F496702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2335 | 844 | 4670 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300046463|Ga0495653_0030612|Ga0495653_0030612_3353_3709 |
| Length | 118 |
| Sequence | MTPRMAAGGFVDLKLGHYNKDGIEVVDVEGEIDVYTAPRLRELLIDLVNKNNMEKVEFLDSTGLGVLVGGLKRVRAHDGSLDLVCTQERILKIFRITGLTKVFGIHNTVDEAIAAKDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 18 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 27 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 30 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 31 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 140 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 141 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 142 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 146 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 147 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 148 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 149 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 150 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 151 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 152 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 153 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 154 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 155 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 156 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 157 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 179 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300019162 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 192 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 198 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 199 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 200 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 201 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 202 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 205 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 206 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 279 | 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Metagenome | Rhizosphere |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 284 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 285 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 286 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 287 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 288 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 289 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 290 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 291 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 292 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 293 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 294 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 295 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 304 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 305 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 306 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 307 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 308 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 309 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 310 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 311 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 312 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 314 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 315 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 316 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 317 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 318 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 319 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 320 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 321 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 322 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 323 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 324 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 325 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 326 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 327 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 328 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 329 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 330 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 331 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 332 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 333 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 334 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 335 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 336 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 337 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 338 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 339 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 341 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 342 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 343 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 344 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 345 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 346 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 347 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 348 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 349 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 350 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 351 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 352 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 353 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 354 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 355 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 356 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 357 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 358 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 359 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 360 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 362 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 363 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 364 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 365 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 366 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 367 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 368 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 369 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 370 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 371 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 372 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 373 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 374 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 375 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 376 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 377 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 378 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 379 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 380 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 381 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 382 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 383 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 384 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 385 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 386 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 387 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 388 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 389 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 390 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 391 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 392 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 393 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 394 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 395 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 396 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 397 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 398 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 399 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 400 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 401 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 402 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 403 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 404 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 405 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 406 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 407 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 408 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 409 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 410 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 411 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 412 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 413 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 414 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 415 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 416 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 417 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 418 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 419 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 420 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 421 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 422 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 423 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 424 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 425 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 426 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 427 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 428 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 429 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 430 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 431 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 432 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 433 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 434 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 435 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 436 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 437 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 438 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 439 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 440 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 441 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 442 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 443 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 444 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 445 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 446 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 447 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 448 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 449 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 450 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 544 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 545 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 546 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 547 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 548 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 549 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 550 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 551 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 552 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 553 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 554 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 555 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 556 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 557 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 558 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 559 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 560 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 561 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 562 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 563 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 564 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 565 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 579 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 580 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 594 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 598 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 615 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 616 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 617 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 618 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 620 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 622 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 623 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 626 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 627 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 628 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 629 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 630 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 631 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 632 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 633 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 634 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 635 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 636 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 637 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 638 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 639 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 640 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 643 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 647 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 648 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 649 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 650 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 651 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 652 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 653 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 654 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 655 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 656 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 657 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 658 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 659 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 660 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 661 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 662 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 663 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 664 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 665 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 666 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 667 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 668 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 669 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 670 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 671 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 672 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 673 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 674 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 675 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 676 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 677 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 678 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 679 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 680 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 681 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 682 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 684 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 685 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 691 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 692 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 706 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 707 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 709 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 710 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 711 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 712 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 713 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 714 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 715 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 716 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 717 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 718 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 719 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 720 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 721 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 722 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 723 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 724 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 725 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 726 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 727 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 728 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 729 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 730 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 731 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 732 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 733 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 734 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 735 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 736 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 737 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 738 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 739 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 740 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 741 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 742 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 743 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 744 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 745 