
180 Ga0068852_100259966 3300005616 Bacteria 1667
181 Ga0068852_100342361 3300005616 Bacteria 1458
182 Ga0068852_100370667 3300005616 Bacteria 1403
183 Ga0068852_100464297 3300005616 Bacteria 1255
184 Ga0068852_100798769 3300005616 Bacteria 958
185 Ga0068859_100000094 3300005617 Bacteria 81844
186 Ga0068859_100019463 3300005617 Bacteria 6819
187 Ga0068859_100760623 3300005617 Bacteria 1057
188 Ga0068864_100036467 3300005618 Bacteria 4192
189 Ga0068864_100197116 3300005618 Bacteria 1848
190 Ga0068864_101881533 3300005618 Bacteria 604
191 Ga0068864_102396079 3300005618 Bacteria 534
192 Ga0068866_10137407 3300005718 Bacteria 1398
193 Ga0068861_100019697 3300005719 Bacteria 4821
194 Ga0068861_100260870 3300005719 Bacteria 1483
195 Ga0068851_10153942 3300005834 Bacteria 1259
196 Ga0068870_10235019 3300005840 Bacteria 1129
197 Ga0068863_100064425 3300005841 Bacteria 3466
198 Ga0068863_100114583 3300005841 Bacteria 2568
199 Ga0068863_101454095 3300005841 Bacteria 693
200 Ga0068858_100000036 3300005842 Bacteria 138467
201 Ga0068858_100163957 3300005842 Bacteria 2094
202 Ga0068858_100674869 3300005842 Bacteria 1005
203 Ga0068858_100781556 3300005842 Bacteria 931
204 Ga0068860_100058211 3300005843 Bacteria 3673
205 Ga0068862_100000204 3300005844 Bacteria 65627
206 Ga0068862_100710697 3300005844 Bacteria 974
207 Ga0081455_10014212 3300005937 Bacteria 7816
208 Ga0081455_10030364 3300005937 Bacteria 4909
209 Ga0081455_10226962 3300005937 Bacteria 1381
210 Ga0081538_10003619 3300005981 Bacteria 14524
211 Ga0081538_10011320 3300005981 Bacteria 7235
212 Ga0081538_10016741 3300005981 Bacteria 5605
213 Ga0081538_10029722 3300005981 Bacteria 3727
214 Ga0081538_10047756 3300005981 Bacteria 2621
215 Ga0081538_10058335 3300005981 Bacteria 2240
216 Ga0081538_10066451 3300005981 Bacteria 2022
217 Ga0081538_10283081 3300005981 Bacteria 615
218 Ga0081540_1000345 3300005983 Bacteria 46912
219 Ga0081540_1009692 3300005983 Bacteria 6613
220 Ga0081539_10002843 3300005985 Bacteria 23096
221 Ga0081539_10028367 3300005985 Bacteria 3521
222 Ga0081539_10030867 3300005985 Bacteria 3316
223 Ga0081539_10208914 3300005985 Bacteria 896
224 Ga0081539_10248166 3300005985 Bacteria 793
225 Ga0081539_10275591 3300005985 Bacteria 735
226 Ga0070717_10045967 3300006028 Bacteria 3571
227 Ga0070717_10046247 3300006028 Bacteria 3561
228 Ga0070717_10323441 3300006028 Bacteria 1374
229 Ga0070717_10611810 3300006028 Bacteria 988
230 Ga0070717_12018596 3300006028 Bacteria 520
231 Ga0075365_10082094 3300006038 Bacteria 2185
232 Ga0075365_10132046 3300006038 Bacteria 1728
233 Ga0075365_10153204 3300006038 Bacteria 1604
234 Ga0075368_10000813 3300006042 Bacteria 9606
235 Ga0075368_10070273 3300006042 Bacteria 1413
236 Ga0075363_100029174 3300006048 Bacteria 2845
237 Ga0075363_100033261 3300006048 Bacteria 2684
238 Ga0075364_10202207 3300006051 Bacteria 1347
239 Ga0075364_10929506 3300006051 Bacteria 592
240 Ga0075432_10003211 3300006058 Bacteria 5514
241 Ga0070715_10016810 3300006163 Bacteria 2757
242 Ga0070715_10070916 3300006163 Bacteria 1556
243 Ga0070715_10085671 3300006163 Bacteria 1439
244 Ga0070716_100016224 3300006173 Bacteria 3839
245 Ga0070716_100098885 3300006173 Bacteria 1784
246 Ga0070712_100003387 3300006175 Bacteria 9805
247 Ga0070712_100165125 3300006175 Bacteria 1713
248 Ga0070712_100182981 3300006175 Bacteria 1634
249 Ga0070712_100195468 3300006175 Bacteria 1586
250 Ga0070712_100395491 3300006175 Bacteria 1140
251 Ga0070712_100708388 3300006175 Bacteria 859
252 Ga0075367_10013875 3300006178 Bacteria 4346
253 Ga0075367_10044898 3300006178 Bacteria 2592
254 Ga0075367_10185529 3300006178 Bacteria 1297
255 Ga0097621_100063674 3300006237 Bacteria 3031
256 Ga0097621_100316810 3300006237 Bacteria 1381
257 Ga0075370_10061581 3300006353 Bacteria 2138
258 Ga0068871_100311016 3300006358 Bacteria 1385
259 Ga0068871_100467349 3300006358 Bacteria 1133
260 Ga0068871_100473318 3300006358 Bacteria 1126
261 Ga0068871_101132021 3300006358 Bacteria 733
262 Ga0075428_100775684 3300006844 Bacteria 1019
263 Ga0075428_100805111 3300006844 Bacteria 999
264 Ga0075430_100008819 3300006846 Bacteria 8510
265 Ga0075431_100014880 3300006847 Bacteria 7876
266 Ga0075433_10042000 3300006852 Bacteria 3965
267 Ga0075433_10321934 3300006852 Bacteria 1368
268 Ga0075434_100018311 3300006871 Bacteria 6764
269 Ga0075434_100693747 3300006871 Bacteria 1036
270 Ga0075434_102227245 3300006871 Bacteria 551
271 Ga0075429_100062979 3300006880 Bacteria 3231
272 Ga0068865_100024075 3300006881 Bacteria 3992
273 Ga0068865_100079207 3300006881 Bacteria 2353
274 Ga0068865_100153696 3300006881 Bacteria 1748
275 Ga0068865_100175399 3300006881 Bacteria 1647
276 Ga0068865_100519429 3300006881 Bacteria 995
277 Ga0068865_100605044 3300006881 Bacteria 927
278 Ga0075436_100900585 3300006914 Bacteria 662
279 Ga0097620_100000094 3300006931 Bacteria 81844
280 Ga0097620_100019463 3300006931 Bacteria 6819
281 Ga0097620_100760619 3300006931 Bacteria 1057
282 Ga0099826_10081983 3300006948 Bacteria 2005
283 Ga0075435_100013330 3300007076 Bacteria 6111
284 Ga0075435_100185638 3300007076 Bacteria 1758
285 Ga0075435_100202372 3300007076 Bacteria 1683
286 Ga0099794_10153458 3300007265 Bacteria 1169
287 Ga0105251_10019082 3300009011 Bacteria 3630
288 Ga0105251_10024110 3300009011 Bacteria 3127
289 Ga0105244_10149676 3300009036 Bacteria 1119
290 Ga0105244_10359605 3300009036 Bacteria 671
291 Ga0105250_10069781 3300009092 Bacteria 1419
292 Ga0105250_10342843 3300009092 Bacteria 653
293 Ga0105240_10813749 3300009093 Bacteria 1011
294 Ga0105240_11086267 3300009093 Bacteria 852
295 Ga0111539_10021256 3300009094 Bacteria 7989
296 Ga0111539_10434718 3300009094 Bacteria 1528
297 Ga0111539_11374947 3300009094 Bacteria 819
298 Ga0111539_11439641 3300009094 Bacteria 799
299 Ga0105245_10007936 3300009098 Bacteria 9281
300 Ga0105245_10320361 3300009098 Bacteria 1527
301 Ga0105245_10452189 3300009098 Bacteria 1293
302 Ga0105245_10486061 3300009098 Bacteria 1249
303 Ga0105245_10625204 3300009098 Bacteria 1105
304 Ga0105245_10631309 3300009098 Bacteria 1100
305 Ga0105245_12684384 3300009098 Bacteria 551
306 Ga0105247_10000357 3300009101 Bacteria 39270
307 Ga0105247_10091356 3300009101 Bacteria 1933
308 Ga0105247_10097314 3300009101 Bacteria 1877
309 Ga0105247_10101372 3300009101 Bacteria 1841
310 Ga0105247_10150418 3300009101 Bacteria 1533
311 Ga0114129_10100488 3300009147 Bacteria 4003
312 Ga0114129_10316525 3300009147 Bacteria 2075
313 Ga0114129_10785511 3300009147 Bacteria 1216
314 Ga0105243_10057425 3300009148 Bacteria 3099
315 Ga0105243_10065756 3300009148 Bacteria 2914
316 Ga0105243_10078129 3300009148 Bacteria 2694
317 Ga0105243_10636481 3300009148 Bacteria 1032
318 Ga0105243_11981364 3300009148 Bacteria 616
319 Ga0105241_10718168 3300009174 Bacteria 914
320 Ga0105241_11168071 3300009174 Bacteria 728
321 Ga0105242_10074221 3300009176 Bacteria 2830
322 Ga0105242_10085779 3300009176 Bacteria 2641
323 Ga0105242_10668381 3300009176 Bacteria 1012
324 Ga0105248_10000023 3300009177 Bacteria 264241
325 Ga0105248_10066086 3300009177 Bacteria 4061
326 Ga0105248_10496689 3300009177 Bacteria 1375
327 Ga0105248_11048756 3300009177 Bacteria 921
328 Ga0105248_11188340 3300009177 Bacteria 862
329 Ga0105248_11191354 3300009177 Bacteria 861
330 Ga0105248_12202217 3300009177 Bacteria 627
331 Ga0105237_10249366 3300009545 Bacteria 1777
332 Ga0105237_10625757 3300009545 Bacteria 1083
333 Ga0105237_10932331 3300009545 Bacteria 875
334 Ga0105237_11864646 3300009545 Bacteria 609
335 Ga0105238_10282092 3300009551 Bacteria 1642
336 Ga0105238_10283855 3300009551 Bacteria 1637
337 Ga0105238_10629320 3300009551 Bacteria 1082
338 Ga0105238_10688085 3300009551 Bacteria 1034
339 Ga0105238_11053877 3300009551 Bacteria 835
340 Ga0105238_12939657 3300009551 Bacteria 512
341 Ga0105249_10010731 3300009553 Bacteria 8048
342 Ga0105249_10012128 3300009553 Bacteria 7586
343 Ga0105249_10039691 3300009553 Bacteria 4274
344 Ga0105249_10548091 3300009553 Bacteria 1207
345 Ga0105249_11522334 3300009553 Bacteria 741
346 Ga0105249_13263324 3300009553 Bacteria 522
347 Ga0130087_1098055 3300009828 Bacteria 621
348 Ga0130086_1044473 3300009829 Bacteria 657
349 Ga0130086_1084162 3300009829 Bacteria 621
350 Ga0130084_1020040 3300009835 Bacteria 607
351 Ga0130084_1048495 3300009835 Bacteria 621
352 Ga0130084_1110514 3300009835 Bacteria 657
353 Ga0130085_1024196 3300009850 Bacteria 607
354 Ga0130085_1052010 3300009850 Bacteria 657
355 Ga0130085_1129671 3300009850 Bacteria 621
356 Ga0105239_10002802 3300010375 Bacteria 21794
357 Ga0105239_10009298 3300010375 Bacteria 11109
358 Ga0105239_10321094 3300010375 Bacteria 1746
359 Ga0105239_11106345 3300010375 Bacteria 912
360 Ga0105239_11310043 3300010375 Bacteria 835
361 Ga0105239_11514965 3300010375 Bacteria 775
362 Ga0105239_11903700 3300010375 Bacteria 690
363 Ga0105239_12832811 3300010375 Bacteria 566
364 Ga0105239_13111368 3300010375 Bacteria 540
365 Ga0105246_10002099 3300011119 Bacteria 12017
366 Ga0105246_10004538 3300011119 Bacteria 8449
367 Ga0105246_10098480 3300011119 Bacteria 2124
368 Ga0105246_10441200 3300011119 Bacteria 1092
369 Ga0105246_10540377 3300011119 Bacteria 997
370 Ga0105246_10555756 3300011119 Bacteria 984
371 Ga0105246_11213661 3300011119 Bacteria 695
372 Ga0105246_11225005 3300011119 Bacteria 692
373 Ga0157344_1004298 3300012476 Bacteria 842
374 Ga0157346_1004194 3300012480 Bacteria 842
375 Ga0157337_1008906 3300012483 Bacteria 747
376 Ga0157322_1021079 3300012490 Bacteria 629
377 Ga0157322_1022184 3300012490 Bacteria 620
378 Ga0157329_1000987 3300012491 Bacteria 1332
379 Ga0157335_1010443 3300012492 Bacteria 746
380 Ga0157341_1001858 3300012494 Bacteria 1329
381 Ga0157347_1013750 3300012502 Bacteria 887
382 Ga0157313_1011014 3300012503 Bacteria 778
383 Ga0157313_1060641 3300012503 Bacteria 516
384 Ga0157342_1018677 3300012507 Bacteria 788
385 Ga0157315_1003551 3300012508 Bacteria 1059
386 Ga0157338_1003156 3300012515 Bacteria 1347
387 Ga0154016_137542 3300013045 Bacteria 741
388 Ga0154014_128446 3300013052 Bacteria 843
389 Ga0154012_175242 3300013059 Bacteria 850
390 Ga0157373_10134868 3300013100 Bacteria 1736
391 Ga0157373_10611236 3300013100 Bacteria 794
392 Ga0157371_10022428 3300013102 Bacteria 4626
393 Ga0157371_10228025 3300013102 Bacteria 1338
394 Ga0157371_10318380 3300013102 Bacteria 1128
395 Ga0157370_10857027 3300013104 Bacteria 825
396 Ga0157369_10033117 3300013105 Bacteria 5681
397 Ga0157369_10144213 3300013105 Bacteria 2518
398 Ga0157369_10194793 3300013105 Bacteria 2129
399 Ga0157369_10431851 3300013105 Bacteria 1365
400 Ga0157369_11119600 3300013105 Bacteria 804
401 Ga0157369_12013227 3300013105 Bacteria 586
402 Ga0157369_12527135 3300013105 Bacteria 520
403 Ga0157374_10298902 3300013296 Bacteria 1592
404 Ga0157374_10431547 3300013296 Bacteria 1317
405 Ga0157374_11725263 3300013296 Bacteria 651
406 Ga0157374_12433564 3300013296 Bacteria 551
407 Ga0157374_12704085 3300013296 Bacteria 524
408 Ga0157378_10512846 3300013297 Bacteria 1199
409 Ga0157378_10577237 3300013297 Bacteria 1133
410 Ga0157378_11176869 3300013297 Bacteria 806
411 Ga0163162_10074982 3300013306 Bacteria 3443
412 Ga0163162_10174935 3300013306 Bacteria 2272
413 Ga0163162_10422012 3300013306 Bacteria 1466
414 Ga0163162_10528100 3300013306 Bacteria 1309
415 Ga0163162_10707313 3300013306 Bacteria 1129
416 Ga0163162_10880805 3300013306 Bacteria 1009
417 Ga0163162_11036780 3300013306 Bacteria 928
418 Ga0163162_11105428 3300013306 Bacteria 898
419 Ga0163162_11248765 3300013306 Bacteria 844
420 Ga0163162_11465456 3300013306 Bacteria 777
421 Ga0157372_10007431 3300013307 Bacteria 11654
422 Ga0157372_10674551 3300013307 Bacteria 1203
423 Ga0157372_10708110 3300013307 Bacteria 1172
424 Ga0157372_10735542 3300013307 Bacteria 1147
425 Ga0157372_10795537 3300013307 Bacteria 1099
426 Ga0157372_11104390 3300013307 Bacteria 917
427 Ga0157375_10023903 3300013308 Bacteria 5645
428 Ga0157375_10070571 3300013308 Bacteria 3504
429 Ga0157375_10141322 3300013308 Bacteria 2535
430 Ga0157375_10143340 3300013308 Bacteria 2518
431 Ga0157375_10177777 3300013308 Bacteria 2279
432 Ga0157375_10774101 3300013308 Bacteria 1110
433 Ga0157375_11189236 3300013308 Bacteria 894
434 Ga0163163_10001744 3300014325 Bacteria 18318
435 Ga0163163_10202231 3300014325 Bacteria 2035
436 Ga0163163_10324433 3300014325 Bacteria 1593
437 Ga0163163_10517480 3300014325 Bacteria 1255
438 Ga0163163_10748687 3300014325 Bacteria 1040
439 Ga0163163_12323148 3300014325 Bacteria 595
440 Ga0163163_12386739 3300014325 Bacteria 587
441 Ga0157380_10046543 3300014326 Bacteria 3408
442 Ga0157380_10130229 3300014326 Bacteria 2145
443 Ga0157380_10706118 3300014326 Bacteria 1014
444 Ga0182008_10010449 3300014497 Bacteria 4966
445 Ga0182008_10068144 3300014497 Bacteria 1751
446 Ga0182008_10120977 3300014497 Bacteria 1301
447 Ga0182008_10157872 3300014497 Bacteria 1140
448 Ga0182008_10513336 3300014497 Bacteria 661
449 Ga0157377_10153939 3300014745 Bacteria 1424
450 Ga0157377_10182311 3300014745 Bacteria 1321
451 Ga0157379_10000244 3300014968 Bacteria 42729
452 Ga0157379_10298909 3300014968 Bacteria 1467
453 Ga0157379_10339812 3300014968 Bacteria 1373
454 Ga0157379_11446460 3300014968 Bacteria 667
455 Ga0157376_10504131 3300014969 Bacteria 1190
456 Ga0157376_10635148 3300014969 Bacteria 1066
457 Ga0157376_10913189 3300014969 Bacteria 897
458 Ga0157376_11125065 3300014969 Bacteria 812
459 Ga0157376_11497346 3300014969 Bacteria 708
460 Ga0157376_12770240 3300014969 Bacteria 530
461 Ga0182006_1083626 3300015261 Bacteria 1160
462 Ga0182007_10001790 3300015262 Bacteria 11232
463 Ga0182005_1044350 3300015265 Bacteria 1209
464 Ga0182005_1146324 3300015265 Bacteria 685
465 Ga0183367_1015 3300015688 Bacteria 298435
466 Ga0163161_10201301 3300017792 Bacteria 1535
467 Ga0163161_10299895 3300017792 Bacteria 1265
468 Ga0163161_10414064 3300017792 Bacteria 1083
469 Ga0163161_10639507 3300017792 Bacteria 880
470 Ga0163161_12055477 3300017792 Bacteria 508
471 Ga0184602_108449 3300019161 Bacteria 544
472 Ga0184597_117329 3300019162 Bacteria 612
473 Ga0184592_115343 3300019177 Bacteria 599
474 Ga0184594_112558 3300019181 Bacteria 619
475 Ga0184598_143521 3300019182 Bacteria 539
476 Ga0184601_110102 3300019183 Bacteria 979
477 Ga0184601_113589 3300019183 Bacteria 649
478 Ga0184600_107951 3300019190 Bacteria 690
479 Ga0184603_137011 3300019192 Bacteria 638
480 Ga0184603_143072 3300019192 Bacteria 648
481 Ga0197907_10020944 3300020069 Bacteria 750
482 Ga0197907_10330890 3300020069 Bacteria 1099
483 Ga0197907_11191419 3300020069 Bacteria 878
484 Ga0206356_10190986 3300020070 Bacteria 1565
485 Ga0206356_10961423 3300020070 Bacteria 923
486 Ga0206356_10999422 3300020070 Bacteria 1266
487 Ga0206356_11074086 3300020070 Bacteria 850
488 Ga0206349_1348860 3300020075 Bacteria 500
489 Ga0206349_1883902 3300020075 Bacteria 1174
490 Ga0206355_1091284 3300020076 Bacteria 660
491 Ga0206351_10065153 3300020077 Bacteria 812
492 Ga0206351_10146335 3300020077 Bacteria 592
493 Ga0206352_10089945 3300020078 Bacteria 504
494 Ga0206352_10201730 3300020078 Bacteria 1153
495 Ga0206352_10411800 3300020078 Bacteria 691
496 Ga0206352_10622047 3300020078 Bacteria 1132
497 Ga0206350_10023960 3300020080 Bacteria 570
498 Ga0206350_10191192 3300020080 Bacteria 1155
499 Ga0206350_10683474 3300020080 Bacteria 841
500 Ga0206350_11029574 3300020080 Bacteria 520
501 Ga0206350_11489402 3300020080 Bacteria 724
502 Ga0206350_11630090 3300020080 Bacteria 628
503 Ga0206354_10543560 3300020081 Bacteria 855
504 Ga0206354_10709520 3300020081 Bacteria 595
505 Ga0206354_11311593 3300020081 Bacteria 1317
506 Ga0206353_10288552 3300020082 Bacteria 5098
507 Ga0206353_10468191 3300020082 Bacteria 811
508 Ga0206353_11120483 3300020082 Bacteria 768
509 Ga0206353_11270550 3300020082 Bacteria 682
510 Ga0206353_12052037 3300020082 Bacteria 502
511 Ga0213874_10388286 3300021377 Bacteria 541
512 Ga0213876_10446852 3300021384 Bacteria 688
513 Ga0213875_10010893 3300021388 Bacteria 4545
514 Ga0213875_10014384 3300021388 Bacteria 3861
515 Ga0213875_10021112 3300021388 Bacteria 3122
516 Ga0213875_10043268 3300021388 Bacteria 2115
517 Ga0213875_10091833 3300021388 Bacteria 1416
518 Ga0256744_107144 3300023309 Bacteria 801
519 Ga0256720_106636 3300023438 Bacteria 712
520 Ga0247551_104190 3300023552 Bacteria 572
521 Ga0247550_104409 3300023660 Bacteria 535
522 Ga0224572_1023820 3300024225 Bacteria 1176
523 Ga0228598_1052773 3300024227 Bacteria 807
524 Ga0209758_1007513 3300025297 Bacteria 7389
525 Ga0207426_1002952 3300025302 Bacteria 9979
526 Ga0207426_1023641 3300025302 Bacteria 2095
527 Ga0207697_10179633 3300025315 Bacteria 927
528 Ga0207656_10166207 3300025321 Bacteria 1052
529 Ga0207696_1079044 3300025711 Bacteria 909
530 Ga0207655_1112249 3300025728 Bacteria 918
531 Ga0207713_1122796 3300025735 Bacteria 869
532 Ga0207713_1143564 3300025735 Bacteria 777
533 Ga0207653_10012809 3300025885 Bacteria 2622
534 Ga0207692_10022809 3300025898 Bacteria 2886
535 Ga0207642_10018159 3300025899 Bacteria 2693
536 Ga0207642_10588149 3300025899 Bacteria 691
537 Ga0207710_10000063 3300025900 Bacteria 163065
538 Ga0207710_10053403 3300025900 Bacteria 1818
539 Ga0207710_10314609 3300025900 Bacteria 793
540 Ga0207688_10009737 3300025901 Bacteria 5230
541 Ga0207688_10123060 3300025901 Bacteria 1515
542 Ga0207680_10607719 3300025903 Bacteria 782
543 Ga0207647_10014108 3300025904 Bacteria 5519
544 Ga0207647_10037539 3300025904 Bacteria 3071
545 Ga0207647_10041665 3300025904 Bacteria 2885
546 Ga0207647_10223703 3300025904 Bacteria 1084
547 Ga0207647_10225604 3300025904 Bacteria 1079
548 Ga0207685_10359099 3300025905 Bacteria 737
549 Ga0207699_10085697 3300025906 Bacteria 1965
550 Ga0207699_10144157 3300025906 Bacteria 1568
551 Ga0207699_10145888 3300025906 Bacteria 1560
552 Ga0207699_10199061 3300025906 Bacteria 1356
553 Ga0207645_10210798 3300025907 Bacteria 1280
554 Ga0207645_10806729 3300025907 Bacteria 638
555 Ga0207643_10012094 3300025908 Bacteria 4663
556 Ga0207643_10360401 3300025908 Bacteria 914
557 Ga0207705_10044132 3300025909 Bacteria 3204
558 Ga0207705_10068197 3300025909 Bacteria 2575
559 Ga0207684_10000323 3300025910 Bacteria 67693
560 Ga0207684_10003999 3300025910 Bacteria 14104
561 Ga0207684_10025297 3300025910 Bacteria 5058
562 Ga0207684_10026466 3300025910 Bacteria 4945
563 Ga0207684_10290158 3300025910 Bacteria 1411
564 Ga0207654_10140334 3300025911 Bacteria 1540
565 Ga0207654_10996818 3300025911 Bacteria 609
566 Ga0207654_11169214 3300025911 Bacteria 561
567 Ga0207707_10129156 3300025912 Bacteria 2210
568 Ga0207707_10255224 3300025912 Bacteria 1522
569 Ga0207671_10092256 3300025914 Bacteria 2283
570 Ga0207671_10527437 3300025914 Bacteria 942
571 Ga0207693_10136892 3300025915 Bacteria 1926
572 Ga0207663_10037969 3300025916 Bacteria 2907
573 Ga0207663_10196750 3300025916 Bacteria 1451
574 Ga0207663_10271298 3300025916 Bacteria 1257
575 Ga0207660_10166316 3300025917 Bacteria 1705
576 Ga0207660_10498001 3300025917 Bacteria 988
577 Ga0207662_10010759 3300025918 Bacteria 5058
578 Ga0207662_10021726 3300025918 Bacteria 3671
579 Ga0207662_10406991 3300025918 Bacteria 924
580 Ga0207657_10359817 3300025919 Bacteria 1147
581 Ga0207649_10315744 3300025920 Bacteria 1146
582 Ga0207652_10048985 3300025921 Bacteria 3614
583 Ga0207652_10245227 3300025921 Bacteria 1615
584 Ga0207652_10468835 3300025921 Bacteria 1134
585 Ga0207652_10569951 3300025921 Bacteria 1017
586 Ga0207646_10000050 3300025922 Bacteria 171554
587 Ga0207646_10010964 3300025922 Bacteria 8799
588 Ga0207646_10049754 3300025922 Bacteria 3753
589 Ga0207646_10080435 3300025922 Bacteria 2913
590 Ga0207681_10486294 3300025923 Bacteria 1009
591 Ga0207694_10377850 3300025924 Bacteria 1176
592 Ga0207694_10522052 3300025924 Bacteria 995
593 Ga0207694_10624516 3300025924 Bacteria 907
594 Ga0207694_10870613 3300025924 Bacteria 761
595 Ga0207694_11852782 3300025924 Bacteria 506
596 Ga0207659_10060860 3300025926 Bacteria 2719
597 Ga0207659_11507007 3300025926 Bacteria 575
598 Ga0207687_10028232 3300025927 Bacteria 3770
599 Ga0207687_10402100 3300025927 Bacteria 1127
600 Ga0207687_10456677 3300025927 Bacteria 1060
601 Ga0207687_10701281 3300025927 Bacteria 859
602 Ga0207687_11623537 3300025927 Bacteria 555
603 Ga0207687_11873861 3300025927 Bacteria 513
604 Ga0207700_10009909 3300025928 Bacteria 5980
605 Ga0207700_10049581 3300025928 Bacteria 3124
606 Ga0207700_10059951 3300025928 Bacteria 2880
607 Ga0207700_10282417 3300025928 Bacteria 1428
608 Ga0207664_10019743 3300025929 Bacteria 4988
609 Ga0207664_10054930 3300025929 Bacteria 3158
610 Ga0207664_10111576 3300025929 Bacteria 2275
611 Ga0207664_10209663 3300025929 Bacteria 1685
612 Ga0207664_10866446 3300025929 Bacteria 812
613 Ga0207644_10879720 3300025931 Bacteria 750
614 Ga0207690_10104502 3300025932 Bacteria 2029
615 Ga0207706_10007021 3300025933 Bacteria 10410
616 Ga0207706_10030756 3300025933 Bacteria 4788
617 Ga0207706_10361206 3300025933 Bacteria 1262
618 Ga0207706_11058925 3300025933 Bacteria 679
619 Ga0207686_10700334 3300025934 Bacteria 805
620 Ga0207709_10376918 3300025935 Bacteria 1079
621 Ga0207709_10489606 3300025935 Bacteria 958
622 Ga0207670_10563490 3300025936 Bacteria 932
623 Ga0207670_11814002 3300025936 Bacteria 519
624 Ga0207669_10094765 3300025937 Bacteria 1955
625 Ga0207669_10280657 3300025937 Bacteria 1256
626 Ga0207669_10500645 3300025937 Bacteria 972
627 Ga0207669_10764015 3300025937 Bacteria 799
628 Ga0207704_10017490 3300025938 Bacteria 3719
629 Ga0207704_10285045 3300025938 Bacteria 1257
630 Ga0207704_10495950 3300025938 Bacteria 983
631 Ga0207704_11124433 3300025938 Bacteria 668
632 Ga0207691_10049713 3300025940 Bacteria 3842
633 Ga0207691_10064364 3300025940 Bacteria 3322
634 Ga0207691_10093203 3300025940 Bacteria 2697
635 Ga0207711_10000262 3300025941 Bacteria 57199
636 Ga0207711_10172030 3300025941 Bacteria 1966
637 Ga0207711_10218658 3300025941 Bacteria 1742
638 Ga0207711_10220819 3300025941 Bacteria 1733
639 Ga0207711_10579701 3300025941 Bacteria 1046
640 Ga0207711_11430804 3300025941 Bacteria 634
641 Ga0207689_10086579 3300025942 Bacteria 2575
642 Ga0207689_10389027 3300025942 Bacteria 1162
643 Ga0207661_10006353 3300025944 Bacteria 8360
644 Ga0207661_10037782 3300025944 Bacteria 3779
645 Ga0207661_10075721 3300025944 Bacteria 2762
646 Ga0207661_10161016 3300025944 Bacteria 1947
647 Ga0207661_10220843 3300025944 Bacteria 1675
648 Ga0207661_10273270 3300025944 Bacteria 1508
649 Ga0207661_10793411 3300025944 Bacteria 872
650 Ga0207661_11252526 3300025944 Bacteria 682
651 Ga0207661_11779833 3300025944 Bacteria 562
652 Ga0207679_10028246 3300025945 Bacteria 3890
653 Ga0207679_10117036 3300025945 Bacteria 2114
654 Ga0207679_10405464 3300025945 Bacteria 1200
655 Ga0207679_10631475 3300025945 Bacteria 967
656 Ga0207667_10136334 3300025949 Bacteria 2527
657 Ga0207667_10547594 3300025949 Bacteria 1170
658 Ga0207651_10465055 3300025960 Bacteria 1087
659 Ga0207651_11157811 3300025960 Bacteria 694
660 Ga0207651_11219586 3300025960 Bacteria 676
661 Ga0207712_10003504 3300025961 Bacteria 9902
662 Ga0207712_10070104 3300025961 Bacteria 2517
663 Ga0207712_10084335 3300025961 Bacteria 2321
664 Ga0207712_10339816 3300025961 Bacteria 1245
665 Ga0207712_10377343 3300025961 Bacteria 1186
666 Ga0207712_10516901 3300025961 Bacteria 1023
667 Ga0207668_10241812 3300025972 Bacteria 1461
668 Ga0207668_10385891 3300025972 Bacteria 1180
669 Ga0207668_10550797 3300025972 Bacteria 999
670 Ga0207668_11055284 3300025972 Bacteria 727
671 Ga0207668_11366594 3300025972 Bacteria 638
672 Ga0207640_10119910 3300025981 Bacteria 1882
673 Ga0207640_10597600 3300025981 Bacteria 934
674 Ga0207658_10100738 3300025986 Bacteria 2262
675 Ga0207658_10146621 3300025986 Bacteria 1918
676 Ga0207677_10534649 3300026023 Bacteria 1019
677 Ga0207677_10859690 3300026023 Bacteria 815
678 Ga0207677_12110009 3300026023 Bacteria 524
679 Ga0207703_10000177 3300026035 Bacteria 74044
680 Ga0207703_10060180 3300026035 Bacteria 3105
681 Ga0207703_10291059 3300026035 Bacteria 1486
682 Ga0207703_10435284 3300026035 Bacteria 1223
683 Ga0207639_10194589 3300026041 Bacteria 1734
684 Ga0207639_10307058 3300026041 Bacteria 1404
685 Ga0207639_10526472 3300026041 Bacteria 1083
686 Ga0207639_10533025 3300026041 Bacteria 1076
687 Ga0207639_10677230 3300026041 Bacteria 956
688 Ga0207639_10812575 3300026041 Bacteria 871
689 Ga0207678_10176582 3300026067 Bacteria 1824
690 Ga0207678_10703577 3300026067 Bacteria 889
691 Ga0207708_10394412 3300026075 Bacteria 1143
692 Ga0207702_10055808 3300026078 Bacteria 3351
693 Ga0207702_10705408 3300026078 Bacteria 994
694 Ga0207702_10968486 3300026078 Bacteria 844
695 Ga0207641_10114337 3300026088 Bacteria 2398
696 Ga0207641_10164144 3300026088 Bacteria 2021
697 Ga0207648_10757287 3300026089 Bacteria 902
698 Ga0207648_10916306 3300026089 Bacteria 819
699 Ga0207676_10203983 3300026095 Bacteria 1749
700 Ga0207676_10875729 3300026095 Bacteria 879
701 Ga0207676_11596193 3300026095 Bacteria 650
702 Ga0207676_11690920 3300026095 Bacteria 631
703 Ga0207674_10007680 3300026116 Bacteria 12555
704 Ga0207674_10127860 3300026116 Bacteria 2505
705 Ga0207674_10271280 3300026116 Bacteria 1644
706 Ga0207674_10679861 3300026116 Bacteria 994
707 Ga0207675_100004621 3300026118 Bacteria 13272
708 Ga0207675_100341405 3300026118 Bacteria 1466
709 Ga0207683_10018022 3300026121 Bacteria 6021
710 Ga0207683_10047963 3300026121 Bacteria 3740
711 Ga0207683_10617663 3300026121 Bacteria 1004
712 Ga0207683_11168306 3300026121 Bacteria 713
713 Ga0207698_10164039 3300026142 Bacteria 1947
714 Ga0207698_10431400 3300026142 Bacteria 1267
715 Ga0207698_10595612 3300026142 Bacteria 1089
716 Ga0207698_11102703 3300026142 Bacteria 806
717 Ga0209371_1010646 3300027312 Bacteria 2806
718 Ga0209371_1048649 3300027312 Bacteria 823
719 Ga0209179_1046444 3300027512 Bacteria 923
720 Ga0209813_10006215 3300027866 Bacteria 2941
721 Ga0209813_10046968 3300027866 Bacteria 1336
722 Ga0207428_10000746 3300027907 Bacteria 37223
723 Ga0207428_11065745 3300027907 Bacteria 566
724 Ga0265358_103167 3300028010 Bacteria 586
725 Ga0268266_10006911 3300028379 Bacteria 10323
726 Ga0268266_10471278 3300028379 Bacteria 1196
727 Ga0268266_10656186 3300028379 Bacteria 1010
728 Ga0268266_10920754 3300028379 Bacteria 845
729 Ga0268266_11023416 3300028379 Bacteria 799
730 Ga0268266_11687320 3300028379 Bacteria 609
731 Ga0268265_10000157 3300028380 Bacteria 83507
732 Ga0268265_10705489 3300028380 Bacteria 975
733 Ga0268264_10199983 3300028381 Bacteria 1827
734 Ga0268264_10213603 3300028381 Bacteria 1772
735 Ga0307517_10005207 3300028786 Bacteria 19701
736 Ga0307517_10020973 3300028786 Bacteria 8287
737 Ga0307517_10640450 3300028786 Bacteria 518
738 Ga0307515_10002733 3300028794 Bacteria 37739
739 Ga0307515_10180880 3300028794 Bacteria 2059
740 Ga0307515_10198377 3300028794 Bacteria 1891
741 Ga0311004_111916 3300029276 Bacteria 649
742 Ga0311011_118056 3300029280 Bacteria 518
743 Ga0311003_171176 3300029282 Bacteria 736
744 Ga0310981_1001123 3300029285 Bacteria 699
745 Ga0268256_1027239 3300030500 Bacteria 1425
746 Ga0268256_1045482 3300030500 Bacteria 956
747 Ga0307511_10009089 3300030521 Bacteria 9910
748 Ga0307511_10056074 3300030521 Bacteria 3086
749 Ga0307511_10064446 3300030521 Bacteria 2755
750 Ga0307512_10000978 3300030522 Bacteria 42035
751 Ga0307512_10106890 3300030522 Bacteria 1864
752 Ga0307512_10116842 3300030522 Bacteria 1731
753 Ga0316176_1020167 3300030732 Bacteria 659
754 Ga0314311_1121511 3300030733 Bacteria 503
755 Ga0316181_1125764 3300030744 Bacteria 698
756 Ga0265762_1031578 3300030760 Bacteria 1008
757 Ga0265767_113326 3300030836 Bacteria 576
758 Ga0265766_1025010 3300030863 Bacteria 510
759 Ga0265777_120614 3300030877 Bacteria 543
760 Ga0265769_103274 3300030888 Bacteria 895
761 Ga0265769_111646 3300030888 Bacteria 614
762 Ga0247549_101801 3300030942 Bacteria 733
763 Ga0265773_1013629 3300031018 Bacteria 728
764 Ga0265760_10260592 3300031090 Bacteria 603
765 Ga0265760_10384268 3300031090 Bacteria 505
766 Ga0307513_10004736 3300031456 Bacteria 18076
767 Ga0307513_10113346 3300031456 Bacteria 2699
768 Ga0307509_10152597 3300031507 Bacteria 2222
769 Ga0307509_10358154 3300031507 Bacteria 1179
770 Ga0307408_100098861 3300031548 Bacteria 2219
771 Ga0307408_100369173 3300031548 Bacteria 1223
772 Ga0307408_101808301 3300031548 Bacteria 584
773 Ga0310117_130551 3300031592 Bacteria 522
774 Ga0307508_10003041 3300031616 Bacteria 17266
775 Ga0307508_10006924 3300031616 Bacteria 10590
776 Ga0307508_10021357 3300031616 Bacteria 5885
777 Ga0307508_10031756 3300031616 Bacteria 4772
778 Ga0307508_10032362 3300031616 Bacteria 4724
779 Ga0307514_10004614 3300031649 Bacteria 12633
780 Ga0307514_10065598 3300031649 Bacteria 2749
781 Ga0307514_10079606 3300031649 Bacteria 2428
782 Ga0307514_10150704 3300031649 Bacteria 1561
783 Ga0307514_10193945 3300031649 Bacteria 1288
784 Ga0307514_10470290 3300031649 Bacteria 610
785 Ga0316579_10000328 3300031691 Bacteria 14833
786 Ga0307516_10006026 3300031730 Bacteria 14331
787 Ga0307516_10042521 3300031730 Bacteria 4507
788 Ga0307516_10045929 3300031730 Bacteria 4311
789 Ga0307516_10174417 3300031730 Bacteria 1888
790 Ga0307516_10270151 3300031730 Bacteria 1387
791 Ga0307405_10070066 3300031731 Bacteria 2250
792 Ga0307405_10130872 3300031731 Bacteria 1733
793 Ga0307405_10238915 3300031731 Bacteria 1344
794 Ga0307405_10353959 3300031731 Bacteria 1134
795 Ga0307405_11153043 3300031731 Bacteria 668
796 Ga0247548_109156 3300031814 Bacteria 507
797 Ga0307413_10208780 3300031824 Bacteria 1416
798 Ga0307413_10318519 3300031824 Bacteria 1187
799 Ga0307413_10959959 3300031824 Bacteria 730
800 Ga0307413_11079886 3300031824 Bacteria 692
801 Ga0307413_11144871 3300031824 Bacteria 674
802 Ga0307413_12099579 3300031824 Bacteria 511
803 Ga0307518_10271667 3300031838 Bacteria 1057
804 Ga0307518_10496883 3300031838 Bacteria 630
805 Ga0307410_10307516 3300031852 Bacteria 1253
806 Ga0307410_10313855 3300031852 Bacteria 1241
807 Ga0307410_10349428 3300031852 Bacteria 1181
808 Ga0307410_10741692 3300031852 Bacteria 831
809 Ga0307410_10746639 3300031852 Bacteria 828
810 Ga0307410_10948187 3300031852 Bacteria 739
811 Ga0307406_10002457 3300031901 Bacteria 10095
812 Ga0307406_10236338 3300031901 Bacteria 1368
813 Ga0307406_10344747 3300031901 Bacteria 1162
814 Ga0307406_10366146 3300031901 Bacteria 1132
815 Ga0307406_10931124 3300031901 Bacteria 741
816 Ga0307407_10004890 3300031903 Bacteria 5749
817 Ga0307407_10118915 3300031903 Bacteria 1671
818 Ga0307407_10186109 3300031903 Bacteria 1380
819 Ga0307407_10188999 3300031903 Bacteria 1371
820 Ga0307407_10264749 3300031903 Bacteria 1184
821 Ga0307407_11673987 3300031903 Bacteria 506
822 Ga0307412_12164622 3300031911 Bacteria 517
823 Ga0307412_12179546 3300031911 Bacteria 515
824 Ga0307409_100086978 3300031995 Bacteria 2545
825 Ga0307409_100117795 3300031995 Bacteria 2242
826 Ga0307409_100125730 3300031995 Bacteria 2180
827 Ga0307409_100175929 3300031995 Bacteria 1889
828 Ga0307409_100185185 3300031995 Bacteria 1847
829 Ga0307409_100219696 3300031995 Bacteria 1715
830 Ga0307409_100250976 3300031995 Bacteria 1617
831 Ga0307409_100536155 3300031995 Bacteria 1146
832 Ga0307409_101069328 3300031995 Bacteria 827
833 Ga0307409_101496822 3300031995 Bacteria 702
834 Ga0307409_101504080 3300031995 Bacteria 701
835 Ga0307416_100013543 3300032002 Bacteria 5549
836 Ga0307416_100084802 3300032002 Bacteria 2693
837 Ga0307416_100132425 3300032002 Bacteria 2247
838 Ga0307416_100172457 3300032002 Bacteria 2016
839 Ga0307416_100185041 3300032002 Bacteria 1957
840 Ga0307416_100268549 3300032002 Bacteria 1673
841 Ga0307416_100513117 3300032002 Bacteria 1265
842 Ga0307416_100739515 3300032002 Bacteria 1075
843 Ga0307416_103849482 3300032002 Bacteria 502
844 Ga0307414_10053800 3300032004 Bacteria 2810
845 Ga0307414_10518567 3300032004 Bacteria 1057
846 Ga0307414_10614309 3300032004 Bacteria 976
847 Ga0307414_10622902 3300032004 Bacteria 970
848 Ga0307414_10784003 3300032004 Bacteria 868
849 Ga0307411_10399432 3300032005 Bacteria 1136
850 Ga0316053_110460 3300032120 Bacteria 646
851 Ga0316053_116349 3300032120 Bacteria 558
852 Ga0307415_100205662 3300032126 Bacteria 1566
853 Ga0307415_100300998 3300032126 Bacteria 1328
854 Ga0307415_100341059 3300032126 Bacteria 1257
855 Ga0307415_100438127 3300032126 Bacteria 1126
856 Ga0307415_102440217 3300032126 Bacteria 514
857 Ga0307507_10202106 3300033179 Bacteria 1372
858 Ga0307510_10076999 3300033180 Bacteria 3275
859 Ga0307510_10168105 3300033180 Bacteria 1777
860 Ga0307510_10209614 3300033180 Bacteria 1472
861 Ga0373930_0015524 3300034816 Bacteria 1430
862 Ga0373948_0001671 3300034817 Bacteria 3135
863 Ga0373958_0009242 3300034819 Bacteria 1618
864 Ga0373958_0132026 3300034819 Bacteria 612
865 Ga0373926_0004416 3300035083 Bacteria 4612
866 Ga0373926_0010520 3300035083 Bacteria 3102
867 Ga0373926_0241544 3300035083 Bacteria 699
868 Ga0373929_0021923 3300035085 Bacteria 1300
869 Ga0373934_0004079 3300035086 Bacteria 5383
870 Ga0373934_0004937 3300035086 Bacteria 4939
871 Ga0373934_0016920 3300035086 Bacteria 2776
872 Ga0373940_0069054 3300035088 Bacteria 1025
873 Ga0373944_0012091 3300035089 Bacteria 2374
874 Ga0373944_0016653 3300035089 Bacteria 2076
875 Ga0373949_0021772 3300035090 Bacteria 1474
876 Ga0373951_0084344 3300035091 Bacteria 826
877 Ga0373952_0043549 3300035092 Bacteria 1046
878 Ga0373923_0000472 3300035111 Bacteria 9588
879 Ga0373932_0013806 3300035112 Bacteria 2018
880 Ga0373936_0001921 3300035113 Bacteria 7677
881 Ga0373936_0001930 3300035113 Bacteria 7666
882 Ga0373936_0006056 3300035113 Bacteria 4558
883 Ga0373936_0101916 3300035113 Bacteria 1212
884 Ga0373939_0219320 3300035114 Bacteria 727
885 Ga0373945_0000693 3300035116 Bacteria 9746
886 Ga0373945_0003551 3300035116 Bacteria 4909
887 Ga0373953_0009915 3300035117 Bacteria 3299
888 Ga0373953_0033274 3300035117 Bacteria 2015
889 Ga0373953_0124333 3300035117 Bacteria 1097
890 Ga0373954_0011407 3300035118 Bacteria 3938
891 Ga0373954_0036506 3300035118 Bacteria 2281
892 Ga0373956_0199385 3300035119 Bacteria 948
893 Ga0373956_0385432 3300035119 Bacteria 668
894 Ga0373957_0003369 3300035120 Bacteria 4713
895 Ga0373957_0005890 3300035120 Bacteria 3829
896 Ga0373957_0036898 3300035120 Bacteria 1823
897 Ga0373957_0160119 3300035120 Bacteria 927
898 Ga0373960_0025527 3300035121 Bacteria 1607
899 Ga0373943_0000869 3300035170 Bacteria 13282
900 Ga0373943_0222164 3300035170 Bacteria 1052
901 Ga0373946_0002754 3300035171 Bacteria 6216
902 Ga0373946_0005561 3300035171 Bacteria 4547
903 Ga0373946_0067320 3300035171 Bacteria 1538
904 Ga0373946_0223373 3300035171 Bacteria 910
905 Ga0373955_0013636 3300035172 Bacteria 3936
906 Ga0373955_0025416 3300035172 Bacteria 3040
907 Ga0373955_0032656 3300035172 Bacteria 2734
908 Ga0373955_0047998 3300035172 Bacteria 2313
909 Ga0373961_0145265 3300035241 Bacteria 804
910 Ga0373962_0041763 3300035242 Bacteria 1294
911 Ga0373924_0015260 3300035410 Bacteria 2918
912 Ga0373924_0036299 3300035410 Bacteria 2002
913 Ga0373924_0216213 3300035410 Bacteria 846
914 Ga0373931_0912112 3300035691 Bacteria 591
915 Ga0373935_0002772 3300035692 Bacteria 10079
916 Ga0373935_0019853 3300035692 Bacteria 4101
917 Ga0373935_0246278 3300035692 Bacteria 1249
918 Ga0373927_0005785 3300035695 Bacteria 8484
919 Ga0373927_0011649 3300035695 Bacteria 5852
920 Ga0373927_0182495 3300035695 Bacteria 1376
921 Ga0373933_0069093 3300035724 Bacteria 2146
922 Ga0373933_0160858 3300035724 Bacteria 1425
923 Ga0373933_0200322 3300035724 Bacteria 1277
924 Ga0373947_0002525 3300035725 Bacteria 10999
925 Ga0373947_0068140 3300035725 Bacteria 2175
926 Ga0373937_0035993 3300036401 Bacteria 4509
927 Ga0373937_0044269 3300036401 Bacteria 4064
928 Ga0373937_0065143 3300036401 Bacteria 3353
929 Ga0265778_025943 3300036457 Bacteria 742
930 Ga0373925_0005148 3300037068 Bacteria 9798
931 Ga0373925_0100426 3300037068 Bacteria 2223
932 Ga0395899_0101344 3300037312 Bacteria 2078
933 Ga0395899_0195572 3300037312 Bacteria 1413
934 Ga0395899_0481338 3300037312 Bacteria 808
935 Ga0395900_0486195 3300037418 Bacteria 1186
936 Ga0395900_0556238 3300037418 Bacteria 1091
937 Ga0395898_0003814 3300037466 Bacteria 16692
938 Ga0395898_0004885 3300037466 Bacteria 14555
939 Ga0395898_0232005 3300037466 Bacteria 1760
940 Ga0395898_0280786 3300037466 Bacteria 1589
941 Ga0395898_0316753 3300037466 Bacteria 1488
942 Ga0395898_0386549 3300037466 Bacteria 1334
943 Ga0395898_0576635 3300037466 Bacteria 1067
944 Ga0395905_0138778 3300037471 Bacteria 2287
945 Ga0395905_0508205 3300037471 Bacteria 1105
946 Ga0395905_1108171 3300037471 Bacteria 695
947 Ga0395905_1151314 3300037471 Bacteria 679
948 Ga0436364_0009738 3300037853 Bacteria 8295
949 Ga0436364_0136351 3300037853 Bacteria 1650
950 Ga0436364_0304869 3300037853 Bacteria 3449
951 Ga0436364_1303572 3300037853 Bacteria 3726
952 Ga0436364_1308949 3300037853 Bacteria 8327
953 Ga0436364_1353616 3300037853 Bacteria 20505
954 Ga0395901_0014451 3300038443 Bacteria 8034
955 Ga0395901_0044449 3300038443 Bacteria 4607
956 Ga0395901_0221123 3300038443 Bacteria 1979
957 Ga0395901_0299275 3300038443 Bacteria 1668
958 Ga0395901_1162619 3300038443 Bacteria 739
959 Ga0242420_076493 3300038996 Bacteria 687
960 Ga0436365_0611199 3300039437 Bacteria 688
961 Ga0436365_1289663 3300039437 Bacteria 2568
962 Ga0436365_1705129 3300039437 Bacteria 735
963 Ga0436360_0110487 3300039438 Bacteria 646
964 Ga0436361_0211931 3300039447 Bacteria 830
965 Ga0436361_0675330 3300039447 Bacteria 844
966 Ga0436361_0858626 3300039447 Bacteria 652
967 Ga0436363_0086959 3300039450 Bacteria 1461
968 Ga0436363_0244953 3300039450 Bacteria 794
969 Ga0436363_0313187 3300039450 Bacteria 1432
970 Ga0436363_0879846 3300039450 Bacteria 685
971 Ga0436363_0992871 3300039450 Bacteria 614
972 Ga0436362_0069517 3300039453 Bacteria 1041
973 Ga0436362_0387930 3300039453 Bacteria 959
974 Ga0436362_0934528 3300039453 Bacteria 843
975 Ga0436362_1211610 3300039453 Bacteria 858
976 Ga0439436_0000928 3300041404 Bacteria 8054
977 Ga0439436_0018153 3300041404 Bacteria 2103
978 Ga0439439_0002357 3300041406 Bacteria 3998
979 Ga0439439_0002711 3300041406 Bacteria 3805
980 Ga0439465_0122188 3300041413 Bacteria 914
981 Ga0451788_01963 3300041442 Bacteria 513
982 Ga0451789_1198906 3300041443 Bacteria 1431
983 Ga0451789_1288683 3300041443 Bacteria 869
984 Ga0451794_30334 3300041446 Bacteria 544
985 Ga0451791_0817771 3300041451 Bacteria 1670
986 Ga0451791_0998527 3300041451 Bacteria 1238
987 Ga0451791_1596303 3300041451 Bacteria 573
988 Ga0451793_0272600 3300041452 Bacteria 831
989 Ga0451797_0242638 3300041453 Bacteria 1560
990 Ga0451797_0372023 3300041453 Bacteria 1101
991 Ga0451802_0005448 3300041460 Bacteria 753
992 Ga0451802_1713972 3300041460 Bacteria 1205
993 Ga0451805_034483 3300041461 Bacteria 650
994 Ga0451807_1271743 3300041486 Bacteria 597
995 Ga0451807_1844026 3300041486 Bacteria 743
996 Ga0451837_0720473 3300041494 Bacteria 1187
997 Ga0451839_0156761 3300041496 Bacteria 575
998 Ga0451839_0530653 3300041496 Bacteria 712
999 Ga0451841_0024364 3300041498 Bacteria 891
1000 Ga0451841_0930514 3300041498 Bacteria 654
1001 Ga0451845_0978105 3300041501 Bacteria 1276
1002 Ga0451846_26990 3300041502 Bacteria 610
1003 Ga0451849_0428000 3300041505 Bacteria 701
1004 Ga0451849_0889599 3300041505 Bacteria 617
1005 Ga0451851_1130574 3300041507 Bacteria 501
1006 Ga0451851_1369277 3300041507 Bacteria 1127
1007 Ga0451843_1183826 3300041509 Bacteria 1052
1008 Ga0451853_2683550 3300041512 Bacteria 3842
1009 Ga0451853_3445873 3300041512 Bacteria 1447