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 746 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 747 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 748 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 749 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 750 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 751 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 752 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 753 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 754 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 755 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 756 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 757 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 758 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 759 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 760 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 761 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 762 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 763 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 764 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 765 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 766 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 767 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 768 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 769 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 770 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 771 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 772 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 773 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 774 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 775 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 776 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 777 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 778 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 779 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 780 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 781 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 782 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 783 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 784 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 785 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 786 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 787 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 788 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 789 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 790 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 791 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 792 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 793 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 794 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 795 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 796 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 797 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 798 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 799 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 800 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 801 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 802 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 803 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 804 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 805 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 806 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 807 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 808 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 809 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 810 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 811 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 812 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 813 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 814 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 815 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 816 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 817 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 818 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 819 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 820 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 821 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 822 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 823 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 824 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 825 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 826 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 827 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 828 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 829 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 830 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 831 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 832 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 833 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 834 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 835 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 836 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 837 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 838 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 839 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 840 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 841 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 842 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 843 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 844 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.48 |
| Metatranscriptomes | 9.72 |
| Isolates | 4.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 3.98 |
| Nodule | 0.64 |
| Rhizoplane | 4.75 |
| Rhizosphere | 84.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495653_0030612 | 3300046463 | Bacteria | 4284 |
| 2 | JGI24739J22299_10012246 | 3300001989 | Bacteria | 3150 |
| 3 | JGI24737J22298_10019105 | 3300001990 | Bacteria | 2192 |
| 4 | JGI24737J22298_10192344 | 3300001990 | Bacteria | 602 |
| 5 | JGI24743J22301_10161148 | 3300001991 | Bacteria | 506 |
| 6 | JGI24735J21928_10045879 | 3300002067 | Bacteria | 1268 |
| 7 | JGI24735J21928_10046425 | 3300002067 | Bacteria | 1260 |
| 8 | JGI24735J21928_10137400 | 3300002067 | Bacteria | 705 |
| 9 | JGI24738J21930_10009224 | 3300002075 | Bacteria | 2226 |
| 10 | Ga0006778J45830_1049852 | 3300003162 | Bacteria | 1083 |
| 11 | Ga0006759J45824_1020748 | 3300003163 | Bacteria | 1220 |
| 12 | JGI25406J46586_10007643 | 3300003203 | Bacteria | 4920 |
| 13 | JGI25153J46596_10101033 | 3300003215 | Bacteria | 678 |
| 14 | Ga0006758J48902_1016223 | 3300003300 | Bacteria | 1097 |
| 15 | Ga0006777J48905_1018870 | 3300003308 | Bacteria | 786 |
| 16 | rootH1_10072002 | 3300003316 | Bacteria | 3813 |
| 17 | rootH2_10022780 | 3300003320 | Bacteria | 4656 |
| 18 | rootH2_10108428 | 3300003320 | Bacteria | 1526 |
| 19 | rootH1_10031505 | 3300003323 | Bacteria | 3992 |
| 20 | JGI25160J50197_1022315 | 3300003354 | Bacteria | 1859 |
| 21 | JGI25160J50197_1039249 | 3300003354 | Bacteria | 1110 |
| 22 | JGI25407J50210_10018107 | 3300003373 | Bacteria | 1831 |
| 23 | JGI25407J50210_10037302 | 3300003373 | Bacteria | 1249 |
| 24 | Ga0007427J51700_111976 | 3300003559 | Bacteria | 799 |
| 25 | Ga0006781J51513_1031642 | 3300003568 | Bacteria | 622 |
| 26 | Ga0007409J51694_1021866 | 3300003575 | Bacteria | 1194 |
| 27 | Ga0006562J51391_1046289 | 3300003578 | Bacteria | 1750 |
| 28 | Ga0007429J51699_1015173 | 3300003579 | Bacteria | 1167 |
| 29 | Ga0007429J51699_1022622 | 3300003579 | Bacteria | 1083 |
| 30 | JGI25404J52841_10003762 | 3300003659 | Bacteria | 3025 |
| 31 | Ga0032354_1015897 | 3300003693 | Bacteria | 1215 |
| 32 | Ga0032354_1034030 | 3300003693 | Bacteria | 908 |
| 33 | Ga0032354_1078986 | 3300003693 | Bacteria | 688 |
| 34 | Ga0006780_1022200 | 3300003735 | Bacteria | 1188 |
| 35 | Ga0058692_1043303 | 3300003856 | Bacteria | 777 |
| 36 | Ga0058859_10015040 | 3300004798 | Bacteria | 595 |
| 37 | Ga0058859_10049176 | 3300004798 | Bacteria | 642 |
| 38 | Ga0058863_10065640 | 3300004799 | Bacteria | 1182 |
| 39 | Ga0058863_11976483 | 3300004799 | Bacteria | 1222 |
| 40 | Ga0058861_10164303 | 3300004800 | Bacteria | 779 |
| 41 | Ga0058861_10176188 | 3300004800 | Bacteria | 923 |
| 42 | Ga0058860_10007162 | 3300004801 | Bacteria | 749 |
| 43 | Ga0058860_10028903 | 3300004801 | Bacteria | 559 |
| 44 | Ga0058860_10033454 | 3300004801 | Bacteria | 705 |
| 45 | Ga0058860_12110909 | 3300004801 | Bacteria | 516 |
| 46 | Ga0058860_12209150 | 3300004801 | Bacteria | 701 |
| 47 | Ga0058862_10234175 | 3300004803 | Bacteria | 540 |
| 48 | Ga0058862_12842049 | 3300004803 | Bacteria | 940 |
| 49 | Ga0070658_10057941 | 3300005327 | Bacteria | 3151 |
| 50 | Ga0070658_11647721 | 3300005327 | Bacteria | 556 |
| 51 | Ga0070683_100046631 | 3300005329 | Bacteria | 4004 |
| 52 | Ga0070683_100072608 | 3300005329 | Bacteria | 3212 |
| 53 | Ga0070683_100190097 | 3300005329 | Bacteria | 1949 |
| 54 | Ga0070683_100202004 | 3300005329 | Bacteria | 1887 |
| 55 | Ga0070683_100396927 | 3300005329 | Bacteria | 1315 |
| 56 | Ga0070683_100563340 | 3300005329 | Bacteria | 1090 |
| 57 | Ga0070670_100578960 | 3300005331 | Bacteria | 1003 |
| 58 | Ga0070670_101515613 | 3300005331 | Bacteria | 616 |
| 59 | Ga0070677_10529932 | 3300005333 | Bacteria | 643 |
| 60 | Ga0068869_100122565 | 3300005334 | Bacteria | 1990 |
| 61 | Ga0068869_100504708 | 3300005334 | Bacteria | 1010 |
| 62 | Ga0070680_100608737 | 3300005336 | Bacteria | 938 |
| 63 | Ga0070682_100003432 | 3300005337 | Bacteria | 8784 |
| 64 | Ga0070682_100117787 | 3300005337 | Bacteria | 1778 |
| 65 | Ga0070682_100284955 | 3300005337 | Bacteria | 1206 |
| 66 | Ga0070682_100449172 | 3300005337 | Bacteria | 987 |
| 67 | Ga0068868_100178637 | 3300005338 | Bacteria | 1760 |
| 68 | Ga0068868_100542817 | 3300005338 | Bacteria | 1024 |
| 69 | Ga0070660_100032354 | 3300005339 | Bacteria | 3935 |
| 70 | Ga0070660_100064698 | 3300005339 | Bacteria | 2845 |
| 71 | Ga0070660_100080638 | 3300005339 | Bacteria | 2554 |
| 72 | Ga0070660_100099506 | 3300005339 | Bacteria | 2302 |
| 73 | Ga0070687_100026149 | 3300005343 | Bacteria | 2808 |
| 74 | Ga0070687_100727747 | 3300005343 | Bacteria | 696 |
| 75 | Ga0070661_100067814 | 3300005344 | Bacteria | 2622 |
| 76 | Ga0070661_100224898 | 3300005344 | Bacteria | 1440 |
| 77 | Ga0070692_10029363 | 3300005345 | Bacteria | 2740 |
| 78 | Ga0070692_10117879 | 3300005345 | Bacteria | 1477 |
| 79 | Ga0070668_100005274 | 3300005347 | Bacteria | 9587 |
| 80 | Ga0070668_100323680 | 3300005347 | Bacteria | 1298 |
| 81 | Ga0070668_101343155 | 3300005347 | Bacteria | 650 |
| 82 | Ga0070668_101377431 | 3300005347 | Bacteria | 643 |
| 83 | Ga0070668_101646027 | 3300005347 | Bacteria | 589 |
| 84 | Ga0070671_100119704 | 3300005355 | Bacteria | 2215 |
| 85 | Ga0070671_100385026 | 3300005355 | Bacteria | 1199 |
| 86 | Ga0070671_100438242 | 3300005355 | Bacteria | 1120 |
| 87 | Ga0070674_100123743 | 3300005356 | Bacteria | 1918 |
| 88 | Ga0070674_100160241 | 3300005356 | Bacteria | 1707 |
| 89 | Ga0070673_100113602 | 3300005364 | Bacteria | 2249 |
| 90 | Ga0070673_100786336 | 3300005364 | Bacteria | 878 |
| 91 | Ga0070673_102039575 | 3300005364 | Bacteria | 545 |
| 92 | Ga0070659_100037012 | 3300005366 | Bacteria | 3804 |
| 93 | Ga0070659_100652007 | 3300005366 | Bacteria | 908 |
| 94 | Ga0070703_10006853 | 3300005406 | Bacteria | 3198 |
| 95 | Ga0070709_10071599 | 3300005434 | Bacteria | 2239 |
| 96 | Ga0070709_10349223 | 3300005434 | Bacteria | 1092 |
| 97 | Ga0070714_100307734 | 3300005435 | Bacteria | 1479 |
| 98 | Ga0070714_101061487 | 3300005435 | Bacteria | 789 |
| 99 | Ga0070713_100016958 | 3300005436 | Bacteria | 5492 |
| 100 | Ga0070710_10049761 | 3300005437 | Bacteria | 2345 |
| 101 | Ga0070711_100347531 | 3300005439 | Bacteria | 1192 |
| 102 | Ga0070711_101219286 | 3300005439 | Bacteria | 651 |
| 103 | Ga0070705_101717572 | 3300005440 | Bacteria | 531 |
| 104 | Ga0070700_100306162 | 3300005441 | Bacteria | 1162 |
| 105 | Ga0070700_100382422 | 3300005441 | Bacteria | 1053 |
| 106 | Ga0070708_100029105 | 3300005445 | Bacteria | 4761 |
| 107 | Ga0070708_100191338 | 3300005445 | Bacteria | 1913 |
| 108 | Ga0070708_100224162 | 3300005445 | Bacteria | 1763 |
| 109 | Ga0070663_100180106 | 3300005455 | Bacteria | 1639 |
| 110 | Ga0070663_100242842 | 3300005455 | Bacteria | 1422 |
| 111 | Ga0070663_100365984 | 3300005455 | Bacteria | 1171 |
| 112 | Ga0070663_100612767 | 3300005455 | Bacteria | 917 |
| 113 | Ga0070678_100148612 | 3300005456 | Bacteria | 1884 |
| 114 | Ga0070678_100369594 | 3300005456 | Bacteria | 1238 |
| 115 | Ga0070662_100033040 | 3300005457 | Bacteria | 3641 |
| 116 | Ga0070662_100091588 | 3300005457 | Bacteria | 2284 |
| 117 | Ga0070662_100140800 | 3300005457 | Bacteria | 1869 |
| 118 | Ga0070681_10041790 | 3300005458 | Bacteria | 4596 |
| 119 | Ga0070681_10301002 | 3300005458 | Bacteria | 1513 |
| 120 | Ga0068867_100173855 | 3300005459 | Bacteria | 1708 |
| 121 | Ga0070685_10121605 | 3300005466 | Bacteria | 1622 |
| 122 | Ga0070685_10219788 | 3300005466 | Bacteria | 1244 |
| 123 | Ga0070706_100002754 | 3300005467 | Bacteria | 17588 |
| 124 | Ga0070706_100003951 | 3300005467 | Bacteria | 14437 |
| 125 | Ga0070706_100050706 | 3300005467 | Bacteria | 3830 |
| 126 | Ga0070706_100230597 | 3300005467 | Bacteria | 1728 |
| 127 | Ga0070707_100001503 | 3300005468 | Bacteria | 22738 |
| 128 | Ga0070707_100049280 | 3300005468 | Bacteria | 4037 |
| 129 | Ga0070707_100051048 | 3300005468 | Bacteria | 3964 |
| 130 | Ga0070707_100098856 | 3300005468 | Bacteria | 2827 |
| 131 | Ga0070698_100000665 | 3300005471 | Bacteria | 36678 |
| 132 | Ga0070698_100005898 | 3300005471 | Bacteria | 13363 |
| 133 | Ga0070698_100022580 | 3300005471 | Bacteria | 6581 |
| 134 | Ga0070698_100055599 | 3300005471 | Bacteria | 4011 |
| 135 | Ga0070698_100421835 | 3300005471 | Bacteria | 1269 |
| 136 | Ga0070698_101679557 | 3300005471 | Bacteria | 587 |
| 137 | Ga0070699_100321904 | 3300005518 | Bacteria | 1390 |
| 138 | Ga0070699_100540722 | 3300005518 | Bacteria | 1060 |
| 139 | Ga0070679_100019803 | 3300005530 | Bacteria | 6551 |
| 140 | Ga0070679_100104922 | 3300005530 | Bacteria | 2812 |
| 141 | Ga0070679_100605866 | 3300005530 | Bacteria | 1038 |
| 142 | Ga0070684_100001778 | 3300005535 | Bacteria | 15736 |
| 143 | Ga0070684_100112941 | 3300005535 | Bacteria | 2437 |
| 144 | Ga0070684_100187049 | 3300005535 | Bacteria | 1884 |
| 145 | Ga0070684_100266179 | 3300005535 | Bacteria | 1568 |
| 146 | Ga0070684_100545705 | 3300005535 | Bacteria | 1076 |
| 147 | Ga0070697_100037989 | 3300005536 | Bacteria | 3889 |
| 148 | Ga0070697_101046319 | 3300005536 | Bacteria | 726 |
| 149 | Ga0070697_102030489 | 3300005536 | Bacteria | 515 |
| 150 | Ga0068853_100074255 | 3300005539 | Bacteria | 2967 |
| 151 | Ga0068853_100194347 | 3300005539 | Bacteria | 1844 |
| 152 | Ga0070672_100160740 | 3300005543 | Bacteria | 1863 |
| 153 | Ga0070672_100458414 | 3300005543 | Bacteria | 1099 |
| 154 | Ga0070686_100238808 | 3300005544 | Bacteria | 1322 |
| 155 | Ga0070686_101494516 | 3300005544 | Bacteria | 569 |
| 156 | Ga0070695_100081265 | 3300005545 | Bacteria | 2144 |
| 157 | Ga0070693_100077237 | 3300005547 | Bacteria | 1976 |
| 158 | Ga0070665_100319651 | 3300005548 | Bacteria | 1556 |
| 159 | Ga0070665_100665089 | 3300005548 | Bacteria | 1055 |
| 160 | Ga0070665_101998709 | 3300005548 | Bacteria | 585 |
| 161 | Ga0070704_100123917 | 3300005549 | Bacteria | 1990 |
| 162 | Ga0070704_100455370 | 3300005549 | Bacteria | 1102 |
| 163 | Ga0068855_100164436 | 3300005563 | Bacteria | 2516 |
| 164 | Ga0068855_100386020 | 3300005563 | Bacteria | 1537 |
| 165 | Ga0068855_100493428 | 3300005563 | Bacteria | 1332 |
| 166 | Ga0070664_100045018 | 3300005564 | Bacteria | 3726 |
| 167 | Ga0070664_100078162 | 3300005564 | Bacteria | 2846 |
| 168 | Ga0068857_100116012 | 3300005577 | Bacteria | 2409 |
| 169 | Ga0068857_101740702 | 3300005577 | Bacteria | 610 |
| 170 | Ga0068854_100215677 | 3300005578 | Bacteria | 1516 |
| 171 | Ga0068854_100343671 | 3300005578 | Bacteria | 1219 |
| 172 | Ga0068854_100512768 | 3300005578 | Bacteria | 1012 |
| 173 | Ga0068856_100259101 | 3300005614 | Bacteria | 1754 |
| 174 | Ga0068856_100354654 | 3300005614 | Bacteria | 1485 |
| 175 | Ga0068856_100470378 | 3300005614 | Bacteria | 1278 |
| 176 | Ga0070702_100075402 | 3300005615 | Bacteria | 2004 |
| 177 | Ga0070702_100094259 | 3300005615 | Bacteria | 1822 |
| 178 | Ga0070702_100333963 | 3300005615 | Bacteria | 1061 |
| 179 | Ga0070702_100974962 | 3300005615 | Bacteria | 669 |
| 180 | Ga0068852_100259966 | 3300005616 | Bacteria | 1667 |
| 181 | Ga0068852_100342361 | 3300005616 | Bacteria | 1458 |
| 182 | Ga0068852_100370667 | 3300005616 | Bacteria | 1403 |
| 183 | Ga0068852_100464297 | 3300005616 | Bacteria | 1255 |
| 184 | Ga0068852_100798769 | 3300005616 | Bacteria | 958 |
| 185 | Ga0068859_100000094 | 3300005617 | Bacteria | 81844 |
| 186 | Ga0068859_100019463 | 3300005617 | Bacteria | 6819 |
| 187 | Ga0068859_100760623 | 3300005617 | Bacteria | 1057 |
| 188 | Ga0068864_100036467 | 3300005618 | Bacteria | 4192 |
| 189 | Ga0068864_100197116 | 3300005618 | Bacteria | 1848 |
| 190 | Ga0068864_101881533 | 3300005618 | Bacteria | 604 |
| 191 | Ga0068864_102396079 | 3300005618 | Bacteria | 534 |
| 192 | Ga0068866_10137407 | 3300005718 | Bacteria | 1398 |
| 193 | Ga0068861_100019697 | 3300005719 | Bacteria | 4821 |
| 194 | Ga0068861_100260870 | 3300005719 | Bacteria | 1483 |
| 195 | Ga0068851_10153942 | 3300005834 | Bacteria | 1259 |
| 196 | Ga0068870_10235019 | 3300005840 | Bacteria | 1129 |
| 197 | Ga0068863_100064425 | 3300005841 | Bacteria | 3466 |
| 198 | Ga0068863_100114583 | 3300005841 | Bacteria | 2568 |
| 199 | Ga0068863_101454095 | 3300005841 | Bacteria | 693 |
| 200 | Ga0068858_100000036 | 3300005842 | Bacteria | 138467 |
| 201 | Ga0068858_100163957 | 3300005842 | Bacteria | 2094 |
| 202 | Ga0068858_100674869 | 3300005842 | Bacteria | 1005 |
| 203 | Ga0068858_100781556 | 3300005842 | Bacteria | 931 |
| 204 | Ga0068860_100058211 | 3300005843 | Bacteria | 3673 |
| 205 | Ga0068862_100000204 | 3300005844 | Bacteria | 65627 |
| 206 | Ga0068862_100710697 | 3300005844 | Bacteria | 974 |
| 207 | Ga0081455_10014212 | 3300005937 | Bacteria | 7816 |
| 208 | Ga0081455_10030364 | 3300005937 | Bacteria | 4909 |
| 209 | Ga0081455_10226962 | 3300005937 | Bacteria | 1381 |