1010 Ga0451853_3531906 3300041512 Bacteria 1203
1011 Ga0452271_73204 3300041916 Bacteria 651
1012 Ga0439431_0160109 3300041997 Bacteria 643
1013 Ga0439433_0003361 3300041999 Bacteria 3430
1014 Ga0439433_0021509 3300041999 Bacteria 1444
1015 Ga0439433_0118153 3300041999 Bacteria 667
1016 Ga0439442_009151 3300042002 Bacteria 2002
1017 Ga0439445_0277711 3300042004 Bacteria 503
1018 Ga0439448_0001957 3300042005 Bacteria 5501
1019 Ga0439448_0008132 3300042005 Bacteria 3063
1020 Ga0439448_0063851 3300042005 Bacteria 1220
1021 Ga0439448_0222206 3300042005 Bacteria 664
1022 Ga0439432_026577 3300042006 Bacteria 1894
1023 Ga0439449_0001280 3300042007 Bacteria 9838
1024 Ga0439449_0018673 3300042007 Bacteria 2601
1025 Ga0439449_0024590 3300042007 Bacteria 2251
1026 Ga0439449_0086552 3300042007 Bacteria 1156
1027 Ga0439450_017797 3300042008 Bacteria 1486
1028 Ga0439454_000513 3300042011 Bacteria 3155
1029 Ga0439454_037620 3300042011 Bacteria 782
1030 Ga0439454_096559 3300042011 Bacteria 551
1031 Ga0439455_0001760 3300042012 Bacteria 3758
1032 Ga0439455_0049166 3300042012 Bacteria 1098
1033 Ga0439457_001493 3300042014 Bacteria 7013
1034 Ga0439457_001678 3300042014 Bacteria 6565
1035 Ga0439463_034875 3300042016 Bacteria 1273
1036 Ga0439463_109687 3300042016 Bacteria 712
1037 Ga0439463_121685 3300042016 Bacteria 674
1038 Ga0439463_174448 3300042016 Bacteria 558
1039 Ga0450920_022188 3300042122 Bacteria 1229
1040 Ga0450920_132262 3300042122 Bacteria 526
1041 Ga0450888_011212 3300042126 Bacteria 1048
1042 Ga0450897_034417 3300042128 Bacteria 582
1043 Ga0450894_000082 3300042131 Bacteria 15452
1044 Ga0450895_002600 3300042132 Bacteria 1352
1045 Ga0450898_001847 3300042134 Bacteria 2864
1046 Ga0450899_001163 3300042135 Bacteria 2986
1047 Ga0450900_002001 3300042136 Bacteria 2096
1048 Ga0450900_085106 3300042136 Bacteria 510
1049 Ga0450903_000408 3300042138 Bacteria 9222
1050 Ga0450903_025346 3300042138 Bacteria 907
1051 Ga0450904_023073 3300042139 Bacteria 636
1052 Ga0450905_001111 3300042142 Bacteria 3389
1053 Ga0450905_067121 3300042142 Bacteria 607
1054 Ga0450889_049024 3300042144 Bacteria 518
1055 Ga0450906_005337 3300042145 Bacteria 2647
1056 Ga0450906_041222 3300042145 Bacteria 815
1057 Ga0450907_014293 3300042146 Bacteria 1325
1058 Ga0450910_023603 3300042147 Bacteria 940
1059 Ga0450910_040113 3300042147 Bacteria 755
1060 Ga0439458_0000894 3300042157 Bacteria 7699
1061 Ga0439458_0135142 3300042157 Bacteria 655
1062 Ga0450908_000754 3300042184 Bacteria 6192
1063 Ga0450909_078172 3300042185 Bacteria 534
1064 Ga0439435_0010445 3300042436 Bacteria 2205
1065 Ga0439444_0041891 3300042437 Bacteria 902
1066 Ga0439459_0059541 3300042438 Bacteria 859
1067 Ga0439459_0172004 3300042438 Bacteria 578
1068 Ga0439464_0318780 3300042439 Bacteria 510
1069 Ga0439460_0116379 3300042461 Bacteria 871
1070 Ga0450916_023589 3300042530 Bacteria 859
1071 Ga0450893_0128390 3300042532 Bacteria 534
1072 Ga0439440_0008474 3300042993 Bacteria 2111
1073 Ga0466969_0002289 3300044656 Bacteria 10225
1074 Ga0466969_0018579 3300044656 Bacteria 3620
1075 Ga0466969_0029433 3300044656 Bacteria 2804
1076 Ga0466969_0041253 3300044656 Bacteria 2310
1077 Ga0466972_0079512 3300044658 Bacteria 1561
1078 Ga0466965_0007538 3300044683 Bacteria 5003
1079 Ga0466965_0014029 3300044683 Bacteria 3789
1080 Ga0466965_0038532 3300044683 Bacteria 2348
1081 Ga0466965_0247725 3300044683 Bacteria 955
1082 Ga0466965_0416359 3300044683 Bacteria 744
1083 Ga0466966_0026669 3300044684 Bacteria 3771
1084 Ga0466966_0032011 3300044684 Bacteria 3410
1085 Ga0466966_0082062 3300044684 Bacteria 2006
1086 Ga0466966_0151591 3300044684 Bacteria 1414
1087 Ga0466966_0497092 3300044684 Bacteria 733
1088 Ga0466961_0004342 3300044693 Bacteria 8882
1089 Ga0466961_0010303 3300044693 Bacteria 5958
1090 Ga0466961_0029559 3300044693 Bacteria 3521
1091 Ga0466961_0046293 3300044693 Bacteria 2783
1092 Ga0466961_0076857 3300044693 Bacteria 2115
1093 Ga0466961_0130585 3300044693 Bacteria 1574
1094 Ga0466961_0229629 3300044693 Bacteria 1142
1095 Ga0466961_0278371 3300044693 Bacteria 1024
1096 Ga0466961_0355647 3300044693 Bacteria 891
1097 Ga0466961_0476154 3300044693 Bacteria 755
1098 Ga0466961_0527097 3300044693 Bacteria 712
1099 Ga0466963_0004564 3300044694 Bacteria 8064
1100 Ga0466963_0004744 3300044694 Bacteria 7934
1101 Ga0466963_0053926 3300044694 Bacteria 2671
1102 Ga0466963_0054762 3300044694 Bacteria 2652
1103 Ga0466963_0129790 3300044694 Bacteria 1740
1104 Ga0466963_0149257 3300044694 Bacteria 1623
1105 Ga0466963_0172532 3300044694 Bacteria 1508
1106 Ga0466963_0203279 3300044694 Bacteria 1386
1107 Ga0466963_0275343 3300044694 Bacteria 1182
1108 Ga0466963_0299986 3300044694 Bacteria 1130
1109 Ga0466963_0348773 3300044694 Bacteria 1042
1110 Ga0466963_1284936 3300044694 Bacteria 514
1111 Ga0466964_0006896 3300044706 Bacteria 4241
1112 Ga0466964_0007424 3300044706 Bacteria 4100
1113 Ga0466964_0314268 3300044706 Bacteria 794
1114 Ga0466964_0754552 3300044706 Bacteria 546
1115 Ga0466971_0002170 3300044719 Bacteria 8300
1116 Ga0466971_0070749 3300044719 Bacteria 1584
1117 Ga0466971_0115327 3300044719 Bacteria 1241
1118 Ga0466971_0178830 3300044719 Bacteria 997
1119 Ga0466971_0247718 3300044719 Bacteria 848
1120 Ga0466968_0049997 3300044735 Bacteria 1782
1121 Ga0466968_0130633 3300044735 Bacteria 1143
1122 Ga0466968_0166062 3300044735 Bacteria 1021
1123 Ga0466970_0003663 3300044765 Bacteria 7502
1124 Ga0466970_0005692 3300044765 Bacteria 6189
1125 Ga0466970_0020231 3300044765 Bacteria 3456
1126 Ga0466970_0099930 3300044765 Bacteria 1579
1127 Ga0466970_0104529 3300044765 Bacteria 1544
1128 Ga0466970_0195015 3300044765 Bacteria 1126
1129 Ga0466970_0249677 3300044765 Bacteria 994
1130 Ga0466970_0378347 3300044765 Bacteria 806
1131 Ga0466957_0000092 3300044842 Bacteria 36059
1132 Ga0466957_0010996 3300044842 Bacteria 5206
1133 Ga0466957_0019419 3300044842 Bacteria 3998
1134 Ga0466957_0245730 3300044842 Bacteria 1188
1135 Ga0466957_1365479 3300044842 Bacteria 515
1136 Ga0466960_0017520 3300044901 Bacteria 3125
1137 Ga0466960_0033394 3300044901 Bacteria 2391
1138 Ga0466960_0087602 3300044901 Bacteria 1581
1139 Ga0466960_0104006 3300044901 Bacteria 1466
1140 Ga0466960_0422329 3300044901 Bacteria 771
1141 Ga0466960_0580970 3300044901 Bacteria 663
1142 Ga0466959_0023604 3300045049 Bacteria 4551
1143 Ga0466959_0040116 3300045049 Bacteria 3459
1144 Ga0466959_0071128 3300045049 Bacteria 2519
1145 Ga0466959_0071597 3300045049 Bacteria 2510
1146 Ga0466959_0165319 3300045049 Bacteria 1554
1147 Ga0466959_0190702 3300045049 Bacteria 1431
1148 Ga0466959_0821559 3300045049 Bacteria 621
1149 Ga0451576_0046672 3300045051 Bacteria 4561
1150 Ga0466958_0010114 3300045836 Bacteria 5274
1151 Ga0466958_0256331 3300045836 Bacteria 1119
1152 Ga0466958_0393430 3300045836 Bacteria 894
1153 Ga0466958_0860448 3300045836 Bacteria 591
1154 Ga0466967_0018221 3300045976 Bacteria 5603
1155 Ga0466967_0064396 3300045976 Bacteria 3260
1156 Ga0466967_0093693 3300045976 Bacteria 2733
1157 Ga0466967_0123331 3300045976 Bacteria 2397
1158 Ga0466967_0239113 3300045976 Bacteria 1732
1159 Ga0466967_0253272 3300045976 Bacteria 1682
1160 Ga0466967_0268287 3300045976 Bacteria 1635
1161 Ga0466967_0368551 3300045976 Bacteria 1393
1162 Ga0466967_0375305 3300045976 Bacteria 1380
1163 Ga0466967_0793549 3300045976 Bacteria 940
1164 Ga0466967_0866240 3300045976 Bacteria 898
1165 Ga0466967_0895234 3300045976 Bacteria 882
1166 Ga0466967_1031217 3300045976 Bacteria 819
1167 Ga0466967_1471241 3300045976 Bacteria 678
1168 Ga0466967_1493603 3300045976 Bacteria 673
1169 Ga0466967_1594002 3300045976 Bacteria 650
1170 Ga0466967_1800516 3300045976 Bacteria 609
1171 Ga0466967_2154901 3300045976 Bacteria 553
1172 Ga0466967_2284396 3300045976 Bacteria 536
1173 Ga0495617_014510 3300046452 Bacteria 2677
1174 Ga0495617_165754 3300046452 Bacteria 699
1175 Ga0495617_206518 3300046452 Bacteria 613
1176 Ga0495627_020039 3300046453 Bacteria 2234
1177 Ga0495627_146848 3300046453 Bacteria 659
1178 Ga0495592_0005557 3300046454 Bacteria 9323
1179 Ga0495592_0018798 3300046454 Bacteria 5262
1180 Ga0495592_0030916 3300046454 Bacteria 4050
1181 Ga0495592_0061761 3300046454 Bacteria 2753
1182 Ga0495592_0086491 3300046454 Bacteria 2257
1183 Ga0495592_0104331 3300046454 Bacteria 2015
1184 Ga0495603_0006510 3300046455 Bacteria 7001
1185 Ga0495603_0085584 3300046455 Bacteria 1845
1186 Ga0495603_0118056 3300046455 Bacteria 1546
1187 Ga0495603_0205771 3300046455 Bacteria 1137
1188 Ga0495603_0362164 3300046455 Bacteria 832
1189 Ga0495629_0001307 3300046459 Bacteria 19594
1190 Ga0495629_0007156 3300046459 Bacteria 8219
1191 Ga0495629_0007564 3300046459 Bacteria 8005
1192 Ga0495629_0026501 3300046459 Bacteria 4117
1193 Ga0495629_0048183 3300046459 Bacteria 2987
1194 Ga0495629_0093663 3300046459 Bacteria 2096
1195 Ga0495629_0111863 3300046459 Bacteria 1904
1196 Ga0495629_0254193 3300046459 Bacteria 1208
1197 Ga0495629_0749212 3300046459 Bacteria 646
1198 Ga0495638_0043781 3300046460 Bacteria 2822
1199 Ga0495638_0056602 3300046460 Bacteria 2433
1200 Ga0495638_0138403 3300046460 Bacteria 1423
1201 Ga0495638_0154209 3300046460 Bacteria 1330
1202 Ga0495641_0003608 3300046461 Bacteria 11461
1203 Ga0495641_0118217 3300046461 Bacteria 1182
1204 Ga0495641_0185141 3300046461 Bacteria 932
1205 Ga0495651_0001137 3300046462 Bacteria 20570
1206 Ga0495651_0004063 3300046462 Bacteria 11179
1207 Ga0495651_0004096 3300046462 Bacteria 11149
1208 Ga0495651_0015483 3300046462 Bacteria 5900
1209 Ga0495651_0046184 3300046462 Bacteria 3371
1210 Ga0495651_0163331 3300046462 Bacteria 1593
1211 Ga0495653_0004863 3300046463 Bacteria 10899
1212 Ga0495653_0029402 3300046463 Bacteria 4386
1213 Ga0495653_0038966 3300046463 Bacteria 3726
1214 Ga0495653_0042270 3300046463 Bacteria 3550
1215 Ga0495653_0071907 3300046463 Bacteria 2584
1216 Ga0495653_0223937 3300046463 Bacteria 1263
1217 Ga0495653_0329739 3300046463 Bacteria 987
1218 Ga0495653_0391850 3300046463 Bacteria 885
1219 Ga0495580_0057637 3300046472 Bacteria 2733
1220 Ga0495580_0183058 3300046472 Bacteria 1446
1221 Ga0495582_0005652 3300046473 Bacteria 6961
1222 Ga0495582_0040378 3300046473 Bacteria 2570
1223 Ga0495582_0099402 3300046473 Bacteria 1628
1224 Ga0495582_0104365 3300046473 Bacteria 1589
1225 Ga0495582_0161218 3300046473 Bacteria 1275
1226 Ga0495582_0236395 3300046473 Bacteria 1047
1227 Ga0495582_0556672 3300046473 Bacteria 663
1228 Ga0495605_0027760 3300046474 Bacteria 2929
1229 Ga0495639_0012462 3300046475 Bacteria 3667
1230 Ga0495639_0031522 3300046475 Bacteria 2360
1231 Ga0495639_0193208 3300046475 Bacteria 994
1232 Ga0495639_0588160 3300046475 Bacteria 572
1233 Ga0495662_0000585 3300046476 Bacteria 16782
1234 Ga0495662_0000600 3300046476 Bacteria 16641
1235 Ga0495662_0012967 3300046476 Bacteria 4060
1236 Ga0495662_0027110 3300046476 Bacteria 2767
1237 Ga0495662_0053026 3300046476 Bacteria 1958
1238 Ga0495662_0080275 3300046476 Bacteria 1586
1239 Ga0495662_0159693 3300046476 Bacteria 1110
1240 Ga0495664_0003849 3300046477 Bacteria 8190
1241 Ga0495664_0012427 3300046477 Bacteria 4823
1242 Ga0495664_0017674 3300046477 Bacteria 4078
1243 Ga0495664_0017854 3300046477 Bacteria 4057
1244 Ga0495664_0022249 3300046477 Bacteria 3672
1245 Ga0495664_0029664 3300046477 Bacteria 3200
1246 Ga0495664_0105905 3300046477 Bacteria 1695
1247 Ga0495584_0125282 3300046491 Bacteria 1302
1248 Ga0495585_0070321 3300046492 Bacteria 1909
1249 Ga0495585_0075451 3300046492 Bacteria 1833
1250 Ga0495585_0075605 3300046492 Bacteria 1830
1251 Ga0495585_0258624 3300046492 Bacteria 866
1252 Ga0495585_0259622 3300046492 Bacteria 864
1253 Ga0495585_0454749 3300046492 Bacteria 612
1254 Ga0495594_0002440 3300046499 Bacteria 9685
1255 Ga0495594_0005436 3300046499 Bacteria 6547
1256 Ga0495594_0057416 3300046499 Bacteria 2149
1257 Ga0495594_0091639 3300046499 Bacteria 1703
1258 Ga0495594_0204491 3300046499 Bacteria 1125
1259 Ga0495594_0227954 3300046499 Bacteria 1062
1260 Ga0495594_0426196 3300046499 Bacteria 754
1261 Ga0495596_0018896 3300046500 Bacteria 2837
1262 Ga0495596_0057813 3300046500 Bacteria 1513
1263 Ga0495596_0177004 3300046500 Bacteria 829
1264 Ga0495607_0048872 3300046501 Bacteria 2470
1265 Ga0495607_0051739 3300046501 Bacteria 2383
1266 Ga0495607_0072728 3300046501 Bacteria 1913
1267 Ga0495583_0061795 3300046506 Bacteria 1669
1268 Ga0495606_0006375 3300046507 Bacteria 10905
1269 Ga0495608_0000457 3300046511 Bacteria 28465
1270 Ga0495608_0019897 3300046511 Bacteria 4616
1271 Ga0495608_0035781 3300046511 Bacteria 3346
1272 Ga0495608_0039886 3300046511 Bacteria 3146
1273 Ga0495608_0527612 3300046511 Bacteria 713
1274 Ga0495610_0063004 3300046512 Bacteria 1757
1275 Ga0495616_0003801 3300046513 Bacteria 9623
1276 Ga0495616_0357371 3300046513 Bacteria 607
1277 Ga0495618_0007498 3300046514 Bacteria 6601
1278 Ga0495618_0019010 3300046514 Bacteria 4222
1279 Ga0495618_0025441 3300046514 Bacteria 3673
1280 Ga0495618_0079095 3300046514 Bacteria 2097
1281 Ga0495618_0127174 3300046514 Bacteria 1631
1282 Ga0495620_0054153 3300046515 Bacteria 1696
1283 Ga0495620_0165499 3300046515 Bacteria 858
1284 Ga0495620_0169227 3300046515 Bacteria 847
1285 Ga0495628_0027669 3300046516 Bacteria 4610
1286 Ga0495628_0042985 3300046516 Bacteria 3602
1287 Ga0495628_0048987 3300046516 Bacteria 3346
1288 Ga0495628_0070625 3300046516 Bacteria 2722
1289 Ga0495628_0084215 3300046516 Bacteria 2467
1290 Ga0495628_0498540 3300046516 Bacteria 879
1291 Ga0495630_0041563 3300046517 Bacteria 3433
1292 Ga0495630_0058292 3300046517 Bacteria 2894
1293 Ga0495630_0062191 3300046517 Bacteria 2804
1294 Ga0495630_0222869 3300046517 Bacteria 1440
1295 Ga0495630_0344043 3300046517 Bacteria 1141
1296 Ga0495630_0631393 3300046517 Bacteria 821
1297 Ga0495631_0004163 3300046518 Bacteria 7749
1298 Ga0495632_0025649 3300046519 Bacteria 3115
1299 Ga0495632_0134282 3300046519 Bacteria 1150
1300 Ga0495632_0303866 3300046519 Bacteria 707
1301 Ga0495637_0027376 3300046520 Bacteria 2551
1302 Ga0495637_0037354 3300046520 Bacteria 2109
1303 Ga0495643_0005977 3300046522 Bacteria 8122
1304 Ga0495643_0008022 3300046522 Bacteria 6732
1305 Ga0495644_0023028 3300046523 Bacteria 2372
1306 Ga0495644_0041104 3300046523 Bacteria 1742
1307 Ga0495648_0068206 3300046524 Bacteria 2076
1308 Ga0495663_0009942 3300046525 Bacteria 2641
1309 Ga0495666_0000906 3300046526 Bacteria 13895
1310 Ga0495666_0080579 3300046526 Bacteria 1540
1311 Ga0495666_0093330 3300046526 Bacteria 1420
1312 Ga0495666_0112439 3300046526 Bacteria 1278
1313 Ga0495666_0183954 3300046526 Bacteria 964
1314 Ga0495666_0280107 3300046526 Bacteria 756
1315 Ga0495642_0055136 3300046528 Bacteria 1640
1316 Ga0495642_0084633 3300046528 Bacteria 1338
1317 Ga0495652_0010842 3300046529 Bacteria 8258
1318 Ga0495652_0091587 3300046529 Bacteria 2485
1319 Ga0495652_0093017 3300046529 Bacteria 2462
1320 Ga0495652_0103996 3300046529 Bacteria 2297
1321 Ga0495652_0107955 3300046529 Bacteria 2244
1322 Ga0495652_0138834 3300046529 Bacteria 1913
1323 Ga0495652_0240179 3300046529 Bacteria 1348
1324 Ga0495652_0306836 3300046529 Bacteria 1151
1325 Ga0495652_0981747 3300046529 Bacteria 553
1326 Ga0495654_0007370 3300046530 Bacteria 6147
1327 Ga0495665_0004964 3300046531 Bacteria 7169
1328 Ga0495665_0005298 3300046531 Bacteria 6951
1329 Ga0495665_0005836 3300046531 Bacteria 6644
1330 Ga0495665_0005892 3300046531 Bacteria 6599
1331 Ga0495640_0003461 3300046533 Bacteria 12706
1332 Ga0495640_0006110 3300046533 Bacteria 9546
1333 Ga0495640_0012238 3300046533 Bacteria 6566
1334 Ga0495640_0023619 3300046533 Bacteria 4475
1335 Ga0495640_0036241 3300046533 Bacteria 3485
1336 Ga0495640_0105248 3300046533 Bacteria 1848
1337 Ga0495640_0240139 3300046533 Bacteria 1137
1338 Ga0495640_0683267 3300046533 Bacteria 616
1339 Ga0495586_0010989 3300046535 Bacteria 4810
1340 Ga0495586_0031312 3300046535 Bacteria 2848
1341 Ga0495586_0141080 3300046535 Bacteria 1352
1342 Ga0495586_0323491 3300046535 Bacteria 885
1343 Ga0495586_0425138 3300046535 Bacteria 765
1344 Ga0495587_0003258 3300046536 Bacteria 10849
1345 Ga0495587_0013451 3300046536 Bacteria 5143
1346 Ga0495587_0013762 3300046536 Bacteria 5083
1347 Ga0495587_0061468 3300046536 Bacteria 2201
1348 Ga0495587_0143557 3300046536 Bacteria 1361
1349 Ga0495587_0376824 3300046536 Bacteria 789
1350 Ga0495598_0021468 3300046537 Bacteria 1718
1351 Ga0495609_0023685 3300046538 Bacteria 2820
1352 Ga0495609_0044610 3300046538 Bacteria 1988
1353 Ga0495609_0097363 3300046538 Bacteria 1276
1354 Ga0495609_0130440 3300046538 Bacteria 1077
1355 Ga0495597_0075657 3300046542 Bacteria 1444
1356 Ga0495597_0162614 3300046542 Bacteria 910
1357 Ga0495645_0006394 3300046543 Bacteria 8179
1358 Ga0495645_0059565 3300046543 Bacteria 2768
1359 Ga0495645_0146946 3300046543 Bacteria 1641
1360 Ga0495645_0319987 3300046543 Bacteria 1007
1361 Ga0495645_0389810 3300046543 Bacteria 889
1362 Ga0495622_0015255 3300046557 Bacteria 3571
1363 Ga0495622_0019042 3300046557 Bacteria 3198
1364 Ga0495622_0045225 3300046557 Bacteria 2045
1365 Ga0495622_0257484 3300046557 Bacteria 766
1366 Ga0495633_0005358 3300046558 Bacteria 7867
1367 Ga0495633_0030269 3300046558 Bacteria 2630
1368 Ga0495667_0005090 3300046559 Bacteria 8884
1369 Ga0495667_0009929 3300046559 Bacteria 6448
1370 Ga0495667_0029960 3300046559 Bacteria 3659
1371 Ga0495667_0072945 3300046559 Bacteria 2236
1372 Ga0495667_0140948 3300046559 Bacteria 1553
1373 Ga0495667_0230183 3300046559 Bacteria 1181
1374 Ga0495667_0242635 3300046559 Bacteria 1147
1375 Ga0495667_0405590 3300046559 Bacteria 858
1376 Ga0495667_0593328 3300046559 Bacteria 690
1377 Ga0495656_0072026 3300046615 Bacteria 1537
1378 Ga0495656_0233741 3300046615 Bacteria 923
1379 Ga0495656_0234142 3300046615 Bacteria 923
1380 Ga0495668_0286789 3300046616 Bacteria 902
1381 Ga0495634_0000626 3300046642 Bacteria 34287
1382 Ga0495634_0004108 3300046642 Bacteria 11528
1383 Ga0495634_0020442 3300046642 Bacteria 4694
1384 Ga0495634_0023454 3300046642 Bacteria 4337
1385 Ga0495634_0028120 3300046642 Bacteria 3905
1386 Ga0495634_0131367 3300046642 Bacteria 1596
1387 Ga0495634_0136447 3300046642 Bacteria 1560
1388 Ga0495634_0156768 3300046642 Bacteria 1437
1389 Ga0495634_0183060 3300046642 Bacteria 1310
1390 Ga0495634_0545153 3300046642 Bacteria 677
1391 Ga0495611_0017753 3300046648 Bacteria 3047
1392 Ga0495611_0022394 3300046648 Bacteria 2733
1393 Ga0495611_0048988 3300046648 Bacteria 1900
1394 Ga0495611_0167329 3300046648 Bacteria 1027
1395 Ga0495611_0292772 3300046648 Bacteria 751
1396 Ga0495625_0011293 3300046660 Bacteria 7294
1397 Ga0495625_0036984 3300046660 Bacteria 3584
1398 Ga0495635_0004539 3300046663 Bacteria 9622
1399 Ga0495635_0013510 3300046663 Bacteria 5714
1400 Ga0495635_0042090 3300046663 Bacteria 3155
1401 Ga0495635_0049734 3300046663 Bacteria 2889
1402 Ga0495635_0057761 3300046663 Bacteria 2669
1403 Ga0495635_0060270 3300046663 Bacteria 2608
1404 Ga0495635_0116887 3300046663 Bacteria 1820
1405 Ga0495635_0182623 3300046663 Bacteria 1425
1406 Ga0495635_0558659 3300046663 Bacteria 750
1407 Ga0495661_0039646 3300046665 Bacteria 2926
1408 Ga0495661_0046389 3300046665 Bacteria 2653
1409 Ga0495661_0118639 3300046665 Bacteria 1464
1410 Ga0495588_0022151 3300046674 Bacteria 3138
1411 Ga0495588_0068342 3300046674 Bacteria 1845
1412 Ga0495588_0091973 3300046674 Bacteria 1589
1413 Ga0495588_0125782 3300046674 Bacteria 1352
1414 Ga0495657_0002383 3300046675 Bacteria 15811
1415 Ga0495657_0007140 3300046675 Bacteria 8665
1416 Ga0495657_0022451 3300046675 Bacteria 4518
1417 Ga0495657_0040887 3300046675 Bacteria 3176
1418 Ga0495657_0058343 3300046675 Bacteria 2563
1419 Ga0495657_0120993 3300046675 Bacteria 1648
1420 Ga0495657_0211605 3300046675 Bacteria 1178
1421 Ga0495657_0725320 3300046675 Bacteria 570
1422 Ga0495599_0030374 3300046678 Bacteria 3390
1423 Ga0495599_0081661 3300046678 Bacteria 2019
1424 Ga0495599_0244800 3300046678 Bacteria 1092
1425 Ga0495599_0282347 3300046678 Bacteria 1005
1426 Ga0495599_0442633 3300046678 Bacteria 770
1427 Ga0495623_0009174 3300046679 Bacteria 6417
1428 Ga0495623_0085990 3300046679 Bacteria 1938
1429 Ga0495623_0155803 3300046679 Bacteria 1346
1430 Ga0495623_0234736 3300046679 Bacteria 1038
1431 Ga0495623_0264130 3300046679 Bacteria 963
1432 Ga0495646_0001371 3300046680 Bacteria 14431
1433 Ga0495646_0011902 3300046680 Bacteria 5534
1434 Ga0495646_0025764 3300046680 Bacteria 3697
1435 Ga0495646_0115853 3300046680 Bacteria 1521
1436 Ga0495646_0255970 3300046680 Bacteria 936
1437 Ga0495646_0281571 3300046680 Bacteria 883
1438 Ga0495646_0570288 3300046680 Bacteria 577
1439 Ga0495647_0020907 3300046681 Bacteria 2353
1440 Ga0495658_0005567 3300046683 Bacteria 6189
1441 Ga0495658_0069363 3300046683 Bacteria 2043
1442 Ga0495658_0163759 3300046683 Bacteria 1373
1443 Ga0495658_0252413 3300046683 Bacteria 1109
1444 Ga0495658_0514031 3300046683 Bacteria 766
1445 Ga0495613_0000704 3300046689 Bacteria 26326
1446 Ga0495613_0005089 3300046689 Bacteria 9851
1447 Ga0495613_0005645 3300046689 Bacteria 9385
1448 Ga0495613_0010257 3300046689 Bacteria 6958
1449 Ga0495613_0018023 3300046689 Bacteria 5262
1450 Ga0495613_0034477 3300046689 Bacteria 3759
1451 Ga0495613_0037380 3300046689 Bacteria 3599
1452 Ga0495613_0093191 3300046689 Bacteria 2180
1453 Ga0495613_0388726 3300046689 Bacteria 953
1454 Ga0495613_0517385 3300046689 Bacteria 802
1455 Ga0495613_0746430 3300046689 Bacteria 641
1456 Ga0495624_0007123 3300046690 Bacteria 7868
1457 Ga0495624_0007746 3300046690 Bacteria 7533
1458 Ga0495624_0011024 3300046690 Bacteria 6222
1459 Ga0495624_0028664 3300046690 Bacteria 3636
1460 Ga0495624_0084490 3300046690 Bacteria 1962
1461 Ga0495624_0131734 3300046690 Bacteria 1533
1462 Ga0495670_0039461 3300046691 Bacteria 2355
1463 Ga0495670_0115907 3300046691 Bacteria 1389
1464 Ga0495670_0260622 3300046691 Bacteria 925
1465 Ga0495670_0406880 3300046691 Bacteria 735
1466 Ga0495670_0768335 3300046691 Bacteria 526
1467 Ga0495671_0008610 3300046692 Bacteria 5730
1468 Ga0495671_0090667 3300046692 Bacteria 1496
1469 Ga0495649_0031629 3300046694 Bacteria 2917
1470 Ga0495649_0075816 3300046694 Bacteria 1800
1471 Ga0495589_0011786 3300046794 Bacteria 4536
1472 Ga0495589_0105099 3300046794 Bacteria 1365
1473 Ga0495589_0152336 3300046794 Bacteria 1103
1474 Ga0495589_0174702 3300046794 Bacteria 1020
1475 Ga0495589_0228315 3300046794 Bacteria 873
1476 Ga0495589_0321088 3300046794 Bacteria 715
1477 Ga0495600_0004210 3300046809 Bacteria 8586
1478 Ga0495600_0006730 3300046809 Bacteria 7006
1479 Ga0495600_0014374 3300046809 Bacteria 4987
1480 Ga0495600_0114315 3300046809 Bacteria 1757
1481 Ga0495600_0163115 3300046809 Bacteria 1440
1482 Ga0495600_0224615 3300046809 Bacteria 1200
1483 Ga0495600_0237698 3300046809 Bacteria 1161
1484 Ga0495600_0246758 3300046809 Bacteria 1136
1485 Ga0495660_0034851 3300046810 Bacteria 2814
1486 Ga0495660_0063398 3300046810 Bacteria 1979
1487 Ga0495581_0002245 3300047315 Bacteria 10864
1488 Ga0495581_0004730 3300047315 Bacteria 7857
1489 Ga0495581_0037892 3300047315 Bacteria 2790
1490 Ga0495581_0045158 3300047315 Bacteria 2547
1491 Ga0495581_0046927 3300047315 Bacteria 2496
1492 Ga0495581_0056765 3300047315 Bacteria 2260
1493 Ga0495581_0080075 3300047315 Bacteria 1890
1494 Ga0495581_0092440 3300047315 Bacteria 1756
1495 Ga0495581_0102572 3300047315 Bacteria 1662
1496 Ga0495581_0179610 3300047315 Bacteria 1237
1497 Ga0495581_0333787 3300047315 Bacteria 885
1498 Ga0495604_0000590 3300047317 Bacteria 31463
1499 Ga0495604_0012749 3300047317 Bacteria 6690
1500 Ga0495604_0024988 3300047317 Bacteria 4762
1501 Ga0495604_0035517 3300047317 Bacteria 3936
1502 Ga0495604_0041000 3300047317 Bacteria 3632
1503 Ga0495604_0059394 3300047317 Bacteria 2931
1504 Ga0495604_0213397 3300047317 Bacteria 1332
1505 Ga0495604_0508706 3300047317 Bacteria 780
1506 Ga0495636_0008517 3300047318 Bacteria 4047
1507 Ga0495636_0019828 3300047318 Bacteria 2705
1508 Ga0495636_0020521 3300047318 Bacteria 2662
1509 Ga0495636_0043369 3300047318 Bacteria 1871
1510 Ga0495636_0099816 3300047318 Bacteria 1268
1511 Ga0495636_0262880 3300047318 Bacteria 800
1512 Ga0495674_0014793 3300047319 Bacteria 7299
1513 Ga0495674_0020722 3300047319 Bacteria 6087
1514 Ga0495674_0026819 3300047319 Bacteria 5269
1515 Ga0495674_0147512 3300047319 Bacteria 1974
1516 Ga0495674_0453210 3300047319 Bacteria 1030
1517 Ga0495674_0554436 3300047319 Bacteria 914
1518 Ga0495672_0098197 3300047320 Bacteria 1593
1519 Ga0495676_0014737 3300047321 Bacteria 6982
1520 Ga0495676_0023696 3300047321 Bacteria 5322
1521 Ga0495676_0031255 3300047321 Bacteria 4505
1522 Ga0495676_0068779 3300047321 Bacteria 2734
1523 Ga0495676_0070119 3300047321 Bacteria 2701
1524 Ga0495676_0072120 3300047321 Bacteria 2652
1525 Ga0495676_0120682 3300047321 Bacteria 1907
1526 Ga0495676_0165295 3300047321 Bacteria 1562
1527 Ga0495676_0347052 3300047321 Bacteria 993
1528 Ga0495676_0494845 3300047321 Bacteria 803
1529 Ga0495680_0003256 3300047322 Bacteria 16121
1530 Ga0495680_0011499 3300047322 Bacteria 7829
1531 Ga0495680_0012358 3300047322 Bacteria 7517
1532 Ga0495680_0044700 3300047322 Bacteria 3501
1533 Ga0495680_0047383 3300047322 Bacteria 3381
1534 Ga0495680_0061680 3300047322 Bacteria 2883
1535 Ga0495680_0142478 3300047322 Bacteria 1753
1536 Ga0495683_0025758 3300047323 Bacteria 3013
1537 Ga0495683_0033477 3300047323 Bacteria 2615
1538 Ga0495683_0352302 3300047323 Bacteria 621
1539 Ga0495687_001001 3300047443 Bacteria 28257
1540 Ga0495687_001560 3300047443 Bacteria 20810
1541 Ga0495687_016118 3300047443 Bacteria 3768
1542 Ga0495675_0018440 3300047444 Bacteria 4429
1543 Ga0495675_0029863 3300047444 Bacteria 3477
1544 Ga0495675_0042833 3300047444 Bacteria 2883
1545 Ga0495675_0066288 3300047444 Bacteria 2282
1546 Ga0495675_0120467 3300047444 Bacteria 1634
1547 Ga0495675_0139361 3300047444 Bacteria 1504
1548 Ga0495675_0218783 3300047444 Bacteria 1153
1549 Ga0495675_0224849 3300047444 Bacteria 1134
1550 Ga0495675_0425703 3300047444 Bacteria 771
1551 Ga0495677_0023235 3300047445 Bacteria 2251
1552 Ga0495677_0029557 3300047445 Bacteria 1993
1553 Ga0495677_0036035 3300047445 Bacteria 1806
1554 Ga0495679_056845 3300047446 Bacteria 1158
1555 Ga0495679_093091 3300047446 Bacteria 843
1556 Ga0495685_000403 3300047447 Bacteria 13717
1557 Ga0495685_004718 3300047447 Bacteria 4421
1558 Ga0495685_019035 3300047447 Bacteria 2357
1559 Ga0495685_022874 3300047447 Bacteria 2150
1560 Ga0495685_114301 3300047447 Bacteria 887
1561 Ga0495685_292351 3300047447 Bacteria 513
1562 Ga0495681_0002670 3300047470 Bacteria 12632
1563 Ga0495681_0003065 3300047470 Bacteria 11723
1564 Ga0495681_0070949 3300047470 Bacteria 1578
1565 Ga0495684_0004164 3300047471 Bacteria 11295
1566 Ga0495684_0004873 3300047471 Bacteria 10469
1567 Ga0495684_0028859 3300047471 Bacteria 4259
1568 Ga0495684_0030673 3300047471 Bacteria 4128
1569 Ga0495684_0064631 3300047471 Bacteria 2781
1570 Ga0495684_0107181 3300047471 Bacteria 2111
1571 Ga0495684_0147989 3300047471 Bacteria 1757
1572 Ga0495686_0005934 3300047472 Bacteria 9505
1573 Ga0495686_0038034 3300047472 Bacteria 3080
1574 Ga0495686_0048999 3300047472 Bacteria 2660
1575 Ga0495593_0003014 3300047673 Bacteria 10148
1576 Ga0495593_0012250 3300047673 Bacteria 4901
1577 Ga0495593_0020518 3300047673 Bacteria 3701
1578 Ga0495593_0061868 3300047673 Bacteria 1957
1579 Ga0495593_0134453 3300047673 Bacteria 1254
1580 Ga0495593_0164734 3300047673 Bacteria 1118
1581 Ga0495593_0182618 3300047673 Bacteria 1056
1582 Ga0495593_0350494 3300047673 Bacteria 738
1583 Ga0495602_0030856 3300048088 Bacteria 5076
1584 Ga0495602_0063495 3300048088 Bacteria 3199
1585 Ga0495602_0083248 3300048088 Bacteria 2681
1586 Ga0495602_0129994 3300048088 Bacteria 2010
1587 Ga0495602_0150723 3300048088 Bacteria 1828
1588 Ga0495602_0410626 3300048088 Bacteria 963
1589 Ga0495602_0452118 3300048088 Bacteria 906
1590 Ga0495602_1011200 3300048088 Bacteria 548
1591 Ga0495614_0003507 3300048089 Bacteria 7026
1592 Ga0495614_0005517 3300048089 Bacteria 5705
1593 Ga0495614_0192948 3300048089 Bacteria 919
1594 Ga0495614_0261666 3300048089 Bacteria 793
1595 Ga0495615_0244012 3300048090 Bacteria 567
1596 Ga0495626_0006925 3300048091 Bacteria 6386
1597 Ga0496100_0041269 3300048903 Bacteria 2941
1598 Ga0496100_0475212 3300048903 Bacteria 961
1599 Ga0496100_0607451 3300048903 Bacteria 850
1600 Ga0496101_0021655 3300048904 Bacteria 4417
1601 Ga0496101_0420429 3300048904 Bacteria 1053
1602 Ga0496101_0476444 3300048904 Bacteria 985
1603 Ga0496102_0005198 3300048905 Bacteria 11050
1604 Ga0496102_0008637 3300048905 Bacteria 8742
1605 Ga0496102_0274201 3300048905 Bacteria 1590
1606 Ga0496102_0357818 3300048905 Bacteria 1374
1607 Ga0496102_0445174 3300048905 Bacteria 1215
1608 Ga0496102_1417763 3300048905 Bacteria 614
1609 Ga0496103_0011644 3300048906 Bacteria 5217
1610 Ga0496103_0053998 3300048906 Bacteria 2490
1611 Ga0496103_0372240 3300048906 Bacteria 918
1612 Ga0496104_0061932 3300048907 Bacteria 3547
1613 Ga0496104_0087405 3300048907 Bacteria 2977
1614 Ga0496104_0188230 3300048907 Bacteria 1975
1615 Ga0496105_0029690 3300048908 Bacteria 4476
1616 Ga0496105_0106953 3300048908 Bacteria 2309
1617 Ga0496105_0119990 3300048908 Bacteria 2169
1618 Ga0496105_0146114 3300048908 Bacteria 1944
1619 Ga0496105_0431586 3300048908 Bacteria 1042
1620 Ga0496105_0647516 3300048908 Bacteria 816
1621 Ga0496106_0008319 3300048909 Bacteria 7677
1622 Ga0496106_0029464 3300048909 Bacteria 4091
1623 Ga0496106_0167415 3300048909 Bacteria 1740
1624 Ga0496106_0562035 3300048909 Bacteria 915
1625 Ga0496106_0569376 3300048909 Bacteria 908
1626 Ga0496106_0835702 3300048909 Bacteria 729
1627 Ga0496106_1166206 3300048909 Bacteria 602
1628 Ga0496107_0019893 3300048910 Bacteria 4740
1629 Ga0496107_0069211 3300048910 Bacteria 2561
1630 Ga0496107_0154792 3300048910 Bacteria 1697
1631 Ga0496107_0606519 3300048910 Bacteria 809
1632 Ga0496107_0820445 3300048910 Bacteria 680
1633 Ga0496108_0019165 3300048911 Bacteria 5616
1634 Ga0496108_0024157 3300048911 Bacteria 5003
1635 Ga0496108_0029657 3300048911 Bacteria 4532
1636 Ga0496108_0089356 3300048911 Bacteria 2618
1637 Ga0496108_0107297 3300048911 Bacteria 2384
1638 Ga0496108_0707495 3300048911 Bacteria 873
1639 Ga0496108_1223311 3300048911 Bacteria 634
1640 Ga0496108_1270374 3300048911 Bacteria 620
1641 Ga0496109_0006258 3300048912 Bacteria 10011
1642 Ga0496109_0015250 3300048912 Bacteria 6690
1643 Ga0496109_0020477 3300048912 Bacteria 5843
1644 Ga0496109_0035248 3300048912 Bacteria 4512
1645 Ga0496109_0044001 3300048912 Bacteria 4049
1646 Ga0496109_0139412 3300048912 Bacteria 2267
1647 Ga0496109_0230614 3300048912 Bacteria 1742
1648 Ga0496109_0230971 3300048912 Bacteria 1740
1649 Ga0496109_0387387 3300048912 Bacteria 1320
1650 Ga0496109_0480538 3300048912 Bacteria 1173
1651 Ga0496109_0486350 3300048912 Bacteria 1165
1652 Ga0496109_0696529 3300048912 Bacteria 953
1653 Ga0496110_0019268 3300048913 Bacteria 5738
1654 Ga0496110_0036101 3300048913 Bacteria 4291
1655 Ga0496110_0062954 3300048913 Bacteria 3277
1656 Ga0496110_0686512 3300048913 Bacteria 925
1657 Ga0496110_1226679 3300048913 Bacteria 659
1658 Ga0496110_1643964 3300048913 Bacteria 552
1659 Ga0496111_0016124 3300048914 Bacteria 5146
1660 Ga0496111_0125687 3300048914 Bacteria 1895
1661 Ga0496111_0148683 3300048914 Bacteria 1737
1662 Ga0496111_0242637 3300048914 Bacteria 1338
1663 Ga0496111_0256985 3300048914 Bacteria 1296
1664 Ga0496111_0849291 3300048914 Bacteria 659
1665 Ga0496112_0189334 3300048915 Bacteria 2020
1666 Ga0496112_0518419 3300048915 Bacteria 1127
1667 Ga0496112_1036803 3300048915 Bacteria 739
1668 Ga0496112_1241449 3300048915 Bacteria 661
1669 Ga0496113_0061466 3300048916 Bacteria 2834
1670 Ga0496113_0068519 3300048916 Bacteria 2693
1671 Ga0496113_0132351 3300048916 Bacteria 1958
1672 Ga0496113_0143982 3300048916 Bacteria 1877
1673 Ga0496113_0798236 3300048916 Bacteria 750
1674 Ga0496113_1150326 3300048916 Bacteria 607
1675 Ga0496113_1594223 3300048916 Bacteria 502
1676 Ga0496114_0002916 3300048917 Bacteria 13112
1677 Ga0496114_0083131 3300048917 Bacteria 2708
1678 Ga0496114_0308065 3300048917 Bacteria 1398
1679 Ga0496114_0391521 3300048917 Bacteria 1231
1680 Ga0496114_0593570 3300048917 Bacteria 977
1681 Ga0496114_0624165 3300048917 Bacteria 949
1682 Ga0496114_0720898 3300048917 Bacteria 873
1683 Ga0496114_1081728 3300048917 Bacteria 686
1684 Ga0496114_1108601 3300048917 Bacteria 676
1685 Ga0496114_1176212 3300048917 Bacteria 653
1686 Ga0496114_1352114 3300048917 Bacteria 599
1687 Ga0496115_0061447 3300048918 Bacteria 3028
1688 Ga0496115_0365229 3300048918 Bacteria 1175
1689 Ga0496115_0688494 3300048918 Bacteria 805
1690 Ga0496115_0770546 3300048918 Bacteria 751
1691 Ga0496115_0955967 3300048918 Bacteria 657
1692 Ga0496117_0028846 3300048920 Bacteria 4290
1693 Ga0496119_0020275 3300048922 Bacteria 4856
1694 Ga0496120_0369915 3300048923 Bacteria 640
1695 Ga0496121_0007510 3300048924 Bacteria 13153
1696 Ga0496125_0468259 3300048928 Bacteria 717
1697 Ga0496126_0726524 3300048929 Bacteria 769
1698 Ga0496126_0835989 3300048929 Bacteria 703
1699 Ga0501306_016193 3300049127 Bacteria 999
1700 Ga0501306_026302 3300049127 Bacteria 842
1701 Ga0501306_056781 3300049127 Bacteria 638
1702 Ga0501306_073855 3300049127 Bacteria 579
1703 Ga0501308_006777 3300049128 Bacteria 1183
1704 Ga0501309_068821 3300049129 Bacteria 579
1705 Ga0501310_022788 3300049130 Bacteria 792
1706 Ga0501310_079142 3300049130 Bacteria 514
1707 Ga0501304_003547 3300049160 Bacteria 1149
1708 Ga0501304_006443 3300049160 Bacteria 947
1709 Ga0501305_119111 3300049161 Bacteria 505
1710 Ga0501307_008271 3300049162 Bacteria 1165
1711 Ga0495678_055852 3300049459 Bacteria 1504
1712 Ga0495682_0005869 3300049460 Bacteria 5043
1713 Ga0501311_012937 3300049527 Bacteria 1047
1714 Ga0501312_046384 3300049528 Bacteria 723
1715 Ga0501312_110483 3300049528 Bacteria 524
1716 Ga0501313_011751 3300049529 Bacteria 1013
1717 Ga0501314_017874 3300049530 Bacteria 717
1718 Ga0501314_034440 3300049530 Bacteria 573
1719 Ga0501315_017434 3300049531 Bacteria 939
1720 Ga0501316_013954 3300049532 Bacteria 954
1721 Ga0501316_031134 3300049532 Bacteria 714
1722 Ga0501317_018717 3300049533 Bacteria 918
1723 Ga0501317_019041 3300049533 Bacteria 914
1724 Ga0501317_020531 3300049533 Bacteria 891
1725 Ga0501318_017683 3300049534 Bacteria 873
1726 Ga0501318_019601 3300049534 Bacteria 845
1727 Ga0501319_010169 3300049535 Bacteria 746
1728 Ga0501320_041643 3300049536 Bacteria 603
1729 Ga0501321_057297 3300049537 Bacteria 582
1730 Ga0501322_010682 3300049538 Bacteria 710
1731 Ga0501323_038698 3300049539 Bacteria 693
1732 Ga0501323_066488 3300049539 Bacteria 570
1733 Ga0501324_006319 3300049540 Bacteria 996
1734 Ga0501325_028288 3300049541 Bacteria 629
1735 Ga0501340_018923 3300049556 Bacteria 566
1736 Ga0501031_0001520 3300049568 Bacteria 14430
1737 Ga0501031_0001758 3300049568 Bacteria 13592
1738 Ga0501031_0005016 3300049568 Bacteria 8608
1739 Ga0501031_0020667 3300049568 Bacteria 4293
1740 Ga0501031_0032383 3300049568 Bacteria 3408
1741 Ga0501031_0042680 3300049568 Bacteria 2960
1742 Ga0501031_0101799 3300049568 Bacteria 1874
1743 Ga0501031_0129984 3300049568 Bacteria 1645
1744 Ga0501031_0332064 3300049568 Bacteria 984
1745 Ga0501032_0008150 3300049569 Bacteria 7642
1746 Ga0501032_0009602 3300049569 Bacteria 7011
1747 Ga0501032_0032281 3300049569 Bacteria 3588
1748 Ga0501032_0057997 3300049569 Bacteria 2600
1749 Ga0501032_0083003 3300049569 Bacteria 2131
1750 Ga0501032_0096678 3300049569 Bacteria 1958
1751 Ga0501032_0097421 3300049569 Bacteria 1949
1752 Ga0501032_0188587 3300049569 Bacteria 1348
1753 Ga0501032_0336681 3300049569 Bacteria 973
1754 Ga0501033_0004033 3300049570 Bacteria 11861
1755 Ga0501033_0005389 3300049570 Bacteria 10137
1756 Ga0501033_0032839 3300049570 Bacteria 3897
1757 Ga0501033_0036941 3300049570 Bacteria 3658
1758 Ga0501033_0045703 3300049570 Bacteria 3257
1759 Ga0501033_0057628 3300049570 Bacteria 2870
1760 Ga0501033_0061928 3300049570 Bacteria 2756
1761 Ga0501033_0076409 3300049570 Bacteria 2458
1762 Ga0501033_0620529 3300049570 Bacteria 740
1763 Ga0501033_0626025 3300049570 Bacteria 736
1764 Ga0501033_0683149 3300049570 Bacteria 699
1765 Ga0501034_0004686 3300049571 Bacteria 15141
1766 Ga0501034_0010199 3300049571 Bacteria 9800
1767 Ga0501034_0026116 3300049571 Bacteria 5947
1768 Ga0501034_0028993 3300049571 Bacteria 5628
1769 Ga0501034_0029673 3300049571 Bacteria 5560
1770 Ga0501034_0087674 3300049571 Bacteria 3111
1771 Ga0501034_0120148 3300049571 Bacteria 2614
1772 Ga0501034_0147390 3300049571 Bacteria 2330
1773 Ga0501034_0644284 3300049571 Bacteria 962
1774 Ga0501036_0001218 3300049572 Bacteria 19672
1775 Ga0501036_0002529 3300049572 Bacteria 14358
1776 Ga0501036_0008870 3300049572 Bacteria 8257
1777 Ga0501036_0012043 3300049572 Bacteria 7168
1778 Ga0501036_0035396 3300049572 Bacteria 4226
1779 Ga0501036_0158590 3300049572 Bacteria 1908
1780 Ga0501036_0167218 3300049572 Bacteria 1853
1781 Ga0501036_0591824 3300049572 Bacteria 920
1782 Ga0501037_0001902 3300049573 Bacteria 15167
1783 Ga0501037_0010995 3300049573 Bacteria 6655
1784 Ga0501037_0018548 3300049573 Bacteria 5129
1785 Ga0501037_0028718 3300049573 Bacteria 4109
1786 Ga0501037_0058249 3300049573 Bacteria 2819
1787 Ga0501037_0065314 3300049573 Bacteria 2651
1788 Ga0501037_0070515 3300049573 Bacteria 2543
1789 Ga0501037_0120552 3300049573 Bacteria 1886
1790 Ga0501037_0384395 3300049573 Bacteria 964
1791 Ga0501037_0772692 3300049573 Bacteria 636
1792 Ga0501037_0987404 3300049573 Bacteria 549
1793 Ga0501038_0001782 3300049574 Bacteria 19989
1794 Ga0501038_0006639 3300049574 Bacteria 10701
1795 Ga0501038_0019013 3300049574 Bacteria 6199
1796 Ga0501038_0019466 3300049574 Bacteria 6117
1797 Ga0501038_0037045 3300049574 Bacteria 4279
1798 Ga0501038_0058879 3300049574 Bacteria 3292
1799 Ga0501038_0115696 3300049574 Bacteria 2217
1800 Ga0501038_0187204 3300049574 Bacteria 1667
1801 Ga0501038_0773577 3300049574 Bacteria 715
1802 Ga0501038_1041324 3300049574 Bacteria 599
1803 Ga0501039_0003824 3300049575 Bacteria 11302
1804 Ga0501039_0007568 3300049575 Bacteria 8296
1805 Ga0501039_0009657 3300049575 Bacteria 7356
1806 Ga0501039_0010002 3300049575 Bacteria 7232
1807 Ga0501039_0017425 3300049575 Bacteria 5509
1808 Ga0501039_0022464 3300049575 Bacteria 4842
1809 Ga0501039_0154128 3300049575 Bacteria 1805
1810 Ga0501039_0279446 3300049575 Bacteria 1312
1811 Ga0501039_0414711 3300049575 Bacteria 1058
1812 Ga0501039_0797700 3300049575 Bacteria 737
1813 Ga0501040_0000579 3300049576 Bacteria 22317
1814 Ga0501040_0006040 3300049576 Bacteria 7841
1815 Ga0501040_0047011 3300049576 Bacteria 2946
1816 Ga0501040_0049450 3300049576 Bacteria 2874
1817 Ga0501040_0105028 3300049576 Bacteria 1973
1818 Ga0501041_0001041 3300049577 Bacteria 15194
1819 Ga0501041_0001449 3300049577 Bacteria 13103
1820 Ga0501041_0035608 3300049577 Bacteria 3016
1821 Ga0501041_0118468 3300049577 Bacteria 1644
1822 Ga0501041_1101466 3300049577 Bacteria 512
1823 Ga0501042_0000607 3300049578 Bacteria 19078
1824 Ga0501042_0007272 3300049578 Bacteria 7241
1825 Ga0501042_0008352 3300049578 Bacteria 6827
1826 Ga0501042_0013528 3300049578 Bacteria 5556
1827 Ga0501042_0022365 3300049578 Bacteria 4417
1828 Ga0501042_0106831 3300049578 Bacteria 2015
1829 Ga0501042_0209058 3300049578 Bacteria 1407
1830 Ga0501042_0248216 3300049578 Bacteria 1284
1831 Ga0501042_0784358 3300049578 Bacteria 693
1832 Ga0501043_0003568 3300049579 Bacteria 12767
1833 Ga0501043_0008028 3300049579 Bacteria 8334
1834 Ga0501043_0011123 3300049579 Bacteria 7048
1835 Ga0501043_0062277 3300049579 Bacteria 2929