| 210 | Ga0081538_10003619 | 3300005981 | Bacteria | 14524 |
| 211 | Ga0081538_10011320 | 3300005981 | Bacteria | 7235 |
| 212 | Ga0081538_10016741 | 3300005981 | Bacteria | 5605 |
| 213 | Ga0081538_10029722 | 3300005981 | Bacteria | 3727 |
| 214 | Ga0081538_10047756 | 3300005981 | Bacteria | 2621 |
| 215 | Ga0081538_10058335 | 3300005981 | Bacteria | 2240 |
| 216 | Ga0081538_10066451 | 3300005981 | Bacteria | 2022 |
| 217 | Ga0081538_10283081 | 3300005981 | Bacteria | 615 |
| 218 | Ga0081540_1000345 | 3300005983 | Bacteria | 46912 |
| 219 | Ga0081540_1009692 | 3300005983 | Bacteria | 6613 |
| 220 | Ga0081539_10002843 | 3300005985 | Bacteria | 23096 |
| 221 | Ga0081539_10028367 | 3300005985 | Bacteria | 3521 |
| 222 | Ga0081539_10030867 | 3300005985 | Bacteria | 3316 |
| 223 | Ga0081539_10208914 | 3300005985 | Bacteria | 896 |
| 224 | Ga0081539_10248166 | 3300005985 | Bacteria | 793 |
| 225 | Ga0081539_10275591 | 3300005985 | Bacteria | 735 |
| 226 | Ga0070717_10045967 | 3300006028 | Bacteria | 3571 |
| 227 | Ga0070717_10046247 | 3300006028 | Bacteria | 3561 |
| 228 | Ga0070717_10323441 | 3300006028 | Bacteria | 1374 |
| 229 | Ga0070717_10611810 | 3300006028 | Bacteria | 988 |
| 230 | Ga0070717_12018596 | 3300006028 | Bacteria | 520 |
| 231 | Ga0075365_10082094 | 3300006038 | Bacteria | 2185 |
| 232 | Ga0075365_10132046 | 3300006038 | Bacteria | 1728 |
| 233 | Ga0075365_10153204 | 3300006038 | Bacteria | 1604 |
| 234 | Ga0075368_10000813 | 3300006042 | Bacteria | 9606 |
| 235 | Ga0075368_10070273 | 3300006042 | Bacteria | 1413 |
| 236 | Ga0075363_100029174 | 3300006048 | Bacteria | 2845 |
| 237 | Ga0075363_100033261 | 3300006048 | Bacteria | 2684 |
| 238 | Ga0075364_10202207 | 3300006051 | Bacteria | 1347 |
| 239 | Ga0075364_10929506 | 3300006051 | Bacteria | 592 |
| 240 | Ga0075432_10003211 | 3300006058 | Bacteria | 5514 |
| 241 | Ga0070715_10016810 | 3300006163 | Bacteria | 2757 |
| 242 | Ga0070715_10070916 | 3300006163 | Bacteria | 1556 |
| 243 | Ga0070715_10085671 | 3300006163 | Bacteria | 1439 |
| 244 | Ga0070716_100016224 | 3300006173 | Bacteria | 3839 |
| 245 | Ga0070716_100098885 | 3300006173 | Bacteria | 1784 |
| 246 | Ga0070712_100003387 | 3300006175 | Bacteria | 9805 |
| 247 | Ga0070712_100165125 | 3300006175 | Bacteria | 1713 |
| 248 | Ga0070712_100182981 | 3300006175 | Bacteria | 1634 |
| 249 | Ga0070712_100195468 | 3300006175 | Bacteria | 1586 |
| 250 | Ga0070712_100395491 | 3300006175 | Bacteria | 1140 |
| 251 | Ga0070712_100708388 | 3300006175 | Bacteria | 859 |
| 252 | Ga0075367_10013875 | 3300006178 | Bacteria | 4346 |
| 253 | Ga0075367_10044898 | 3300006178 | Bacteria | 2592 |
| 254 | Ga0075367_10185529 | 3300006178 | Bacteria | 1297 |
| 255 | Ga0097621_100063674 | 3300006237 | Bacteria | 3031 |
| 256 | Ga0097621_100316810 | 3300006237 | Bacteria | 1381 |
| 257 | Ga0075370_10061581 | 3300006353 | Bacteria | 2138 |
| 258 | Ga0068871_100311016 | 3300006358 | Bacteria | 1385 |
| 259 | Ga0068871_100467349 | 3300006358 | Bacteria | 1133 |
| 260 | Ga0068871_100473318 | 3300006358 | Bacteria | 1126 |
| 261 | Ga0068871_101132021 | 3300006358 | Bacteria | 733 |
| 262 | Ga0075428_100775684 | 3300006844 | Bacteria | 1019 |
| 263 | Ga0075428_100805111 | 3300006844 | Bacteria | 999 |
| 264 | Ga0075430_100008819 | 3300006846 | Bacteria | 8510 |
| 265 | Ga0075431_100014880 | 3300006847 | Bacteria | 7876 |
| 266 | Ga0075433_10042000 | 3300006852 | Bacteria | 3965 |
| 267 | Ga0075433_10321934 | 3300006852 | Bacteria | 1368 |
| 268 | Ga0075434_100018311 | 3300006871 | Bacteria | 6764 |
| 269 | Ga0075434_100693747 | 3300006871 | Bacteria | 1036 |
| 270 | Ga0075434_102227245 | 3300006871 | Bacteria | 551 |
| 271 | Ga0075429_100062979 | 3300006880 | Bacteria | 3231 |
| 272 | Ga0068865_100024075 | 3300006881 | Bacteria | 3992 |
| 273 | Ga0068865_100079207 | 3300006881 | Bacteria | 2353 |
| 274 | Ga0068865_100153696 | 3300006881 | Bacteria | 1748 |
| 275 | Ga0068865_100175399 | 3300006881 | Bacteria | 1647 |
| 276 | Ga0068865_100519429 | 3300006881 | Bacteria | 995 |
| 277 | Ga0068865_100605044 | 3300006881 | Bacteria | 927 |
| 278 | Ga0075436_100900585 | 3300006914 | Bacteria | 662 |
| 279 | Ga0097620_100000094 | 3300006931 | Bacteria | 81844 |
| 280 | Ga0097620_100019463 | 3300006931 | Bacteria | 6819 |
| 281 | Ga0097620_100760619 | 3300006931 | Bacteria | 1057 |
| 282 | Ga0099826_10081983 | 3300006948 | Bacteria | 2005 |
| 283 | Ga0075435_100013330 | 3300007076 | Bacteria | 6111 |
| 284 | Ga0075435_100185638 | 3300007076 | Bacteria | 1758 |
| 285 | Ga0075435_100202372 | 3300007076 | Bacteria | 1683 |
| 286 | Ga0099794_10153458 | 3300007265 | Bacteria | 1169 |
| 287 | Ga0105251_10019082 | 3300009011 | Bacteria | 3630 |
| 288 | Ga0105251_10024110 | 3300009011 | Bacteria | 3127 |
| 289 | Ga0105244_10149676 | 3300009036 | Bacteria | 1119 |
| 290 | Ga0105244_10359605 | 3300009036 | Bacteria | 671 |
| 291 | Ga0105250_10069781 | 3300009092 | Bacteria | 1419 |
| 292 | Ga0105250_10342843 | 3300009092 | Bacteria | 653 |
| 293 | Ga0105240_10813749 | 3300009093 | Bacteria | 1011 |
| 294 | Ga0105240_11086267 | 3300009093 | Bacteria | 852 |
| 295 | Ga0111539_10021256 | 3300009094 | Bacteria | 7989 |
| 296 | Ga0111539_10434718 | 3300009094 | Bacteria | 1528 |
| 297 | Ga0111539_11374947 | 3300009094 | Bacteria | 819 |
| 298 | Ga0111539_11439641 | 3300009094 | Bacteria | 799 |
| 299 | Ga0105245_10007936 | 3300009098 | Bacteria | 9281 |
| 300 | Ga0105245_10320361 | 3300009098 | Bacteria | 1527 |
| 301 | Ga0105245_10452189 | 3300009098 | Bacteria | 1293 |
| 302 | Ga0105245_10486061 | 3300009098 | Bacteria | 1249 |
| 303 | Ga0105245_10625204 | 3300009098 | Bacteria | 1105 |
| 304 | Ga0105245_10631309 | 3300009098 | Bacteria | 1100 |
| 305 | Ga0105245_12684384 | 3300009098 | Bacteria | 551 |
| 306 | Ga0105247_10000357 | 3300009101 | Bacteria | 39270 |
| 307 | Ga0105247_10091356 | 3300009101 | Bacteria | 1933 |
| 308 | Ga0105247_10097314 | 3300009101 | Bacteria | 1877 |
| 309 | Ga0105247_10101372 | 3300009101 | Bacteria | 1841 |
| 310 | Ga0105247_10150418 | 3300009101 | Bacteria | 1533 |
| 311 | Ga0114129_10100488 | 3300009147 | Bacteria | 4003 |
| 312 | Ga0114129_10316525 | 3300009147 | Bacteria | 2075 |
| 313 | Ga0114129_10785511 | 3300009147 | Bacteria | 1216 |
| 314 | Ga0105243_10057425 | 3300009148 | Bacteria | 3099 |
| 315 | Ga0105243_10065756 | 3300009148 | Bacteria | 2914 |
| 316 | Ga0105243_10078129 | 3300009148 | Bacteria | 2694 |
| 317 | Ga0105243_10636481 | 3300009148 | Bacteria | 1032 |
| 318 | Ga0105243_11981364 | 3300009148 | Bacteria | 616 |
| 319 | Ga0105241_10718168 | 3300009174 | Bacteria | 914 |
| 320 | Ga0105241_11168071 | 3300009174 | Bacteria | 728 |
| 321 | Ga0105242_10074221 | 3300009176 | Bacteria | 2830 |
| 322 | Ga0105242_10085779 | 3300009176 | Bacteria | 2641 |
| 323 | Ga0105242_10668381 | 3300009176 | Bacteria | 1012 |
| 324 | Ga0105248_10000023 | 3300009177 | Bacteria | 264241 |
| 325 | Ga0105248_10066086 | 3300009177 | Bacteria | 4061 |
| 326 | Ga0105248_10496689 | 3300009177 | Bacteria | 1375 |
| 327 | Ga0105248_11048756 | 3300009177 | Bacteria | 921 |
| 328 | Ga0105248_11188340 | 3300009177 | Bacteria | 862 |
| 329 | Ga0105248_11191354 | 3300009177 | Bacteria | 861 |
| 330 | Ga0105248_12202217 | 3300009177 | Bacteria | 627 |
| 331 | Ga0105237_10249366 | 3300009545 | Bacteria | 1777 |
| 332 | Ga0105237_10625757 | 3300009545 | Bacteria | 1083 |
| 333 | Ga0105237_10932331 | 3300009545 | Bacteria | 875 |
| 334 | Ga0105237_11864646 | 3300009545 | Bacteria | 609 |
| 335 | Ga0105238_10282092 | 3300009551 | Bacteria | 1642 |
| 336 | Ga0105238_10283855 | 3300009551 | Bacteria | 1637 |
| 337 | Ga0105238_10629320 | 3300009551 | Bacteria | 1082 |
| 338 | Ga0105238_10688085 | 3300009551 | Bacteria | 1034 |
| 339 | Ga0105238_11053877 | 3300009551 | Bacteria | 835 |
| 340 | Ga0105238_12939657 | 3300009551 | Bacteria | 512 |
| 341 | Ga0105249_10010731 | 3300009553 | Bacteria | 8048 |
| 342 | Ga0105249_10012128 | 3300009553 | Bacteria | 7586 |
| 343 | Ga0105249_10039691 | 3300009553 | Bacteria | 4274 |
| 344 | Ga0105249_10548091 | 3300009553 | Bacteria | 1207 |
| 345 | Ga0105249_11522334 | 3300009553 | Bacteria | 741 |
| 346 | Ga0105249_13263324 | 3300009553 | Bacteria | 522 |
| 347 | Ga0130087_1098055 | 3300009828 | Bacteria | 621 |
| 348 | Ga0130086_1044473 | 3300009829 | Bacteria | 657 |
| 349 | Ga0130086_1084162 | 3300009829 | Bacteria | 621 |
| 350 | Ga0130084_1020040 | 3300009835 | Bacteria | 607 |
| 351 | Ga0130084_1048495 | 3300009835 | Bacteria | 621 |
| 352 | Ga0130084_1110514 | 3300009835 | Bacteria | 657 |
| 353 | Ga0130085_1024196 | 3300009850 | Bacteria | 607 |
| 354 | Ga0130085_1052010 | 3300009850 | Bacteria | 657 |
| 355 | Ga0130085_1129671 | 3300009850 | Bacteria | 621 |
| 356 | Ga0105239_10002802 | 3300010375 | Bacteria | 21794 |
| 357 | Ga0105239_10009298 | 3300010375 | Bacteria | 11109 |
| 358 | Ga0105239_10321094 | 3300010375 | Bacteria | 1746 |
| 359 | Ga0105239_11106345 | 3300010375 | Bacteria | 912 |
| 360 | Ga0105239_11310043 | 3300010375 | Bacteria | 835 |
| 361 | Ga0105239_11514965 | 3300010375 | Bacteria | 775 |
| 362 | Ga0105239_11903700 | 3300010375 | Bacteria | 690 |
| 363 | Ga0105239_12832811 | 3300010375 | Bacteria | 566 |
| 364 | Ga0105239_13111368 | 3300010375 | Bacteria | 540 |
| 365 | Ga0105246_10002099 | 3300011119 | Bacteria | 12017 |
| 366 | Ga0105246_10004538 | 3300011119 | Bacteria | 8449 |
| 367 | Ga0105246_10098480 | 3300011119 | Bacteria | 2124 |
| 368 | Ga0105246_10441200 | 3300011119 | Bacteria | 1092 |
| 369 | Ga0105246_10540377 | 3300011119 | Bacteria | 997 |
| 370 | Ga0105246_10555756 | 3300011119 | Bacteria | 984 |
| 371 | Ga0105246_11213661 | 3300011119 | Bacteria | 695 |
| 372 | Ga0105246_11225005 | 3300011119 | Bacteria | 692 |
| 373 | Ga0157344_1004298 | 3300012476 | Bacteria | 842 |
| 374 | Ga0157346_1004194 | 3300012480 | Bacteria | 842 |
| 375 | Ga0157337_1008906 | 3300012483 | Bacteria | 747 |
| 376 | Ga0157322_1021079 | 3300012490 | Bacteria | 629 |
| 377 | Ga0157322_1022184 | 3300012490 | Bacteria | 620 |
| 378 | Ga0157329_1000987 | 3300012491 | Bacteria | 1332 |
| 379 | Ga0157335_1010443 | 3300012492 | Bacteria | 746 |
| 380 | Ga0157341_1001858 | 3300012494 | Bacteria | 1329 |
| 381 | Ga0157347_1013750 | 3300012502 | Bacteria | 887 |
| 382 | Ga0157313_1011014 | 3300012503 | Bacteria | 778 |
| 383 | Ga0157313_1060641 | 3300012503 | Bacteria | 516 |
| 384 | Ga0157342_1018677 | 3300012507 | Bacteria | 788 |
| 385 | Ga0157315_1003551 | 3300012508 | Bacteria | 1059 |
| 386 | Ga0157338_1003156 | 3300012515 | Bacteria | 1347 |
| 387 | Ga0154016_137542 | 3300013045 | Bacteria | 741 |
| 388 | Ga0154014_128446 | 3300013052 | Bacteria | 843 |
| 389 | Ga0154012_175242 | 3300013059 | Bacteria | 850 |
| 390 | Ga0157373_10134868 | 3300013100 | Bacteria | 1736 |
| 391 | Ga0157373_10611236 | 3300013100 | Bacteria | 794 |
| 392 | Ga0157371_10022428 | 3300013102 | Bacteria | 4626 |
| 393 | Ga0157371_10228025 | 3300013102 | Bacteria | 1338 |
| 394 | Ga0157371_10318380 | 3300013102 | Bacteria | 1128 |
| 395 | Ga0157370_10857027 | 3300013104 | Bacteria | 825 |
| 396 | Ga0157369_10033117 | 3300013105 | Bacteria | 5681 |
| 397 | Ga0157369_10144213 | 3300013105 | Bacteria | 2518 |
| 398 | Ga0157369_10194793 | 3300013105 | Bacteria | 2129 |
| 399 | Ga0157369_10431851 | 3300013105 | Bacteria | 1365 |
| 400 | Ga0157369_11119600 | 3300013105 | Bacteria | 804 |
| 401 | Ga0157369_12013227 | 3300013105 | Bacteria | 586 |
| 402 | Ga0157369_12527135 | 3300013105 | Bacteria | 520 |
| 403 | Ga0157374_10298902 | 3300013296 | Bacteria | 1592 |
| 404 | Ga0157374_10431547 | 3300013296 | Bacteria | 1317 |
| 405 | Ga0157374_11725263 | 3300013296 | Bacteria | 651 |
| 406 | Ga0157374_12433564 | 3300013296 | Bacteria | 551 |
| 407 | Ga0157374_12704085 | 3300013296 | Bacteria | 524 |
| 408 | Ga0157378_10512846 | 3300013297 | Bacteria | 1199 |
| 409 | Ga0157378_10577237 | 3300013297 | Bacteria | 1133 |
| 410 | Ga0157378_11176869 | 3300013297 | Bacteria | 806 |
| 411 | Ga0163162_10074982 | 3300013306 | Bacteria | 3443 |
| 412 | Ga0163162_10174935 | 3300013306 | Bacteria | 2272 |
| 413 | Ga0163162_10422012 | 3300013306 | Bacteria | 1466 |
| 414 | Ga0163162_10528100 | 3300013306 | Bacteria | 1309 |
| 415 | Ga0163162_10707313 | 3300013306 | Bacteria | 1129 |
| 416 | Ga0163162_10880805 | 3300013306 | Bacteria | 1009 |
| 417 | Ga0163162_11036780 | 3300013306 | Bacteria | 928 |
| 418 | Ga0163162_11105428 | 3300013306 | Bacteria | 898 |
| 419 | Ga0163162_11248765 | 3300013306 | Bacteria | 844 |
| 420 | Ga0163162_11465456 | 3300013306 | Bacteria | 777 |
| 421 | Ga0157372_10007431 | 3300013307 | Bacteria | 11654 |
| 422 | Ga0157372_10674551 | 3300013307 | Bacteria | 1203 |
| 423 | Ga0157372_10708110 | 3300013307 | Bacteria | 1172 |
| 424 | Ga0157372_10735542 | 3300013307 | Bacteria | 1147 |
| 425 | Ga0157372_10795537 | 3300013307 | Bacteria | 1099 |
| 426 | Ga0157372_11104390 | 3300013307 | Bacteria | 917 |
| 427 | Ga0157375_10023903 | 3300013308 | Bacteria | 5645 |
| 428 | Ga0157375_10070571 | 3300013308 | Bacteria | 3504 |
| 429 | Ga0157375_10141322 | 3300013308 | Bacteria | 2535 |
| 430 | Ga0157375_10143340 | 3300013308 | Bacteria | 2518 |
| 431 | Ga0157375_10177777 | 3300013308 | Bacteria | 2279 |
| 432 | Ga0157375_10774101 | 3300013308 | Bacteria | 1110 |
| 433 | Ga0157375_11189236 | 3300013308 | Bacteria | 894 |
| 434 | Ga0163163_10001744 | 3300014325 | Bacteria | 18318 |
| 435 | Ga0163163_10202231 | 3300014325 | Bacteria | 2035 |
| 436 | Ga0163163_10324433 | 3300014325 | Bacteria | 1593 |
| 437 | Ga0163163_10517480 | 3300014325 | Bacteria | 1255 |
| 438 | Ga0163163_10748687 | 3300014325 | Bacteria | 1040 |
| 439 | Ga0163163_12323148 | 3300014325 | Bacteria | 595 |
| 440 | Ga0163163_12386739 | 3300014325 | Bacteria | 587 |
| 441 | Ga0157380_10046543 | 3300014326 | Bacteria | 3408 |
| 442 | Ga0157380_10130229 | 3300014326 | Bacteria | 2145 |
| 443 | Ga0157380_10706118 | 3300014326 | Bacteria | 1014 |
| 444 | Ga0182008_10010449 | 3300014497 | Bacteria | 4966 |
| 445 | Ga0182008_10068144 | 3300014497 | Bacteria | 1751 |
| 446 | Ga0182008_10120977 | 3300014497 | Bacteria | 1301 |
| 447 | Ga0182008_10157872 | 3300014497 | Bacteria | 1140 |
| 448 | Ga0182008_10513336 | 3300014497 | Bacteria | 661 |
| 449 | Ga0157377_10153939 | 3300014745 | Bacteria | 1424 |
| 450 | Ga0157377_10182311 | 3300014745 | Bacteria | 1321 |
| 451 | Ga0157379_10000244 | 3300014968 | Bacteria | 42729 |
| 452 | Ga0157379_10298909 | 3300014968 | Bacteria | 1467 |
| 453 | Ga0157379_10339812 | 3300014968 | Bacteria | 1373 |
| 454 | Ga0157379_11446460 | 3300014968 | Bacteria | 667 |
| 455 | Ga0157376_10504131 | 3300014969 | Bacteria | 1190 |
| 456 | Ga0157376_10635148 | 3300014969 | Bacteria | 1066 |
| 457 | Ga0157376_10913189 | 3300014969 | Bacteria | 897 |
| 458 | Ga0157376_11125065 | 3300014969 | Bacteria | 812 |
| 459 | Ga0157376_11497346 | 3300014969 | Bacteria | 708 |
| 460 | Ga0157376_12770240 | 3300014969 | Bacteria | 530 |
| 461 | Ga0182006_1083626 | 3300015261 | Bacteria | 1160 |
| 462 | Ga0182007_10001790 | 3300015262 | Bacteria | 11232 |
| 463 | Ga0182005_1044350 | 3300015265 | Bacteria | 1209 |
| 464 | Ga0182005_1146324 | 3300015265 | Bacteria | 685 |
| 465 | Ga0183367_1015 | 3300015688 | Bacteria | 298435 |
| 466 | Ga0163161_10201301 | 3300017792 | Bacteria | 1535 |
| 467 | Ga0163161_10299895 | 3300017792 | Bacteria | 1265 |
| 468 | Ga0163161_10414064 | 3300017792 | Bacteria | 1083 |
| 469 | Ga0163161_10639507 | 3300017792 | Bacteria | 880 |
| 470 | Ga0163161_12055477 | 3300017792 | Bacteria | 508 |
| 471 | Ga0184602_108449 | 3300019161 | Bacteria | 544 |
| 472 | Ga0184597_117329 | 3300019162 | Bacteria | 612 |
| 473 | Ga0184592_115343 | 3300019177 | Bacteria | 599 |
| 474 | Ga0184594_112558 | 3300019181 | Bacteria | 619 |
| 475 | Ga0184598_143521 | 3300019182 | Bacteria | 539 |
| 476 | Ga0184601_110102 | 3300019183 | Bacteria | 979 |
| 477 | Ga0184601_113589 | 3300019183 | Bacteria | 649 |
| 478 | Ga0184600_107951 | 3300019190 | Bacteria | 690 |
| 479 | Ga0184603_137011 | 3300019192 | Bacteria | 638 |
| 480 | Ga0184603_143072 | 3300019192 | Bacteria | 648 |
| 481 | Ga0197907_10020944 | 3300020069 | Bacteria | 750 |
| 482 | Ga0197907_10330890 | 3300020069 | Bacteria | 1099 |
| 483 | Ga0197907_11191419 | 3300020069 | Bacteria | 878 |
| 484 | Ga0206356_10190986 | 3300020070 | Bacteria | 1565 |
| 485 | Ga0206356_10961423 | 3300020070 | Bacteria | 923 |
| 486 | Ga0206356_10999422 | 3300020070 | Bacteria | 1266 |
| 487 | Ga0206356_11074086 | 3300020070 | Bacteria | 850 |
| 488 | Ga0206349_1348860 | 3300020075 | Bacteria | 500 |
| 489 | Ga0206349_1883902 | 3300020075 | Bacteria | 1174 |
| 490 | Ga0206355_1091284 | 3300020076 | Bacteria | 660 |
| 491 | Ga0206351_10065153 | 3300020077 | Bacteria | 812 |
| 492 | Ga0206351_10146335 | 3300020077 | Bacteria | 592 |
| 493 | Ga0206352_10089945 | 3300020078 | Bacteria | 504 |
| 494 | Ga0206352_10201730 | 3300020078 | Bacteria | 1153 |
| 495 | Ga0206352_10411800 | 3300020078 | Bacteria | 691 |
| 496 | Ga0206352_10622047 | 3300020078 | Bacteria | 1132 |
| 497 | Ga0206350_10023960 | 3300020080 | Bacteria | 570 |
| 498 | Ga0206350_10191192 | 3300020080 | Bacteria | 1155 |
| 499 | Ga0206350_10683474 | 3300020080 | Bacteria | 841 |
| 500 | Ga0206350_11029574 | 3300020080 | Bacteria | 520 |
| 501 | Ga0206350_11489402 | 3300020080 | Bacteria | 724 |
| 502 | Ga0206350_11630090 | 3300020080 | Bacteria | 628 |
| 503 | Ga0206354_10543560 | 3300020081 | Bacteria | 855 |
| 504 | Ga0206354_10709520 | 3300020081 | Bacteria | 595 |
| 505 | Ga0206354_11311593 | 3300020081 | Bacteria | 1317 |
| 506 | Ga0206353_10288552 | 3300020082 | Bacteria | 5098 |
| 507 | Ga0206353_10468191 | 3300020082 | Bacteria | 811 |
| 508 | Ga0206353_11120483 | 3300020082 | Bacteria | 768 |
| 509 | Ga0206353_11270550 | 3300020082 | Bacteria | 682 |
| 510 | Ga0206353_12052037 | 3300020082 | Bacteria | 502 |
| 511 | Ga0213874_10388286 | 3300021377 | Bacteria | 541 |
| 512 | Ga0213876_10446852 | 3300021384 | Bacteria | 688 |
| 513 | Ga0213875_10010893 | 3300021388 | Bacteria | 4545 |
| 514 | Ga0213875_10014384 | 3300021388 | Bacteria | 3861 |
| 515 | Ga0213875_10021112 | 3300021388 | Bacteria | 3122 |
| 516 | Ga0213875_10043268 | 3300021388 | Bacteria | 2115 |
| 517 | Ga0213875_10091833 | 3300021388 | Bacteria | 1416 |
| 518 | Ga0256744_107144 | 3300023309 | Bacteria | 801 |
| 519 | Ga0256720_106636 | 3300023438 | Bacteria | 712 |
| 520 | Ga0247551_104190 | 3300023552 | Bacteria | 572 |
| 521 | Ga0247550_104409 | 3300023660 | Bacteria | 535 |
| 522 | Ga0224572_1023820 | 3300024225 | Bacteria | 1176 |
| 523 | Ga0228598_1052773 | 3300024227 | Bacteria | 807 |