1836 Ga0501043_0067156 3300049579 Bacteria 2816
1837 Ga0501043_0146826 3300049579 Bacteria 1846
1838 Ga0501043_0185774 3300049579 Bacteria 1618
1839 Ga0501043_0464413 3300049579 Bacteria 949
1840 Ga0501046_0000350 3300049580 Bacteria 46288
1841 Ga0501046_0001971 3300049580 Bacteria 19517
1842 Ga0501046_0006649 3300049580 Bacteria 10210
1843 Ga0501046_0009788 3300049580 Bacteria 8266
1844 Ga0501046_0269366 3300049580 Bacteria 1249
1845 Ga0501047_0000082 3300049581 Bacteria 121193
1846 Ga0501047_0027981 3300049581 Bacteria 5432
1847 Ga0501047_0040432 3300049581 Bacteria 4510
1848 Ga0501047_0043725 3300049581 Bacteria 4327
1849 Ga0501047_0056039 3300049581 Bacteria 3811
1850 Ga0501047_0174784 3300049581 Bacteria 2015
1851 Ga0501047_0176285 3300049581 Bacteria 2005
1852 Ga0501047_0846179 3300049581 Bacteria 729
1853 Ga0501048_0003167 3300049582 Bacteria 12539
1854 Ga0501048_0025475 3300049582 Bacteria 4310
1855 Ga0501048_0028799 3300049582 Bacteria 4031
1856 Ga0501048_0114008 3300049582 Bacteria 1909
1857 Ga0501067_0000588 3300049583 Bacteria 19588
1858 Ga0501067_0006519 3300049583 Bacteria 6472
1859 Ga0501067_0011450 3300049583 Bacteria 4912
1860 Ga0501067_0129624 3300049583 Bacteria 1404
1861 Ga0501067_0162598 3300049583 Bacteria 1243
1862 Ga0501067_0289061 3300049583 Bacteria 913
1863 Ga0501067_0298539 3300049583 Bacteria 897
1864 Ga0501067_0341550 3300049583 Bacteria 834
1865 Ga0501068_0002952 3300049584 Bacteria 9056
1866 Ga0501068_0005119 3300049584 Bacteria 7143
1867 Ga0501068_0016559 3300049584 Bacteria 4250
1868 Ga0501068_0029090 3300049584 Bacteria 3271
1869 Ga0501068_0033245 3300049584 Bacteria 3071
1870 Ga0501068_0403671 3300049584 Bacteria 881
1871 Ga0501069_0015331 3300049585 Bacteria 4106
1872 Ga0501069_0039069 3300049585 Bacteria 2621
1873 Ga0501069_0068075 3300049585 Bacteria 1992
1874 Ga0501069_0162964 3300049585 Bacteria 1284
1875 Ga0501069_0199757 3300049585 Bacteria 1158
1876 Ga0501069_0300642 3300049585 Bacteria 941
1877 Ga0501069_0758572 3300049585 Bacteria 587
1878 Ga0501069_0855057 3300049585 Bacteria 552
1879 Ga0501070_0001374 3300049586 Bacteria 21761
1880 Ga0501070_0001688 3300049586 Bacteria 19572
1881 Ga0501070_0003396 3300049586 Bacteria 13822
1882 Ga0501070_0004501 3300049586 Bacteria 11964
1883 Ga0501070_0016792 3300049586 Bacteria 6144
1884 Ga0501070_0062709 3300049586 Bacteria 3079
1885 Ga0501070_0072239 3300049586 Bacteria 2856
1886 Ga0501070_0168938 3300049586 Bacteria 1802
1887 Ga0501070_0260878 3300049586 Bacteria 1416
1888 Ga0501070_0369077 3300049586 Bacteria 1163
1889 Ga0501070_0549610 3300049586 Bacteria 924
1890 Ga0501070_0811722 3300049586 Bacteria 734
1891 Ga0501070_1337098 3300049586 Bacteria 546
1892 Ga0501071_0005647 3300049587 Bacteria 8065
1893 Ga0501071_0016929 3300049587 Bacteria 5017
1894 Ga0501071_0032668 3300049587 Bacteria 3696
1895 Ga0501071_0039679 3300049587 Bacteria 3368
1896 Ga0501071_0051445 3300049587 Bacteria 2968
1897 Ga0501071_0219565 3300049587 Bacteria 1430
1898 Ga0501071_0490613 3300049587 Bacteria 942
1899 Ga0501072_0000270 3300049588 Bacteria 37630
1900 Ga0501072_0005882 3300049588 Bacteria 9341
1901 Ga0501072_0008909 3300049588 Bacteria 7625
1902 Ga0501072_0020558 3300049588 Bacteria 5116
1903 Ga0501072_0022030 3300049588 Bacteria 4943
1904 Ga0501072_0400957 3300049588 Bacteria 1088
1905 Ga0501073_0005761 3300049589 Bacteria 9262
1906 Ga0501073_0026507 3300049589 Bacteria 4152
1907 Ga0501073_0049763 3300049589 Bacteria 2937
1908 Ga0501073_0195689 3300049589 Bacteria 1398
1909 Ga0501073_0205868 3300049589 Bacteria 1360
1910 Ga0501073_0212647 3300049589 Bacteria 1336
1911 Ga0501073_0504434 3300049589 Bacteria 836
1912 Ga0501073_0576558 3300049589 Bacteria 777
1913 Ga0501073_0978170 3300049589 Bacteria 582
1914 Ga0501074_0000467 3300049590 Bacteria 24425
1915 Ga0501074_0001013 3300049590 Bacteria 18266
1916 Ga0501074_0004839 3300049590 Bacteria 9652
1917 Ga0501074_0006802 3300049590 Bacteria 8257
1918 Ga0501074_0022949 3300049590 Bacteria 4538
1919 Ga0501074_0046101 3300049590 Bacteria 3151
1920 Ga0501074_0065394 3300049590 Bacteria 2617
1921 Ga0501074_0073103 3300049590 Bacteria 2463
1922 Ga0501074_0095789 3300049590 Bacteria 2125
1923 Ga0501074_0620009 3300049590 Bacteria 765
1924 Ga0501075_0000637 3300049591 Bacteria 21435
1925 Ga0501075_0009333 3300049591 Bacteria 6863
1926 Ga0501075_0023189 3300049591 Bacteria 4541
1927 Ga0501076_0001351 3300049592 Bacteria 16400
1928 Ga0501076_0003185 3300049592 Bacteria 11450
1929 Ga0501076_0004713 3300049592 Bacteria 9726
1930 Ga0501076_0100103 3300049592 Bacteria 2335
1931 Ga0501076_0104276 3300049592 Bacteria 2288
1932 Ga0501076_0776127 3300049592 Bacteria 791
1933 Ga0501077_0001343 3300049593 Bacteria 14842
1934 Ga0501077_0001967 3300049593 Bacteria 12418
1935 Ga0501077_0005313 3300049593 Bacteria 7826
1936 Ga0501077_0006715 3300049593 Bacteria 7078
1937 Ga0501077_0031918 3300049593 Bacteria 3351
1938 Ga0501077_0033465 3300049593 Bacteria 3271
1939 Ga0501077_0348454 3300049593 Bacteria 945
1940 Ga0501077_0362636 3300049593 Bacteria 925
1941 Ga0501223_115543 3300049663 Bacteria 563
1942 Ga0501079_0000101 3300049741 Bacteria 43428
1943 Ga0501079_0000116 3300049741 Bacteria 41552
1944 Ga0501079_0004539 3300049741 Bacteria 10297
1945 Ga0501079_0032784 3300049741 Bacteria 3995
1946 Ga0501079_0039279 3300049741 Bacteria 3650
1947 Ga0501079_0116421 3300049741 Bacteria 2077
1948 Ga0501079_0117223 3300049741 Bacteria 2070
1949 Ga0501079_1209836 3300049741 Bacteria 595
1950 Ga0501080_0001308 3300049742 Bacteria 20742
1951 Ga0501080_0005935 3300049742 Bacteria 10946
1952 Ga0501080_0010008 3300049742 Bacteria 8668
1953 Ga0501080_0022122 3300049742 Bacteria 5891
1954 Ga0501080_0023020 3300049742 Bacteria 5778
1955 Ga0501080_0046099 3300049742 Bacteria 4060
1956 Ga0501080_0059335 3300049742 Bacteria 3560
1957 Ga0501080_0078415 3300049742 Bacteria 3072
1958 Ga0501080_0104595 3300049742 Bacteria 2625
1959 Ga0501080_0157590 3300049742 Bacteria 2097
1960 Ga0501081_0006102 3300049743 Bacteria 7812
1961 Ga0501081_0011066 3300049743 Bacteria 5900
1962 Ga0501081_0059195 3300049743 Bacteria 2651
1963 Ga0501081_0800379 3300049743 Bacteria 709
1964 Ga0501081_0871279 3300049743 Bacteria 679
1965 Ga0501083_0017262 3300049744 Bacteria 5032
1966 Ga0501083_0025869 3300049744 Bacteria 4062
1967 Ga0501083_0049351 3300049744 Bacteria 2837
1968 Ga0501083_0080653 3300049744 Bacteria 2157
1969 Ga0501269_050554 3300049766 Bacteria 571
1970 Ga0501035_0001438 3300049822 Bacteria 24416
1971 Ga0501035_0008434 3300049822 Bacteria 9595
1972 Ga0501035_0019377 3300049822 Bacteria 6258
1973 Ga0501035_0022376 3300049822 Bacteria 5804
1974 Ga0501035_0037050 3300049822 Bacteria 4418
1975 Ga0501035_0041418 3300049822 Bacteria 4158
1976 Ga0501035_0077993 3300049822 Bacteria 2927
1977 Ga0501035_0269160 3300049822 Bacteria 1443
1978 Ga0501035_0321346 3300049822 Bacteria 1300
1979 Ga0501035_0480666 3300049822 Bacteria 1024
1980 Ga0501044_0004514 3300049823 Bacteria 15562
1981 Ga0501044_0038471 3300049823 Bacteria 4995
1982 Ga0501044_0040381 3300049823 Bacteria 4862
1983 Ga0501044_0047320 3300049823 Bacteria 4448
1984 Ga0501044_0048427 3300049823 Bacteria 4391
1985 Ga0501044_0101227 3300049823 Bacteria 2899
1986 Ga0501044_0133427 3300049823 Bacteria 2476
1987 Ga0501044_0140994 3300049823 Bacteria 2399
1988 Ga0501044_0203404 3300049823 Bacteria 1938
1989 Ga0501044_0255597 3300049823 Bacteria 1691
1990 Ga0501044_0283851 3300049823 Bacteria 1588
1991 Ga0501044_0605989 3300049823 Bacteria 988
1992 Ga0501044_0824696 3300049823 Bacteria 806
1993 Ga0501044_1211710 3300049823 Bacteria 622
1994 Ga0501045_0001819 3300049824 Bacteria 14408
1995 Ga0501045_0005729 3300049824 Bacteria 8602
1996 Ga0501045_0024980 3300049824 Bacteria 4292
1997 Ga0501045_0111857 3300049824 Bacteria 2025
1998 Ga0501045_0160595 3300049824 Bacteria 1673
1999 Ga0501045_0251326 3300049824 Bacteria 1316
2000 Ga0501045_0346534 3300049824 Bacteria 1105
2001 Ga0501045_0946683 3300049824 Bacteria 632
2002 nmdc:mga03n38_187029_c1 3300050490 Bacteria 1065
2003 nmdc:mga03n38_310903_c1 3300050490 Bacteria 849
2004 nmdc:mga03n38_50941_c1 3300050490 Bacteria 1847
2005 nmdc:mga00v17_119642_c1 3300050491 Bacteria 1676
2006 nmdc:mga00v17_352928_c1 3300050491 Bacteria 956
2007 nmdc:mga00v17_548062_c1 3300050491 Bacteria 748
2008 nmdc:mga0yw44_11283_c1 3300050492 Bacteria 4606
2009 nmdc:mga0yw44_123625_c1 3300050492 Bacteria 1669
2010 nmdc:mga0yw44_175697_c1 3300050492 Bacteria 1408
2011 nmdc:mga0yw44_684704_c1 3300050492 Bacteria 697
2012 nmdc:mga0yw44_818351_c1 3300050492 Bacteria 632
2013 nmdc:mga06z11_15925_c1 3300050494 Bacteria 3371
2014 nmdc:mga06z11_19310_c1 3300050494 Bacteria 3131
2015 nmdc:mga06z11_5215_c1 3300050494 Bacteria 5193
2016 nmdc:mga04h51_465981_c1 3300050495 Bacteria 536
2017 nmdc:mga04h51_51127_c1 3300050495 Bacteria 1387
2018 nmdc:mga04h51_62512_c1 3300050495 Bacteria 1280
2019 nmdc:mga07m45_191974_c1 3300050496 Bacteria 1188
2020 nmdc:mga07m45_87073_c1 3300050496 Bacteria 1787
2021 nmdc:mga05p37_114478_c1 3300050507 Bacteria 3315
2022 nmdc:mga05p37_6462_c1 3300050507 Bacteria 13826
2023 nmdc:mga09592_10546_c1 3300050508 Bacteria 7518
2024 nmdc:mga09592_499059_c1 3300050508 Bacteria 1048
2025 nmdc:mga0qj67_257874_c1 3300050509 Bacteria 1415
2026 nmdc:mga06r32_2732_c1 3300050510 Bacteria 15788
2027 nmdc:mga08y16_12139_c1 3300050511 Bacteria 9054
2028 nmdc:mga08y16_515666_c1 3300050511 Bacteria 1213
2029 nmdc:mga08y16_699681_c1 3300050511 Bacteria 1013
2030 nmdc:mga0n895_111117_c1 3300050512 Bacteria 2757
2031 nmdc:mga0n895_174320_c1 3300050512 Bacteria 2182
2032 nmdc:mga0n895_34608_c1 3300050512 Bacteria 4864
2033 nmdc:mga0n895_904729_c1 3300050512 Bacteria 868
2034 nmdc:mga0rr50_1236835_c1 3300050513 Bacteria 634
2035 nmdc:mga0rr50_143507_c1 3300050513 Bacteria 1923
2036 nmdc:mga0rr50_653046_c1 3300050513 Bacteria 898
2037 nmdc:mga08x19_300406_c1 3300050514 Bacteria 1115
2038 nmdc:mga08x19_608140_c1 3300050514 Bacteria 775
2039 nmdc:mga0a205_159293_c1 3300050515 Bacteria 2155
2040 nmdc:mga0a205_3754_c1 3300050515 Bacteria 13599
2041 nmdc:mga0a205_568603_c1 3300050515 Bacteria 988
2042 Ga0495601_0007727 3300053077 Bacteria 6322
2043 Ga0495601_0071684 3300053077 Bacteria 2212
2044 Ga0495601_0098757 3300053077 Bacteria 1884
2045 Ga0495601_0330064 3300053077 Bacteria 993
2046 Ga0495601_0827590 3300053077 Bacteria 587
2047 Ga0495612_0003458 3300053078 Bacteria 6545
2048 Ga0495612_0007651 3300053078 Bacteria 4413
2049 Ga0495612_0085043 3300053078 Bacteria 1333
2050 Ga0495612_0147651 3300053078 Bacteria 1022
2051 Ga0500610_0035252 3300053079 Bacteria 2565
2052 Ga0500610_0080827 3300053079 Bacteria 1694
2053 Ga0495655_0001784 3300053083 Bacteria 3347
2054 Ga0495655_0012525 3300053083 Bacteria 1731
2055 Ga0495655_0045842 3300053083 Bacteria 1137
2056 Ga0495595_0007432 3300053084 Bacteria 4486
2057 Ga0495595_0009129 3300053084 Bacteria 4096
2058 Ga0495619_0010762 3300053085 Bacteria 5756
2059 Ga0495619_0011748 3300053085 Bacteria 5518
2060 Ga0495619_0030603 3300053085 Bacteria 3484
2061 Ga0495619_0042518 3300053085 Bacteria 2976
2062 Ga0495619_0120465 3300053085 Bacteria 1799
2063 Ga0495619_0452760 3300053085 Bacteria 885
2064 Ga0500578_0006859 3300053086 Bacteria 7556
2065 Ga0500578_0126045 3300053086 Bacteria 1608
2066 Ga0500647_0110949 3300053091 Bacteria 1304
2067 Ga0500583_0038758 3300053092 Bacteria 2148
2068 Ga0500583_0061881 3300053092 Bacteria 1769
2069 Ga0500566_0136760 3300053094 Bacteria 1304
2070 Ga0500566_0515526 3300053094 Bacteria 512
2071 Ga0500640_109154 3300053095 Bacteria 1129
2072 Ga0500641_0135438 3300053096 Bacteria 1063
2073 Ga0500650_0054083 3300053098 Bacteria 1868
2074 Ga0500654_039757 3300053099 Bacteria 2690
2075 Ga0500660_096080 3300053100 Bacteria 1307
2076 Ga0500553_031442 3300053101 Bacteria 2647
2077 Ga0500558_032856 3300053106 Bacteria 2214
2078 Ga0500560_004604 3300053107 Bacteria 2954
2079 Ga0500560_072902 3300053107 Bacteria 1133
2080 Ga0500569_004849 3300053109 Bacteria 2858
2081 Ga0500582_113048 3300053114 Bacteria 945
2082 Ga0500614_012437 3300053123 Bacteria 1857
2083 Ga0500614_038919 3300053123 Bacteria 1200
2084 Ga0500621_062680 3300053126 Bacteria 1502
2085 Ga0500628_000565 3300053129 Bacteria 6750
2086 Ga0500628_242801 3300053129 Bacteria 528
2087 Ga0500652_000224 3300053131 Bacteria 21753
2088 Ga0500652_339740 3300053131 Bacteria 570
2089 Ga0500658_0005753 3300053134 Bacteria 4619
2090 Ga0500559_0239480 3300053136 Bacteria 855
2091 Ga0500561_0000306 3300053137 Bacteria 8416
2092 Ga0500564_116365 3300053138 Bacteria 1169
2093 Ga0500573_0064876 3300053140 Bacteria 2088
2094 Ga0500573_0077749 3300053140 Bacteria 1888
2095 Ga0500573_0174440 3300053140 Bacteria 1160
2096 Ga0500573_0237534 3300053140 Bacteria 947
2097 Ga0500577_0336053 3300053142 Bacteria 660
2098 Ga0500579_073305 3300053143 Bacteria 1962
2099 Ga0500586_049792 3300053145 Bacteria 1443
2100 Ga0500586_170856 3300053145 Bacteria 731
2101 Ga0500590_257113 3300053148 Bacteria 689
2102 Ga0500600_0023373 3300053149 Bacteria 3691
2103 Ga0500600_0061947 3300053149 Bacteria 2082
2104 Ga0500600_0252445 3300053149 Bacteria 789
2105 Ga0500603_052203 3300053150 Bacteria 1122
2106 Ga0500624_004048 3300053157 Bacteria 1921
2107 Ga0500627_0259645 3300053158 Bacteria 767
2108 Ga0500633_0002695 3300053160 Bacteria 3715
2109 Ga0500633_0025173 3300053160 Bacteria 1858
2110 Ga0500634_0001104 3300053161 Bacteria 9996
2111 Ga0500634_0135673 3300053161 Bacteria 1174
2112 Ga0500636_0076304 3300053177 Bacteria 1938
2113 Ga0500656_000394 3300053732 Bacteria 3175
2114 Ga0500587_005298 3300053739 Bacteria 1740
2115 Ga0501084_0003000 3300054114 Bacteria 13672
2116 Ga0501084_0011286 3300054114 Bacteria 7395
2117 Ga0501084_0012452 3300054114 Bacteria 7050
2118 Ga0501084_0054298 3300054114 Bacteria 3351
2119 Ga0501084_0058996 3300054114 Bacteria 3212
2120 Ga0501084_0063427 3300054114 Bacteria 3093
2121 Ga0501084_0135656 3300054114 Bacteria 2072
2122 Ga0501084_0260857 3300054114 Bacteria 1463
2123 Ga0590071_007801 3300059421 Bacteria 2530
2124 Ga0590077_012840 3300059426 Bacteria 1739
2125 Ga0587084_056625 3300059477 Bacteria 708
2126 Ga0587084_071300 3300059477 Bacteria 656
2127 Ga0587093_037219 3300059478 Bacteria 725
2128 Ga0587093_071716 3300059478 Bacteria 583
2129 Ga0587066_135223 3300059490 Bacteria 596
2130 Ga0587066_204050 3300059490 Bacteria 522
2131 Ga0587070_042295 3300059491 Bacteria 877
2132 Ga0587070_077693 3300059491 Bacteria 722
2133 Ga0587070_148926 3300059491 Bacteria 585
2134 Ga0587073_0036373 3300059492 Bacteria 1049
2135 Ga0587077_059551 3300059493 Bacteria 823
2136 Ga0587077_064803 3300059493 Bacteria 801
2137 Ga0587080_123904 3300059503 Bacteria 575
2138 Ga0587082_015224 3300059504 Bacteria 1184
2139 Ga0587082_084420 3300059504 Bacteria 667
2140 Ga0587082_128972 3300059504 Bacteria 579
2141 Ga0587083_0062786 3300059505 Bacteria 842
2142 Ga0587083_0138073 3300059505 Bacteria 646
2143 Ga0587086_060008 3300059507 Bacteria 632
2144 Ga0587086_100781 3300059507 Bacteria 532
2145 Ga0587086_117062 3300059507 Bacteria 506
2146 Ga0587088_029323 3300059508 Bacteria 974
2147 Ga0587088_079551 3300059508 Bacteria 699
2148 Ga0587088_083515 3300059508 Bacteria 688
2149 Ga0587089_030881 3300059509 Bacteria 790
2150 Ga0587089_045871 3300059509 Bacteria 689
2151 Ga0587089_097698 3300059509 Bacteria 529
2152 Ga0587090_061073 3300059510 Bacteria 715
2153 Ga0587090_118392 3300059510 Bacteria 572
2154 Ga0587090_147523 3300059510 Bacteria 531
2155 Ga0587091_033717 3300059511 Bacteria 975
2156 Ga0587091_195216 3300059511 Bacteria 540
2157 Ga0587092_064880 3300059512 Bacteria 691
2158 Ga0587094_039699 3300059513 Bacteria 762
2159 Ga0587094_092102 3300059513 Bacteria 575
2160 Ga0587095_013316 3300059514 Bacteria 725
2161 Ga0587095_040725 3300059514 Bacteria 507
2162 Ga0587098_009513 3300059604 Bacteria 1058
2163 Ga0587098_039147 3300059604 Bacteria 683
2164 Ga0587106_011775 3300059605 Bacteria 1161
2165 Ga0587106_162451 3300059605 Bacteria 504
2166 Ga0587121_12050 3300059606 Bacteria 554
2167 Ga0587129_011998 3300059608 Bacteria 688
2168 Ga0587101_062885 3300059623 Bacteria 667
2169 Ga0587109_040369 3300059624 Bacteria 923
2170 Ga0587115_118606 3300059626 Bacteria 507
2171 Ga0587117_082174 3300059627 Bacteria 589
2172 Ga0587117_105524 3300059627 Bacteria 542
2173 Ga0587122_004238 3300059628 Bacteria 1150
2174 Ga0587122_037222 3300059628 Bacteria 593
2175 Ga0587127_015289 3300059629 Bacteria 640
2176 Ga0587127_026249 3300059629 Bacteria 540
2177 Ga0587128_013352 3300059630 Bacteria 1158
2178 Ga0587128_072532 3300059630 Bacteria 673
2179 Ga0587062_009549 3300059639 Bacteria 1184
2180 Ga0587062_123093 3300059639 Bacteria 526
2181 Ga0587067_075859 3300059640 Bacteria 735
2182 Ga0587068_037729 3300059641 Bacteria 863
2183 Ga0587068_146291 3300059641 Bacteria 531
2184 Ga0587069_045982 3300059642 Bacteria 761
2185 Ga0587069_063928 3300059642 Bacteria 684
2186 Ga0587072_171877 3300059643 Bacteria 536
2187 Ga0587075_093364 3300059644 Bacteria 591
2188 Ga0587075_097888 3300059644 Bacteria 582
2189 Ga0587076_084261 3300059645 Bacteria 684
2190 Ga0587076_106021 3300059645 Bacteria 634
2191 Ga0587076_128661 3300059645 Bacteria 594
2192 Ga0587076_133428 3300059645 Bacteria 587
2193 Ga0587076_146340 3300059645 Bacteria 570
2194 Ga0587078_057959 3300059646 Bacteria 581
2195 Ga0587078_068196 3300059646 Bacteria 551
2196 Ga0587079_060167 3300059647 Bacteria 821
2197 Ga0587102_042439 3300059649 Bacteria 591
2198 Ga0587102_052357 3300059649 Bacteria 553
2199 Ga0587104_015797 3300059650 Bacteria 596
2200 Ga0587107_020713 3300059652 Bacteria 914
2201 Ga0587107_050157 3300059652 Bacteria 705
2202 Ga0587107_125916 3300059652 Bacteria 533
2203 Ga0587114_051133 3300059655 Bacteria 700
2204 Ga0587114_055588 3300059655 Bacteria 681
2205 Ga0587119_012126 3300059658 Bacteria 1003
2206 Ga0587124_026868 3300059660 Bacteria 618
2207 Ga0587071_022032 3300060344 Bacteria 1173
2208 Ga0587111_0061708 3300060346 Bacteria 854
2209 Ga0587111_0117750 3300060346 Bacteria 680
2210 Ga0501082_0003349 3300060353 Bacteria 13998
2211 Ga0501082_0006289 3300060353 Bacteria 10299
2212 Ga0501082_0018558 3300060353 Bacteria 5995
2213 Ga0501082_0021714 3300060353 Bacteria 5533
2214 Ga0501082_0032005 3300060353 Bacteria 4537
2215 Ga0501082_0559591 3300060353 Bacteria 1000
2216 Ga0466962_0001218 3300061719 Bacteria 11836
2217 Ga0466962_0007976 3300061719 Bacteria 5080
2218 Ga0466962_0069553 3300061719 Bacteria 1681
2219 Ga0466962_0550558 3300061719 Bacteria 586
2220 Ga0530510_0000081 3300061734 Bacteria 50329
2221 Ga0530510_0020052 3300061734 Bacteria 4753
2222 Ga0530510_0031999 3300061734 Bacteria 3782
2223 Ga0530510_0250432 3300061734 Bacteria 1320
2224 2508671868 2508501039 Bacteria 9978592
2225 2517761262 2517572101 Bacteria 6884336
2226 2547411593 2547132111 Bacteria 8013147
2227 2585298024 2582581312 Bacteria 7308206
2228 2585305216 2582581313 Bacteria 10042643
2229 2585313016 2582581314 Bacteria 11452267
2230 2616702926 2616644814 Bacteria 11555299
2231 2616903681 2616644941 Bacteria 8510691
2232 2643763442 2643221548 Bacteria 8053412
2233 2643824834 2643221561 Bacteria 4984412
2234 2643900706 2643221578 Bacteria 9213798
2235 2643947580 2643221587 Bacteria 7586415
2236 2644093270 2643221615 Bacteria 5487866
2237 2644266014 2643221647 Bacteria 10741251
2238 2644322881 2643221657 Bacteria 5490246
2239 2644390287 2643221670 Bacteria 6497041
2240 2644405073 2643221673 Bacteria 9196637
2241 2644435272 2643221677 Bacteria 7584031
2242 2644437523 2643221678 Bacteria 9540101
2243 2644463690 2643221682 Bacteria 6743283
2244 2644532615 2643221696 Bacteria 5431823
2245 2644628067 2643221714 Bacteria 9015452
2246 2671836728 2671180195 Bacteria 9757215
2247 2676203290 2675902999 Bacteria 9438463
2248 2686539328 2684623035 Bacteria 8032739