| 524 | Ga0209758_1007513 | 3300025297 | Bacteria | 7389 |
| 525 | Ga0207426_1002952 | 3300025302 | Bacteria | 9979 |
| 526 | Ga0207426_1023641 | 3300025302 | Bacteria | 2095 |
| 527 | Ga0207697_10179633 | 3300025315 | Bacteria | 927 |
| 528 | Ga0207656_10166207 | 3300025321 | Bacteria | 1052 |
| 529 | Ga0207696_1079044 | 3300025711 | Bacteria | 909 |
| 530 | Ga0207655_1112249 | 3300025728 | Bacteria | 918 |
| 531 | Ga0207713_1122796 | 3300025735 | Bacteria | 869 |
| 532 | Ga0207713_1143564 | 3300025735 | Bacteria | 777 |
| 533 | Ga0207653_10012809 | 3300025885 | Bacteria | 2622 |
| 534 | Ga0207692_10022809 | 3300025898 | Bacteria | 2886 |
| 535 | Ga0207642_10018159 | 3300025899 | Bacteria | 2693 |
| 536 | Ga0207642_10588149 | 3300025899 | Bacteria | 691 |
| 537 | Ga0207710_10000063 | 3300025900 | Bacteria | 163065 |
| 538 | Ga0207710_10053403 | 3300025900 | Bacteria | 1818 |
| 539 | Ga0207710_10314609 | 3300025900 | Bacteria | 793 |
| 540 | Ga0207688_10009737 | 3300025901 | Bacteria | 5230 |
| 541 | Ga0207688_10123060 | 3300025901 | Bacteria | 1515 |
| 542 | Ga0207680_10607719 | 3300025903 | Bacteria | 782 |
| 543 | Ga0207647_10014108 | 3300025904 | Bacteria | 5519 |
| 544 | Ga0207647_10037539 | 3300025904 | Bacteria | 3071 |
| 545 | Ga0207647_10041665 | 3300025904 | Bacteria | 2885 |
| 546 | Ga0207647_10223703 | 3300025904 | Bacteria | 1084 |
| 547 | Ga0207647_10225604 | 3300025904 | Bacteria | 1079 |
| 548 | Ga0207685_10359099 | 3300025905 | Bacteria | 737 |
| 549 | Ga0207699_10085697 | 3300025906 | Bacteria | 1965 |
| 550 | Ga0207699_10144157 | 3300025906 | Bacteria | 1568 |
| 551 | Ga0207699_10145888 | 3300025906 | Bacteria | 1560 |
| 552 | Ga0207699_10199061 | 3300025906 | Bacteria | 1356 |
| 553 | Ga0207645_10210798 | 3300025907 | Bacteria | 1280 |
| 554 | Ga0207645_10806729 | 3300025907 | Bacteria | 638 |
| 555 | Ga0207643_10012094 | 3300025908 | Bacteria | 4663 |
| 556 | Ga0207643_10360401 | 3300025908 | Bacteria | 914 |
| 557 | Ga0207705_10044132 | 3300025909 | Bacteria | 3204 |
| 558 | Ga0207705_10068197 | 3300025909 | Bacteria | 2575 |
| 559 | Ga0207684_10000323 | 3300025910 | Bacteria | 67693 |
| 560 | Ga0207684_10003999 | 3300025910 | Bacteria | 14104 |
| 561 | Ga0207684_10025297 | 3300025910 | Bacteria | 5058 |
| 562 | Ga0207684_10026466 | 3300025910 | Bacteria | 4945 |
| 563 | Ga0207684_10290158 | 3300025910 | Bacteria | 1411 |
| 564 | Ga0207654_10140334 | 3300025911 | Bacteria | 1540 |
| 565 | Ga0207654_10996818 | 3300025911 | Bacteria | 609 |
| 566 | Ga0207654_11169214 | 3300025911 | Bacteria | 561 |
| 567 | Ga0207707_10129156 | 3300025912 | Bacteria | 2210 |
| 568 | Ga0207707_10255224 | 3300025912 | Bacteria | 1522 |
| 569 | Ga0207671_10092256 | 3300025914 | Bacteria | 2283 |
| 570 | Ga0207671_10527437 | 3300025914 | Bacteria | 942 |
| 571 | Ga0207693_10136892 | 3300025915 | Bacteria | 1926 |
| 572 | Ga0207663_10037969 | 3300025916 | Bacteria | 2907 |
| 573 | Ga0207663_10196750 | 3300025916 | Bacteria | 1451 |
| 574 | Ga0207663_10271298 | 3300025916 | Bacteria | 1257 |
| 575 | Ga0207660_10166316 | 3300025917 | Bacteria | 1705 |
| 576 | Ga0207660_10498001 | 3300025917 | Bacteria | 988 |
| 577 | Ga0207662_10010759 | 3300025918 | Bacteria | 5058 |
| 578 | Ga0207662_10021726 | 3300025918 | Bacteria | 3671 |
| 579 | Ga0207662_10406991 | 3300025918 | Bacteria | 924 |
| 580 | Ga0207657_10359817 | 3300025919 | Bacteria | 1147 |
| 581 | Ga0207649_10315744 | 3300025920 | Bacteria | 1146 |
| 582 | Ga0207652_10048985 | 3300025921 | Bacteria | 3614 |
| 583 | Ga0207652_10245227 | 3300025921 | Bacteria | 1615 |
| 584 | Ga0207652_10468835 | 3300025921 | Bacteria | 1134 |
| 585 | Ga0207652_10569951 | 3300025921 | Bacteria | 1017 |
| 586 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 587 | Ga0207646_10010964 | 3300025922 | Bacteria | 8799 |
| 588 | Ga0207646_10049754 | 3300025922 | Bacteria | 3753 |
| 589 | Ga0207646_10080435 | 3300025922 | Bacteria | 2913 |
| 590 | Ga0207681_10486294 | 3300025923 | Bacteria | 1009 |
| 591 | Ga0207694_10377850 | 3300025924 | Bacteria | 1176 |
| 592 | Ga0207694_10522052 | 3300025924 | Bacteria | 995 |
| 593 | Ga0207694_10624516 | 3300025924 | Bacteria | 907 |
| 594 | Ga0207694_10870613 | 3300025924 | Bacteria | 761 |
| 595 | Ga0207694_11852782 | 3300025924 | Bacteria | 506 |
| 596 | Ga0207659_10060860 | 3300025926 | Bacteria | 2719 |
| 597 | Ga0207659_11507007 | 3300025926 | Bacteria | 575 |
| 598 | Ga0207687_10028232 | 3300025927 | Bacteria | 3770 |
| 599 | Ga0207687_10402100 | 3300025927 | Bacteria | 1127 |
| 600 | Ga0207687_10456677 | 3300025927 | Bacteria | 1060 |
| 601 | Ga0207687_10701281 | 3300025927 | Bacteria | 859 |
| 602 | Ga0207687_11623537 | 3300025927 | Bacteria | 555 |
| 603 | Ga0207687_11873861 | 3300025927 | Bacteria | 513 |
| 604 | Ga0207700_10009909 | 3300025928 | Bacteria | 5980 |
| 605 | Ga0207700_10049581 | 3300025928 | Bacteria | 3124 |
| 606 | Ga0207700_10059951 | 3300025928 | Bacteria | 2880 |
| 607 | Ga0207700_10282417 | 3300025928 | Bacteria | 1428 |
| 608 | Ga0207664_10019743 | 3300025929 | Bacteria | 4988 |
| 609 | Ga0207664_10054930 | 3300025929 | Bacteria | 3158 |
| 610 | Ga0207664_10111576 | 3300025929 | Bacteria | 2275 |
| 611 | Ga0207664_10209663 | 3300025929 | Bacteria | 1685 |
| 612 | Ga0207664_10866446 | 3300025929 | Bacteria | 812 |
| 613 | Ga0207644_10879720 | 3300025931 | Bacteria | 750 |
| 614 | Ga0207690_10104502 | 3300025932 | Bacteria | 2029 |
| 615 | Ga0207706_10007021 | 3300025933 | Bacteria | 10410 |
| 616 | Ga0207706_10030756 | 3300025933 | Bacteria | 4788 |
| 617 | Ga0207706_10361206 | 3300025933 | Bacteria | 1262 |
| 618 | Ga0207706_11058925 | 3300025933 | Bacteria | 679 |
| 619 | Ga0207686_10700334 | 3300025934 | Bacteria | 805 |
| 620 | Ga0207709_10376918 | 3300025935 | Bacteria | 1079 |
| 621 | Ga0207709_10489606 | 3300025935 | Bacteria | 958 |
| 622 | Ga0207670_10563490 | 3300025936 | Bacteria | 932 |
| 623 | Ga0207670_11814002 | 3300025936 | Bacteria | 519 |
| 624 | Ga0207669_10094765 | 3300025937 | Bacteria | 1955 |
| 625 | Ga0207669_10280657 | 3300025937 | Bacteria | 1256 |
| 626 | Ga0207669_10500645 | 3300025937 | Bacteria | 972 |
| 627 | Ga0207669_10764015 | 3300025937 | Bacteria | 799 |
| 628 | Ga0207704_10017490 | 3300025938 | Bacteria | 3719 |
| 629 | Ga0207704_10285045 | 3300025938 | Bacteria | 1257 |
| 630 | Ga0207704_10495950 | 3300025938 | Bacteria | 983 |
| 631 | Ga0207704_11124433 | 3300025938 | Bacteria | 668 |
| 632 | Ga0207691_10049713 | 3300025940 | Bacteria | 3842 |
| 633 | Ga0207691_10064364 | 3300025940 | Bacteria | 3322 |
| 634 | Ga0207691_10093203 | 3300025940 | Bacteria | 2697 |
| 635 | Ga0207711_10000262 | 3300025941 | Bacteria | 57199 |
| 636 | Ga0207711_10172030 | 3300025941 | Bacteria | 1966 |
| 637 | Ga0207711_10218658 | 3300025941 | Bacteria | 1742 |
| 638 | Ga0207711_10220819 | 3300025941 | Bacteria | 1733 |
| 639 | Ga0207711_10579701 | 3300025941 | Bacteria | 1046 |
| 640 | Ga0207711_11430804 | 3300025941 | Bacteria | 634 |
| 641 | Ga0207689_10086579 | 3300025942 | Bacteria | 2575 |
| 642 | Ga0207689_10389027 | 3300025942 | Bacteria | 1162 |
| 643 | Ga0207661_10006353 | 3300025944 | Bacteria | 8360 |
| 644 | Ga0207661_10037782 | 3300025944 | Bacteria | 3779 |
| 645 | Ga0207661_10075721 | 3300025944 | Bacteria | 2762 |
| 646 | Ga0207661_10161016 | 3300025944 | Bacteria | 1947 |
| 647 | Ga0207661_10220843 | 3300025944 | Bacteria | 1675 |
| 648 | Ga0207661_10273270 | 3300025944 | Bacteria | 1508 |
| 649 | Ga0207661_10793411 | 3300025944 | Bacteria | 872 |
| 650 | Ga0207661_11252526 | 3300025944 | Bacteria | 682 |
| 651 | Ga0207661_11779833 | 3300025944 | Bacteria | 562 |
| 652 | Ga0207679_10028246 | 3300025945 | Bacteria | 3890 |
| 653 | Ga0207679_10117036 | 3300025945 | Bacteria | 2114 |
| 654 | Ga0207679_10405464 | 3300025945 | Bacteria | 1200 |
| 655 | Ga0207679_10631475 | 3300025945 | Bacteria | 967 |
| 656 | Ga0207667_10136334 | 3300025949 | Bacteria | 2527 |
| 657 | Ga0207667_10547594 | 3300025949 | Bacteria | 1170 |
| 658 | Ga0207651_10465055 | 3300025960 | Bacteria | 1087 |
| 659 | Ga0207651_11157811 | 3300025960 | Bacteria | 694 |
| 660 | Ga0207651_11219586 | 3300025960 | Bacteria | 676 |
| 661 | Ga0207712_10003504 | 3300025961 | Bacteria | 9902 |
| 662 | Ga0207712_10070104 | 3300025961 | Bacteria | 2517 |
| 663 | Ga0207712_10084335 | 3300025961 | Bacteria | 2321 |
| 664 | Ga0207712_10339816 | 3300025961 | Bacteria | 1245 |
| 665 | Ga0207712_10377343 | 3300025961 | Bacteria | 1186 |
| 666 | Ga0207712_10516901 | 3300025961 | Bacteria | 1023 |
| 667 | Ga0207668_10241812 | 3300025972 | Bacteria | 1461 |
| 668 | Ga0207668_10385891 | 3300025972 | Bacteria | 1180 |
| 669 | Ga0207668_10550797 | 3300025972 | Bacteria | 999 |
| 670 | Ga0207668_11055284 | 3300025972 | Bacteria | 727 |
| 671 | Ga0207668_11366594 | 3300025972 | Bacteria | 638 |
| 672 | Ga0207640_10119910 | 3300025981 | Bacteria | 1882 |
| 673 | Ga0207640_10597600 | 3300025981 | Bacteria | 934 |
| 674 | Ga0207658_10100738 | 3300025986 | Bacteria | 2262 |
| 675 | Ga0207658_10146621 | 3300025986 | Bacteria | 1918 |
| 676 | Ga0207677_10534649 | 3300026023 | Bacteria | 1019 |
| 677 | Ga0207677_10859690 | 3300026023 | Bacteria | 815 |
| 678 | Ga0207677_12110009 | 3300026023 | Bacteria | 524 |
| 679 | Ga0207703_10000177 | 3300026035 | Bacteria | 74044 |
| 680 | Ga0207703_10060180 | 3300026035 | Bacteria | 3105 |
| 681 | Ga0207703_10291059 | 3300026035 | Bacteria | 1486 |
| 682 | Ga0207703_10435284 | 3300026035 | Bacteria | 1223 |
| 683 | Ga0207639_10194589 | 3300026041 | Bacteria | 1734 |
| 684 | Ga0207639_10307058 | 3300026041 | Bacteria | 1404 |
| 685 | Ga0207639_10526472 | 3300026041 | Bacteria | 1083 |
| 686 | Ga0207639_10533025 | 3300026041 | Bacteria | 1076 |
| 687 | Ga0207639_10677230 | 3300026041 | Bacteria | 956 |
| 688 | Ga0207639_10812575 | 3300026041 | Bacteria | 871 |
| 689 | Ga0207678_10176582 | 3300026067 | Bacteria | 1824 |
| 690 | Ga0207678_10703577 | 3300026067 | Bacteria | 889 |
| 691 | Ga0207708_10394412 | 3300026075 | Bacteria | 1143 |
| 692 | Ga0207702_10055808 | 3300026078 | Bacteria | 3351 |
| 693 | Ga0207702_10705408 | 3300026078 | Bacteria | 994 |
| 694 | Ga0207702_10968486 | 3300026078 | Bacteria | 844 |
| 695 | Ga0207641_10114337 | 3300026088 | Bacteria | 2398 |
| 696 | Ga0207641_10164144 | 3300026088 | Bacteria | 2021 |
| 697 | Ga0207648_10757287 | 3300026089 | Bacteria | 902 |
| 698 | Ga0207648_10916306 | 3300026089 | Bacteria | 819 |
| 699 | Ga0207676_10203983 | 3300026095 | Bacteria | 1749 |
| 700 | Ga0207676_10875729 | 3300026095 | Bacteria | 879 |
| 701 | Ga0207676_11596193 | 3300026095 | Bacteria | 650 |
| 702 | Ga0207676_11690920 | 3300026095 | Bacteria | 631 |
| 703 | Ga0207674_10007680 | 3300026116 | Bacteria | 12555 |
| 704 | Ga0207674_10127860 | 3300026116 | Bacteria | 2505 |
| 705 | Ga0207674_10271280 | 3300026116 | Bacteria | 1644 |
| 706 | Ga0207674_10679861 | 3300026116 | Bacteria | 994 |
| 707 | Ga0207675_100004621 | 3300026118 | Bacteria | 13272 |
| 708 | Ga0207675_100341405 | 3300026118 | Bacteria | 1466 |
| 709 | Ga0207683_10018022 | 3300026121 | Bacteria | 6021 |
| 710 | Ga0207683_10047963 | 3300026121 | Bacteria | 3740 |
| 711 | Ga0207683_10617663 | 3300026121 | Bacteria | 1004 |
| 712 | Ga0207683_11168306 | 3300026121 | Bacteria | 713 |
| 713 | Ga0207698_10164039 | 3300026142 | Bacteria | 1947 |
| 714 | Ga0207698_10431400 | 3300026142 | Bacteria | 1267 |
| 715 | Ga0207698_10595612 | 3300026142 | Bacteria | 1089 |
| 716 | Ga0207698_11102703 | 3300026142 | Bacteria | 806 |
| 717 | Ga0209371_1010646 | 3300027312 | Bacteria | 2806 |
| 718 | Ga0209371_1048649 | 3300027312 | Bacteria | 823 |
| 719 | Ga0209179_1046444 | 3300027512 | Bacteria | 923 |
| 720 | Ga0209813_10006215 | 3300027866 | Bacteria | 2941 |
| 721 | Ga0209813_10046968 | 3300027866 | Bacteria | 1336 |
| 722 | Ga0207428_10000746 | 3300027907 | Bacteria | 37223 |
| 723 | Ga0207428_11065745 | 3300027907 | Bacteria | 566 |
| 724 | Ga0265358_103167 | 3300028010 | Bacteria | 586 |
| 725 | Ga0268266_10006911 | 3300028379 | Bacteria | 10323 |
| 726 | Ga0268266_10471278 | 3300028379 | Bacteria | 1196 |
| 727 | Ga0268266_10656186 | 3300028379 | Bacteria | 1010 |
| 728 | Ga0268266_10920754 | 3300028379 | Bacteria | 845 |
| 729 | Ga0268266_11023416 | 3300028379 | Bacteria | 799 |
| 730 | Ga0268266_11687320 | 3300028379 | Bacteria | 609 |
| 731 | Ga0268265_10000157 | 3300028380 | Bacteria | 83507 |
| 732 | Ga0268265_10705489 | 3300028380 | Bacteria | 975 |
| 733 | Ga0268264_10199983 | 3300028381 | Bacteria | 1827 |
| 734 | Ga0268264_10213603 | 3300028381 | Bacteria | 1772 |
| 735 | Ga0307517_10005207 | 3300028786 | Bacteria | 19701 |
| 736 | Ga0307517_10020973 | 3300028786 | Bacteria | 8287 |
| 737 | Ga0307517_10640450 | 3300028786 | Bacteria | 518 |
| 738 | Ga0307515_10002733 | 3300028794 | Bacteria | 37739 |
| 739 | Ga0307515_10180880 | 3300028794 | Bacteria | 2059 |
| 740 | Ga0307515_10198377 | 3300028794 | Bacteria | 1891 |
| 741 | Ga0311004_111916 | 3300029276 | Bacteria | 649 |
| 742 | Ga0311011_118056 | 3300029280 | Bacteria | 518 |
| 743 | Ga0311003_171176 | 3300029282 | Bacteria | 736 |
| 744 | Ga0310981_1001123 | 3300029285 | Bacteria | 699 |
| 745 | Ga0268256_1027239 | 3300030500 | Bacteria | 1425 |
| 746 | Ga0268256_1045482 | 3300030500 | Bacteria | 956 |
| 747 | Ga0307511_10009089 | 3300030521 | Bacteria | 9910 |
| 748 | Ga0307511_10056074 | 3300030521 | Bacteria | 3086 |
| 749 | Ga0307511_10064446 | 3300030521 | Bacteria | 2755 |
| 750 | Ga0307512_10000978 | 3300030522 | Bacteria | 42035 |
| 751 | Ga0307512_10106890 | 3300030522 | Bacteria | 1864 |
| 752 | Ga0307512_10116842 | 3300030522 | Bacteria | 1731 |
| 753 | Ga0316176_1020167 | 3300030732 | Bacteria | 659 |
| 754 | Ga0314311_1121511 | 3300030733 | Bacteria | 503 |
| 755 | Ga0316181_1125764 | 3300030744 | Bacteria | 698 |
| 756 | Ga0265762_1031578 | 3300030760 | Bacteria | 1008 |
| 757 | Ga0265767_113326 | 3300030836 | Bacteria | 576 |
| 758 | Ga0265766_1025010 | 3300030863 | Bacteria | 510 |
| 759 | Ga0265777_120614 | 3300030877 | Bacteria | 543 |
| 760 | Ga0265769_103274 | 3300030888 | Bacteria | 895 |
| 761 | Ga0265769_111646 | 3300030888 | Bacteria | 614 |
| 762 | Ga0247549_101801 | 3300030942 | Bacteria | 733 |
| 763 | Ga0265773_1013629 | 3300031018 | Bacteria | 728 |
| 764 | Ga0265760_10260592 | 3300031090 | Bacteria | 603 |
| 765 | Ga0265760_10384268 | 3300031090 | Bacteria | 505 |
| 766 | Ga0307513_10004736 | 3300031456 | Bacteria | 18076 |
| 767 | Ga0307513_10113346 | 3300031456 | Bacteria | 2699 |
| 768 | Ga0307509_10152597 | 3300031507 | Bacteria | 2222 |
| 769 | Ga0307509_10358154 | 3300031507 | Bacteria | 1179 |
| 770 | Ga0307408_100098861 | 3300031548 | Bacteria | 2219 |
| 771 | Ga0307408_100369173 | 3300031548 | Bacteria | 1223 |
| 772 | Ga0307408_101808301 | 3300031548 | Bacteria | 584 |
| 773 | Ga0310117_130551 | 3300031592 | Bacteria | 522 |
| 774 | Ga0307508_10003041 | 3300031616 | Bacteria | 17266 |
| 775 | Ga0307508_10006924 | 3300031616 | Bacteria | 10590 |
| 776 | Ga0307508_10021357 | 3300031616 | Bacteria | 5885 |
| 777 | Ga0307508_10031756 | 3300031616 | Bacteria | 4772 |
| 778 | Ga0307508_10032362 | 3300031616 | Bacteria | 4724 |
| 779 | Ga0307514_10004614 | 3300031649 | Bacteria | 12633 |
| 780 | Ga0307514_10065598 | 3300031649 | Bacteria | 2749 |
| 781 | Ga0307514_10079606 | 3300031649 | Bacteria | 2428 |
| 782 | Ga0307514_10150704 | 3300031649 | Bacteria | 1561 |
| 783 | Ga0307514_10193945 | 3300031649 | Bacteria | 1288 |
| 784 | Ga0307514_10470290 | 3300031649 | Bacteria | 610 |
| 785 | Ga0316579_10000328 | 3300031691 | Bacteria | 14833 |
| 786 | Ga0307516_10006026 | 3300031730 | Bacteria | 14331 |
| 787 | Ga0307516_10042521 | 3300031730 | Bacteria | 4507 |
| 788 | Ga0307516_10045929 | 3300031730 | Bacteria | 4311 |
| 789 | Ga0307516_10174417 | 3300031730 | Bacteria | 1888 |
| 790 | Ga0307516_10270151 | 3300031730 | Bacteria | 1387 |
| 791 | Ga0307405_10070066 | 3300031731 | Bacteria | 2250 |
| 792 | Ga0307405_10130872 | 3300031731 | Bacteria | 1733 |
| 793 | Ga0307405_10238915 | 3300031731 | Bacteria | 1344 |
| 794 | Ga0307405_10353959 | 3300031731 | Bacteria | 1134 |
| 795 | Ga0307405_11153043 | 3300031731 | Bacteria | 668 |
| 796 | Ga0247548_109156 | 3300031814 | Bacteria | 507 |
| 797 | Ga0307413_10208780 | 3300031824 | Bacteria | 1416 |
| 798 | Ga0307413_10318519 | 3300031824 | Bacteria | 1187 |
| 799 | Ga0307413_10959959 | 3300031824 | Bacteria | 730 |
| 800 | Ga0307413_11079886 | 3300031824 | Bacteria | 692 |
| 801 | Ga0307413_11144871 | 3300031824 | Bacteria | 674 |
| 802 | Ga0307413_12099579 | 3300031824 | Bacteria | 511 |
| 803 | Ga0307518_10271667 | 3300031838 | Bacteria | 1057 |
| 804 | Ga0307518_10496883 | 3300031838 | Bacteria | 630 |
| 805 | Ga0307410_10307516 | 3300031852 | Bacteria | 1253 |
| 806 | Ga0307410_10313855 | 3300031852 | Bacteria | 1241 |
| 807 | Ga0307410_10349428 | 3300031852 | Bacteria | 1181 |
| 808 | Ga0307410_10741692 | 3300031852 | Bacteria | 831 |
| 809 | Ga0307410_10746639 | 3300031852 | Bacteria | 828 |
| 810 | Ga0307410_10948187 | 3300031852 | Bacteria | 739 |
| 811 | Ga0307406_10002457 | 3300031901 | Bacteria | 10095 |
| 812 | Ga0307406_10236338 | 3300031901 | Bacteria | 1368 |
| 813 | Ga0307406_10344747 | 3300031901 | Bacteria | 1162 |
| 814 | Ga0307406_10366146 | 3300031901 | Bacteria | 1132 |
| 815 | Ga0307406_10931124 | 3300031901 | Bacteria | 741 |
| 816 | Ga0307407_10004890 | 3300031903 | Bacteria | 5749 |
| 817 | Ga0307407_10118915 | 3300031903 | Bacteria | 1671 |
| 818 | Ga0307407_10186109 | 3300031903 | Bacteria | 1380 |
| 819 | Ga0307407_10188999 | 3300031903 | Bacteria | 1371 |
| 820 | Ga0307407_10264749 | 3300031903 | Bacteria | 1184 |
| 821 | Ga0307407_11673987 | 3300031903 | Bacteria | 506 |
| 822 | Ga0307412_12164622 | 3300031911 | Bacteria | 517 |
| 823 | Ga0307412_12179546 | 3300031911 | Bacteria | 515 |
| 824 | Ga0307409_100086978 | 3300031995 | Bacteria | 2545 |
| 825 | Ga0307409_100117795 | 3300031995 | Bacteria | 2242 |
| 826 | Ga0307409_100125730 | 3300031995 | Bacteria | 2180 |
| 827 | Ga0307409_100175929 | 3300031995 | Bacteria | 1889 |
| 828 | Ga0307409_100185185 | 3300031995 | Bacteria | 1847 |
| 829 | Ga0307409_100219696 | 3300031995 | Bacteria | 1715 |
| 830 | Ga0307409_100250976 | 3300031995 | Bacteria | 1617 |
| 831 | Ga0307409_100536155 | 3300031995 | Bacteria | 1146 |
| 832 | Ga0307409_101069328 | 3300031995 | Bacteria | 827 |
| 833 | Ga0307409_101496822 | 3300031995 | Bacteria | 702 |
| 834 | Ga0307409_101504080 | 3300031995 | Bacteria | 701 |
| 835 | Ga0307416_100013543 | 3300032002 | Bacteria | 5549 |