2249 2689961976 2687453737 Bacteria 11203906
2250 2689995916 2687453743 Bacteria 8361025
2251 2710603702 2710264753 Bacteria 5455564
2252 2740168484 2739367898 Bacteria 4367674
2253 2774847866 2773857921 Bacteria 9435764
2254 2774854884 2773857922 Bacteria 9757215
2255 2784589360 2784132148 Bacteria 8627943
2256 2785342239 2784746763 Bacteria 9783172
2257 2785370414 2784746768 Bacteria 10036182
2258 2786671585 2786546132 Bacteria 10419719
2259 2793979198 2791355406 Bacteria 11364898
2260 2808842986 2808606359 Bacteria 9866990
2261 2808921338 2808606375 Bacteria 9466072
2262 2809233020 2808606448 Bacteria 8656184
2263 2811845414 2808606982 Bacteria 7791042
2264 2812357134 2811994879 Bacteria 9313447
2265 2812479776 2811994917 Bacteria 7761064
2266 2819698223 2818991463 Bacteria 7948711
2267 2819741936 2818991472 Bacteria 10089953
2268 2837184624 2837183177 Bacteria 4637169
2269 2852639985 2852635781 Bacteria 8251373
2270 2855390079 2855386786 Bacteria 4752232
2271 2862180131 2862178590 Bacteria 8583590
2272 2862286582 2862281513 Bacteria 9621493
2273 2862294564 2862290372 Bacteria 7471434
2274 2862383697 2862382967 Bacteria 10317375
2275 2862510219 2862507626 Bacteria 9425308
2276 2862578497 2862574272 Bacteria 10567477
2277 2863411924 2863404153 Bacteria 9672205
2278 2867372886 2867369537 Bacteria 6501581
2279 2867432713 2867428634 Bacteria 9590268
2280 2867478289 2867475112 Bacteria 6909112
2281 2873155032 2873151551 Bacteria 8625867
2282 2875394741 2875391855 Bacteria 7600475
2283 2877680192 2877676314 Bacteria 9512378
2284 2895886600 2895880812 Bacteria 11255272
2285 2912718773 2912715099 Bacteria 9460473
2286 2912731123 2912723979 Bacteria 8557534
2287 2912761787 2912757875 Bacteria 7940295
2288 2918504675 2918501144 Bacteria 8668083
2289 2919471411 2919468124 Bacteria 9133025
2290 2935392749 2935390628 Bacteria 7043367
2291 2946049064 2946045630 Bacteria 8527308
2292 2946068743 2946064051 Bacteria 8957905
2293 2946076745 2946072368 Bacteria 8999607
2294 2947228165 2947224130 Bacteria 9938529
2295 2954006208 2954002825 Bacteria 9173742
2296 2954385180 2954380949 Bacteria 10050426
2297 2954677869 2954673503 Bacteria 9685905
2298 2954686287 2954682443 Bacteria 9862841
2299 2954695964 2954691527 Bacteria 10720516
2300 2954711135 2954701450 Bacteria 10834262
2301 2954715371 2954711539 Bacteria 10867210
2302 2954725291 2954721474 Bacteria 10456478
2303 2954736524 2954731030 Bacteria 10243860
2304 2954744225 2954740390 Bacteria 10229294
2305 2954755353 2954749733 Bacteria 10366972
2306 2954763190 2954759201 Bacteria 9358192
2307 2966602426 2966598605 Bacteria 7676064
2308 2984578698 2984576629 Bacteria 4248407
2309 2990068047 2990059506 Bacteria 9321252
2310 2990090966 2990088156 Bacteria 6657676
2311 2990260718 2990256926 Bacteria 4252839
2312 2995471390 2995463766 Bacteria 8577691
2313 2997454359 2997451912 Bacteria 8492419
2314 2997600158 2997600082 Bacteria 9896405
2315 3003006230 3002998708 Bacteria 11715108
2316 3006325245 3006321560 Bacteria 8247479
2317 3006398051 3006393351 Bacteria 6615579
2318 3006486800 3006486233 Bacteria 8157040
2319 3006500301 3006493962 Bacteria 8825450
2320 8002784314 8002784119 Bacteria 9788632
2321 8008566142 8008558824 Bacteria 10610750
2322 8008578109 8008574985 Bacteria 7815457
2323 8023629597 8023623736 Bacteria 8593882
2324 8025479461 8025478263 Bacteria 8209203
2325 8025538206 8025530807 Bacteria 8495698
2326 8033686068 8033684223 Bacteria 6906479
2327 8047897812 8047893842 Bacteria 11723082
2328 8048361059 8048356638 Bacteria 11044339
2329 8048374798 8048369669 Bacteria 11666822
2330 8048383424 8048379754 Bacteria 11877923
2331 8048410125 8048406513 Bacteria 8936924
2332 8054161279 8054160619 Bacteria 7783213
2333 8054614154 8054609563 Bacteria 5170090
2334 8056669145 8056667051 Bacteria 6953971
2335 8056833183 8056829672 Bacteria 9045328
2336 Ga0495653_0030612
2337 JGI24739J22299_10012246
2338 JGI24737J22298_10019105
2339 JGI24737J22298_10192344
2340 JGI24743J22301_10161148
2341 JGI24735J21928_10045879
2342 JGI24735J21928_10046425
2343 JGI24735J21928_10137400
2344 JGI24738J21930_10009224
2345 Ga0006778J45830_1049852
2346 Ga0006759J45824_1020748
2347 JGI25406J46586_10007643
2348 JGI25153J46596_10101033
2349 Ga0006758J48902_1016223
2350 Ga0006777J48905_1018870
2351 rootH1_10072002
2352 rootH2_10022780
2353 rootH2_10108428
2354 rootH1_10031505
2355 JGI25160J50197_1022315
2356 JGI25160J50197_1039249
2357 JGI25407J50210_10018107
2358 JGI25407J50210_10037302
2359 Ga0007427J51700_111976
2360 Ga0006781J51513_1031642
2361 Ga0007409J51694_1021866
2362 Ga0006562J51391_1046289
2363 Ga0007429J51699_1015173
2364 Ga0007429J51699_1022622
2365 JGI25404J52841_10003762
2366 Ga0032354_1015897
2367 Ga0032354_1034030
2368 Ga0032354_1078986
2369 Ga0006780_1022200
2370 Ga0058692_1043303
2371 Ga0058859_10015040
2372 Ga0058859_10049176
2373 Ga0058863_10065640
2374 Ga0058863_11976483
2375 Ga0058861_10164303
2376 Ga0058861_10176188
2377 Ga0058860_10007162
2378 Ga0058860_10028903
2379 Ga0058860_10033454
2380 Ga0058860_12110909
2381 Ga0058860_12209150
2382 Ga0058862_10234175
2383 Ga0058862_12842049
2384 Ga0070658_10057941
2385 Ga0070658_11647721
2386 Ga0070683_100046631
2387 Ga0070683_100072608
2388 Ga0070683_100190097
2389 Ga0070683_100202004
2390 Ga0070683_100396927
2391 Ga0070683_100563340
2392 Ga0070670_100578960
2393 Ga0070670_101515613
2394 Ga0070677_10529932
2395 Ga0068869_100122565
2396 Ga0068869_100504708
2397 Ga0070680_100608737
2398 Ga0070682_100003432
2399 Ga0070682_100117787
2400 Ga0070682_100284955
2401 Ga0070682_100449172
2402 Ga0068868_100178637
2403 Ga0068868_100542817
2404 Ga0070660_100032354
2405 Ga0070660_100064698
2406 Ga0070660_100080638
2407 Ga0070660_100099506
2408 Ga0070687_100026149
2409 Ga0070687_100727747
2410 Ga0070661_100067814
2411 Ga0070661_100224898
2412 Ga0070692_10029363
2413 Ga0070692_10117879
2414 Ga0070668_100005274
2415 Ga0070668_100323680
2416 Ga0070668_101343155
2417 Ga0070668_101377431
2418 Ga0070668_101646027
2419 Ga0070671_100119704
2420 Ga0070671_100385026
2421 Ga0070671_100438242
2422 Ga0070674_100123743
2423 Ga0070674_100160241
2424 Ga0070673_100113602
2425 Ga0070673_100786336
2426 Ga0070673_102039575
2427 Ga0070659_100037012
2428 Ga0070659_100652007
2429 Ga0070703_10006853
2430 Ga0070709_10071599
2431 Ga0070709_10349223
2432 Ga0070714_100307734
2433 Ga0070714_101061487
2434 Ga0070713_100016958
2435 Ga0070710_10049761
2436 Ga0070711_100347531
2437 Ga0070711_101219286
2438 Ga0070705_101717572
2439 Ga0070700_100306162
2440 Ga0070700_100382422
2441 Ga0070708_100029105
2442 Ga0070708_100191338
2443 Ga0070708_100224162
2444 Ga0070663_100180106
2445 Ga0070663_100242842
2446 Ga0070663_100365984
2447 Ga0070663_100612767
2448 Ga0070678_100148612
2449 Ga0070678_100369594
2450 Ga0070662_100033040
2451 Ga0070662_100091588
2452 Ga0070662_100140800
2453 Ga0070681_10041790
2454 Ga0070681_10301002
2455 Ga0068867_100173855
2456 Ga0070685_10121605
2457 Ga0070685_10219788
2458 Ga0070706_100002754
2459 Ga0070706_100003951
2460 Ga0070706_100050706
2461 Ga0070706_100230597
2462 Ga0070707_100001503
2463 Ga0070707_100049280
2464 Ga0070707_100051048
2465 Ga0070707_100098856
2466 Ga0070698_100000665
2467 Ga0070698_100005898
2468 Ga0070698_100022580
2469 Ga0070698_100055599
2470 Ga0070698_100421835
2471 Ga0070698_101679557
2472 Ga0070699_100321904
2473 Ga0070699_100540722
2474 Ga0070679_100019803
2475 Ga0070679_100104922
2476 Ga0070679_100605866
2477 Ga0070684_100001778
2478 Ga0070684_100112941
2479 Ga0070684_100187049
2480 Ga0070684_100266179
2481 Ga0070684_100545705
2482 Ga0070697_100037989
2483 Ga0070697_101046319
2484 Ga0070697_102030489
2485 Ga0068853_100074255
2486 Ga0068853_100194347
2487 Ga0070672_100160740
2488 Ga0070672_100458414
2489 Ga0070686_100238808
2490 Ga0070686_101494516
2491 Ga0070695_100081265
2492 Ga0070693_100077237
2493 Ga0070665_100319651
2494 Ga0070665_100665089
2495 Ga0070665_101998709
2496 Ga0070704_100123917
2497 Ga0070704_100455370
2498 Ga0068855_100164436
2499 Ga0068855_100386020
2500 Ga0068855_100493428
2501 Ga0070664_100045018
2502 Ga0070664_100078162
2503 Ga0068857_100116012
2504 Ga0068857_101740702
2505 Ga0068854_100215677
2506 Ga0068854_100343671
2507 Ga0068854_100512768
2508 Ga0068856_100259101
2509 Ga0068856_100354654
2510 Ga0068856_100470378
2511 Ga0070702_100075402
2512 Ga0070702_100094259
2513 Ga0070702_100333963
2514 Ga0070702_100974962
2515 Ga0068852_100259966
2516 Ga0068852_100342361
2517 Ga0068852_100370667
2518 Ga0068852_100464297
2519 Ga0068852_100798769
2520 Ga0068859_100000094
2521 Ga0068859_100019463
2522 Ga0068859_100760623
2523 Ga0068864_100036467
2524 Ga0068864_100197116
2525 Ga0068864_101881533
2526 Ga0068864_102396079
2527 Ga0068866_10137407
2528 Ga0068861_100019697
2529 Ga0068861_100260870
2530 Ga0068851_10153942
2531 Ga0068870_10235019
2532 Ga0068863_100064425
2533 Ga0068863_100114583
2534 Ga0068863_101454095
2535 Ga0068858_100000036
2536 Ga0068858_100163957
2537 Ga0068858_100674869
2538 Ga0068858_100781556
2539 Ga0068860_100058211
2540 Ga0068862_100000204
2541 Ga0068862_100710697
2542 Ga0081455_10014212
2543 Ga0081455_10030364
2544 Ga0081455_10226962
2545 Ga0081538_10003619
2546 Ga0081538_10011320
2547 Ga0081538_10016741
2548 Ga0081538_10029722
2549 Ga0081538_10047756
2550 Ga0081538_10058335
2551 Ga0081538_10066451
2552 Ga0081538_10283081
2553 Ga0081540_1000345
2554 Ga0081540_1009692
2555 Ga0081539_10002843
2556 Ga0081539_10028367
2557 Ga0081539_10030867
2558 Ga0081539_10208914
2559 Ga0081539_10248166
2560 Ga0081539_10275591
2561 Ga0070717_10045967
2562 Ga0070717_10046247
2563 Ga0070717_10323441
2564 Ga0070717_10611810
2565 Ga0070717_12018596
2566 Ga0075365_10082094
2567 Ga0075365_10132046
2568 Ga0075365_10153204
2569 Ga0075368_10000813
2570 Ga0075368_10070273
2571 Ga0075363_100029174
2572 Ga0075363_100033261
2573 Ga0075364_10202207
2574 Ga0075364_10929506
2575 Ga0075432_10003211
2576 Ga0070715_10016810
2577 Ga0070715_10070916
2578 Ga0070715_10085671
2579 Ga0070716_100016224
2580 Ga0070716_100098885
2581 Ga0070712_100003387
2582 Ga0070712_100165125
2583 Ga0070712_100182981
2584 Ga0070712_100195468
2585 Ga0070712_100395491
2586 Ga0070712_100708388
2587 Ga0075367_10013875
2588 Ga0075367_10044898
2589 Ga0075367_10185529
2590 Ga0097621_100063674
2591 Ga0097621_100316810
2592 Ga0075370_10061581
2593 Ga0068871_100311016
2594 Ga0068871_100467349
2595 Ga0068871_100473318
2596 Ga0068871_101132021
2597 Ga0075428_100775684
2598 Ga0075428_100805111
2599 Ga0075430_100008819
2600 Ga0075431_100014880
2601 Ga0075433_10042000
2602 Ga0075433_10321934
2603 Ga0075434_100018311
2604 Ga0075434_100693747
2605 Ga0075434_102227245
2606 Ga0075429_100062979
2607 Ga0068865_100024075
2608 Ga0068865_100079207
2609 Ga0068865_100153696
2610 Ga0068865_100175399
2611 Ga0068865_100519429
2612 Ga0068865_100605044
2613 Ga0075436_100900585
2614 Ga0097620_100000094
2615 Ga0097620_100019463
2616 Ga0097620_100760619
2617 Ga0099826_10081983
2618 Ga0075435_100013330
2619 Ga0075435_100185638
2620 Ga0075435_100202372
2621 Ga0099794_10153458
2622 Ga0105251_10019082
2623 Ga0105251_10024110
2624 Ga0105244_10149676
2625 Ga0105244_10359605
2626 Ga0105250_10069781
2627 Ga0105250_10342843
2628 Ga0105240_10813749
2629 Ga0105240_11086267
2630 Ga0111539_10021256
2631 Ga0111539_10434718
2632 Ga0111539_11374947
2633 Ga0111539_11439641
2634 Ga0105245_10007936
2635 Ga0105245_10320361
2636 Ga0105245_10452189
2637 Ga0105245_10486061
2638 Ga0105245_10625204
2639 Ga0105245_10631309
2640 Ga0105245_12684384
2641 Ga0105247_10000357
2642 Ga0105247_10091356
2643 Ga0105247_10097314
2644 Ga0105247_10101372
2645 Ga0105247_10150418
2646 Ga0114129_10100488
2647 Ga0114129_10316525
2648 Ga0114129_10785511
2649 Ga0105243_10057425
2650 Ga0105243_10065756
2651 Ga0105243_10078129
2652 Ga0105243_10636481
2653 Ga0105243_11981364
2654 Ga0105241_10718168
2655 Ga0105241_11168071
2656 Ga0105242_10074221
2657 Ga0105242_10085779
2658 Ga0105242_10668381
2659 Ga0105248_10000023
2660 Ga0105248_10066086
2661 Ga0105248_10496689
2662 Ga0105248_11048756
2663 Ga0105248_11188340
2664 Ga0105248_11191354
2665 Ga0105248_12202217
2666 Ga0105237_10249366
2667 Ga0105237_10625757
2668 Ga0105237_10932331
2669 Ga0105237_11864646
2670 Ga0105238_10282092
2671 Ga0105238_10283855
2672 Ga0105238_10629320
2673 Ga0105238_10688085
2674 Ga0105238_11053877
2675 Ga0105238_12939657
2676 Ga0105249_10010731
2677 Ga0105249_10012128
2678 Ga0105249_10039691
2679 Ga0105249_10548091
2680 Ga0105249_11522334
2681 Ga0105249_13263324
2682 Ga0130087_1098055
2683 Ga0130086_1044473
2684 Ga0130086_1084162
2685 Ga0130084_1020040
2686 Ga0130084_1048495
2687 Ga0130084_1110514
2688 Ga0130085_1024196
2689 Ga0130085_1052010
2690 Ga0130085_1129671
2691 Ga0105239_10002802
2692 Ga0105239_10009298
2693 Ga0105239_10321094
2694 Ga0105239_11106345
2695 Ga0105239_11310043
2696 Ga0105239_11514965
2697 Ga0105239_11903700
2698 Ga0105239_12832811
2699 Ga0105239_13111368
2700 Ga0105246_10002099
2701 Ga0105246_10004538
2702 Ga0105246_10098480
2703 Ga0105246_10441200
2704 Ga0105246_10540377
2705 Ga0105246_10555756
2706 Ga0105246_11213661
2707 Ga0105246_11225005
2708 Ga0157344_1004298
2709 Ga0157346_1004194
2710 Ga0157337_1008906
2711 Ga0157322_1021079
2712 Ga0157322_1022184
2713 Ga0157329_1000987
2714 Ga0157335_1010443
2715 Ga0157341_1001858
2716 Ga0157347_1013750
2717 Ga0157313_1011014
2718 Ga0157313_1060641
2719 Ga0157342_1018677
2720 Ga0157315_1003551
2721 Ga0157338_1003156
2722 Ga0154016_137542
2723 Ga0154014_128446
2724 Ga0154012_175242
2725 Ga0157373_10134868
2726 Ga0157373_10611236
2727 Ga0157371_10022428
2728 Ga0157371_10228025
2729 Ga0157371_10318380
2730 Ga0157370_10857027
2731 Ga0157369_10033117
2732 Ga0157369_10144213
2733 Ga0157369_10194793
2734 Ga0157369_10431851
2735 Ga0157369_11119600
2736 Ga0157369_12013227
2737 Ga0157369_12527135
2738 Ga0157374_10298902
2739 Ga0157374_10431547
2740 Ga0157374_11725263
2741 Ga0157374_12433564
2742 Ga0157374_12704085
2743 Ga0157378_10512846
2744 Ga0157378_10577237
2745 Ga0157378_11176869
2746 Ga0163162_10074982
2747 Ga0163162_10174935
2748 Ga0163162_10422012
2749 Ga0163162_10528100
2750 Ga0163162_10707313
2751 Ga0163162_10880805
2752 Ga0163162_11036780
2753 Ga0163162_11105428
2754 Ga0163162_11248765
2755 Ga0163162_11465456
2756 Ga0157372_10007431
2757 Ga0157372_10674551
2758 Ga0157372_10708110
2759 Ga0157372_10735542
2760 Ga0157372_10795537
2761 Ga0157372_11104390
2762 Ga0157375_10023903
2763 Ga0157375_10070571
2764 Ga0157375_10141322
2765 Ga0157375_10143340
2766 Ga0157375_10177777
2767 Ga0157375_10774101
2768 Ga0157375_11189236
2769 Ga0163163_10001744
2770 Ga0163163_10202231
2771 Ga0163163_10324433
2772 Ga0163163_10517480
2773 Ga0163163_10748687
2774 Ga0163163_12323148
2775 Ga0163163_12386739
2776 Ga0157380_10046543
2777 Ga0157380_10130229
2778 Ga0157380_10706118
2779 Ga0182008_10010449
2780 Ga0182008_10068144
2781 Ga0182008_10120977
2782 Ga0182008_10157872
2783 Ga0182008_10513336
2784 Ga0157377_10153939
2785 Ga0157377_10182311
2786 Ga0157379_10000244
2787 Ga0157379_10298909
2788 Ga0157379_10339812
2789 Ga0157379_11446460
2790 Ga0157376_10504131
2791 Ga0157376_10635148
2792 Ga0157376_10913189
2793 Ga0157376_11125065
2794 Ga0157376_11497346
2795 Ga0157376_12770240
2796 Ga0182006_1083626
2797 Ga0182007_10001790
2798 Ga0182005_1044350
2799 Ga0182005_1146324
2800 Ga0183367_1015
2801 Ga0163161_10201301
2802 Ga0163161_10299895
2803 Ga0163161_10414064
2804 Ga0163161_10639507
2805 Ga0163161_12055477
2806 Ga0184602_108449
2807 Ga0184597_117329
2808 Ga0184592_115343
2809 Ga0184594_112558
2810 Ga0184598_143521
2811 Ga0184601_110102
2812 Ga0184601_113589
2813 Ga0184600_107951
2814 Ga0184603_137011
2815 Ga0184603_143072
2816 Ga0197907_10020944
2817 Ga0197907_10330890
2818 Ga0197907_11191419
2819 Ga0206356_10190986
2820 Ga0206356_10961423
2821 Ga0206356_10999422
2822 Ga0206356_11074086
2823 Ga0206349_1348860
2824 Ga0206349_1883902
2825 Ga0206355_1091284
2826 Ga0206351_10065153
2827 Ga0206351_10146335
2828 Ga0206352_10089945
2829 Ga0206352_10201730
2830 Ga0206352_10411800
2831 Ga0206352_10622047
2832 Ga0206350_10023960
2833 Ga0206350_10191192
2834 Ga0206350_10683474
2835 Ga0206350_11029574
2836 Ga0206350_11489402
2837 Ga0206350_11630090
2838 Ga0206354_10543560
2839 Ga0206354_10709520
2840 Ga0206354_11311593
2841 Ga0206353_10288552
2842 Ga0206353_10468191
2843 Ga0206353_11120483
2844 Ga0206353_11270550
2845 Ga0206353_12052037
2846 Ga0213874_10388286
2847 Ga0213876_10446852
2848 Ga0213875_10010893
2849 Ga0213875_10014384
2850 Ga0213875_10021112
2851 Ga0213875_10043268
2852 Ga0213875_10091833
2853 Ga0256744_107144
2854 Ga0256720_106636
2855 Ga0247551_104190
2856 Ga0247550_104409
2857 Ga0224572_1023820
2858 Ga0228598_1052773
2859 Ga0209758_1007513
2860 Ga0207426_1002952
2861 Ga0207426_1023641
2862 Ga0207697_10179633
2863 Ga0207656_10166207
2864 Ga0207696_1079044
2865 Ga0207655_1112249
2866 Ga0207713_1122796
2867 Ga0207713_1143564
2868 Ga0207653_10012809
2869 Ga0207692_10022809
2870 Ga0207642_10018159
2871 Ga0207642_10588149
2872 Ga0207710_10000063
2873 Ga0207710_10053403
2874 Ga0207710_10314609
2875 Ga0207688_10009737
2876 Ga0207688_10123060
2877 Ga0207680_10607719
2878 Ga0207647_10014108
2879 Ga0207647_10037539
2880 Ga0207647_10041665
2881 Ga0207647_10223703
2882 Ga0207647_10225604
2883 Ga0207685_10359099
2884 Ga0207699_10085697
2885 Ga0207699_10144157
2886 Ga0207699_10145888
2887 Ga0207699_10199061
2888 Ga0207645_10210798
2889 Ga0207645_10806729
2890 Ga0207643_10012094
2891 Ga0207643_10360401
2892 Ga0207705_10044132
2893 Ga0207705_10068197
2894 Ga0207684_10000323
2895 Ga0207684_10003999
2896 Ga0207684_10025297
2897 Ga0207684_10026466
2898 Ga0207684_10290158
2899 Ga0207654_10140334
2900 Ga0207654_10996818
2901 Ga0207654_11169214
2902 Ga0207707_10129156
2903 Ga0207707_10255224
2904 Ga0207671_10092256
2905 Ga0207671_10527437
2906 Ga0207693_10136892
2907 Ga0207663_10037969
2908 Ga0207663_10196750
2909 Ga0207663_10271298
2910 Ga0207660_10166316
2911 Ga0207660_10498001
2912 Ga0207662_10010759
2913 Ga0207662_10021726
2914 Ga0207662_10406991
2915 Ga0207657_10359817
2916 Ga0207649_10315744
2917 Ga0207652_10048985
2918 Ga0207652_10245227
2919 Ga0207652_10468835
2920 Ga0207652_10569951
2921 Ga0207646_10000050
2922 Ga0207646_10010964
2923 Ga0207646_10049754
2924 Ga0207646_10080435
2925 Ga0207681_10486294
2926 Ga0207694_10377850
2927 Ga0207694_10522052
2928 Ga0207694_10624516
2929 Ga0207694_10870613
2930 Ga0207694_11852782
2931 Ga0207659_10060860
2932 Ga0207659_11507007
2933 Ga0207687_10028232
2934 Ga0207687_10402100
2935 Ga0207687_10456677
2936 Ga0207687_10701281
2937 Ga0207687_11623537
2938 Ga0207687_11873861
2939 Ga0207700_10009909
2940 Ga0207700_10049581
2941 Ga0207700_10059951
2942 Ga0207700_10282417
2943 Ga0207664_10019743
2944 Ga0207664_10054930
2945 Ga0207664_10111576
2946 Ga0207664_10209663
2947 Ga0207664_10866446
2948 Ga0207644_10879720
2949 Ga0207690_10104502
2950 Ga0207706_10007021
2951 Ga0207706_10030756
2952 Ga0207706_10361206
2953 Ga0207706_11058925
2954 Ga0207686_10700334
2955 Ga0207709_10376918
2956 Ga0207709_10489606
2957 Ga0207670_10563490
2958 Ga0207670_11814002
2959 Ga0207669_10094765
2960 Ga0207669_10280657
2961 Ga0207669_10500645
2962 Ga0207669_10764015
2963 Ga0207704_10017490
2964 Ga0207704_10285045
2965 Ga0207704_10495950
2966 Ga0207704_11124433
2967 Ga0207691_10049713
2968 Ga0207691_10064364
2969 Ga0207691_10093203
2970 Ga0207711_10000262
2971 Ga0207711_10172030
2972 Ga0207711_10218658
2973 Ga0207711_10220819
2974 Ga0207711_10579701
2975 Ga0207711_11430804
2976 Ga0207689_10086579
2977 Ga0207689_10389027
2978 Ga0207661_10006353
2979 Ga0207661_10037782
2980 Ga0207661_10075721
2981 Ga0207661_10161016
2982 Ga0207661_10220843
2983 Ga0207661_10273270
2984 Ga0207661_10793411
2985 Ga0207661_11252526
2986 Ga0207661_11779833
2987 Ga0207679_10028246
2988 Ga0207679_10117036
2989 Ga0207679_10405464
2990 Ga0207679_10631475
2991 Ga0207667_10136334
2992 Ga0207667_10547594
2993 Ga0207651_10465055
2994 Ga0207651_11157811
2995 Ga0207651_11219586
2996 Ga0207712_10003504
2997 Ga0207712_10070104
2998 Ga0207712_10084335
2999 Ga0207712_10339816
3000 Ga0207712_10377343
3001 Ga0207712_10516901
3002 Ga0207668_10241812
3003 Ga0207668_10385891
3004 Ga0207668_10550797
3005 Ga0207668_11055284
3006 Ga0207668_11366594
3007 Ga0207640_10119910
3008 Ga0207640_10597600
3009 Ga0207658_10100738
3010 Ga0207658_10146621
3011 Ga0207677_10534649
3012 Ga0207677_10859690
3013 Ga0207677_12110009
3014 Ga0207703_10000177
3015 Ga0207703_10060180
3016 Ga0207703_10291059
3017 Ga0207703_10435284
3018 Ga0207639_10194589
3019 Ga0207639_10307058
3020 Ga0207639_10526472
3021 Ga0207639_10533025
3022 Ga0207639_10677230
3023 Ga0207639_10812575
3024 Ga0207678_10176582
3025 Ga0207678_10703577
3026 Ga0207708_10394412
3027 Ga0207702_10055808
3028 Ga0207702_10705408
3029 Ga0207702_10968486
3030 Ga0207641_10114337
3031 Ga0207641_10164144
3032 Ga0207648_10757287
3033 Ga0207648_10916306
3034 Ga0207676_10203983
3035 Ga0207676_10875729
3036 Ga0207676_11596193
3037 Ga0207676_11690920
3038 Ga0207674_10007680
3039 Ga0207674_10127860
3040 Ga0207674_10271280
3041 Ga0207674_10679861
3042 Ga0207675_100004621
3043 Ga0207675_100341405
3044 Ga0207683_10018022
3045 Ga0207683_10047963
3046 Ga0207683_10617663
3047 Ga0207683_11168306
3048 Ga0207698_10164039
3049 Ga0207698_10431400
3050 Ga0207698_10595612
3051 Ga0207698_11102703
3052 Ga0209371_1010646
3053 Ga0209371_1048649
3054 Ga0209179_1046444
3055 Ga0209813_10006215
3056 Ga0209813_10046968
3057 Ga0207428_10000746
3058 Ga0207428_11065745
3059 Ga0265358_103167
3060 Ga0268266_10006911
3061 Ga0268266_10471278
3062 Ga0268266_10656186
3063 Ga0268266_10920754
3064 Ga0268266_11023416
3065 Ga0268266_11687320
3066 Ga0268265_10000157
3067 Ga0268265_10705489
3068 Ga0268264_10199983
3069 Ga0268264_10213603
3070 Ga0307517_10005207
3071 Ga0307517_10020973
3072 Ga0307517_10640450
3073 Ga0307515_10002733
3074 Ga0307515_10180880
3075 Ga0307515_10198377
3076 Ga0311004_111916
3077 Ga0311011_118056
3078 Ga0311003_171176
3079 Ga0310981_1001123
3080 Ga0268256_1027239
3081 Ga0268256_1045482
3082 Ga0307511_10009089
3083 Ga0307511_10056074
3084 Ga0307511_10064446
3085 Ga0307512_10000978
3086 Ga0307512_10106890
3087 Ga0307512_10116842
3088 Ga0316176_1020167
3089 Ga0314311_1121511
3090 Ga0316181_1125764
3091 Ga0265762_1031578
3092 Ga0265767_113326
3093 Ga0265766_1025010
3094 Ga0265777_120614
3095 Ga0265769_103274
3096 Ga0265769_111646
3097 Ga0247549_101801
3098 Ga0265773_1013629
3099 Ga0265760_10260592
3100 Ga0265760_10384268
3101 Ga0307513_10004736
3102 Ga0307513_10113346
3103 Ga0307509_10152597
3104 Ga0307509_10358154
3105 Ga0307408_100098861
3106 Ga0307408_100369173
3107 Ga0307408_101808301
3108 Ga0310117_130551
3109 Ga0307508_10003041
3110 Ga0307508_10006924
3111 Ga0307508_10021357
3112 Ga0307508_10031756
3113 Ga0307508_10032362
3114 Ga0307514_10004614
3115 Ga0307514_10065598
3116 Ga0307514_10079606
3117 Ga0307514_10150704
3118 Ga0307514_10193945
3119 Ga0307514_10470290
3120 Ga0316579_10000328
3121 Ga0307516_10006026
3122 Ga0307516_10042521
3123 Ga0307516_10045929
3124 Ga0307516_10174417
3125 Ga0307516_10270151
3126 Ga0307405_10070066
3127 Ga0307405_10130872
3128 Ga0307405_10238915
3129 Ga0307405_10353959
3130 Ga0307405_11153043
3131 Ga0247548_109156
3132 Ga0307413_10208780
3133 Ga0307413_10318519
3134 Ga0307413_10959959
3135 Ga0307413_11079886
3136 Ga0307413_11144871
3137 Ga0307413_12099579
3138 Ga0307518_10271667
3139 Ga0307518_10496883
3140 Ga0307410_10307516
3141 Ga0307410_10313855
3142 Ga0307410_10349428
3143 Ga0307410_10741692
3144 Ga0307410_10746639
3145 Ga0307410_10948187
3146 Ga0307406_10002457
3147 Ga0307406_10236338
3148 Ga0307406_10344747
3149 Ga0307406_10366146
3150 Ga0307406_10931124
3151 Ga0307407_10004890
3152 Ga0307407_10118915
3153 Ga0307407_10186109
3154 Ga0307407_10188999
3155 Ga0307407_10264749
3156 Ga0307407_11673987
3157 Ga0307412_12164622
3158 Ga0307412_12179546
3159 Ga0307409_100086978
3160 Ga0307409_100117795
3161 Ga0307409_100125730
3162 Ga0307409_100175929
3163 Ga0307409_100185185
3164 Ga0307409_100219696
3165 Ga0307409_100250976
3166 Ga0307409_100536155
3167 Ga0307409_101069328
3168 Ga0307409_101496822
3169 Ga0307409_101504080
3170 Ga0307416_100013543
3171 Ga0307416_100084802
3172 Ga0307416_100132425
3173 Ga0307416_100172457
3174 Ga0307416_100185041
3175 Ga0307416_100268549
3176 Ga0307416_100513117
3177 Ga0307416_100739515
3178 Ga0307416_103849482
3179 Ga0307414_10053800
3180 Ga0307414_10518567
3181 Ga0307414_10614309
3182 Ga0307414_10622902
3183 Ga0307414_10784003
3184 Ga0307411_10399432
3185 Ga0316053_110460
3186 Ga0316053_116349
3187 Ga0307415_100205662
3188 Ga0307415_100300998
3189 Ga0307415_100341059
3190 Ga0307415_100438127
3191 Ga0307415_102440217
3192 Ga0307507_10202106
3193 Ga0307510_10076999
3194 Ga0307510_10168105
3195 Ga0307510_10209614
3196 Ga0373930_0015524
3197 Ga0373948_0001671
3198 Ga0373958_0009242
3199 Ga0373958_0132026
3200 Ga0373926_0004416
3201 Ga0373926_0010520
3202 Ga0373926_0241544
3203 Ga0373929_0021923
3204 Ga0373934_0004079
3205 Ga0373934_0004937
3206 Ga0373934_0016920
3207 Ga0373940_0069054
3208 Ga0373944_0012091
3209 Ga0373944_0016653
3210 Ga0373949_0021772
3211 Ga0373951_0084344
3212 Ga0373952_0043549
3213 Ga0373923_0000472
3214 Ga0373932_0013806
3215 Ga0373936_0001921
3216 Ga0373936_0001930
3217 Ga0373936_0006056
3218 Ga0373936_0101916
3219 Ga0373939_0219320
3220 Ga0373945_0000693
3221 Ga0373945_0003551
3222 Ga0373953_0009915
3223 Ga0373953_0033274
3224 Ga0373953_0124333
3225 Ga0373954_0011407
3226 Ga0373954_0036506
3227 Ga0373956_0199385
3228 Ga0373956_0385432
3229 Ga0373957_0003369
3230 Ga0373957_0005890
3231 Ga0373957_0036898
3232 Ga0373957_0160119
3233 Ga0373960_0025527
3234 Ga0373943_0000869
3235 Ga0373943_0222164
3236 Ga0373946_0002754
3237 Ga0373946_0005561
3238 Ga0373946_0067320
3239 Ga0373946_0223373
3240 Ga0373955_0013636
3241 Ga0373955_0025416
3242 Ga0373955_0032656
3243 Ga0373955_0047998
3244 Ga0373961_0145265
3245 Ga0373962_0041763
3246 Ga0373924_0015260
3247 Ga0373924_0036299
3248 Ga0373924_0216213
3249 Ga0373931_0912112
3250 Ga0373935_0002772
3251 Ga0373935_0019853
3252 Ga0373935_0246278
3253 Ga0373927_0005785
3254 Ga0373927_0011649
3255 Ga0373927_0182495
3256 Ga0373933_0069093
3257 Ga0373933_0160858
3258 Ga0373933_0200322
3259 Ga0373947_0002525
3260 Ga0373947_0068140
3261 Ga0373937_0035993
3262 Ga0373937_0044269
3263 Ga0373937_0065143
3264 Ga0265778_025943
3265 Ga0373925_0005148
3266 Ga0373925_0100426
3267 Ga0395899_0101344
3268 Ga0395899_0195572
3269 Ga0395899_0481338
3270 Ga0395900_0486195
3271 Ga0395900_0556238
3272 Ga0395898_0003814
3273 Ga0395898_0004885
3274 Ga0395898_0232005
3275 Ga0395898_0280786
3276 Ga0395898_0316753
3277 Ga0395898_0386549
3278 Ga0395898_0576635
3279 Ga0395905_0138778
3280 Ga0395905_0508205
3281 Ga0395905_1108171
3282 Ga0395905_1151314
3283 Ga0436364_0009738
3284 Ga0436364_0136351
3285 Ga0436364_0304869
3286 Ga0436364_1303572
3287 Ga0436364_1308949
3288 Ga0436364_1353616
3289 Ga0395901_0014451
3290 Ga0395901_0044449
3291 Ga0395901_0221123
3292 Ga0395901_0299275
3293 Ga0395901_1162619
3294 Ga0242420_076493
3295 Ga0436365_0611199
3296 Ga0436365_1289663
3297 Ga0436365_1705129
3298 Ga0436360_0110487
3299 Ga0436361_0211931
3300 Ga0436361_0675330
3301 Ga0436361_0858626
3302 Ga0436363_0086959
3303 Ga0436363_0244953
3304 Ga0436363_0313187
3305 Ga0436363_0879846
3306 Ga0436363_0992871
3307 Ga0436362_0069517
3308 Ga0436362_0387930
3309 Ga0436362_0934528
3310 Ga0436362_1211610
3311 Ga0439436_0000928
3312 Ga0439436_0018153
3313 Ga0439439_0002357
3314 Ga0439439_0002711
3315 Ga0439465_0122188
3316 Ga0451788_01963
3317 Ga0451789_1198906
3318 Ga0451789_1288683
3319 Ga0451794_30334
3320 Ga0451791_0817771
3321 Ga0451791_0998527
3322 Ga0451791_1596303
3323 Ga0451793_0272600
3324 Ga0451797_0242638
3325 Ga0451797_0372023
3326 Ga0451802_0005448
3327 Ga0451802_1713972
3328 Ga0451805_034483
3329 Ga0451807_1271743
3330 Ga0451807_1844026
3331 Ga0451837_0720473
3332 Ga0451839_0156761
3333 Ga0451839_0530653
3334 Ga0451841_0024364
3335 Ga0451841_0930514
3336 Ga0451845_0978105
3337 Ga0451846_26990
3338 Ga0451849_0428000
3339 Ga0451849_0889599
3340 Ga0451851_1130574
3341 Ga0451851_1369277
3342 Ga0451843_1183826
3343 Ga0451853_2683550
3344 Ga0451853_3445873
3345 Ga0451853_3531906
3346 Ga0452271_73204
3347 Ga0439431_0160109
3348 Ga0439433_0003361
3349 Ga0439433_0021509
3350 Ga0439433_0118153
3351 Ga0439442_009151
3352 Ga0439445_0277711
3353 Ga0439448_0001957
3354 Ga0439448_0008132
3355 Ga0439448_0063851
3356 Ga0439448_0222206
3357 Ga0439432_026577
3358 Ga0439449_0001280
3359 Ga0439449_0018673
3360 Ga0439449_0024590
3361 Ga0439449_0086552
3362 Ga0439450_017797
3363 Ga0439454_000513
3364 Ga0439454_037620
3365 Ga0439454_096559
3366 Ga0439455_0001760
3367 Ga0439455_0049166
3368 Ga0439457_001493
3369 Ga0439457_001678
3370 Ga0439463_034875
3371 Ga0439463_109687
3372 Ga0439463_121685
3373 Ga0439463_174448
3374 Ga0450920_022188
3375 Ga0450920_132262
3376 Ga0450888_011212
3377 Ga0450897_034417
3378 Ga0450894_000082
3379 Ga0450895_002600
3380 Ga0450898_001847
3381 Ga0450899_001163
3382 Ga0450900_002001
3383 Ga0450900_085106
3384 Ga0450903_000408
3385 Ga0450903_025346
3386 Ga0450904_023073
3387 Ga0450905_001111
3388 Ga0450905_067121
3389 Ga0450889_049024
3390 Ga0450906_005337
3391 Ga0450906_041222
3392 Ga0450907_014293
3393 Ga0450910_023603
3394 Ga0450910_040113
3395 Ga0439458_0000894
3396 Ga0439458_0135142
3397 Ga0450908_000754
3398 Ga0450909_078172
3399 Ga0439435_0010445
3400 Ga0439444_0041891
3401 Ga0439459_0059541
3402 Ga0439459_0172004
3403 Ga0439464_0318780
3404 Ga0439460_0116379
3405 Ga0450916_023589
3406 Ga0450893_0128390
3407 Ga0439440_0008474
3408 Ga0466969_0002289
3409 Ga0466969_0018579
3410 Ga0466969_0029433
3411 Ga0466969_0041253
3412 Ga0466972_0079512
3413 Ga0466965_0007538
3414 Ga0466965_0014029
3415 Ga0466965_0038532
3416 Ga0466965_0247725
3417 Ga0466965_0416359
3418 Ga0466966_0026669
3419 Ga0466966_0032011
3420 Ga0466966_0082062
3421 Ga0466966_0151591
3422 Ga0466966_0497092
3423 Ga0466961_0004342
3424 Ga0466961_0010303
3425 Ga0466961_0029559
3426 Ga0466961_0046293
3427 Ga0466961_0076857
3428 Ga0466961_0130585
3429 Ga0466961_0229629
3430 Ga0466961_0278371
3431 Ga0466961_0355647
3432 Ga0466961_0476154
3433 Ga0466961_0527097
3434 Ga0466963_0004564
3435 Ga0466963_0004744
3436 Ga0466963_0053926
3437 Ga0466963_0054762
3438 Ga0466963_0129790
3439 Ga0466963_0149257
3440 Ga0466963_0172532
3441 Ga0466963_0203279
3442 Ga0466963_0275343
3443 Ga0466963_0299986
3444 Ga0466963_0348773
3445 Ga0466963_1284936
3446 Ga0466964_0006896
3447 Ga0466964_0007424
3448 Ga0466964_0314268
3449 Ga0466964_0754552
3450 Ga0466971_0002170
3451 Ga0466971_0070749
3452 Ga0466971_0115327
3453 Ga0466971_0178830
3454 Ga0466971_0247718
3455 Ga0466968_0049997
3456 Ga0466968_0130633
3457 Ga0466968_0166062
3458 Ga0466970_0003663
3459 Ga0466970_0005692
3460 Ga0466970_0020231
3461 Ga0466970_0099930
3462 Ga0466970_0104529
3463 Ga0466970_0195015
3464 Ga0466970_0249677
3465 Ga0466970_0378347
3466 Ga0466957_0000092
3467 Ga0466957_0010996
3468 Ga0466957_0019419
3469 Ga0466957_0245730
3470 Ga0466957_1365479
3471 Ga0466960_0017520
3472 Ga0466960_0033394
3473 Ga0466960_0087602
3474 Ga0466960_0104006
3475 Ga0466960_0422329
3476 Ga0466960_0580970
3477 Ga0466959_0023604
3478 Ga0466959_0040116
3479 Ga0466959_0071128
3480 Ga0466959_0071597
3481 Ga0466959_0165319
3482 Ga0466959_0190702
3483 Ga0466959_0821559
3484 Ga0451576_0046672
3485 Ga0466958_0010114
3486 Ga0466958_0256331
3487 Ga0466958_0393430
3488 Ga0466958_0860448
3489 Ga0466967_0018221
3490 Ga0466967_0064396
3491 Ga0466967_0093693
3492 Ga0466967_0123331
3493 Ga0466967_0239113
3494 Ga0466967_0253272
3495 Ga0466967_0268287
3496 Ga0466967_0368551
3497 Ga0466967_0375305
3498 Ga0466967_0793549
3499 Ga0466967_0866240
3500 Ga0466967_0895234
3501 Ga0466967_1031217
3502 Ga0466967_1471241
3503 Ga0466967_1493603
3504 Ga0466967_1594002
3505 Ga0466967_1800516
3506 Ga0466967_2154901
3507 Ga0466967_2284396
3508 Ga0495617_014510
3509 Ga0495617_165754
3510 Ga0495617_206518
3511 Ga0495627_020039
3512 Ga0495627_146848
3513 Ga0495592_0005557
3514 Ga0495592_0018798
3515 Ga0495592_0030916
3516 Ga0495592_0061761
3517 Ga0495592_0086491
3518 Ga0495592_0104331
3519 Ga0495603_0006510
3520 Ga0495603_0085584
3521 Ga0495603_0118056
3522 Ga0495603_0205771
3523 Ga0495603_0362164
3524 Ga0495629_0001307
3525 Ga0495629_0007156
3526 Ga0495629_0007564
3527 Ga0495629_0026501
3528 Ga0495629_0048183
3529 Ga0495629_0093663
3530 Ga0495629_0111863
3531 Ga0495629_0254193
3532 Ga0495629_0749212
3533 Ga0495638_0043781
3534 Ga0495638_0056602
3535 Ga0495638_0138403
3536 Ga0495638_0154209
3537 Ga0495641_0003608
3538 Ga0495641_0118217
3539 Ga0495641_0185141
3540 Ga0495651_0001137
3541 Ga0495651_0004063
3542 Ga0495651_0004096
3543 Ga0495651_0015483
3544 Ga0495651_0046184
3545 Ga0495651_0163331
3546 Ga0495653_0004863
3547 Ga0495653_0029402
3548 Ga0495653_0038966
3549 Ga0495653_0042270
3550 Ga0495653_0071907
3551 Ga0495653_0223937
3552 Ga0495653_0329739
3553 Ga0495653_0391850
3554 Ga0495580_0057637
3555 Ga0495580_0183058
3556 Ga0495582_0005652
3557 Ga0495582_0040378
3558 Ga0495582_0099402
3559 Ga0495582_0104365
3560 Ga0495582_0161218
3561 Ga0495582_0236395
3562 Ga0495582_0556672
3563 Ga0495605_0027760
3564 Ga0495639_0012462
3565 Ga0495639_0031522
3566 Ga0495639_0193208
3567 Ga0495639_0588160
3568 Ga0495662_0000585
3569 Ga0495662_0000600
3570 Ga0495662_0012967
3571 Ga0495662_0027110
3572 Ga0495662_0053026
3573 Ga0495662_0080275
3574 Ga0495662_0159693
3575 Ga0495664_0003849
3576 Ga0495664_0012427
3577 Ga0495664_0017674
3578 Ga0495664_0017854
3579 Ga0495664_0022249
3580 Ga0495664_0029664
3581 Ga0495664_0105905
3582 Ga0495584_0125282
3583 Ga0495585_0070321
3584 Ga0495585_0075451
3585 Ga0495585_0075605
3586 Ga0495585_0258624
3587 Ga0495585_0259622
3588 Ga0495585_0454749
3589 Ga0495594_0002440
3590 Ga0495594_0005436
3591 Ga0495594_0057416
3592 Ga0495594_0091639
3593 Ga0495594_0204491
3594 Ga0495594_0227954
3595 Ga0495594_0426196
3596 Ga0495596_0018896
3597 Ga0495596_0057813
3598 Ga0495596_0177004
3599 Ga0495607_0048872
3600 Ga0495607_0051739
3601 Ga0495607_0072728
3602 Ga0495583_0061795
3603 Ga0495606_0006375
3604 Ga0495608_0000457
3605 Ga0495608_0019897
3606 Ga0495608_0035781
3607 Ga0495608_0039886
3608 Ga0495608_0527612
3609 Ga0495610_0063004
3610 Ga0495616_0003801
3611 Ga0495616_0357371
3612 Ga0495618_0007498
3613 Ga0495618_0019010
3614 Ga0495618_0025441
3615 Ga0495618_0079095
3616 Ga0495618_0127174
3617 Ga0495620_0054153
3618 Ga0495620_0165499
3619 Ga0495620_0169227
3620 Ga0495628_0027669
3621 Ga0495628_0042985
3622 Ga0495628_0048987
3623 Ga0495628_0070625
3624 Ga0495628_0084215
3625 Ga0495628_0498540
3626 Ga0495630_0041563
3627 Ga0495630_0058292
3628 Ga0495630_0062191
3629 Ga0495630_0222869
3630 Ga0495630_0344043
3631 Ga0495630_0631393
3632 Ga0495631_0004163
3633 Ga0495632_0025649
3634 Ga0495632_0134282
3635 Ga0495632_0303866
3636 Ga0495637_0027376
3637 Ga0495637_0037354
3638 Ga0495643_0005977
3639 Ga0495643_0008022
3640 Ga0495644_0023028
3641 Ga0495644_0041104
3642 Ga0495648_0068206
3643 Ga0495663_0009942
3644 Ga0495666_0000906
3645 Ga0495666_0080579
3646 Ga0495666_0093330
3647 Ga0495666_0112439
3648 Ga0495666_0183954
3649 Ga0495666_0280107
3650 Ga0495642_0055136
3651 Ga0495642_0084633
3652 Ga0495652_0010842
3653 Ga0495652_0091587
3654 Ga0495652_0093017
3655 Ga0495652_0103996
3656 Ga0495652_0107955
3657 Ga0495652_0138834
3658 Ga0495652_0240179
3659 Ga0495652_0306836
3660 Ga0495652_0981747
3661 Ga0495654_0007370
3662 Ga0495665_0004964
3663 Ga0495665_0005298
3664 Ga0495665_0005836
3665 Ga0495665_0005892
3666 Ga0495640_0003461
3667 Ga0495640_0006110
3668 Ga0495640_0012238
3669 Ga0495640_0023619
3670 Ga0495640_0036241
3671 Ga0495640_0105248
3672 Ga0495640_0240139
3673 Ga0495640_0683267
3674 Ga0495586_0010989
3675 Ga0495586_0031312
3676 Ga0495586_0141080
3677 Ga0495586_0323491
3678 Ga0495586_0425138
3679 Ga0495587_0003258
3680 Ga0495587_0013451
3681 Ga0495587_0013762
3682 Ga0495587_0061468
3683 Ga0495587_0143557
3684 Ga0495587_0376824
3685 Ga0495598_0021468
3686 Ga0495609_0023685
3687 Ga0495609_0044610
3688 Ga0495609_0097363
3689 Ga0495609_0130440
3690 Ga0495597_0075657
3691 Ga0495597_0162614
3692 Ga0495645_0006394
3693 Ga0495645_0059565
3694 Ga0495645_0146946
3695 Ga0495645_0319987
3696 Ga0495645_0389810
3697 Ga0495622_0015255
3698 Ga0495622_0019042
3699 Ga0495622_0045225
3700 Ga0495622_0257484
3701 Ga0495633_0005358
3702 Ga0495633_0030269
3703 Ga0495667_0005090
3704 Ga0495667_0009929
3705 Ga0495667_0029960
3706 Ga0495667_0072945
3707 Ga0495667_0140948
3708 Ga0495667_0230183
3709 Ga0495667_0242635
3710 Ga0495667_0405590
3711 Ga0495667_0593328
3712 Ga0495656_0072026
3713 Ga0495656_0233741
3714 Ga0495656_0234142
3715 Ga0495668_0286789
3716 Ga0495634_0000626
3717 Ga0495634_0004108
3718 Ga0495634_0020442
3719 Ga0495634_0023454
3720 Ga0495634_0028120
3721 Ga0495634_0131367
3722 Ga0495634_0136447
3723 Ga0495634_0156768
3724 Ga0495634_0183060
3725 Ga0495634_0545153
3726 Ga0495611_0017753
3727 Ga0495611_0022394
3728 Ga0495611_0048988
3729 Ga0495611_0167329
3730 Ga0495611_0292772
3731 Ga0495625_0011293
3732 Ga0495625_0036984
3733 Ga0495635_0004539
3734 Ga0495635_0013510
3735 Ga0495635_0042090
3736 Ga0495635_0049734
3737 Ga0495635_0057761
3738 Ga0495635_0060270
3739 Ga0495635_0116887
3740 Ga0495635_0182623
3741 Ga0495635_0558659
3742 Ga0495661_0039646
3743 Ga0495661_0046389
3744 Ga0495661_0118639
3745 Ga0495588_0022151
3746 Ga0495588_0068342
3747 Ga0495588_0091973
3748 Ga0495588_0125782
3749 Ga0495657_0002383
3750 Ga0495657_0007140
3751 Ga0495657_0022451
3752 Ga0495657_0040887
3753 Ga0495657_0058343
3754 Ga0495657_0120993
3755 Ga0495657_0211605
3756 Ga0495657_0725320
3757 Ga0495599_0030374
3758 Ga0495599_0081661
3759 Ga0495599_0244800
3760 Ga0495599_0282347
3761 Ga0495599_0442633
3762 Ga0495623_0009174
3763 Ga0495623_0085990
3764 Ga0495623_0155803
3765 Ga0495623_0234736
3766 Ga0495623_0264130
3767 Ga0495646_0001371
3768 Ga0495646_0011902
3769 Ga0495646_0025764
3770 Ga0495646_0115853
3771 Ga0495646_0255970
3772 Ga0495646_0281571
3773 Ga0495646_0570288
3774 Ga0495647_0020907
3775 Ga0495658_0005567
3776 Ga0495658_0069363
3777 Ga0495658_0163759
3778 Ga0495658_0252413
3779 Ga0495658_0514031
3780 Ga0495613_0000704
3781 Ga0495613_0005089
3782 Ga0495613_0005645
3783 Ga0495613_0010257
3784 Ga0495613_0018023
3785 Ga0495613_0034477
3786 Ga0495613_0037380
3787 Ga0495613_0093191
3788 Ga0495613_0388726
3789 Ga0495613_0517385
3790 Ga0495613_0746430
3791 Ga0495624_0007123
3792 Ga0495624_0007746
3793 Ga0495624_0011024
3794 Ga0495624_0028664
3795 Ga0495624_0084490
3796 Ga0495624_0131734
3797 Ga0495670_0039461
3798 Ga0495670_0115907
3799 Ga0495670_0260622
3800 Ga0495670_0406880
3801 Ga0495670_0768335
3802 Ga0495671_0008610
3803 Ga0495671_0090667
3804 Ga0495649_0031629
3805 Ga0495649_0075816
3806 Ga0495589_0011786
3807 Ga0495589_0105099
3808 Ga0495589_0152336
3809 Ga0495589_0174702
3810 Ga0495589_0228315
3811 Ga0495589_0321088
3812 Ga0495600_0004210
3813 Ga0495600_0006730
3814 Ga0495600_0014374
3815 Ga0495600_0114315
3816 Ga0495600_0163115
3817 Ga0495600_0224615
3818 Ga0495600_0237698
3819 Ga0495600_0246758
3820 Ga0495660_0034851
3821 Ga0495660_0063398
3822 Ga0495581_0002245
3823 Ga0495581_0004730
3824 Ga0495581_0037892
3825 Ga0495581_0045158
3826 Ga0495581_0046927
3827 Ga0495581_0056765
3828 Ga0495581_0080075
3829 Ga0495581_0092440
3830 Ga0495581_0102572
3831 Ga0495581_0179610
3832 Ga0495581_0333787
3833 Ga0495604_0000590
3834 Ga0495604_0012749
3835 Ga0495604_0024988
3836 Ga0495604_0035517
3837 Ga0495604_0041000