| 836 | Ga0307416_100084802 | 3300032002 | Bacteria | 2693 |
| 837 | Ga0307416_100132425 | 3300032002 | Bacteria | 2247 |
| 838 | Ga0307416_100172457 | 3300032002 | Bacteria | 2016 |
| 839 | Ga0307416_100185041 | 3300032002 | Bacteria | 1957 |
| 840 | Ga0307416_100268549 | 3300032002 | Bacteria | 1673 |
| 841 | Ga0307416_100513117 | 3300032002 | Bacteria | 1265 |
| 842 | Ga0307416_100739515 | 3300032002 | Bacteria | 1075 |
| 843 | Ga0307416_103849482 | 3300032002 | Bacteria | 502 |
| 844 | Ga0307414_10053800 | 3300032004 | Bacteria | 2810 |
| 845 | Ga0307414_10518567 | 3300032004 | Bacteria | 1057 |
| 846 | Ga0307414_10614309 | 3300032004 | Bacteria | 976 |
| 847 | Ga0307414_10622902 | 3300032004 | Bacteria | 970 |
| 848 | Ga0307414_10784003 | 3300032004 | Bacteria | 868 |
| 849 | Ga0307411_10399432 | 3300032005 | Bacteria | 1136 |
| 850 | Ga0316053_110460 | 3300032120 | Bacteria | 646 |
| 851 | Ga0316053_116349 | 3300032120 | Bacteria | 558 |
| 852 | Ga0307415_100205662 | 3300032126 | Bacteria | 1566 |
| 853 | Ga0307415_100300998 | 3300032126 | Bacteria | 1328 |
| 854 | Ga0307415_100341059 | 3300032126 | Bacteria | 1257 |
| 855 | Ga0307415_100438127 | 3300032126 | Bacteria | 1126 |
| 856 | Ga0307415_102440217 | 3300032126 | Bacteria | 514 |
| 857 | Ga0307507_10202106 | 3300033179 | Bacteria | 1372 |
| 858 | Ga0307510_10076999 | 3300033180 | Bacteria | 3275 |
| 859 | Ga0307510_10168105 | 3300033180 | Bacteria | 1777 |
| 860 | Ga0307510_10209614 | 3300033180 | Bacteria | 1472 |
| 861 | Ga0373930_0015524 | 3300034816 | Bacteria | 1430 |
| 862 | Ga0373948_0001671 | 3300034817 | Bacteria | 3135 |
| 863 | Ga0373958_0009242 | 3300034819 | Bacteria | 1618 |
| 864 | Ga0373958_0132026 | 3300034819 | Bacteria | 612 |
| 865 | Ga0373926_0004416 | 3300035083 | Bacteria | 4612 |
| 866 | Ga0373926_0010520 | 3300035083 | Bacteria | 3102 |
| 867 | Ga0373926_0241544 | 3300035083 | Bacteria | 699 |
| 868 | Ga0373929_0021923 | 3300035085 | Bacteria | 1300 |
| 869 | Ga0373934_0004079 | 3300035086 | Bacteria | 5383 |
| 870 | Ga0373934_0004937 | 3300035086 | Bacteria | 4939 |
| 871 | Ga0373934_0016920 | 3300035086 | Bacteria | 2776 |
| 872 | Ga0373940_0069054 | 3300035088 | Bacteria | 1025 |
| 873 | Ga0373944_0012091 | 3300035089 | Bacteria | 2374 |
| 874 | Ga0373944_0016653 | 3300035089 | Bacteria | 2076 |
| 875 | Ga0373949_0021772 | 3300035090 | Bacteria | 1474 |
| 876 | Ga0373951_0084344 | 3300035091 | Bacteria | 826 |
| 877 | Ga0373952_0043549 | 3300035092 | Bacteria | 1046 |
| 878 | Ga0373923_0000472 | 3300035111 | Bacteria | 9588 |
| 879 | Ga0373932_0013806 | 3300035112 | Bacteria | 2018 |
| 880 | Ga0373936_0001921 | 3300035113 | Bacteria | 7677 |
| 881 | Ga0373936_0001930 | 3300035113 | Bacteria | 7666 |
| 882 | Ga0373936_0006056 | 3300035113 | Bacteria | 4558 |
| 883 | Ga0373936_0101916 | 3300035113 | Bacteria | 1212 |
| 884 | Ga0373939_0219320 | 3300035114 | Bacteria | 727 |
| 885 | Ga0373945_0000693 | 3300035116 | Bacteria | 9746 |
| 886 | Ga0373945_0003551 | 3300035116 | Bacteria | 4909 |
| 887 | Ga0373953_0009915 | 3300035117 | Bacteria | 3299 |
| 888 | Ga0373953_0033274 | 3300035117 | Bacteria | 2015 |
| 889 | Ga0373953_0124333 | 3300035117 | Bacteria | 1097 |
| 890 | Ga0373954_0011407 | 3300035118 | Bacteria | 3938 |
| 891 | Ga0373954_0036506 | 3300035118 | Bacteria | 2281 |
| 892 | Ga0373956_0199385 | 3300035119 | Bacteria | 948 |
| 893 | Ga0373956_0385432 | 3300035119 | Bacteria | 668 |
| 894 | Ga0373957_0003369 | 3300035120 | Bacteria | 4713 |
| 895 | Ga0373957_0005890 | 3300035120 | Bacteria | 3829 |
| 896 | Ga0373957_0036898 | 3300035120 | Bacteria | 1823 |
| 897 | Ga0373957_0160119 | 3300035120 | Bacteria | 927 |
| 898 | Ga0373960_0025527 | 3300035121 | Bacteria | 1607 |
| 899 | Ga0373943_0000869 | 3300035170 | Bacteria | 13282 |
| 900 | Ga0373943_0222164 | 3300035170 | Bacteria | 1052 |
| 901 | Ga0373946_0002754 | 3300035171 | Bacteria | 6216 |
| 902 | Ga0373946_0005561 | 3300035171 | Bacteria | 4547 |
| 903 | Ga0373946_0067320 | 3300035171 | Bacteria | 1538 |
| 904 | Ga0373946_0223373 | 3300035171 | Bacteria | 910 |
| 905 | Ga0373955_0013636 | 3300035172 | Bacteria | 3936 |
| 906 | Ga0373955_0025416 | 3300035172 | Bacteria | 3040 |
| 907 | Ga0373955_0032656 | 3300035172 | Bacteria | 2734 |
| 908 | Ga0373955_0047998 | 3300035172 | Bacteria | 2313 |
| 909 | Ga0373961_0145265 | 3300035241 | Bacteria | 804 |
| 910 | Ga0373962_0041763 | 3300035242 | Bacteria | 1294 |
| 911 | Ga0373924_0015260 | 3300035410 | Bacteria | 2918 |
| 912 | Ga0373924_0036299 | 3300035410 | Bacteria | 2002 |
| 913 | Ga0373924_0216213 | 3300035410 | Bacteria | 846 |
| 914 | Ga0373931_0912112 | 3300035691 | Bacteria | 591 |
| 915 | Ga0373935_0002772 | 3300035692 | Bacteria | 10079 |
| 916 | Ga0373935_0019853 | 3300035692 | Bacteria | 4101 |
| 917 | Ga0373935_0246278 | 3300035692 | Bacteria | 1249 |
| 918 | Ga0373927_0005785 | 3300035695 | Bacteria | 8484 |
| 919 | Ga0373927_0011649 | 3300035695 | Bacteria | 5852 |
| 920 | Ga0373927_0182495 | 3300035695 | Bacteria | 1376 |
| 921 | Ga0373933_0069093 | 3300035724 | Bacteria | 2146 |
| 922 | Ga0373933_0160858 | 3300035724 | Bacteria | 1425 |
| 923 | Ga0373933_0200322 | 3300035724 | Bacteria | 1277 |
| 924 | Ga0373947_0002525 | 3300035725 | Bacteria | 10999 |
| 925 | Ga0373947_0068140 | 3300035725 | Bacteria | 2175 |
| 926 | Ga0373937_0035993 | 3300036401 | Bacteria | 4509 |
| 927 | Ga0373937_0044269 | 3300036401 | Bacteria | 4064 |
| 928 | Ga0373937_0065143 | 3300036401 | Bacteria | 3353 |
| 929 | Ga0265778_025943 | 3300036457 | Bacteria | 742 |
| 930 | Ga0373925_0005148 | 3300037068 | Bacteria | 9798 |
| 931 | Ga0373925_0100426 | 3300037068 | Bacteria | 2223 |
| 932 | Ga0395899_0101344 | 3300037312 | Bacteria | 2078 |
| 933 | Ga0395899_0195572 | 3300037312 | Bacteria | 1413 |
| 934 | Ga0395899_0481338 | 3300037312 | Bacteria | 808 |
| 935 | Ga0395900_0486195 | 3300037418 | Bacteria | 1186 |
| 936 | Ga0395900_0556238 | 3300037418 | Bacteria | 1091 |
| 937 | Ga0395898_0003814 | 3300037466 | Bacteria | 16692 |
| 938 | Ga0395898_0004885 | 3300037466 | Bacteria | 14555 |
| 939 | Ga0395898_0232005 | 3300037466 | Bacteria | 1760 |
| 940 | Ga0395898_0280786 | 3300037466 | Bacteria | 1589 |
| 941 | Ga0395898_0316753 | 3300037466 | Bacteria | 1488 |
| 942 | Ga0395898_0386549 | 3300037466 | Bacteria | 1334 |
| 943 | Ga0395898_0576635 | 3300037466 | Bacteria | 1067 |
| 944 | Ga0395905_0138778 | 3300037471 | Bacteria | 2287 |
| 945 | Ga0395905_0508205 | 3300037471 | Bacteria | 1105 |
| 946 | Ga0395905_1108171 | 3300037471 | Bacteria | 695 |
| 947 | Ga0395905_1151314 | 3300037471 | Bacteria | 679 |
| 948 | Ga0436364_0009738 | 3300037853 | Bacteria | 8295 |
| 949 | Ga0436364_0136351 | 3300037853 | Bacteria | 1650 |
| 950 | Ga0436364_0304869 | 3300037853 | Bacteria | 3449 |
| 951 | Ga0436364_1303572 | 3300037853 | Bacteria | 3726 |
| 952 | Ga0436364_1308949 | 3300037853 | Bacteria | 8327 |
| 953 | Ga0436364_1353616 | 3300037853 | Bacteria | 20505 |
| 954 | Ga0395901_0014451 | 3300038443 | Bacteria | 8034 |
| 955 | Ga0395901_0044449 | 3300038443 | Bacteria | 4607 |
| 956 | Ga0395901_0221123 | 3300038443 | Bacteria | 1979 |
| 957 | Ga0395901_0299275 | 3300038443 | Bacteria | 1668 |
| 958 | Ga0395901_1162619 | 3300038443 | Bacteria | 739 |
| 959 | Ga0242420_076493 | 3300038996 | Bacteria | 687 |
| 960 | Ga0436365_0611199 | 3300039437 | Bacteria | 688 |
| 961 | Ga0436365_1289663 | 3300039437 | Bacteria | 2568 |
| 962 | Ga0436365_1705129 | 3300039437 | Bacteria | 735 |
| 963 | Ga0436360_0110487 | 3300039438 | Bacteria | 646 |
| 964 | Ga0436361_0211931 | 3300039447 | Bacteria | 830 |
| 965 | Ga0436361_0675330 | 3300039447 | Bacteria | 844 |
| 966 | Ga0436361_0858626 | 3300039447 | Bacteria | 652 |
| 967 | Ga0436363_0086959 | 3300039450 | Bacteria | 1461 |
| 968 | Ga0436363_0244953 | 3300039450 | Bacteria | 794 |
| 969 | Ga0436363_0313187 | 3300039450 | Bacteria | 1432 |
| 970 | Ga0436363_0879846 | 3300039450 | Bacteria | 685 |
| 971 | Ga0436363_0992871 | 3300039450 | Bacteria | 614 |
| 972 | Ga0436362_0069517 | 3300039453 | Bacteria | 1041 |
| 973 | Ga0436362_0387930 | 3300039453 | Bacteria | 959 |
| 974 | Ga0436362_0934528 | 3300039453 | Bacteria | 843 |
| 975 | Ga0436362_1211610 | 3300039453 | Bacteria | 858 |
| 976 | Ga0439436_0000928 | 3300041404 | Bacteria | 8054 |
| 977 | Ga0439436_0018153 | 3300041404 | Bacteria | 2103 |
| 978 | Ga0439439_0002357 | 3300041406 | Bacteria | 3998 |
| 979 | Ga0439439_0002711 | 3300041406 | Bacteria | 3805 |
| 980 | Ga0439465_0122188 | 3300041413 | Bacteria | 914 |
| 981 | Ga0451788_01963 | 3300041442 | Bacteria | 513 |
| 982 | Ga0451789_1198906 | 3300041443 | Bacteria | 1431 |
| 983 | Ga0451789_1288683 | 3300041443 | Bacteria | 869 |
| 984 | Ga0451794_30334 | 3300041446 | Bacteria | 544 |
| 985 | Ga0451791_0817771 | 3300041451 | Bacteria | 1670 |
| 986 | Ga0451791_0998527 | 3300041451 | Bacteria | 1238 |
| 987 | Ga0451791_1596303 | 3300041451 | Bacteria | 573 |
| 988 | Ga0451793_0272600 | 3300041452 | Bacteria | 831 |
| 989 | Ga0451797_0242638 | 3300041453 | Bacteria | 1560 |
| 990 | Ga0451797_0372023 | 3300041453 | Bacteria | 1101 |
| 991 | Ga0451802_0005448 | 3300041460 | Bacteria | 753 |
| 992 | Ga0451802_1713972 | 3300041460 | Bacteria | 1205 |
| 993 | Ga0451805_034483 | 3300041461 | Bacteria | 650 |
| 994 | Ga0451807_1271743 | 3300041486 | Bacteria | 597 |
| 995 | Ga0451807_1844026 | 3300041486 | Bacteria | 743 |
| 996 | Ga0451837_0720473 | 3300041494 | Bacteria | 1187 |
| 997 | Ga0451839_0156761 | 3300041496 | Bacteria | 575 |
| 998 | Ga0451839_0530653 | 3300041496 | Bacteria | 712 |
| 999 | Ga0451841_0024364 | 3300041498 | Bacteria | 891 |
| 1000 | Ga0451841_0930514 | 3300041498 | Bacteria | 654 |
| 1001 | Ga0451845_0978105 | 3300041501 | Bacteria | 1276 |
| 1002 | Ga0451846_26990 | 3300041502 | Bacteria | 610 |
| 1003 | Ga0451849_0428000 | 3300041505 | Bacteria | 701 |
| 1004 | Ga0451849_0889599 | 3300041505 | Bacteria | 617 |
| 1005 | Ga0451851_1130574 | 3300041507 | Bacteria | 501 |
| 1006 | Ga0451851_1369277 | 3300041507 | Bacteria | 1127 |
| 1007 | Ga0451843_1183826 | 3300041509 | Bacteria | 1052 |
| 1008 | Ga0451853_2683550 | 3300041512 | Bacteria | 3842 |
| 1009 | Ga0451853_3445873 | 3300041512 | Bacteria | 1447 |
| 1010 | Ga0451853_3531906 | 3300041512 | Bacteria | 1203 |
| 1011 | Ga0452271_73204 | 3300041916 | Bacteria | 651 |
| 1012 | Ga0439431_0160109 | 3300041997 | Bacteria | 643 |
| 1013 | Ga0439433_0003361 | 3300041999 | Bacteria | 3430 |
| 1014 | Ga0439433_0021509 | 3300041999 | Bacteria | 1444 |
| 1015 | Ga0439433_0118153 | 3300041999 | Bacteria | 667 |
| 1016 | Ga0439442_009151 | 3300042002 | Bacteria | 2002 |
| 1017 | Ga0439445_0277711 | 3300042004 | Bacteria | 503 |
| 1018 | Ga0439448_0001957 | 3300042005 | Bacteria | 5501 |
| 1019 | Ga0439448_0008132 | 3300042005 | Bacteria | 3063 |
| 1020 | Ga0439448_0063851 | 3300042005 | Bacteria | 1220 |
| 1021 | Ga0439448_0222206 | 3300042005 | Bacteria | 664 |
| 1022 | Ga0439432_026577 | 3300042006 | Bacteria | 1894 |
| 1023 | Ga0439449_0001280 | 3300042007 | Bacteria | 9838 |
| 1024 | Ga0439449_0018673 | 3300042007 | Bacteria | 2601 |
| 1025 | Ga0439449_0024590 | 3300042007 | Bacteria | 2251 |
| 1026 | Ga0439449_0086552 | 3300042007 | Bacteria | 1156 |
| 1027 | Ga0439450_017797 | 3300042008 | Bacteria | 1486 |
| 1028 | Ga0439454_000513 | 3300042011 | Bacteria | 3155 |
| 1029 | Ga0439454_037620 | 3300042011 | Bacteria | 782 |
| 1030 | Ga0439454_096559 | 3300042011 | Bacteria | 551 |
| 1031 | Ga0439455_0001760 | 3300042012 | Bacteria | 3758 |
| 1032 | Ga0439455_0049166 | 3300042012 | Bacteria | 1098 |
| 1033 | Ga0439457_001493 | 3300042014 | Bacteria | 7013 |
| 1034 | Ga0439457_001678 | 3300042014 | Bacteria | 6565 |
| 1035 | Ga0439463_034875 | 3300042016 | Bacteria | 1273 |
| 1036 | Ga0439463_109687 | 3300042016 | Bacteria | 712 |
| 1037 | Ga0439463_121685 | 3300042016 | Bacteria | 674 |
| 1038 | Ga0439463_174448 | 3300042016 | Bacteria | 558 |
| 1039 | Ga0450920_022188 | 3300042122 | Bacteria | 1229 |
| 1040 | Ga0450920_132262 | 3300042122 | Bacteria | 526 |
| 1041 | Ga0450888_011212 | 3300042126 | Bacteria | 1048 |
| 1042 | Ga0450897_034417 | 3300042128 | Bacteria | 582 |
| 1043 | Ga0450894_000082 | 3300042131 | Bacteria | 15452 |
| 1044 | Ga0450895_002600 | 3300042132 | Bacteria | 1352 |
| 1045 | Ga0450898_001847 | 3300042134 | Bacteria | 2864 |
| 1046 | Ga0450899_001163 | 3300042135 | Bacteria | 2986 |
| 1047 | Ga0450900_002001 | 3300042136 | Bacteria | 2096 |
| 1048 | Ga0450900_085106 | 3300042136 | Bacteria | 510 |
| 1049 | Ga0450903_000408 | 3300042138 | Bacteria | 9222 |
| 1050 | Ga0450903_025346 | 3300042138 | Bacteria | 907 |
| 1051 | Ga0450904_023073 | 3300042139 | Bacteria | 636 |
| 1052 | Ga0450905_001111 | 3300042142 | Bacteria | 3389 |
| 1053 | Ga0450905_067121 | 3300042142 | Bacteria | 607 |
| 1054 | Ga0450889_049024 | 3300042144 | Bacteria | 518 |
| 1055 | Ga0450906_005337 | 3300042145 | Bacteria | 2647 |
| 1056 | Ga0450906_041222 | 3300042145 | Bacteria | 815 |
| 1057 | Ga0450907_014293 | 3300042146 | Bacteria | 1325 |
| 1058 | Ga0450910_023603 | 3300042147 | Bacteria | 940 |
| 1059 | Ga0450910_040113 | 3300042147 | Bacteria | 755 |
| 1060 | Ga0439458_0000894 | 3300042157 | Bacteria | 7699 |
| 1061 | Ga0439458_0135142 | 3300042157 | Bacteria | 655 |
| 1062 | Ga0450908_000754 | 3300042184 | Bacteria | 6192 |
| 1063 | Ga0450909_078172 | 3300042185 | Bacteria | 534 |
| 1064 | Ga0439435_0010445 | 3300042436 | Bacteria | 2205 |
| 1065 | Ga0439444_0041891 | 3300042437 | Bacteria | 902 |
| 1066 | Ga0439459_0059541 | 3300042438 | Bacteria | 859 |
| 1067 | Ga0439459_0172004 | 3300042438 | Bacteria | 578 |
| 1068 | Ga0439464_0318780 | 3300042439 | Bacteria | 510 |
| 1069 | Ga0439460_0116379 | 3300042461 | Bacteria | 871 |
| 1070 | Ga0450916_023589 | 3300042530 | Bacteria | 859 |
| 1071 | Ga0450893_0128390 | 3300042532 | Bacteria | 534 |
| 1072 | Ga0439440_0008474 | 3300042993 | Bacteria | 2111 |
| 1073 | Ga0466969_0002289 | 3300044656 | Bacteria | 10225 |
| 1074 | Ga0466969_0018579 | 3300044656 | Bacteria | 3620 |
| 1075 | Ga0466969_0029433 | 3300044656 | Bacteria | 2804 |
| 1076 | Ga0466969_0041253 | 3300044656 | Bacteria | 2310 |
| 1077 | Ga0466972_0079512 | 3300044658 | Bacteria | 1561 |
| 1078 | Ga0466965_0007538 | 3300044683 | Bacteria | 5003 |
| 1079 | Ga0466965_0014029 | 3300044683 | Bacteria | 3789 |
| 1080 | Ga0466965_0038532 | 3300044683 | Bacteria | 2348 |
| 1081 | Ga0466965_0247725 | 3300044683 | Bacteria | 955 |
| 1082 | Ga0466965_0416359 | 3300044683 | Bacteria | 744 |
| 1083 | Ga0466966_0026669 | 3300044684 | Bacteria | 3771 |
| 1084 | Ga0466966_0032011 | 3300044684 | Bacteria | 3410 |
| 1085 | Ga0466966_0082062 | 3300044684 | Bacteria | 2006 |
| 1086 | Ga0466966_0151591 | 3300044684 | Bacteria | 1414 |
| 1087 | Ga0466966_0497092 | 3300044684 | Bacteria | 733 |
| 1088 | Ga0466961_0004342 | 3300044693 | Bacteria | 8882 |
| 1089 | Ga0466961_0010303 | 3300044693 | Bacteria | 5958 |
| 1090 | Ga0466961_0029559 | 3300044693 | Bacteria | 3521 |
| 1091 | Ga0466961_0046293 | 3300044693 | Bacteria | 2783 |
| 1092 | Ga0466961_0076857 | 3300044693 | Bacteria | 2115 |
| 1093 | Ga0466961_0130585 | 3300044693 | Bacteria | 1574 |
| 1094 | Ga0466961_0229629 | 3300044693 | Bacteria | 1142 |
| 1095 | Ga0466961_0278371 | 3300044693 | Bacteria | 1024 |
| 1096 | Ga0466961_0355647 | 3300044693 | Bacteria | 891 |
| 1097 | Ga0466961_0476154 | 3300044693 | Bacteria | 755 |
| 1098 | Ga0466961_0527097 | 3300044693 | Bacteria | 712 |
| 1099 | Ga0466963_0004564 | 3300044694 | Bacteria | 8064 |
| 1100 | Ga0466963_0004744 | 3300044694 | Bacteria | 7934 |
| 1101 | Ga0466963_0053926 | 3300044694 | Bacteria | 2671 |
| 1102 | Ga0466963_0054762 | 3300044694 | Bacteria | 2652 |
| 1103 | Ga0466963_0129790 | 3300044694 | Bacteria | 1740 |
| 1104 | Ga0466963_0149257 | 3300044694 | Bacteria | 1623 |
| 1105 | Ga0466963_0172532 | 3300044694 | Bacteria | 1508 |
| 1106 | Ga0466963_0203279 | 3300044694 | Bacteria | 1386 |
| 1107 | Ga0466963_0275343 | 3300044694 | Bacteria | 1182 |
| 1108 | Ga0466963_0299986 | 3300044694 | Bacteria | 1130 |
| 1109 | Ga0466963_0348773 | 3300044694 | Bacteria | 1042 |
| 1110 | Ga0466963_1284936 | 3300044694 | Bacteria | 514 |
| 1111 | Ga0466964_0006896 | 3300044706 | Bacteria | 4241 |
| 1112 | Ga0466964_0007424 | 3300044706 | Bacteria | 4100 |
| 1113 | Ga0466964_0314268 | 3300044706 | Bacteria | 794 |
| 1114 | Ga0466964_0754552 | 3300044706 | Bacteria | 546 |
| 1115 | Ga0466971_0002170 | 3300044719 | Bacteria | 8300 |
| 1116 | Ga0466971_0070749 | 3300044719 | Bacteria | 1584 |
| 1117 | Ga0466971_0115327 | 3300044719 | Bacteria | 1241 |
| 1118 | Ga0466971_0178830 | 3300044719 | Bacteria | 997 |
| 1119 | Ga0466971_0247718 | 3300044719 | Bacteria | 848 |
| 1120 | Ga0466968_0049997 | 3300044735 | Bacteria | 1782 |
| 1121 | Ga0466968_0130633 | 3300044735 | Bacteria | 1143 |
| 1122 | Ga0466968_0166062 | 3300044735 | Bacteria | 1021 |
| 1123 | Ga0466970_0003663 | 3300044765 | Bacteria | 7502 |
| 1124 | Ga0466970_0005692 | 3300044765 | Bacteria | 6189 |
| 1125 | Ga0466970_0020231 | 3300044765 | Bacteria | 3456 |
| 1126 | Ga0466970_0099930 | 3300044765 | Bacteria | 1579 |
| 1127 | Ga0466970_0104529 | 3300044765 | Bacteria | 1544 |
| 1128 | Ga0466970_0195015 | 3300044765 | Bacteria | 1126 |
| 1129 | Ga0466970_0249677 | 3300044765 | Bacteria | 994 |
| 1130 | Ga0466970_0378347 | 3300044765 | Bacteria | 806 |
| 1131 | Ga0466957_0000092 | 3300044842 | Bacteria | 36059 |
| 1132 | Ga0466957_0010996 | 3300044842 | Bacteria | 5206 |
| 1133 | Ga0466957_0019419 | 3300044842 | Bacteria | 3998 |
| 1134 | Ga0466957_0245730 | 3300044842 | Bacteria | 1188 |
| 1135 | Ga0466957_1365479 | 3300044842 | Bacteria | 515 |
| 1136 | Ga0466960_0017520 | 3300044901 | Bacteria | 3125 |
| 1137 | Ga0466960_0033394 | 3300044901 | Bacteria | 2391 |
| 1138 | Ga0466960_0087602 | 3300044901 | Bacteria | 1581 |
| 1139 | Ga0466960_0104006 | 3300044901 | Bacteria | 1466 |
| 1140 | Ga0466960_0422329 | 3300044901 | Bacteria | 771 |
| 1141 | Ga0466960_0580970 | 3300044901 | Bacteria | 663 |
| 1142 | Ga0466959_0023604 | 3300045049 | Bacteria | 4551 |
| 1143 | Ga0466959_0040116 | 3300045049 | Bacteria | 3459 |
| 1144 | Ga0466959_0071128 | 3300045049 | Bacteria | 2519 |
| 1145 | Ga0466959_0071597 | 3300045049 | Bacteria | 2510 |
| 1146 | Ga0466959_0165319 | 3300045049 | Bacteria | 1554 |
| 1147 | Ga0466959_0190702 | 3300045049 | Bacteria | 1431 |
| 1148 | Ga0466959_0821559 | 3300045049 | Bacteria | 621 |
| 1149 | Ga0451576_0046672 | 3300045051 | Bacteria | 4561 |
| 1150 | Ga0466958_0010114 | 3300045836 | Bacteria | 5274 |
| 1151 | Ga0466958_0256331 | 3300045836 | Bacteria | 1119 |
| 1152 | Ga0466958_0393430 | 3300045836 | Bacteria | 894 |
| 1153 | Ga0466958_0860448 | 3300045836 | Bacteria | 591 |
| 1154 | Ga0466967_0018221 | 3300045976 | Bacteria | 5603 |
| 1155 | Ga0466967_0064396 | 3300045976 | Bacteria | 3260 |
| 1156 | Ga0466967_0093693 | 3300045976 | Bacteria | 2733 |
| 1157 | Ga0466967_0123331 | 3300045976 | Bacteria | 2397 |
| 1158 | Ga0466967_0239113 | 3300045976 | Bacteria | 1732 |
| 1159 | Ga0466967_0253272 | 3300045976 | Bacteria | 1682 |
| 1160 | Ga0466967_0268287 | 3300045976 | Bacteria | 1635 |
| 1161 | Ga0466967_0368551 | 3300045976 | Bacteria | 1393 |
| 1162 | Ga0466967_0375305 | 3300045976 | Bacteria | 1380 |
| 1163 | Ga0466967_0793549 | 3300045976 | Bacteria | 940 |
| 1164 | Ga0466967_0866240 | 3300045976 | Bacteria | 898 |
| 1165 | Ga0466967_0895234 | 3300045976 | Bacteria | 882 |
| 1166 | Ga0466967_1031217 | 3300045976 | Bacteria | 819 |
| 1167 | Ga0466967_1471241 | 3300045976 | Bacteria | 678 |
| 1168 | Ga0466967_1493603 | 3300045976 | Bacteria | 673 |
| 1169 | Ga0466967_1594002 | 3300045976 | Bacteria | 650 |
| 1170 | Ga0466967_1800516 | 3300045976 | Bacteria | 609 |
| 1171 | Ga0466967_2154901 | 3300045976 | Bacteria | 553 |
| 1172 | Ga0466967_2284396 | 3300045976 | Bacteria | 536 |
| 1173 | Ga0495617_014510 | 3300046452 | Bacteria | 2677 |
| 1174 | Ga0495617_165754 | 3300046452 | Bacteria | 699 |
| 1175 | Ga0495617_206518 | 3300046452 | Bacteria | 613 |
| 1176 | Ga0495627_020039 | 3300046453 | Bacteria | 2234 |
| 1177 | Ga0495627_146848 | 3300046453 | Bacteria | 659 |
| 1178 | Ga0495592_0005557 | 3300046454 | Bacteria | 9323 |
| 1179 | Ga0495592_0018798 | 3300046454 | Bacteria | 5262 |
| 1180 | Ga0495592_0030916 | 3300046454 | Bacteria | 4050 |
| 1181 | Ga0495592_0061761 | 3300046454 | Bacteria | 2753 |
| 1182 | Ga0495592_0086491 | 3300046454 | Bacteria | 2257 |
| 1183 | Ga0495592_0104331 | 3300046454 | Bacteria | 2015 |
| 1184 | Ga0495603_0006510 | 3300046455 | Bacteria | 7001 |
| 1185 | Ga0495603_0085584 | 3300046455 | Bacteria | 1845 |
| 1186 | Ga0495603_0118056 | 3300046455 | Bacteria | 1546 |
| 1187 | Ga0495603_0205771 | 3300046455 | Bacteria | 1137 |
| 1188 | Ga0495603_0362164 | 3300046455 | Bacteria | 832 |
| 1189 | Ga0495629_0001307 | 3300046459 | Bacteria | 19594 |
| 1190 | Ga0495629_0007156 | 3300046459 | Bacteria | 8219 |
| 1191 | Ga0495629_0007564 | 3300046459 | Bacteria | 8005 |
| 1192 | Ga0495629_0026501 | 3300046459 | Bacteria | 4117 |
| 1193 | Ga0495629_0048183 | 3300046459 | Bacteria | 2987 |
| 1194 | Ga0495629_0093663 | 3300046459 | Bacteria | 2096 |
| 1195 | Ga0495629_0111863 | 3300046459 | Bacteria | 1904 |
| 1196 | Ga0495629_0254193 | 3300046459 | Bacteria | 1208 |
| 1197 | Ga0495629_0749212 | 3300046459 | Bacteria | 646 |
| 1198 | Ga0495638_0043781 | 3300046460 | Bacteria | 2822 |
| 1199 | Ga0495638_0056602 | 3300046460 | Bacteria | 2433 |
| 1200 | Ga0495638_0138403 | 3300046460 | Bacteria | 1423 |
| 1201 | Ga0495638_0154209 | 3300046460 | Bacteria | 1330 |
| 1202 | Ga0495641_0003608 | 3300046461 | Bacteria | 11461 |
| 1203 | Ga0495641_0118217 | 3300046461 | Bacteria | 1182 |
| 1204 | Ga0495641_0185141 | 3300046461 | Bacteria | 932 |
| 1205 | Ga0495651_0001137 | 3300046462 | Bacteria | 20570 |
| 1206 | Ga0495651_0004063 | 3300046462 | Bacteria | 11179 |
| 1207 | Ga0495651_0004096 | 3300046462 | Bacteria | 11149 |
| 1208 | Ga0495651_0015483 | 3300046462 | Bacteria | 5900 |
| 1209 | Ga0495651_0046184 | 3300046462 | Bacteria | 3371 |
| 1210 | Ga0495651_0163331 | 3300046462 | Bacteria | 1593 |
| 1211 | Ga0495653_0004863 | 3300046463 | Bacteria | 10899 |
| 1212 | Ga0495653_0029402 | 3300046463 | Bacteria | 4386 |
| 1213 | Ga0495653_0038966 | 3300046463 | Bacteria | 3726 |
| 1214 | Ga0495653_0042270 | 3300046463 | Bacteria | 3550 |
| 1215 | Ga0495653_0071907 | 3300046463 | Bacteria | 2584 |
| 1216 | Ga0495653_0223937 | 3300046463 | Bacteria | 1263 |
| 1217 | Ga0495653_0329739 | 3300046463 | Bacteria | 987 |
| 1218 | Ga0495653_0391850 | 3300046463 | Bacteria | 885 |
| 1219 | Ga0495580_0057637 | 3300046472 | Bacteria | 2733 |
| 1220 | Ga0495580_0183058 | 3300046472 | Bacteria | 1446 |
| 1221 | Ga0495582_0005652 | 3300046473 | Bacteria | 6961 |
| 1222 | Ga0495582_0040378 | 3300046473 | Bacteria | 2570 |
| 1223 | Ga0495582_0099402 | 3300046473 | Bacteria | 1628 |
| 1224 | Ga0495582_0104365 | 3300046473 | Bacteria | 1589 |
| 1225 | Ga0495582_0161218 | 3300046473 | Bacteria | 1275 |
| 1226 | Ga0495582_0236395 | 3300046473 | Bacteria | 1047 |
| 1227 | Ga0495582_0556672 | 3300046473 | Bacteria | 663 |
| 1228 | Ga0495605_0027760 | 3300046474 | Bacteria | 2929 |
| 1229 | Ga0495639_0012462 | 3300046475 | Bacteria | 3667 |
| 1230 | Ga0495639_0031522 | 3300046475 | Bacteria | 2360 |
| 1231 | Ga0495639_0193208 | 3300046475 | Bacteria | 994 |
| 1232 | Ga0495639_0588160 | 3300046475 | Bacteria | 572 |
| 1233 | Ga0495662_0000585 | 3300046476 | Bacteria | 16782 |
| 1234 | Ga0495662_0000600 | 3300046476 | Bacteria | 16641 |
| 1235 | Ga0495662_0012967 | 3300046476 | Bacteria | 4060 |
| 1236 | Ga0495662_0027110 | 3300046476 | Bacteria | 2767 |
| 1237 | Ga0495662_0053026 | 3300046476 | Bacteria | 1958 |
| 1238 | Ga0495662_0080275 | 3300046476 | Bacteria | 1586 |
| 1239 | Ga0495662_0159693 | 3300046476 | Bacteria | 1110 |
| 1240 | Ga0495664_0003849 | 3300046477 | Bacteria | 8190 |
| 1241 | Ga0495664_0012427 | 3300046477 | Bacteria | 4823 |
| 1242 | Ga0495664_0017674 | 3300046477 | Bacteria | 4078 |
| 1243 | Ga0495664_0017854 | 3300046477 | Bacteria | 4057 |
| 1244 | Ga0495664_0022249 | 3300046477 | Bacteria | 3672 |
| 1245 | Ga0495664_0029664 | 3300046477 | Bacteria | 3200 |
| 1246 | Ga0495664_0105905 | 3300046477 | Bacteria | 1695 |
| 1247 | Ga0495584_0125282 | 3300046491 | Bacteria | 1302 |
| 1248 | Ga0495585_0070321 | 3300046492 | Bacteria | 1909 |
| 1249 | Ga0495585_0075451 | 3300046492 | Bacteria | 1833 |
| 1250 | Ga0495585_0075605 | 3300046492 | Bacteria | 1830 |
| 1251 | Ga0495585_0258624 | 3300046492 | Bacteria | 866 |
| 1252 | Ga0495585_0259622 | 3300046492 | Bacteria | 864 |
| 1253 | Ga0495585_0454749 | 3300046492 | Bacteria | 612 |
| 1254 | Ga0495594_0002440 | 3300046499 | Bacteria | 9685 |
| 1255 | Ga0495594_0005436 | 3300046499 | Bacteria | 6547 |
| 1256 | Ga0495594_0057416 | 3300046499 | Bacteria | 2149 |
| 1257 | Ga0495594_0091639 | 3300046499 | Bacteria | 1703 |
| 1258 | Ga0495594_0204491 | 3300046499 | Bacteria | 1125 |
| 1259 | Ga0495594_0227954 | 3300046499 | Bacteria | 1062 |
| 1260 | Ga0495594_0426196 | 3300046499 | Bacteria | 754 |
| 1261 | Ga0495596_0018896 | 3300046500 | Bacteria | 2837 |
| 1262 | Ga0495596_0057813 | 3300046500 | Bacteria | 1513 |
| 1263 | Ga0495596_0177004 | 3300046500 | Bacteria | 829 |
| 1264 | Ga0495607_0048872 | 3300046501 | Bacteria | 2470 |
| 1265 | Ga0495607_0051739 | 3300046501 | Bacteria | 2383 |
| 1266 | Ga0495607_0072728 | 3300046501 | Bacteria | 1913 |
| 1267 | Ga0495583_0061795 | 3300046506 | Bacteria | 1669 |
| 1268 | Ga0495606_0006375 | 3300046507 | Bacteria | 10905 |
| 1269 | Ga0495608_0000457 | 3300046511 | Bacteria | 28465 |
| 1270 | Ga0495608_0019897 | 3300046511 | Bacteria | 4616 |
| 1271 | Ga0495608_0035781 | 3300046511 | Bacteria | 3346 |
| 1272 | Ga0495608_0039886 | 3300046511 | Bacteria | 3146 |
| 1273 | Ga0495608_0527612 | 3300046511 | Bacteria | 713 |
| 1274 | Ga0495610_0063004 | 3300046512 | Bacteria | 1757 |
| 1275 | Ga0495616_0003801 | 3300046513 | Bacteria | 9623 |
| 1276 | Ga0495616_0357371 | 3300046513 | Bacteria | 607 |
| 1277 | Ga0495618_0007498 | 3300046514 | Bacteria | 6601 |
| 1278 | Ga0495618_0019010 | 3300046514 | Bacteria | 4222 |
| 1279 | Ga0495618_0025441 | 3300046514 | Bacteria | 3673 |
| 1280 | Ga0495618_0079095 | 3300046514 | Bacteria | 2097 |
| 1281 | Ga0495618_0127174 | 3300046514 | Bacteria | 1631 |
| 1282 | Ga0495620_0054153 | 3300046515 | Bacteria | 1696 |
| 1283 | Ga0495620_0165499 | 3300046515 | Bacteria | 858 |
| 1284 | Ga0495620_0169227 | 3300046515 | Bacteria | 847 |
| 1285 | Ga0495628_0027669 | 3300046516 | Bacteria | 4610 |
| 1286 | Ga0495628_0042985 | 3300046516 | Bacteria | 3602 |
| 1287 | Ga0495628_0048987 | 3300046516 | Bacteria | 3346 |
| 1288 | Ga0495628_0070625 | 3300046516 | Bacteria | 2722 |
| 1289 | Ga0495628_0084215 | 3300046516 | Bacteria | 2467 |
| 1290 | Ga0495628_0498540 | 3300046516 | Bacteria | 879 |
| 1291 | Ga0495630_0041563 | 3300046517 | Bacteria | 3433 |
| 1292 | Ga0495630_0058292 | 3300046517 | Bacteria | 2894 |
| 1293 | Ga0495630_0062191 | 3300046517 | Bacteria | 2804 |
| 1294 | Ga0495630_0222869 | 3300046517 | Bacteria | 1440 |
| 1295 | Ga0495630_0344043 | 3300046517 | Bacteria | 1141 |
| 1296 | Ga0495630_0631393 | 3300046517 | Bacteria | 821 |
| 1297 | Ga0495631_0004163 | 3300046518 | Bacteria | 7749 |
| 1298 | Ga0495632_0025649 | 3300046519 | Bacteria | 3115 |
| 1299 | Ga0495632_0134282 | 3300046519 | Bacteria | 1150 |
| 1300 | Ga0495632_0303866 | 3300046519 | Bacteria | 707 |
| 1301 | Ga0495637_0027376 | 3300046520 | Bacteria | 2551 |
| 1302 | Ga0495637_0037354 | 3300046520 | Bacteria | 2109 |
| 1303 | Ga0495643_0005977 | 3300046522 | Bacteria | 8122 |
| 1304 | Ga0495643_0008022 | 3300046522 | Bacteria | 6732 |
| 1305 | Ga0495644_0023028 | 3300046523 | Bacteria | 2372 |
| 1306 | Ga0495644_0041104 | 3300046523 | Bacteria | 1742 |
| 1307 | Ga0495648_0068206 | 3300046524 | Bacteria | 2076 |
| 1308 | Ga0495663_0009942 | 3300046525 | Bacteria | 2641 |
| 1309 | Ga0495666_0000906 | 3300046526 | Bacteria | 13895 |
| 1310 | Ga0495666_0080579 | 3300046526 | Bacteria | 1540 |
| 1311 | Ga0495666_0093330 | 3300046526 | Bacteria | 1420 |
| 1312 | Ga0495666_0112439 | 3300046526 | Bacteria | 1278 |
| 1313 | Ga0495666_0183954 | 3300046526 | Bacteria | 964 |
| 1314 | Ga0495666_0280107 | 3300046526 | Bacteria | 756 |
| 1315 | Ga0495642_0055136 | 3300046528 | Bacteria | 1640 |
| 1316 | Ga0495642_0084633 | 3300046528 | Bacteria | 1338 |
| 1317 | Ga0495652_0010842 | 3300046529 | Bacteria | 8258 |
| 1318 | Ga0495652_0091587 | 3300046529 | Bacteria | 2485 |
| 1319 | Ga0495652_0093017 | 3300046529 | Bacteria | 2462 |
| 1320 | Ga0495652_0103996 | 3300046529 | Bacteria | 2297 |
| 1321 | Ga0495652_0107955 | 3300046529 | Bacteria | 2244 |
| 1322 | Ga0495652_0138834 | 3300046529 | Bacteria | 1913 |
| 1323 | Ga0495652_0240179 | 3300046529 | Bacteria | 1348 |
| 1324 | Ga0495652_0306836 | 3300046529 | Bacteria | 1151 |
| 1325 | Ga0495652_0981747 | 3300046529 | Bacteria | 553 |
| 1326 | Ga0495654_0007370 | 3300046530 | Bacteria | 6147 |
| 1327 | Ga0495665_0004964 | 3300046531 | Bacteria | 7169 |
| 1328 | Ga0495665_0005298 | 3300046531 | Bacteria | 6951 |
| 1329 | Ga0495665_0005836 | 3300046531 | Bacteria | 6644 |
| 1330 | Ga0495665_0005892 | 3300046531 | Bacteria | 6599 |
| 1331 | Ga0495640_0003461 | 3300046533 | Bacteria | 12706 |
| 1332 | Ga0495640_0006110 | 3300046533 | Bacteria | 9546 |
| 1333 | Ga0495640_0012238 | 3300046533 | Bacteria | 6566 |
| 1334 | Ga0495640_0023619 | 3300046533 | Bacteria | 4475 |
| 1335 | Ga0495640_0036241 | 3300046533 | Bacteria | 3485 |
| 1336 | Ga0495640_0105248 | 3300046533 | Bacteria | 1848 |
| 1337 | Ga0495640_0240139 | 3300046533 | Bacteria | 1137 |
| 1338 | Ga0495640_0683267 | 3300046533 | Bacteria | 616 |
| 1339 | Ga0495586_0010989 | 3300046535 | Bacteria | 4810 |
| 1340 | Ga0495586_0031312 | 3300046535 | Bacteria | 2848 |
| 1341 | Ga0495586_0141080 | 3300046535 | Bacteria | 1352 |
| 1342 | Ga0495586_0323491 | 3300046535 | Bacteria | 885 |
| 1343 | Ga0495586_0425138 | 3300046535 | Bacteria | 765 |
| 1344 | Ga0495587_0003258 | 3300046536 | Bacteria | 10849 |
| 1345 | Ga0495587_0013451 | 3300046536 | Bacteria | 5143 |
| 1346 | Ga0495587_0013762 | 3300046536 | Bacteria | 5083 |
| 1347 | Ga0495587_0061468 | 3300046536 | Bacteria | 2201 |
| 1348 | Ga0495587_0143557 | 3300046536 | Bacteria | 1361 |
| 1349 | Ga0495587_0376824 | 3300046536 | Bacteria | 789 |
| 1350 | Ga0495598_0021468 | 3300046537 | Bacteria | 1718 |
| 1351 | Ga0495609_0023685 | 3300046538 | Bacteria | 2820 |
| 1352 | Ga0495609_0044610 | 3300046538 | Bacteria | 1988 |
| 1353 | Ga0495609_0097363 | 3300046538 | Bacteria | 1276 |
| 1354 | Ga0495609_0130440 | 3300046538 | Bacteria | 1077 |
| 1355 | Ga0495597_0075657 | 3300046542 | Bacteria | 1444 |
| 1356 | Ga0495597_0162614 | 3300046542 | Bacteria | 910 |
| 1357 | Ga0495645_0006394 | 3300046543 | Bacteria | 8179 |
| 1358 | Ga0495645_0059565 | 3300046543 | Bacteria | 2768 |
| 1359 | Ga0495645_0146946 | 3300046543 | Bacteria | 1641 |
| 1360 | Ga0495645_0319987 | 3300046543 | Bacteria | 1007 |
| 1361 | Ga0495645_0389810 | 3300046543 | Bacteria | 889 |
| 1362 | Ga0495622_0015255 | 3300046557 | Bacteria | 3571 |
| 1363 | Ga0495622_0019042 | 3300046557 | Bacteria | 3198 |
| 1364 | Ga0495622_0045225 | 3300046557 | Bacteria | 2045 |
| 1365 | Ga0495622_0257484 | 3300046557 | Bacteria | 766 |
| 1366 | Ga0495633_0005358 | 3300046558 | Bacteria | 7867 |
| 1367 | Ga0495633_0030269 | 3300046558 | Bacteria | 2630 |
| 1368 | Ga0495667_0005090 | 3300046559 | Bacteria | 8884 |
| 1369 | Ga0495667_0009929 | 3300046559 | Bacteria | 6448 |
| 1370 | Ga0495667_0029960 | 3300046559 | Bacteria | 3659 |
| 1371 | Ga0495667_0072945 | 3300046559 | Bacteria | 2236 |
| 1372 | Ga0495667_0140948 | 3300046559 | Bacteria | 1553 |
| 1373 | Ga0495667_0230183 | 3300046559 | Bacteria | 1181 |
| 1374 | Ga0495667_0242635 | 3300046559 | Bacteria | 1147 |
| 1375 | Ga0495667_0405590 | 3300046559 | Bacteria | 858 |
| 1376 | Ga0495667_0593328 | 3300046559 | Bacteria | 690 |
| 1377 | Ga0495656_0072026 | 3300046615 | Bacteria | 1537 |
| 1378 | Ga0495656_0233741 | 3300046615 | Bacteria | 923 |
| 1379 | Ga0495656_0234142 | 3300046615 | Bacteria | 923 |
| 1380 | Ga0495668_0286789 | 3300046616 | Bacteria | 902 |
| 1381 | Ga0495634_0000626 | 3300046642 | Bacteria | 34287 |
| 1382 | Ga0495634_0004108 | 3300046642 | Bacteria | 11528 |
| 1383 | Ga0495634_0020442 | 3300046642 | Bacteria | 4694 |
| 1384 | Ga0495634_0023454 | 3300046642 | Bacteria | 4337 |
| 1385 | Ga0495634_0028120 | 3300046642 | Bacteria | 3905 |
| 1386 | Ga0495634_0131367 | 3300046642 | Bacteria | 1596 |
| 1387 | Ga0495634_0136447 | 3300046642 | Bacteria | 1560 |
| 1388 | Ga0495634_0156768 | 3300046642 | Bacteria | 1437 |
| 1389 | Ga0495634_0183060 | 3300046642 | Bacteria | 1310 |
| 1390 | Ga0495634_0545153 | 3300046642 | Bacteria | 677 |
| 1391 | Ga0495611_0017753 | 3300046648 | Bacteria | 3047 |
| 1392 | Ga0495611_0022394 | 3300046648 | Bacteria | 2733 |
| 1393 | Ga0495611_0048988 | 3300046648 | Bacteria | 1900 |
| 1394 | Ga0495611_0167329 | 3300046648 | Bacteria | 1027 |
| 1395 | Ga0495611_0292772 | 3300046648 | Bacteria | 751 |
| 1396 | Ga0495625_0011293 | 3300046660 | Bacteria | 7294 |
| 1397 | Ga0495625_0036984 | 3300046660 | Bacteria | 3584 |
| 1398 | Ga0495635_0004539 | 3300046663 | Bacteria | 9622 |
| 1399 | Ga0495635_0013510 | 3300046663 | Bacteria | 5714 |
| 1400 | Ga0495635_0042090 | 3300046663 | Bacteria | 3155 |
| 1401 | Ga0495635_0049734 | 3300046663 | Bacteria | 2889 |
| 1402 | Ga0495635_0057761 | 3300046663 | Bacteria | 2669 |
| 1403 | Ga0495635_0060270 | 3300046663 | Bacteria | 2608 |
| 1404 | Ga0495635_0116887 | 3300046663 | Bacteria | 1820 |
| 1405 | Ga0495635_0182623 | 3300046663 | Bacteria | 1425 |
| 1406 | Ga0495635_0558659 | 3300046663 | Bacteria | 750 |
| 1407 | Ga0495661_0039646 | 3300046665 | Bacteria | 2926 |
| 1408 | Ga0495661_0046389 | 3300046665 | Bacteria | 2653 |
| 1409 | Ga0495661_0118639 | 3300046665 | Bacteria | 1464 |
| 1410 | Ga0495588_0022151 | 3300046674 | Bacteria | 3138 |
| 1411 | Ga0495588_0068342 | 3300046674 | Bacteria | 1845 |
| 1412 | Ga0495588_0091973 | 3300046674 | Bacteria | 1589 |
| 1413 | Ga0495588_0125782 | 3300046674 | Bacteria | 1352 |
| 1414 | Ga0495657_0002383 | 3300046675 | Bacteria | 15811 |
| 1415 | Ga0495657_0007140 | 3300046675 | Bacteria | 8665 |
| 1416 | Ga0495657_0022451 | 3300046675 | Bacteria | 4518 |
| 1417 | Ga0495657_0040887 | 3300046675 | Bacteria | 3176 |
| 1418 | Ga0495657_0058343 | 3300046675 | Bacteria | 2563 |
| 1419 | Ga0495657_0120993 | 3300046675 | Bacteria | 1648 |
| 1420 | Ga0495657_0211605 | 3300046675 | Bacteria | 1178 |
| 1421 | Ga0495657_0725320 | 3300046675 | Bacteria | 570 |
| 1422 | Ga0495599_0030374 | 3300046678 | Bacteria | 3390 |
| 1423 | Ga0495599_0081661 | 3300046678 | Bacteria | 2019 |
| 1424 | Ga0495599_0244800 | 3300046678 | Bacteria | 1092 |
| 1425 | Ga0495599_0282347 | 3300046678 | Bacteria | 1005 |
| 1426 | Ga0495599_0442633 | 3300046678 | Bacteria | 770 |
| 1427 | Ga0495623_0009174 | 3300046679 | Bacteria | 6417 |
| 1428 | Ga0495623_0085990 | 3300046679 | Bacteria | 1938 |
| 1429 | Ga0495623_0155803 | 3300046679 | Bacteria | 1346 |
| 1430 | Ga0495623_0234736 | 3300046679 | Bacteria | 1038 |
| 1431 | Ga0495623_0264130 | 3300046679 | Bacteria | 963 |
| 1432 | Ga0495646_0001371 | 3300046680 | Bacteria | 14431 |
| 1433 | Ga0495646_0011902 | 3300046680 | Bacteria | 5534 |
| 1434 | Ga0495646_0025764 | 3300046680 | Bacteria | 3697 |
| 1435 | Ga0495646_0115853 | 3300046680 | Bacteria | 1521 |
| 1436 | Ga0495646_0255970 | 3300046680 | Bacteria | 936 |
| 1437 | Ga0495646_0281571 | 3300046680 | Bacteria | 883 |
| 1438 | Ga0495646_0570288 | 3300046680 | Bacteria | 577 |
| 1439 | Ga0495647_0020907 | 3300046681 | Bacteria | 2353 |
| 1440 | Ga0495658_0005567 | 3300046683 | Bacteria | 6189 |
| 1441 | Ga0495658_0069363 | 3300046683 | Bacteria | 2043 |
| 1442 | Ga0495658_0163759 | 3300046683 | Bacteria | 1373 |
| 1443 | Ga0495658_0252413 | 3300046683 | Bacteria | 1109 |
| 1444 | Ga0495658_0514031 | 3300046683 | Bacteria | 766 |
| 1445 | Ga0495613_0000704 | 3300046689 | Bacteria | 26326 |
| 1446 | Ga0495613_0005089 | 3300046689 | Bacteria | 9851 |
| 1447 | Ga0495613_0005645 | 3300046689 | Bacteria | 9385 |
| 1448 | Ga0495613_0010257 | 3300046689 | Bacteria | 6958 |
| 1449 | Ga0495613_0018023 | 3300046689 | Bacteria | 5262 |
| 1450 | Ga0495613_0034477 | 3300046689 | Bacteria | 3759 |
| 1451 | Ga0495613_0037380 | 3300046689 | Bacteria | 3599 |
| 1452 | Ga0495613_0093191 | 3300046689 | Bacteria | 2180 |
| 1453 | Ga0495613_0388726 | 3300046689 | Bacteria | 953 |
| 1454 | Ga0495613_0517385 | 3300046689 | Bacteria | 802 |
| 1455 | Ga0495613_0746430 | 3300046689 | Bacteria | 641 |
| 1456 | Ga0495624_0007123 | 3300046690 | Bacteria | 7868 |
| 1457 | Ga0495624_0007746 | 3300046690 | Bacteria | 7533 |
| 1458 | Ga0495624_0011024 | 3300046690 | Bacteria | 6222 |
| 1459 | Ga0495624_0028664 | 3300046690 | Bacteria | 3636 |
| 1460 | Ga0495624_0084490 | 3300046690 | Bacteria | 1962 |
| 1461 | Ga0495624_0131734 | 3300046690 | Bacteria | 1533 |
| 1462 | Ga0495670_0039461 | 3300046691 | Bacteria | 2355 |