3838 Ga0495604_0059394
3839 Ga0495604_0213397
3840 Ga0495604_0508706
3841 Ga0495636_0008517
3842 Ga0495636_0019828
3843 Ga0495636_0020521
3844 Ga0495636_0043369
3845 Ga0495636_0099816
3846 Ga0495636_0262880
3847 Ga0495674_0014793
3848 Ga0495674_0020722
3849 Ga0495674_0026819
3850 Ga0495674_0147512
3851 Ga0495674_0453210
3852 Ga0495674_0554436
3853 Ga0495672_0098197
3854 Ga0495676_0014737
3855 Ga0495676_0023696
3856 Ga0495676_0031255
3857 Ga0495676_0068779
3858 Ga0495676_0070119
3859 Ga0495676_0072120
3860 Ga0495676_0120682
3861 Ga0495676_0165295
3862 Ga0495676_0347052
3863 Ga0495676_0494845
3864 Ga0495680_0003256
3865 Ga0495680_0011499
3866 Ga0495680_0012358
3867 Ga0495680_0044700
3868 Ga0495680_0047383
3869 Ga0495680_0061680
3870 Ga0495680_0142478
3871 Ga0495683_0025758
3872 Ga0495683_0033477
3873 Ga0495683_0352302
3874 Ga0495687_001001
3875 Ga0495687_001560
3876 Ga0495687_016118
3877 Ga0495675_0018440
3878 Ga0495675_0029863
3879 Ga0495675_0042833
3880 Ga0495675_0066288
3881 Ga0495675_0120467
3882 Ga0495675_0139361
3883 Ga0495675_0218783
3884 Ga0495675_0224849
3885 Ga0495675_0425703
3886 Ga0495677_0023235
3887 Ga0495677_0029557
3888 Ga0495677_0036035
3889 Ga0495679_056845
3890 Ga0495679_093091
3891 Ga0495685_000403
3892 Ga0495685_004718
3893 Ga0495685_019035
3894 Ga0495685_022874
3895 Ga0495685_114301
3896 Ga0495685_292351
3897 Ga0495681_0002670
3898 Ga0495681_0003065
3899 Ga0495681_0070949
3900 Ga0495684_0004164
3901 Ga0495684_0004873
3902 Ga0495684_0028859
3903 Ga0495684_0030673
3904 Ga0495684_0064631
3905 Ga0495684_0107181
3906 Ga0495684_0147989
3907 Ga0495686_0005934
3908 Ga0495686_0038034
3909 Ga0495686_0048999
3910 Ga0495593_0003014
3911 Ga0495593_0012250
3912 Ga0495593_0020518
3913 Ga0495593_0061868
3914 Ga0495593_0134453
3915 Ga0495593_0164734
3916 Ga0495593_0182618
3917 Ga0495593_0350494
3918 Ga0495602_0030856
3919 Ga0495602_0063495
3920 Ga0495602_0083248
3921 Ga0495602_0129994
3922 Ga0495602_0150723
3923 Ga0495602_0410626
3924 Ga0495602_0452118
3925 Ga0495602_1011200
3926 Ga0495614_0003507
3927 Ga0495614_0005517
3928 Ga0495614_0192948
3929 Ga0495614_0261666
3930 Ga0495615_0244012
3931 Ga0495626_0006925
3932 Ga0496100_0041269
3933 Ga0496100_0475212
3934 Ga0496100_0607451
3935 Ga0496101_0021655
3936 Ga0496101_0420429
3937 Ga0496101_0476444
3938 Ga0496102_0005198
3939 Ga0496102_0008637
3940 Ga0496102_0274201
3941 Ga0496102_0357818
3942 Ga0496102_0445174
3943 Ga0496102_1417763
3944 Ga0496103_0011644
3945 Ga0496103_0053998
3946 Ga0496103_0372240
3947 Ga0496104_0061932
3948 Ga0496104_0087405
3949 Ga0496104_0188230
3950 Ga0496105_0029690
3951 Ga0496105_0106953
3952 Ga0496105_0119990
3953 Ga0496105_0146114
3954 Ga0496105_0431586
3955 Ga0496105_0647516
3956 Ga0496106_0008319
3957 Ga0496106_0029464
3958 Ga0496106_0167415
3959 Ga0496106_0562035
3960 Ga0496106_0569376
3961 Ga0496106_0835702
3962 Ga0496106_1166206
3963 Ga0496107_0019893
3964 Ga0496107_0069211
3965 Ga0496107_0154792
3966 Ga0496107_0606519
3967 Ga0496107_0820445
3968 Ga0496108_0019165
3969 Ga0496108_0024157
3970 Ga0496108_0029657
3971 Ga0496108_0089356
3972 Ga0496108_0107297
3973 Ga0496108_0707495
3974 Ga0496108_1223311
3975 Ga0496108_1270374
3976 Ga0496109_0006258
3977 Ga0496109_0015250
3978 Ga0496109_0020477
3979 Ga0496109_0035248
3980 Ga0496109_0044001
3981 Ga0496109_0139412
3982 Ga0496109_0230614
3983 Ga0496109_0230971
3984 Ga0496109_0387387
3985 Ga0496109_0480538
3986 Ga0496109_0486350
3987 Ga0496109_0696529
3988 Ga0496110_0019268
3989 Ga0496110_0036101
3990 Ga0496110_0062954
3991 Ga0496110_0686512
3992 Ga0496110_1226679
3993 Ga0496110_1643964
3994 Ga0496111_0016124
3995 Ga0496111_0125687
3996 Ga0496111_0148683
3997 Ga0496111_0242637
3998 Ga0496111_0256985
3999 Ga0496111_0849291
4000 Ga0496112_0189334
4001 Ga0496112_0518419
4002 Ga0496112_1036803
4003 Ga0496112_1241449
4004 Ga0496113_0061466
4005 Ga0496113_0068519
4006 Ga0496113_0132351
4007 Ga0496113_0143982
4008 Ga0496113_0798236
4009 Ga0496113_1150326
4010 Ga0496113_1594223
4011 Ga0496114_0002916
4012 Ga0496114_0083131
4013 Ga0496114_0308065
4014 Ga0496114_0391521
4015 Ga0496114_0593570
4016 Ga0496114_0624165
4017 Ga0496114_0720898
4018 Ga0496114_1081728
4019 Ga0496114_1108601
4020 Ga0496114_1176212
4021 Ga0496114_1352114
4022 Ga0496115_0061447
4023 Ga0496115_0365229
4024 Ga0496115_0688494
4025 Ga0496115_0770546
4026 Ga0496115_0955967
4027 Ga0496117_0028846
4028 Ga0496119_0020275
4029 Ga0496120_0369915
4030 Ga0496121_0007510
4031 Ga0496125_0468259
4032 Ga0496126_0726524
4033 Ga0496126_0835989
4034 Ga0501306_016193
4035 Ga0501306_026302
4036 Ga0501306_056781
4037 Ga0501306_073855
4038 Ga0501308_006777
4039 Ga0501309_068821
4040 Ga0501310_022788
4041 Ga0501310_079142
4042 Ga0501304_003547
4043 Ga0501304_006443
4044 Ga0501305_119111
4045 Ga0501307_008271
4046 Ga0495678_055852
4047 Ga0495682_0005869
4048 Ga0501311_012937
4049 Ga0501312_046384
4050 Ga0501312_110483
4051 Ga0501313_011751
4052 Ga0501314_017874
4053 Ga0501314_034440
4054 Ga0501315_017434
4055 Ga0501316_013954
4056 Ga0501316_031134
4057 Ga0501317_018717
4058 Ga0501317_019041
4059 Ga0501317_020531
4060 Ga0501318_017683
4061 Ga0501318_019601
4062 Ga0501319_010169
4063 Ga0501320_041643
4064 Ga0501321_057297
4065 Ga0501322_010682
4066 Ga0501323_038698
4067 Ga0501323_066488
4068 Ga0501324_006319
4069 Ga0501325_028288
4070 Ga0501340_018923
4071 Ga0501031_0001520
4072 Ga0501031_0001758
4073 Ga0501031_0005016
4074 Ga0501031_0020667
4075 Ga0501031_0032383
4076 Ga0501031_0042680
4077 Ga0501031_0101799
4078 Ga0501031_0129984
4079 Ga0501031_0332064
4080 Ga0501032_0008150
4081 Ga0501032_0009602
4082 Ga0501032_0032281
4083 Ga0501032_0057997
4084 Ga0501032_0083003
4085 Ga0501032_0096678
4086 Ga0501032_0097421
4087 Ga0501032_0188587
4088 Ga0501032_0336681
4089 Ga0501033_0004033
4090 Ga0501033_0005389
4091 Ga0501033_0032839
4092 Ga0501033_0036941
4093 Ga0501033_0045703
4094 Ga0501033_0057628
4095 Ga0501033_0061928
4096 Ga0501033_0076409
4097 Ga0501033_0620529
4098 Ga0501033_0626025
4099 Ga0501033_0683149
4100 Ga0501034_0004686
4101 Ga0501034_0010199
4102 Ga0501034_0026116
4103 Ga0501034_0028993
4104 Ga0501034_0029673
4105 Ga0501034_0087674
4106 Ga0501034_0120148
4107 Ga0501034_0147390
4108 Ga0501034_0644284
4109 Ga0501036_0001218
4110 Ga0501036_0002529
4111 Ga0501036_0008870
4112 Ga0501036_0012043
4113 Ga0501036_0035396
4114 Ga0501036_0158590
4115 Ga0501036_0167218
4116 Ga0501036_0591824
4117 Ga0501037_0001902
4118 Ga0501037_0010995
4119 Ga0501037_0018548
4120 Ga0501037_0028718
4121 Ga0501037_0058249
4122 Ga0501037_0065314
4123 Ga0501037_0070515
4124 Ga0501037_0120552
4125 Ga0501037_0384395
4126 Ga0501037_0772692
4127 Ga0501037_0987404
4128 Ga0501038_0001782
4129 Ga0501038_0006639
4130 Ga0501038_0019013
4131 Ga0501038_0019466
4132 Ga0501038_0037045
4133 Ga0501038_0058879
4134 Ga0501038_0115696
4135 Ga0501038_0187204
4136 Ga0501038_0773577
4137 Ga0501038_1041324
4138 Ga0501039_0003824
4139 Ga0501039_0007568
4140 Ga0501039_0009657
4141 Ga0501039_0010002
4142 Ga0501039_0017425
4143 Ga0501039_0022464
4144 Ga0501039_0154128
4145 Ga0501039_0279446
4146 Ga0501039_0414711
4147 Ga0501039_0797700
4148 Ga0501040_0000579
4149 Ga0501040_0006040
4150 Ga0501040_0047011
4151 Ga0501040_0049450
4152 Ga0501040_0105028
4153 Ga0501041_0001041
4154 Ga0501041_0001449
4155 Ga0501041_0035608
4156 Ga0501041_0118468
4157 Ga0501041_1101466
4158 Ga0501042_0000607
4159 Ga0501042_0007272
4160 Ga0501042_0008352
4161 Ga0501042_0013528
4162 Ga0501042_0022365
4163 Ga0501042_0106831
4164 Ga0501042_0209058
4165 Ga0501042_0248216
4166 Ga0501042_0784358
4167 Ga0501043_0003568
4168 Ga0501043_0008028
4169 Ga0501043_0011123
4170 Ga0501043_0062277
4171 Ga0501043_0067156
4172 Ga0501043_0146826
4173 Ga0501043_0185774
4174 Ga0501043_0464413
4175 Ga0501046_0000350
4176 Ga0501046_0001971
4177 Ga0501046_0006649
4178 Ga0501046_0009788
4179 Ga0501046_0269366
4180 Ga0501047_0000082
4181 Ga0501047_0027981
4182 Ga0501047_0040432
4183 Ga0501047_0043725
4184 Ga0501047_0056039
4185 Ga0501047_0174784
4186 Ga0501047_0176285
4187 Ga0501047_0846179
4188 Ga0501048_0003167
4189 Ga0501048_0025475
4190 Ga0501048_0028799
4191 Ga0501048_0114008
4192 Ga0501067_0000588
4193 Ga0501067_0006519
4194 Ga0501067_0011450
4195 Ga0501067_0129624
4196 Ga0501067_0162598
4197 Ga0501067_0289061
4198 Ga0501067_0298539
4199 Ga0501067_0341550
4200 Ga0501068_0002952
4201 Ga0501068_0005119
4202 Ga0501068_0016559
4203 Ga0501068_0029090
4204 Ga0501068_0033245
4205 Ga0501068_0403671
4206 Ga0501069_0015331
4207 Ga0501069_0039069
4208 Ga0501069_0068075
4209 Ga0501069_0162964
4210 Ga0501069_0199757
4211 Ga0501069_0300642
4212 Ga0501069_0758572
4213 Ga0501069_0855057
4214 Ga0501070_0001374
4215 Ga0501070_0001688
4216 Ga0501070_0003396
4217 Ga0501070_0004501
4218 Ga0501070_0016792
4219 Ga0501070_0062709
4220 Ga0501070_0072239
4221 Ga0501070_0168938
4222 Ga0501070_0260878
4223 Ga0501070_0369077
4224 Ga0501070_0549610
4225 Ga0501070_0811722
4226 Ga0501070_1337098
4227 Ga0501071_0005647
4228 Ga0501071_0016929
4229 Ga0501071_0032668
4230 Ga0501071_0039679
4231 Ga0501071_0051445
4232 Ga0501071_0219565
4233 Ga0501071_0490613
4234 Ga0501072_0000270
4235 Ga0501072_0005882
4236 Ga0501072_0008909
4237 Ga0501072_0020558
4238 Ga0501072_0022030
4239 Ga0501072_0400957
4240 Ga0501073_0005761
4241 Ga0501073_0026507
4242 Ga0501073_0049763
4243 Ga0501073_0195689
4244 Ga0501073_0205868
4245 Ga0501073_0212647
4246 Ga0501073_0504434
4247 Ga0501073_0576558
4248 Ga0501073_0978170
4249 Ga0501074_0000467
4250 Ga0501074_0001013
4251 Ga0501074_0004839
4252 Ga0501074_0006802
4253 Ga0501074_0022949
4254 Ga0501074_0046101
4255 Ga0501074_0065394
4256 Ga0501074_0073103
4257 Ga0501074_0095789
4258 Ga0501074_0620009
4259 Ga0501075_0000637
4260 Ga0501075_0009333
4261 Ga0501075_0023189
4262 Ga0501076_0001351
4263 Ga0501076_0003185
4264 Ga0501076_0004713
4265 Ga0501076_0100103
4266 Ga0501076_0104276
4267 Ga0501076_0776127
4268 Ga0501077_0001343
4269 Ga0501077_0001967
4270 Ga0501077_0005313
4271 Ga0501077_0006715
4272 Ga0501077_0031918
4273 Ga0501077_0033465
4274 Ga0501077_0348454
4275 Ga0501077_0362636
4276 Ga0501223_115543
4277 Ga0501079_0000101
4278 Ga0501079_0000116
4279 Ga0501079_0004539
4280 Ga0501079_0032784
4281 Ga0501079_0039279
4282 Ga0501079_0116421
4283 Ga0501079_0117223
4284 Ga0501079_1209836
4285 Ga0501080_0001308
4286 Ga0501080_0005935
4287 Ga0501080_0010008
4288 Ga0501080_0022122
4289 Ga0501080_0023020
4290 Ga0501080_0046099
4291 Ga0501080_0059335
4292 Ga0501080_0078415
4293 Ga0501080_0104595
4294 Ga0501080_0157590
4295 Ga0501081_0006102
4296 Ga0501081_0011066
4297 Ga0501081_0059195
4298 Ga0501081_0800379
4299 Ga0501081_0871279
4300 Ga0501083_0017262
4301 Ga0501083_0025869
4302 Ga0501083_0049351
4303 Ga0501083_0080653
4304 Ga0501269_050554
4305 Ga0501035_0001438
4306 Ga0501035_0008434
4307 Ga0501035_0019377
4308 Ga0501035_0022376
4309 Ga0501035_0037050
4310 Ga0501035_0041418
4311 Ga0501035_0077993
4312 Ga0501035_0269160
4313 Ga0501035_0321346
4314 Ga0501035_0480666
4315 Ga0501044_0004514
4316 Ga0501044_0038471
4317 Ga0501044_0040381
4318 Ga0501044_0047320
4319 Ga0501044_0048427
4320 Ga0501044_0101227
4321 Ga0501044_0133427
4322 Ga0501044_0140994
4323 Ga0501044_0203404
4324 Ga0501044_0255597
4325 Ga0501044_0283851
4326 Ga0501044_0605989
4327 Ga0501044_0824696
4328 Ga0501044_1211710
4329 Ga0501045_0001819
4330 Ga0501045_0005729
4331 Ga0501045_0024980
4332 Ga0501045_0111857
4333 Ga0501045_0160595
4334 Ga0501045_0251326
4335 Ga0501045_0346534
4336 Ga0501045_0946683
4337 nmdc:mga03n38_187029_c1
4338 nmdc:mga03n38_310903_c1
4339 nmdc:mga03n38_50941_c1
4340 nmdc:mga00v17_119642_c1
4341 nmdc:mga00v17_352928_c1
4342 nmdc:mga00v17_548062_c1
4343 nmdc:mga0yw44_11283_c1
4344 nmdc:mga0yw44_123625_c1
4345 nmdc:mga0yw44_175697_c1
4346 nmdc:mga0yw44_684704_c1
4347 nmdc:mga0yw44_818351_c1
4348 nmdc:mga06z11_15925_c1
4349 nmdc:mga06z11_19310_c1
4350 nmdc:mga06z11_5215_c1
4351 nmdc:mga04h51_465981_c1
4352 nmdc:mga04h51_51127_c1
4353 nmdc:mga04h51_62512_c1
4354 nmdc:mga07m45_191974_c1
4355 nmdc:mga07m45_87073_c1
4356 nmdc:mga05p37_114478_c1
4357 nmdc:mga05p37_6462_c1
4358 nmdc:mga09592_10546_c1
4359 nmdc:mga09592_499059_c1
4360 nmdc:mga0qj67_257874_c1
4361 nmdc:mga06r32_2732_c1
4362 nmdc:mga08y16_12139_c1
4363 nmdc:mga08y16_515666_c1
4364 nmdc:mga08y16_699681_c1
4365 nmdc:mga0n895_111117_c1
4366 nmdc:mga0n895_174320_c1
4367 nmdc:mga0n895_34608_c1
4368 nmdc:mga0n895_904729_c1
4369 nmdc:mga0rr50_1236835_c1
4370 nmdc:mga0rr50_143507_c1
4371 nmdc:mga0rr50_653046_c1
4372 nmdc:mga08x19_300406_c1
4373 nmdc:mga08x19_608140_c1
4374 nmdc:mga0a205_159293_c1
4375 nmdc:mga0a205_3754_c1
4376 nmdc:mga0a205_568603_c1
4377 Ga0495601_0007727
4378 Ga0495601_0071684
4379 Ga0495601_0098757
4380 Ga0495601_0330064
4381 Ga0495601_0827590
4382 Ga0495612_0003458
4383 Ga0495612_0007651
4384 Ga0495612_0085043
4385 Ga0495612_0147651
4386 Ga0500610_0035252
4387 Ga0500610_0080827
4388 Ga0495655_0001784
4389 Ga0495655_0012525
4390 Ga0495655_0045842
4391 Ga0495595_0007432
4392 Ga0495595_0009129
4393 Ga0495619_0010762
4394 Ga0495619_0011748
4395 Ga0495619_0030603
4396 Ga0495619_0042518
4397 Ga0495619_0120465
4398 Ga0495619_0452760
4399 Ga0500578_0006859
4400 Ga0500578_0126045
4401 Ga0500647_0110949
4402 Ga0500583_0038758
4403 Ga0500583_0061881
4404 Ga0500566_0136760
4405 Ga0500566_0515526
4406 Ga0500640_109154
4407 Ga0500641_0135438
4408 Ga0500650_0054083
4409 Ga0500654_039757
4410 Ga0500660_096080
4411 Ga0500553_031442
4412 Ga0500558_032856
4413 Ga0500560_004604
4414 Ga0500560_072902
4415 Ga0500569_004849
4416 Ga0500582_113048
4417 Ga0500614_012437
4418 Ga0500614_038919
4419 Ga0500621_062680
4420 Ga0500628_000565
4421 Ga0500628_242801
4422 Ga0500652_000224
4423 Ga0500652_339740
4424 Ga0500658_0005753
4425 Ga0500559_0239480
4426 Ga0500561_0000306
4427 Ga0500564_116365
4428 Ga0500573_0064876
4429 Ga0500573_0077749
4430 Ga0500573_0174440
4431 Ga0500573_0237534
4432 Ga0500577_0336053
4433 Ga0500579_073305
4434 Ga0500586_049792
4435 Ga0500586_170856
4436 Ga0500590_257113
4437 Ga0500600_0023373
4438 Ga0500600_0061947
4439 Ga0500600_0252445
4440 Ga0500603_052203
4441 Ga0500624_004048
4442 Ga0500627_0259645
4443 Ga0500633_0002695
4444 Ga0500633_0025173
4445 Ga0500634_0001104
4446 Ga0500634_0135673
4447 Ga0500636_0076304
4448 Ga0500656_000394
4449 Ga0500587_005298
4450 Ga0501084_0003000
4451 Ga0501084_0011286
4452 Ga0501084_0012452
4453 Ga0501084_0054298
4454 Ga0501084_0058996
4455 Ga0501084_0063427
4456 Ga0501084_0135656
4457 Ga0501084_0260857
4458 Ga0590071_007801
4459 Ga0590077_012840
4460 Ga0587084_056625
4461 Ga0587084_071300
4462 Ga0587093_037219
4463 Ga0587093_071716
4464 Ga0587066_135223
4465 Ga0587066_204050
4466 Ga0587070_042295
4467 Ga0587070_077693
4468 Ga0587070_148926
4469 Ga0587073_0036373
4470 Ga0587077_059551
4471 Ga0587077_064803
4472 Ga0587080_123904
4473 Ga0587082_015224
4474 Ga0587082_084420
4475 Ga0587082_128972
4476 Ga0587083_0062786
4477 Ga0587083_0138073
4478 Ga0587086_060008
4479 Ga0587086_100781
4480 Ga0587086_117062
4481 Ga0587088_029323
4482 Ga0587088_079551
4483 Ga0587088_083515
4484 Ga0587089_030881
4485 Ga0587089_045871
4486 Ga0587089_097698
4487 Ga0587090_061073
4488 Ga0587090_118392
4489 Ga0587090_147523
4490 Ga0587091_033717
4491 Ga0587091_195216
4492 Ga0587092_064880
4493 Ga0587094_039699
4494 Ga0587094_092102
4495 Ga0587095_013316
4496 Ga0587095_040725
4497 Ga0587098_009513
4498 Ga0587098_039147
4499 Ga0587106_011775
4500 Ga0587106_162451
4501 Ga0587121_12050
4502 Ga0587129_011998
4503 Ga0587101_062885
4504 Ga0587109_040369
4505 Ga0587115_118606
4506 Ga0587117_082174
4507 Ga0587117_105524
4508 Ga0587122_004238
4509 Ga0587122_037222
4510 Ga0587127_015289
4511 Ga0587127_026249
4512 Ga0587128_013352
4513 Ga0587128_072532
4514 Ga0587062_009549
4515 Ga0587062_123093
4516 Ga0587067_075859
4517 Ga0587068_037729
4518 Ga0587068_146291
4519 Ga0587069_045982
4520 Ga0587069_063928
4521 Ga0587072_171877
4522 Ga0587075_093364
4523 Ga0587075_097888
4524 Ga0587076_084261
4525 Ga0587076_106021
4526 Ga0587076_128661
4527 Ga0587076_133428
4528 Ga0587076_146340
4529 Ga0587078_057959
4530 Ga0587078_068196
4531 Ga0587079_060167
4532 Ga0587102_042439
4533 Ga0587102_052357
4534 Ga0587104_015797
4535 Ga0587107_020713
4536 Ga0587107_050157
4537 Ga0587107_125916
4538 Ga0587114_051133
4539 Ga0587114_055588
4540 Ga0587119_012126
4541 Ga0587124_026868
4542 Ga0587071_022032
4543 Ga0587111_0061708
4544 Ga0587111_0117750
4545 Ga0501082_0003349
4546 Ga0501082_0006289
4547 Ga0501082_0018558
4548 Ga0501082_0021714
4549 Ga0501082_0032005
4550 Ga0501082_0559591
4551 Ga0466962_0001218
4552 Ga0466962_0007976
4553 Ga0466962_0069553
4554 Ga0466962_0550558
4555 Ga0530510_0000081
4556 Ga0530510_0020052
4557 Ga0530510_0031999
4558 Ga0530510_0250432
4559 2508671868
4560 2517761262
4561 2547411593
4562 2585298024
4563 2585305216
4564 2585313016
4565 2616702926
4566 2616903681
4567 2643763442
4568 2643824834
4569 2643900706
4570 2643947580
4571 2644093270
4572 2644266014
4573 2644322881
4574 2644390287
4575 2644405073
4576 2644435272
4577 2644437523
4578 2644463690
4579 2644532615
4580 2644628067
4581 2671836728
4582 2676203290
4583 2686539328
4584 2689961976
4585 2689995916
4586 2710603702
4587 2740168484
4588 2774847866
4589 2774854884
4590 2784589360
4591 2785342239
4592 2785370414
4593 2786671585
4594 2793979198
4595 2808842986
4596 2808921338
4597 2809233020
4598 2811845414
4599 2812357134
4600 2812479776
4601 2819698223
4602 2819741936
4603 2837184624
4604 2852639985
4605 2855390079
4606 2862180131
4607 2862286582
4608 2862294564
4609 2862383697
4610 2862510219
4611 2862578497
4612 2863411924
4613 2867372886
4614 2867432713
4615 2867478289
4616 2873155032
4617 2875394741
4618 2877680192
4619 2895886600
4620 2912718773
4621 2912731123
4622 2912761787
4623 2918504675
4624 2919471411
4625 2935392749
4626 2946049064
4627 2946068743
4628 2946076745
4629 2947228165
4630 2954006208
4631 2954385180
4632 2954677869
4633 2954686287
4634 2954695964
4635 2954711135
4636 2954715371
4637 2954725291
4638 2954736524
4639 2954744225
4640 2954755353
4641 2954763190
4642 2966602426
4643 2984578698
4644 2990068047
4645 2990090966
4646 2990260718
4647 2995471390
4648 2997454359
4649 2997600158
4650 3003006230
4651 3006325245
4652 3006398051
4653 3006486800
4654 3006500301
4655 8002784314
4656 8008566142
4657 8008578109
4658 8023629597
4659 8025479461
4660 8025538206
4661 8033686068
4662 8047897812
4663 8048361059
4664 8048374798
4665 8048383424
4666 8048410125
4667 8054161279
4668 8054614154
4669 8056669145
4670 8056833183

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

17

112

0.98

PF13466

STAS_2

STAS domain

26

100

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9531 5 109
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.9444 1 109
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.939 2 109
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.936 2 99
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.9344 2 109
ID Description Score Start End Superfamily
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9457 2 109 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9374 8 109 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9278 3 109 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.913 1 105 3.30.750.24
af_I1KV89_512_657_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9014 8 110 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A838E4J6-F1-model_v4 Anti-sigma factor antagonist 1.003 1 109 GO:0043856
AF-A0A4R2IXC1-F1-model_v4 Anti-sigma factor antagonist 1.003 1 108 GO:0043856
AF-A0A1I3DT39-F1-model_v4 Anti-sigma factor antagonist 0.9998 1 110 GO:0043856
AF-A0A367FCX8-F1-model_v4 Anti-sigma factor antagonist 0.9988 1 109 GO:0043856
AF-A0A6N7I5W0-F1-model_v4 Anti-sigma factor antagonist 0.9985 1 109 GO:0043856

Map