| 1463 | Ga0495670_0115907 | 3300046691 | Bacteria | 1389 |
| 1464 | Ga0495670_0260622 | 3300046691 | Bacteria | 925 |
| 1465 | Ga0495670_0406880 | 3300046691 | Bacteria | 735 |
| 1466 | Ga0495670_0768335 | 3300046691 | Bacteria | 526 |
| 1467 | Ga0495671_0008610 | 3300046692 | Bacteria | 5730 |
| 1468 | Ga0495671_0090667 | 3300046692 | Bacteria | 1496 |
| 1469 | Ga0495649_0031629 | 3300046694 | Bacteria | 2917 |
| 1470 | Ga0495649_0075816 | 3300046694 | Bacteria | 1800 |
| 1471 | Ga0495589_0011786 | 3300046794 | Bacteria | 4536 |
| 1472 | Ga0495589_0105099 | 3300046794 | Bacteria | 1365 |
| 1473 | Ga0495589_0152336 | 3300046794 | Bacteria | 1103 |
| 1474 | Ga0495589_0174702 | 3300046794 | Bacteria | 1020 |
| 1475 | Ga0495589_0228315 | 3300046794 | Bacteria | 873 |
| 1476 | Ga0495589_0321088 | 3300046794 | Bacteria | 715 |
| 1477 | Ga0495600_0004210 | 3300046809 | Bacteria | 8586 |
| 1478 | Ga0495600_0006730 | 3300046809 | Bacteria | 7006 |
| 1479 | Ga0495600_0014374 | 3300046809 | Bacteria | 4987 |
| 1480 | Ga0495600_0114315 | 3300046809 | Bacteria | 1757 |
| 1481 | Ga0495600_0163115 | 3300046809 | Bacteria | 1440 |
| 1482 | Ga0495600_0224615 | 3300046809 | Bacteria | 1200 |
| 1483 | Ga0495600_0237698 | 3300046809 | Bacteria | 1161 |
| 1484 | Ga0495600_0246758 | 3300046809 | Bacteria | 1136 |
| 1485 | Ga0495660_0034851 | 3300046810 | Bacteria | 2814 |
| 1486 | Ga0495660_0063398 | 3300046810 | Bacteria | 1979 |
| 1487 | Ga0495581_0002245 | 3300047315 | Bacteria | 10864 |
| 1488 | Ga0495581_0004730 | 3300047315 | Bacteria | 7857 |
| 1489 | Ga0495581_0037892 | 3300047315 | Bacteria | 2790 |
| 1490 | Ga0495581_0045158 | 3300047315 | Bacteria | 2547 |
| 1491 | Ga0495581_0046927 | 3300047315 | Bacteria | 2496 |
| 1492 | Ga0495581_0056765 | 3300047315 | Bacteria | 2260 |
| 1493 | Ga0495581_0080075 | 3300047315 | Bacteria | 1890 |
| 1494 | Ga0495581_0092440 | 3300047315 | Bacteria | 1756 |
| 1495 | Ga0495581_0102572 | 3300047315 | Bacteria | 1662 |
| 1496 | Ga0495581_0179610 | 3300047315 | Bacteria | 1237 |
| 1497 | Ga0495581_0333787 | 3300047315 | Bacteria | 885 |
| 1498 | Ga0495604_0000590 | 3300047317 | Bacteria | 31463 |
| 1499 | Ga0495604_0012749 | 3300047317 | Bacteria | 6690 |
| 1500 | Ga0495604_0024988 | 3300047317 | Bacteria | 4762 |
| 1501 | Ga0495604_0035517 | 3300047317 | Bacteria | 3936 |
| 1502 | Ga0495604_0041000 | 3300047317 | Bacteria | 3632 |
| 1503 | Ga0495604_0059394 | 3300047317 | Bacteria | 2931 |
| 1504 | Ga0495604_0213397 | 3300047317 | Bacteria | 1332 |
| 1505 | Ga0495604_0508706 | 3300047317 | Bacteria | 780 |
| 1506 | Ga0495636_0008517 | 3300047318 | Bacteria | 4047 |
| 1507 | Ga0495636_0019828 | 3300047318 | Bacteria | 2705 |
| 1508 | Ga0495636_0020521 | 3300047318 | Bacteria | 2662 |
| 1509 | Ga0495636_0043369 | 3300047318 | Bacteria | 1871 |
| 1510 | Ga0495636_0099816 | 3300047318 | Bacteria | 1268 |
| 1511 | Ga0495636_0262880 | 3300047318 | Bacteria | 800 |
| 1512 | Ga0495674_0014793 | 3300047319 | Bacteria | 7299 |
| 1513 | Ga0495674_0020722 | 3300047319 | Bacteria | 6087 |
| 1514 | Ga0495674_0026819 | 3300047319 | Bacteria | 5269 |
| 1515 | Ga0495674_0147512 | 3300047319 | Bacteria | 1974 |
| 1516 | Ga0495674_0453210 | 3300047319 | Bacteria | 1030 |
| 1517 | Ga0495674_0554436 | 3300047319 | Bacteria | 914 |
| 1518 | Ga0495672_0098197 | 3300047320 | Bacteria | 1593 |
| 1519 | Ga0495676_0014737 | 3300047321 | Bacteria | 6982 |
| 1520 | Ga0495676_0023696 | 3300047321 | Bacteria | 5322 |
| 1521 | Ga0495676_0031255 | 3300047321 | Bacteria | 4505 |
| 1522 | Ga0495676_0068779 | 3300047321 | Bacteria | 2734 |
| 1523 | Ga0495676_0070119 | 3300047321 | Bacteria | 2701 |
| 1524 | Ga0495676_0072120 | 3300047321 | Bacteria | 2652 |
| 1525 | Ga0495676_0120682 | 3300047321 | Bacteria | 1907 |
| 1526 | Ga0495676_0165295 | 3300047321 | Bacteria | 1562 |
| 1527 | Ga0495676_0347052 | 3300047321 | Bacteria | 993 |
| 1528 | Ga0495676_0494845 | 3300047321 | Bacteria | 803 |
| 1529 | Ga0495680_0003256 | 3300047322 | Bacteria | 16121 |
| 1530 | Ga0495680_0011499 | 3300047322 | Bacteria | 7829 |
| 1531 | Ga0495680_0012358 | 3300047322 | Bacteria | 7517 |
| 1532 | Ga0495680_0044700 | 3300047322 | Bacteria | 3501 |
| 1533 | Ga0495680_0047383 | 3300047322 | Bacteria | 3381 |
| 1534 | Ga0495680_0061680 | 3300047322 | Bacteria | 2883 |
| 1535 | Ga0495680_0142478 | 3300047322 | Bacteria | 1753 |
| 1536 | Ga0495683_0025758 | 3300047323 | Bacteria | 3013 |
| 1537 | Ga0495683_0033477 | 3300047323 | Bacteria | 2615 |
| 1538 | Ga0495683_0352302 | 3300047323 | Bacteria | 621 |
| 1539 | Ga0495687_001001 | 3300047443 | Bacteria | 28257 |
| 1540 | Ga0495687_001560 | 3300047443 | Bacteria | 20810 |
| 1541 | Ga0495687_016118 | 3300047443 | Bacteria | 3768 |
| 1542 | Ga0495675_0018440 | 3300047444 | Bacteria | 4429 |
| 1543 | Ga0495675_0029863 | 3300047444 | Bacteria | 3477 |
| 1544 | Ga0495675_0042833 | 3300047444 | Bacteria | 2883 |
| 1545 | Ga0495675_0066288 | 3300047444 | Bacteria | 2282 |
| 1546 | Ga0495675_0120467 | 3300047444 | Bacteria | 1634 |
| 1547 | Ga0495675_0139361 | 3300047444 | Bacteria | 1504 |
| 1548 | Ga0495675_0218783 | 3300047444 | Bacteria | 1153 |
| 1549 | Ga0495675_0224849 | 3300047444 | Bacteria | 1134 |
| 1550 | Ga0495675_0425703 | 3300047444 | Bacteria | 771 |
| 1551 | Ga0495677_0023235 | 3300047445 | Bacteria | 2251 |
| 1552 | Ga0495677_0029557 | 3300047445 | Bacteria | 1993 |
| 1553 | Ga0495677_0036035 | 3300047445 | Bacteria | 1806 |
| 1554 | Ga0495679_056845 | 3300047446 | Bacteria | 1158 |
| 1555 | Ga0495679_093091 | 3300047446 | Bacteria | 843 |
| 1556 | Ga0495685_000403 | 3300047447 | Bacteria | 13717 |
| 1557 | Ga0495685_004718 | 3300047447 | Bacteria | 4421 |
| 1558 | Ga0495685_019035 | 3300047447 | Bacteria | 2357 |
| 1559 | Ga0495685_022874 | 3300047447 | Bacteria | 2150 |
| 1560 | Ga0495685_114301 | 3300047447 | Bacteria | 887 |
| 1561 | Ga0495685_292351 | 3300047447 | Bacteria | 513 |
| 1562 | Ga0495681_0002670 | 3300047470 | Bacteria | 12632 |
| 1563 | Ga0495681_0003065 | 3300047470 | Bacteria | 11723 |
| 1564 | Ga0495681_0070949 | 3300047470 | Bacteria | 1578 |
| 1565 | Ga0495684_0004164 | 3300047471 | Bacteria | 11295 |
| 1566 | Ga0495684_0004873 | 3300047471 | Bacteria | 10469 |
| 1567 | Ga0495684_0028859 | 3300047471 | Bacteria | 4259 |
| 1568 | Ga0495684_0030673 | 3300047471 | Bacteria | 4128 |
| 1569 | Ga0495684_0064631 | 3300047471 | Bacteria | 2781 |
| 1570 | Ga0495684_0107181 | 3300047471 | Bacteria | 2111 |
| 1571 | Ga0495684_0147989 | 3300047471 | Bacteria | 1757 |
| 1572 | Ga0495686_0005934 | 3300047472 | Bacteria | 9505 |
| 1573 | Ga0495686_0038034 | 3300047472 | Bacteria | 3080 |
| 1574 | Ga0495686_0048999 | 3300047472 | Bacteria | 2660 |
| 1575 | Ga0495593_0003014 | 3300047673 | Bacteria | 10148 |
| 1576 | Ga0495593_0012250 | 3300047673 | Bacteria | 4901 |
| 1577 | Ga0495593_0020518 | 3300047673 | Bacteria | 3701 |
| 1578 | Ga0495593_0061868 | 3300047673 | Bacteria | 1957 |
| 1579 | Ga0495593_0134453 | 3300047673 | Bacteria | 1254 |
| 1580 | Ga0495593_0164734 | 3300047673 | Bacteria | 1118 |
| 1581 | Ga0495593_0182618 | 3300047673 | Bacteria | 1056 |
| 1582 | Ga0495593_0350494 | 3300047673 | Bacteria | 738 |
| 1583 | Ga0495602_0030856 | 3300048088 | Bacteria | 5076 |
| 1584 | Ga0495602_0063495 | 3300048088 | Bacteria | 3199 |
| 1585 | Ga0495602_0083248 | 3300048088 | Bacteria | 2681 |
| 1586 | Ga0495602_0129994 | 3300048088 | Bacteria | 2010 |
| 1587 | Ga0495602_0150723 | 3300048088 | Bacteria | 1828 |
| 1588 | Ga0495602_0410626 | 3300048088 | Bacteria | 963 |
| 1589 | Ga0495602_0452118 | 3300048088 | Bacteria | 906 |
| 1590 | Ga0495602_1011200 | 3300048088 | Bacteria | 548 |
| 1591 | Ga0495614_0003507 | 3300048089 | Bacteria | 7026 |
| 1592 | Ga0495614_0005517 | 3300048089 | Bacteria | 5705 |
| 1593 | Ga0495614_0192948 | 3300048089 | Bacteria | 919 |
| 1594 | Ga0495614_0261666 | 3300048089 | Bacteria | 793 |
| 1595 | Ga0495615_0244012 | 3300048090 | Bacteria | 567 |
| 1596 | Ga0495626_0006925 | 3300048091 | Bacteria | 6386 |
| 1597 | Ga0496100_0041269 | 3300048903 | Bacteria | 2941 |
| 1598 | Ga0496100_0475212 | 3300048903 | Bacteria | 961 |
| 1599 | Ga0496100_0607451 | 3300048903 | Bacteria | 850 |
| 1600 | Ga0496101_0021655 | 3300048904 | Bacteria | 4417 |
| 1601 | Ga0496101_0420429 | 3300048904 | Bacteria | 1053 |
| 1602 | Ga0496101_0476444 | 3300048904 | Bacteria | 985 |
| 1603 | Ga0496102_0005198 | 3300048905 | Bacteria | 11050 |
| 1604 | Ga0496102_0008637 | 3300048905 | Bacteria | 8742 |
| 1605 | Ga0496102_0274201 | 3300048905 | Bacteria | 1590 |
| 1606 | Ga0496102_0357818 | 3300048905 | Bacteria | 1374 |
| 1607 | Ga0496102_0445174 | 3300048905 | Bacteria | 1215 |
| 1608 | Ga0496102_1417763 | 3300048905 | Bacteria | 614 |
| 1609 | Ga0496103_0011644 | 3300048906 | Bacteria | 5217 |
| 1610 | Ga0496103_0053998 | 3300048906 | Bacteria | 2490 |
| 1611 | Ga0496103_0372240 | 3300048906 | Bacteria | 918 |
| 1612 | Ga0496104_0061932 | 3300048907 | Bacteria | 3547 |
| 1613 | Ga0496104_0087405 | 3300048907 | Bacteria | 2977 |
| 1614 | Ga0496104_0188230 | 3300048907 | Bacteria | 1975 |
| 1615 | Ga0496105_0029690 | 3300048908 | Bacteria | 4476 |
| 1616 | Ga0496105_0106953 | 3300048908 | Bacteria | 2309 |
| 1617 | Ga0496105_0119990 | 3300048908 | Bacteria | 2169 |
| 1618 | Ga0496105_0146114 | 3300048908 | Bacteria | 1944 |
| 1619 | Ga0496105_0431586 | 3300048908 | Bacteria | 1042 |
| 1620 | Ga0496105_0647516 | 3300048908 | Bacteria | 816 |
| 1621 | Ga0496106_0008319 | 3300048909 | Bacteria | 7677 |
| 1622 | Ga0496106_0029464 | 3300048909 | Bacteria | 4091 |
| 1623 | Ga0496106_0167415 | 3300048909 | Bacteria | 1740 |
| 1624 | Ga0496106_0562035 | 3300048909 | Bacteria | 915 |
| 1625 | Ga0496106_0569376 | 3300048909 | Bacteria | 908 |
| 1626 | Ga0496106_0835702 | 3300048909 | Bacteria | 729 |
| 1627 | Ga0496106_1166206 | 3300048909 | Bacteria | 602 |
| 1628 | Ga0496107_0019893 | 3300048910 | Bacteria | 4740 |
| 1629 | Ga0496107_0069211 | 3300048910 | Bacteria | 2561 |
| 1630 | Ga0496107_0154792 | 3300048910 | Bacteria | 1697 |
| 1631 | Ga0496107_0606519 | 3300048910 | Bacteria | 809 |
| 1632 | Ga0496107_0820445 | 3300048910 | Bacteria | 680 |
| 1633 | Ga0496108_0019165 | 3300048911 | Bacteria | 5616 |
| 1634 | Ga0496108_0024157 | 3300048911 | Bacteria | 5003 |
| 1635 | Ga0496108_0029657 | 3300048911 | Bacteria | 4532 |
| 1636 | Ga0496108_0089356 | 3300048911 | Bacteria | 2618 |
| 1637 | Ga0496108_0107297 | 3300048911 | Bacteria | 2384 |
| 1638 | Ga0496108_0707495 | 3300048911 | Bacteria | 873 |
| 1639 | Ga0496108_1223311 | 3300048911 | Bacteria | 634 |
| 1640 | Ga0496108_1270374 | 3300048911 | Bacteria | 620 |
| 1641 | Ga0496109_0006258 | 3300048912 | Bacteria | 10011 |
| 1642 | Ga0496109_0015250 | 3300048912 | Bacteria | 6690 |
| 1643 | Ga0496109_0020477 | 3300048912 | Bacteria | 5843 |
| 1644 | Ga0496109_0035248 | 3300048912 | Bacteria | 4512 |
| 1645 | Ga0496109_0044001 | 3300048912 | Bacteria | 4049 |
| 1646 | Ga0496109_0139412 | 3300048912 | Bacteria | 2267 |
| 1647 | Ga0496109_0230614 | 3300048912 | Bacteria | 1742 |
| 1648 | Ga0496109_0230971 | 3300048912 | Bacteria | 1740 |
| 1649 | Ga0496109_0387387 | 3300048912 | Bacteria | 1320 |
| 1650 | Ga0496109_0480538 | 3300048912 | Bacteria | 1173 |
| 1651 | Ga0496109_0486350 | 3300048912 | Bacteria | 1165 |
| 1652 | Ga0496109_0696529 | 3300048912 | Bacteria | 953 |
| 1653 | Ga0496110_0019268 | 3300048913 | Bacteria | 5738 |
| 1654 | Ga0496110_0036101 | 3300048913 | Bacteria | 4291 |
| 1655 | Ga0496110_0062954 | 3300048913 | Bacteria | 3277 |
| 1656 | Ga0496110_0686512 | 3300048913 | Bacteria | 925 |
| 1657 | Ga0496110_1226679 | 3300048913 | Bacteria | 659 |
| 1658 | Ga0496110_1643964 | 3300048913 | Bacteria | 552 |
| 1659 | Ga0496111_0016124 | 3300048914 | Bacteria | 5146 |
| 1660 | Ga0496111_0125687 | 3300048914 | Bacteria | 1895 |
| 1661 | Ga0496111_0148683 | 3300048914 | Bacteria | 1737 |
| 1662 | Ga0496111_0242637 | 3300048914 | Bacteria | 1338 |
| 1663 | Ga0496111_0256985 | 3300048914 | Bacteria | 1296 |
| 1664 | Ga0496111_0849291 | 3300048914 | Bacteria | 659 |
| 1665 | Ga0496112_0189334 | 3300048915 | Bacteria | 2020 |
| 1666 | Ga0496112_0518419 | 3300048915 | Bacteria | 1127 |
| 1667 | Ga0496112_1036803 | 3300048915 | Bacteria | 739 |
| 1668 | Ga0496112_1241449 | 3300048915 | Bacteria | 661 |
| 1669 | Ga0496113_0061466 | 3300048916 | Bacteria | 2834 |
| 1670 | Ga0496113_0068519 | 3300048916 | Bacteria | 2693 |
| 1671 | Ga0496113_0132351 | 3300048916 | Bacteria | 1958 |
| 1672 | Ga0496113_0143982 | 3300048916 | Bacteria | 1877 |
| 1673 | Ga0496113_0798236 | 3300048916 | Bacteria | 750 |
| 1674 | Ga0496113_1150326 | 3300048916 | Bacteria | 607 |
| 1675 | Ga0496113_1594223 | 3300048916 | Bacteria | 502 |
| 1676 | Ga0496114_0002916 | 3300048917 | Bacteria | 13112 |
| 1677 | Ga0496114_0083131 | 3300048917 | Bacteria | 2708 |
| 1678 | Ga0496114_0308065 | 3300048917 | Bacteria | 1398 |
| 1679 | Ga0496114_0391521 | 3300048917 | Bacteria | 1231 |
| 1680 | Ga0496114_0593570 | 3300048917 | Bacteria | 977 |
| 1681 | Ga0496114_0624165 | 3300048917 | Bacteria | 949 |
| 1682 | Ga0496114_0720898 | 3300048917 | Bacteria | 873 |
| 1683 | Ga0496114_1081728 | 3300048917 | Bacteria | 686 |
| 1684 | Ga0496114_1108601 | 3300048917 | Bacteria | 676 |
| 1685 | Ga0496114_1176212 | 3300048917 | Bacteria | 653 |
| 1686 | Ga0496114_1352114 | 3300048917 | Bacteria | 599 |
| 1687 | Ga0496115_0061447 | 3300048918 | Bacteria | 3028 |
| 1688 | Ga0496115_0365229 | 3300048918 | Bacteria | 1175 |
| 1689 | Ga0496115_0688494 | 3300048918 | Bacteria | 805 |
| 1690 | Ga0496115_0770546 | 3300048918 | Bacteria | 751 |
| 1691 | Ga0496115_0955967 | 3300048918 | Bacteria | 657 |
| 1692 | Ga0496117_0028846 | 3300048920 | Bacteria | 4290 |
| 1693 | Ga0496119_0020275 | 3300048922 | Bacteria | 4856 |
| 1694 | Ga0496120_0369915 | 3300048923 | Bacteria | 640 |
| 1695 | Ga0496121_0007510 | 3300048924 | Bacteria | 13153 |
| 1696 | Ga0496125_0468259 | 3300048928 | Bacteria | 717 |
| 1697 | Ga0496126_0726524 | 3300048929 | Bacteria | 769 |
| 1698 | Ga0496126_0835989 | 3300048929 | Bacteria | 703 |
| 1699 | Ga0501306_016193 | 3300049127 | Bacteria | 999 |
| 1700 | Ga0501306_026302 | 3300049127 | Bacteria | 842 |
| 1701 | Ga0501306_056781 | 3300049127 | Bacteria | 638 |
| 1702 | Ga0501306_073855 | 3300049127 | Bacteria | 579 |
| 1703 | Ga0501308_006777 | 3300049128 | Bacteria | 1183 |
| 1704 | Ga0501309_068821 | 3300049129 | Bacteria | 579 |
| 1705 | Ga0501310_022788 | 3300049130 | Bacteria | 792 |
| 1706 | Ga0501310_079142 | 3300049130 | Bacteria | 514 |
| 1707 | Ga0501304_003547 | 3300049160 | Bacteria | 1149 |
| 1708 | Ga0501304_006443 | 3300049160 | Bacteria | 947 |
| 1709 | Ga0501305_119111 | 3300049161 | Bacteria | 505 |
| 1710 | Ga0501307_008271 | 3300049162 | Bacteria | 1165 |
| 1711 | Ga0495678_055852 | 3300049459 | Bacteria | 1504 |
| 1712 | Ga0495682_0005869 | 3300049460 | Bacteria | 5043 |
| 1713 | Ga0501311_012937 | 3300049527 | Bacteria | 1047 |
| 1714 | Ga0501312_046384 | 3300049528 | Bacteria | 723 |
| 1715 | Ga0501312_110483 | 3300049528 | Bacteria | 524 |
| 1716 | Ga0501313_011751 | 3300049529 | Bacteria | 1013 |
| 1717 | Ga0501314_017874 | 3300049530 | Bacteria | 717 |
| 1718 | Ga0501314_034440 | 3300049530 | Bacteria | 573 |
| 1719 | Ga0501315_017434 | 3300049531 | Bacteria | 939 |
| 1720 | Ga0501316_013954 | 3300049532 | Bacteria | 954 |
| 1721 | Ga0501316_031134 | 3300049532 | Bacteria | 714 |
| 1722 | Ga0501317_018717 | 3300049533 | Bacteria | 918 |
| 1723 | Ga0501317_019041 | 3300049533 | Bacteria | 914 |
| 1724 | Ga0501317_020531 | 3300049533 | Bacteria | 891 |
| 1725 | Ga0501318_017683 | 3300049534 | Bacteria | 873 |
| 1726 | Ga0501318_019601 | 3300049534 | Bacteria | 845 |
| 1727 | Ga0501319_010169 | 3300049535 | Bacteria | 746 |
| 1728 | Ga0501320_041643 | 3300049536 | Bacteria | 603 |
| 1729 | Ga0501321_057297 | 3300049537 | Bacteria | 582 |
| 1730 | Ga0501322_010682 | 3300049538 | Bacteria | 710 |
| 1731 | Ga0501323_038698 | 3300049539 | Bacteria | 693 |
| 1732 | Ga0501323_066488 | 3300049539 | Bacteria | 570 |
| 1733 | Ga0501324_006319 | 3300049540 | Bacteria | 996 |
| 1734 | Ga0501325_028288 | 3300049541 | Bacteria | 629 |
| 1735 | Ga0501340_018923 | 3300049556 | Bacteria | 566 |
| 1736 | Ga0501031_0001520 | 3300049568 | Bacteria | 14430 |
| 1737 | Ga0501031_0001758 | 3300049568 | Bacteria | 13592 |
| 1738 | Ga0501031_0005016 | 3300049568 | Bacteria | 8608 |
| 1739 | Ga0501031_0020667 | 3300049568 | Bacteria | 4293 |
| 1740 | Ga0501031_0032383 | 3300049568 | Bacteria | 3408 |
| 1741 | Ga0501031_0042680 | 3300049568 | Bacteria | 2960 |
| 1742 | Ga0501031_0101799 | 3300049568 | Bacteria | 1874 |
| 1743 | Ga0501031_0129984 | 3300049568 | Bacteria | 1645 |
| 1744 | Ga0501031_0332064 | 3300049568 | Bacteria | 984 |
| 1745 | Ga0501032_0008150 | 3300049569 | Bacteria | 7642 |
| 1746 | Ga0501032_0009602 | 3300049569 | Bacteria | 7011 |
| 1747 | Ga0501032_0032281 | 3300049569 | Bacteria | 3588 |
| 1748 | Ga0501032_0057997 | 3300049569 | Bacteria | 2600 |
| 1749 | Ga0501032_0083003 | 3300049569 | Bacteria | 2131 |
| 1750 | Ga0501032_0096678 | 3300049569 | Bacteria | 1958 |
| 1751 | Ga0501032_0097421 | 3300049569 | Bacteria | 1949 |
| 1752 | Ga0501032_0188587 | 3300049569 | Bacteria | 1348 |
| 1753 | Ga0501032_0336681 | 3300049569 | Bacteria | 973 |
| 1754 | Ga0501033_0004033 | 3300049570 | Bacteria | 11861 |
| 1755 | Ga0501033_0005389 | 3300049570 | Bacteria | 10137 |
| 1756 | Ga0501033_0032839 | 3300049570 | Bacteria | 3897 |
| 1757 | Ga0501033_0036941 | 3300049570 | Bacteria | 3658 |
| 1758 | Ga0501033_0045703 | 3300049570 | Bacteria | 3257 |
| 1759 | Ga0501033_0057628 | 3300049570 | Bacteria | 2870 |
| 1760 | Ga0501033_0061928 | 3300049570 | Bacteria | 2756 |
| 1761 | Ga0501033_0076409 | 3300049570 | Bacteria | 2458 |
| 1762 | Ga0501033_0620529 | 3300049570 | Bacteria | 740 |
| 1763 | Ga0501033_0626025 | 3300049570 | Bacteria | 736 |
| 1764 | Ga0501033_0683149 | 3300049570 | Bacteria | 699 |
| 1765 | Ga0501034_0004686 | 3300049571 | Bacteria | 15141 |
| 1766 | Ga0501034_0010199 | 3300049571 | Bacteria | 9800 |
| 1767 | Ga0501034_0026116 | 3300049571 | Bacteria | 5947 |
| 1768 | Ga0501034_0028993 | 3300049571 | Bacteria | 5628 |
| 1769 | Ga0501034_0029673 | 3300049571 | Bacteria | 5560 |
| 1770 | Ga0501034_0087674 | 3300049571 | Bacteria | 3111 |
| 1771 | Ga0501034_0120148 | 3300049571 | Bacteria | 2614 |
| 1772 | Ga0501034_0147390 | 3300049571 | Bacteria | 2330 |
| 1773 | Ga0501034_0644284 | 3300049571 | Bacteria | 962 |
| 1774 | Ga0501036_0001218 | 3300049572 | Bacteria | 19672 |
| 1775 | Ga0501036_0002529 | 3300049572 | Bacteria | 14358 |
| 1776 | Ga0501036_0008870 | 3300049572 | Bacteria | 8257 |
| 1777 | Ga0501036_0012043 | 3300049572 | Bacteria | 7168 |
| 1778 | Ga0501036_0035396 | 3300049572 | Bacteria | 4226 |
| 1779 | Ga0501036_0158590 | 3300049572 | Bacteria | 1908 |
| 1780 | Ga0501036_0167218 | 3300049572 | Bacteria | 1853 |
| 1781 | Ga0501036_0591824 | 3300049572 | Bacteria | 920 |
| 1782 | Ga0501037_0001902 | 3300049573 | Bacteria | 15167 |
| 1783 | Ga0501037_0010995 | 3300049573 | Bacteria | 6655 |
| 1784 | Ga0501037_0018548 | 3300049573 | Bacteria | 5129 |
| 1785 | Ga0501037_0028718 | 3300049573 | Bacteria | 4109 |
| 1786 | Ga0501037_0058249 | 3300049573 | Bacteria | 2819 |
| 1787 | Ga0501037_0065314 | 3300049573 | Bacteria | 2651 |
| 1788 | Ga0501037_0070515 | 3300049573 | Bacteria | 2543 |
| 1789 | Ga0501037_0120552 | 3300049573 | Bacteria | 1886 |
| 1790 | Ga0501037_0384395 | 3300049573 | Bacteria | 964 |
| 1791 | Ga0501037_0772692 | 3300049573 | Bacteria | 636 |
| 1792 | Ga0501037_0987404 | 3300049573 | Bacteria | 549 |
| 1793 | Ga0501038_0001782 | 3300049574 | Bacteria | 19989 |
| 1794 | Ga0501038_0006639 | 3300049574 | Bacteria | 10701 |
| 1795 | Ga0501038_0019013 | 3300049574 | Bacteria | 6199 |
| 1796 | Ga0501038_0019466 | 3300049574 | Bacteria | 6117 |
| 1797 | Ga0501038_0037045 | 3300049574 | Bacteria | 4279 |
| 1798 | Ga0501038_0058879 | 3300049574 | Bacteria | 3292 |
| 1799 | Ga0501038_0115696 | 3300049574 | Bacteria | 2217 |
| 1800 | Ga0501038_0187204 | 3300049574 | Bacteria | 1667 |
| 1801 | Ga0501038_0773577 | 3300049574 | Bacteria | 715 |
| 1802 | Ga0501038_1041324 | 3300049574 | Bacteria | 599 |
| 1803 | Ga0501039_0003824 | 3300049575 | Bacteria | 11302 |
| 1804 | Ga0501039_0007568 | 3300049575 | Bacteria | 8296 |
| 1805 | Ga0501039_0009657 | 3300049575 | Bacteria | 7356 |
| 1806 | Ga0501039_0010002 | 3300049575 | Bacteria | 7232 |
| 1807 | Ga0501039_0017425 | 3300049575 | Bacteria | 5509 |
| 1808 | Ga0501039_0022464 | 3300049575 | Bacteria | 4842 |
| 1809 | Ga0501039_0154128 | 3300049575 | Bacteria | 1805 |
| 1810 | Ga0501039_0279446 | 3300049575 | Bacteria | 1312 |
| 1811 | Ga0501039_0414711 | 3300049575 | Bacteria | 1058 |
| 1812 | Ga0501039_0797700 | 3300049575 | Bacteria | 737 |
| 1813 | Ga0501040_0000579 | 3300049576 | Bacteria | 22317 |
| 1814 | Ga0501040_0006040 | 3300049576 | Bacteria | 7841 |
| 1815 | Ga0501040_0047011 | 3300049576 | Bacteria | 2946 |
| 1816 | Ga0501040_0049450 | 3300049576 | Bacteria | 2874 |
| 1817 | Ga0501040_0105028 | 3300049576 | Bacteria | 1973 |
| 1818 | Ga0501041_0001041 | 3300049577 | Bacteria | 15194 |
| 1819 | Ga0501041_0001449 | 3300049577 | Bacteria | 13103 |
| 1820 | Ga0501041_0035608 | 3300049577 | Bacteria | 3016 |
| 1821 | Ga0501041_0118468 | 3300049577 | Bacteria | 1644 |
| 1822 | Ga0501041_1101466 | 3300049577 | Bacteria | 512 |
| 1823 | Ga0501042_0000607 | 3300049578 | Bacteria | 19078 |
| 1824 | Ga0501042_0007272 | 3300049578 | Bacteria | 7241 |
| 1825 | Ga0501042_0008352 | 3300049578 | Bacteria | 6827 |
| 1826 | Ga0501042_0013528 | 3300049578 | Bacteria | 5556 |
| 1827 | Ga0501042_0022365 | 3300049578 | Bacteria | 4417 |
| 1828 | Ga0501042_0106831 | 3300049578 | Bacteria | 2015 |
| 1829 | Ga0501042_0209058 | 3300049578 | Bacteria | 1407 |
| 1830 | Ga0501042_0248216 | 3300049578 | Bacteria | 1284 |
| 1831 | Ga0501042_0784358 | 3300049578 | Bacteria | 693 |
| 1832 | Ga0501043_0003568 | 3300049579 | Bacteria | 12767 |
| 1833 | Ga0501043_0008028 | 3300049579 | Bacteria | 8334 |
| 1834 | Ga0501043_0011123 | 3300049579 | Bacteria | 7048 |
| 1835 | Ga0501043_0062277 | 3300049579 | Bacteria | 2929 |
| 1836 | Ga0501043_0067156 | 3300049579 | Bacteria | 2816 |
| 1837 | Ga0501043_0146826 | 3300049579 | Bacteria | 1846 |
| 1838 | Ga0501043_0185774 | 3300049579 | Bacteria | 1618 |
| 1839 | Ga0501043_0464413 | 3300049579 | Bacteria | 949 |
| 1840 | Ga0501046_0000350 | 3300049580 | Bacteria | 46288 |
| 1841 | Ga0501046_0001971 | 3300049580 | Bacteria | 19517 |
| 1842 | Ga0501046_0006649 | 3300049580 | Bacteria | 10210 |
| 1843 | Ga0501046_0009788 | 3300049580 | Bacteria | 8266 |
| 1844 | Ga0501046_0269366 | 3300049580 | Bacteria | 1249 |
| 1845 | Ga0501047_0000082 | 3300049581 | Bacteria | 121193 |
| 1846 | Ga0501047_0027981 | 3300049581 | Bacteria | 5432 |
| 1847 | Ga0501047_0040432 | 3300049581 | Bacteria | 4510 |
| 1848 | Ga0501047_0043725 | 3300049581 | Bacteria | 4327 |
| 1849 | Ga0501047_0056039 | 3300049581 | Bacteria | 3811 |
| 1850 | Ga0501047_0174784 | 3300049581 | Bacteria | 2015 |
| 1851 | Ga0501047_0176285 | 3300049581 | Bacteria | 2005 |
| 1852 | Ga0501047_0846179 | 3300049581 | Bacteria | 729 |
| 1853 | Ga0501048_0003167 | 3300049582 | Bacteria | 12539 |
| 1854 | Ga0501048_0025475 | 3300049582 | Bacteria | 4310 |
| 1855 | Ga0501048_0028799 | 3300049582 | Bacteria | 4031 |
| 1856 | Ga0501048_0114008 | 3300049582 | Bacteria | 1909 |
| 1857 | Ga0501067_0000588 | 3300049583 | Bacteria | 19588 |
| 1858 | Ga0501067_0006519 | 3300049583 | Bacteria | 6472 |
| 1859 | Ga0501067_0011450 | 3300049583 | Bacteria | 4912 |
| 1860 | Ga0501067_0129624 | 3300049583 | Bacteria | 1404 |
| 1861 | Ga0501067_0162598 | 3300049583 | Bacteria | 1243 |
| 1862 | Ga0501067_0289061 | 3300049583 | Bacteria | 913 |
| 1863 | Ga0501067_0298539 | 3300049583 | Bacteria | 897 |
| 1864 | Ga0501067_0341550 | 3300049583 | Bacteria | 834 |
| 1865 | Ga0501068_0002952 | 3300049584 | Bacteria | 9056 |
| 1866 | Ga0501068_0005119 | 3300049584 | Bacteria | 7143 |
| 1867 | Ga0501068_0016559 | 3300049584 | Bacteria | 4250 |
| 1868 | Ga0501068_0029090 | 3300049584 | Bacteria | 3271 |
| 1869 | Ga0501068_0033245 | 3300049584 | Bacteria | 3071 |
| 1870 | Ga0501068_0403671 | 3300049584 | Bacteria | 881 |
| 1871 | Ga0501069_0015331 | 3300049585 | Bacteria | 4106 |
| 1872 | Ga0501069_0039069 | 3300049585 | Bacteria | 2621 |
| 1873 | Ga0501069_0068075 | 3300049585 | Bacteria | 1992 |
| 1874 | Ga0501069_0162964 | 3300049585 | Bacteria | 1284 |
| 1875 | Ga0501069_0199757 | 3300049585 | Bacteria | 1158 |
| 1876 | Ga0501069_0300642 | 3300049585 | Bacteria | 941 |
| 1877 | Ga0501069_0758572 | 3300049585 | Bacteria | 587 |
| 1878 | Ga0501069_0855057 | 3300049585 | Bacteria | 552 |
| 1879 | Ga0501070_0001374 | 3300049586 | Bacteria | 21761 |
| 1880 | Ga0501070_0001688 | 3300049586 | Bacteria | 19572 |
| 1881 | Ga0501070_0003396 | 3300049586 | Bacteria | 13822 |
| 1882 | Ga0501070_0004501 | 3300049586 | Bacteria | 11964 |
| 1883 | Ga0501070_0016792 | 3300049586 | Bacteria | 6144 |
| 1884 | Ga0501070_0062709 | 3300049586 | Bacteria | 3079 |
| 1885 | Ga0501070_0072239 | 3300049586 | Bacteria | 2856 |
| 1886 | Ga0501070_0168938 | 3300049586 | Bacteria | 1802 |
| 1887 | Ga0501070_0260878 | 3300049586 | Bacteria | 1416 |
| 1888 | Ga0501070_0369077 | 3300049586 | Bacteria | 1163 |
| 1889 | Ga0501070_0549610 | 3300049586 | Bacteria | 924 |
| 1890 | Ga0501070_0811722 | 3300049586 | Bacteria | 734 |
| 1891 | Ga0501070_1337098 | 3300049586 | Bacteria | 546 |
| 1892 | Ga0501071_0005647 | 3300049587 | Bacteria | 8065 |
| 1893 | Ga0501071_0016929 | 3300049587 | Bacteria | 5017 |
| 1894 | Ga0501071_0032668 | 3300049587 | Bacteria | 3696 |
| 1895 | Ga0501071_0039679 | 3300049587 | Bacteria | 3368 |
| 1896 | Ga0501071_0051445 | 3300049587 | Bacteria | 2968 |
| 1897 | Ga0501071_0219565 | 3300049587 | Bacteria | 1430 |
| 1898 | Ga0501071_0490613 | 3300049587 | Bacteria | 942 |
| 1899 | Ga0501072_0000270 | 3300049588 | Bacteria | 37630 |
| 1900 | Ga0501072_0005882 | 3300049588 | Bacteria | 9341 |
| 1901 | Ga0501072_0008909 | 3300049588 | Bacteria | 7625 |
| 1902 | Ga0501072_0020558 | 3300049588 | Bacteria | 5116 |
| 1903 | Ga0501072_0022030 | 3300049588 | Bacteria | 4943 |
| 1904 | Ga0501072_0400957 | 3300049588 | Bacteria | 1088 |
| 1905 | Ga0501073_0005761 | 3300049589 | Bacteria | 9262 |
| 1906 | Ga0501073_0026507 | 3300049589 | Bacteria | 4152 |
| 1907 | Ga0501073_0049763 | 3300049589 | Bacteria | 2937 |
| 1908 | Ga0501073_0195689 | 3300049589 | Bacteria | 1398 |
| 1909 | Ga0501073_0205868 | 3300049589 | Bacteria | 1360 |
| 1910 | Ga0501073_0212647 | 3300049589 | Bacteria | 1336 |
| 1911 | Ga0501073_0504434 | 3300049589 | Bacteria | 836 |
| 1912 | Ga0501073_0576558 | 3300049589 | Bacteria | 777 |
| 1913 | Ga0501073_0978170 | 3300049589 | Bacteria | 582 |
| 1914 | Ga0501074_0000467 | 3300049590 | Bacteria | 24425 |
| 1915 | Ga0501074_0001013 | 3300049590 | Bacteria | 18266 |
| 1916 | Ga0501074_0004839 | 3300049590 | Bacteria | 9652 |
| 1917 | Ga0501074_0006802 | 3300049590 | Bacteria | 8257 |
| 1918 | Ga0501074_0022949 | 3300049590 | Bacteria | 4538 |
| 1919 | Ga0501074_0046101 | 3300049590 | Bacteria | 3151 |
| 1920 | Ga0501074_0065394 | 3300049590 | Bacteria | 2617 |
| 1921 | Ga0501074_0073103 | 3300049590 | Bacteria | 2463 |
| 1922 | Ga0501074_0095789 | 3300049590 | Bacteria | 2125 |
| 1923 | Ga0501074_0620009 | 3300049590 | Bacteria | 765 |
| 1924 | Ga0501075_0000637 | 3300049591 | Bacteria | 21435 |
| 1925 | Ga0501075_0009333 | 3300049591 | Bacteria | 6863 |
| 1926 | Ga0501075_0023189 | 3300049591 | Bacteria | 4541 |
| 1927 | Ga0501076_0001351 | 3300049592 | Bacteria | 16400 |
| 1928 | Ga0501076_0003185 | 3300049592 | Bacteria | 11450 |
| 1929 | Ga0501076_0004713 | 3300049592 | Bacteria | 9726 |
| 1930 | Ga0501076_0100103 | 3300049592 | Bacteria | 2335 |
| 1931 | Ga0501076_0104276 | 3300049592 | Bacteria | 2288 |
| 1932 | Ga0501076_0776127 | 3300049592 | Bacteria | 791 |
| 1933 | Ga0501077_0001343 | 3300049593 | Bacteria | 14842 |
| 1934 | Ga0501077_0001967 | 3300049593 | Bacteria | 12418 |
| 1935 | Ga0501077_0005313 | 3300049593 | Bacteria | 7826 |
| 1936 | Ga0501077_0006715 | 3300049593 | Bacteria | 7078 |
| 1937 | Ga0501077_0031918 | 3300049593 | Bacteria | 3351 |
| 1938 | Ga0501077_0033465 | 3300049593 | Bacteria | 3271 |
| 1939 | Ga0501077_0348454 | 3300049593 | Bacteria | 945 |
| 1940 | Ga0501077_0362636 | 3300049593 | Bacteria | 925 |
| 1941 | Ga0501223_115543 | 3300049663 | Bacteria | 563 |
| 1942 | Ga0501079_0000101 | 3300049741 | Bacteria | 43428 |
| 1943 | Ga0501079_0000116 | 3300049741 | Bacteria | 41552 |
| 1944 | Ga0501079_0004539 | 3300049741 | Bacteria | 10297 |
| 1945 | Ga0501079_0032784 | 3300049741 | Bacteria | 3995 |
| 1946 | Ga0501079_0039279 | 3300049741 | Bacteria | 3650 |
| 1947 | Ga0501079_0116421 | 3300049741 | Bacteria | 2077 |
| 1948 | Ga0501079_0117223 | 3300049741 | Bacteria | 2070 |
| 1949 | Ga0501079_1209836 | 3300049741 | Bacteria | 595 |
| 1950 | Ga0501080_0001308 | 3300049742 | Bacteria | 20742 |
| 1951 | Ga0501080_0005935 | 3300049742 | Bacteria | 10946 |
| 1952 | Ga0501080_0010008 | 3300049742 | Bacteria | 8668 |
| 1953 | Ga0501080_0022122 | 3300049742 | Bacteria | 5891 |
| 1954 | Ga0501080_0023020 | 3300049742 | Bacteria | 5778 |
| 1955 | Ga0501080_0046099 | 3300049742 | Bacteria | 4060 |
| 1956 | Ga0501080_0059335 | 3300049742 | Bacteria | 3560 |
| 1957 | Ga0501080_0078415 | 3300049742 | Bacteria | 3072 |
| 1958 | Ga0501080_0104595 | 3300049742 | Bacteria | 2625 |
| 1959 | Ga0501080_0157590 | 3300049742 | Bacteria | 2097 |
| 1960 | Ga0501081_0006102 | 3300049743 | Bacteria | 7812 |
| 1961 | Ga0501081_0011066 | 3300049743 | Bacteria | 5900 |
| 1962 | Ga0501081_0059195 | 3300049743 | Bacteria | 2651 |
| 1963 | Ga0501081_0800379 | 3300049743 | Bacteria | 709 |
| 1964 | Ga0501081_0871279 | 3300049743 | Bacteria | 679 |
| 1965 | Ga0501083_0017262 | 3300049744 | Bacteria | 5032 |
| 1966 | Ga0501083_0025869 | 3300049744 | Bacteria | 4062 |
| 1967 | Ga0501083_0049351 | 3300049744 | Bacteria | 2837 |
| 1968 | Ga0501083_0080653 | 3300049744 | Bacteria | 2157 |
| 1969 | Ga0501269_050554 | 3300049766 | Bacteria | 571 |
| 1970 | Ga0501035_0001438 | 3300049822 | Bacteria | 24416 |
| 1971 | Ga0501035_0008434 | 3300049822 | Bacteria | 9595 |
| 1972 | Ga0501035_0019377 | 3300049822 | Bacteria | 6258 |
| 1973 | Ga0501035_0022376 | 3300049822 | Bacteria | 5804 |
| 1974 | Ga0501035_0037050 | 3300049822 | Bacteria | 4418 |
| 1975 | Ga0501035_0041418 | 3300049822 | Bacteria | 4158 |
| 1976 | Ga0501035_0077993 | 3300049822 | Bacteria | 2927 |
| 1977 | Ga0501035_0269160 | 3300049822 | Bacteria | 1443 |
| 1978 | Ga0501035_0321346 | 3300049822 | Bacteria | 1300 |
| 1979 | Ga0501035_0480666 | 3300049822 | Bacteria | 1024 |
| 1980 | Ga0501044_0004514 | 3300049823 | Bacteria | 15562 |
| 1981 | Ga0501044_0038471 | 3300049823 | Bacteria | 4995 |
| 1982 | Ga0501044_0040381 | 3300049823 | Bacteria | 4862 |
| 1983 | Ga0501044_0047320 | 3300049823 | Bacteria | 4448 |
| 1984 | Ga0501044_0048427 | 3300049823 | Bacteria | 4391 |
| 1985 | Ga0501044_0101227 | 3300049823 | Bacteria | 2899 |
| 1986 | Ga0501044_0133427 | 3300049823 | Bacteria | 2476 |
| 1987 | Ga0501044_0140994 | 3300049823 | Bacteria | 2399 |
| 1988 | Ga0501044_0203404 | 3300049823 | Bacteria | 1938 |
| 1989 | Ga0501044_0255597 | 3300049823 | Bacteria | 1691 |
| 1990 | Ga0501044_0283851 | 3300049823 | Bacteria | 1588 |
| 1991 | Ga0501044_0605989 | 3300049823 | Bacteria | 988 |
| 1992 | Ga0501044_0824696 | 3300049823 | Bacteria | 806 |
| 1993 | Ga0501044_1211710 | 3300049823 | Bacteria | 622 |
| 1994 | Ga0501045_0001819 | 3300049824 | Bacteria | 14408 |
| 1995 | Ga0501045_0005729 | 3300049824 | Bacteria | 8602 |
| 1996 | Ga0501045_0024980 | 3300049824 | Bacteria | 4292 |
| 1997 | Ga0501045_0111857 | 3300049824 | Bacteria | 2025 |
| 1998 | Ga0501045_0160595 | 3300049824 | Bacteria | 1673 |
| 1999 | Ga0501045_0251326 | 3300049824 | Bacteria | 1316 |
| 2000 | Ga0501045_0346534 | 3300049824 | Bacteria | 1105 |
| 2001 | Ga0501045_0946683 | 3300049824 | Bacteria | 632 |
| 2002 | nmdc:mga03n38_187029_c1 | 3300050490 | Bacteria | 1065 |
| 2003 | nmdc:mga03n38_310903_c1 | 3300050490 | Bacteria | 849 |
| 2004 | nmdc:mga03n38_50941_c1 | 3300050490 | Bacteria | 1847 |
| 2005 | nmdc:mga00v17_119642_c1 | 3300050491 | Bacteria | 1676 |
| 2006 | nmdc:mga00v17_352928_c1 | 3300050491 | Bacteria | 956 |
| 2007 | nmdc:mga00v17_548062_c1 | 3300050491 | Bacteria | 748 |
| 2008 | nmdc:mga0yw44_11283_c1 | 3300050492 | Bacteria | 4606 |
| 2009 | nmdc:mga0yw44_123625_c1 | 3300050492 | Bacteria | 1669 |
| 2010 | nmdc:mga0yw44_175697_c1 | 3300050492 | Bacteria | 1408 |
| 2011 | nmdc:mga0yw44_684704_c1 | 3300050492 | Bacteria | 697 |
| 2012 | nmdc:mga0yw44_818351_c1 | 3300050492 | Bacteria | 632 |
| 2013 | nmdc:mga06z11_15925_c1 | 3300050494 | Bacteria | 3371 |
| 2014 | nmdc:mga06z11_19310_c1 | 3300050494 | Bacteria | 3131 |
| 2015 | nmdc:mga06z11_5215_c1 | 3300050494 | Bacteria | 5193 |
| 2016 | nmdc:mga04h51_465981_c1 | 3300050495 | Bacteria | 536 |
| 2017 | nmdc:mga04h51_51127_c1 | 3300050495 | Bacteria | 1387 |
| 2018 | nmdc:mga04h51_62512_c1 | 3300050495 | Bacteria | 1280 |
| 2019 | nmdc:mga07m45_191974_c1 | 3300050496 | Bacteria | 1188 |
| 2020 | nmdc:mga07m45_87073_c1 | 3300050496 | Bacteria | 1787 |
| 2021 | nmdc:mga05p37_114478_c1 | 3300050507 | Bacteria | 3315 |
| 2022 | nmdc:mga05p37_6462_c1 | 3300050507 | Bacteria | 13826 |
| 2023 | nmdc:mga09592_10546_c1 | 3300050508 | Bacteria | 7518 |
| 2024 | nmdc:mga09592_499059_c1 | 3300050508 | Bacteria | 1048 |
| 2025 | nmdc:mga0qj67_257874_c1 | 3300050509 | Bacteria | 1415 |
| 2026 | nmdc:mga06r32_2732_c1 | 3300050510 | Bacteria | 15788 |
| 2027 | nmdc:mga08y16_12139_c1 | 3300050511 | Bacteria | 9054 |
| 2028 | nmdc:mga08y16_515666_c1 | 3300050511 | Bacteria | 1213 |
| 2029 | nmdc:mga08y16_699681_c1 | 3300050511 | Bacteria | 1013 |
| 2030 | nmdc:mga0n895_111117_c1 | 3300050512 | Bacteria | 2757 |
| 2031 | nmdc:mga0n895_174320_c1 | 3300050512 | Bacteria | 2182 |
| 2032 | nmdc:mga0n895_34608_c1 | 3300050512 | Bacteria | 4864 |
| 2033 | nmdc:mga0n895_904729_c1 | 3300050512 | Bacteria | 868 |
| 2034 | nmdc:mga0rr50_1236835_c1 | 3300050513 | Bacteria | 634 |
| 2035 | nmdc:mga0rr50_143507_c1 | 3300050513 | Bacteria | 1923 |
| 2036 | nmdc:mga0rr50_653046_c1 | 3300050513 | Bacteria | 898 |
| 2037 | nmdc:mga08x19_300406_c1 | 3300050514 | Bacteria | 1115 |
| 2038 | nmdc:mga08x19_608140_c1 | 3300050514 | Bacteria | 775 |
| 2039 | nmdc:mga0a205_159293_c1 | 3300050515 | Bacteria | 2155 |
| 2040 | nmdc:mga0a205_3754_c1 | 3300050515 | Bacteria | 13599 |
| 2041 | nmdc:mga0a205_568603_c1 | 3300050515 | Bacteria | 988 |
| 2042 | Ga0495601_0007727 | 3300053077 | Bacteria | 6322 |
| 2043 | Ga0495601_0071684 | 3300053077 | Bacteria | 2212 |
| 2044 | Ga0495601_0098757 | 3300053077 | Bacteria | 1884 |
| 2045 | Ga0495601_0330064 | 3300053077 | Bacteria | 993 |
| 2046 | Ga0495601_0827590 | 3300053077 | Bacteria | 587 |
| 2047 | Ga0495612_0003458 | 3300053078 | Bacteria | 6545 |
| 2048 | Ga0495612_0007651 | 3300053078 | Bacteria | 4413 |
| 2049 | Ga0495612_0085043 | 3300053078 | Bacteria | 1333 |
| 2050 | Ga0495612_0147651 | 3300053078 | Bacteria | 1022 |
| 2051 | Ga0500610_0035252 | 3300053079 | Bacteria | 2565 |
| 2052 | Ga0500610_0080827 | 3300053079 | Bacteria | 1694 |
| 2053 | Ga0495655_0001784 | 3300053083 | Bacteria | 3347 |
| 2054 | Ga0495655_0012525 | 3300053083 | Bacteria | 1731 |
| 2055 | Ga0495655_0045842 | 3300053083 | Bacteria | 1137 |
| 2056 | Ga0495595_0007432 | 3300053084 | Bacteria | 4486 |
| 2057 | Ga0495595_0009129 | 3300053084 | Bacteria | 4096 |
| 2058 | Ga0495619_0010762 | 3300053085 | Bacteria | 5756 |
| 2059 | Ga0495619_0011748 | 3300053085 | Bacteria | 5518 |
| 2060 | Ga0495619_0030603 | 3300053085 | Bacteria | 3484 |
| 2061 | Ga0495619_0042518 | 3300053085 | Bacteria | 2976 |
| 2062 | Ga0495619_0120465 | 3300053085 | Bacteria | 1799 |
| 2063 | Ga0495619_0452760 | 3300053085 | Bacteria | 885 |
| 2064 | Ga0500578_0006859 | 3300053086 | Bacteria | 7556 |
| 2065 | Ga0500578_0126045 | 3300053086 | Bacteria | 1608 |
| 2066 | Ga0500647_0110949 | 3300053091 | Bacteria | 1304 |
| 2067 | Ga0500583_0038758 | 3300053092 | Bacteria | 2148 |
| 2068 | Ga0500583_0061881 | 3300053092 | Bacteria | 1769 |
| 2069 | Ga0500566_0136760 | 3300053094 | Bacteria | 1304 |
| 2070 | Ga0500566_0515526 | 3300053094 | Bacteria | 512 |
| 2071 | Ga0500640_109154 | 3300053095 | Bacteria | 1129 |
| 2072 | Ga0500641_0135438 | 3300053096 | Bacteria | 1063 |
| 2073 | Ga0500650_0054083 | 3300053098 | Bacteria | 1868 |
| 2074 | Ga0500654_039757 | 3300053099 | Bacteria | 2690 |
| 2075 | Ga0500660_096080 | 3300053100 | Bacteria | 1307 |
| 2076 | Ga0500553_031442 | 3300053101 | Bacteria | 2647 |
| 2077 | Ga0500558_032856 | 3300053106 | Bacteria | 2214 |
| 2078 | Ga0500560_004604 | 3300053107 | Bacteria | 2954 |
| 2079 | Ga0500560_072902 | 3300053107 | Bacteria | 1133 |
| 2080 | Ga0500569_004849 | 3300053109 | Bacteria | 2858 |
| 2081 | Ga0500582_113048 | 3300053114 | Bacteria | 945 |
| 2082 | Ga0500614_012437 | 3300053123 | Bacteria | 1857 |
| 2083 | Ga0500614_038919 | 3300053123 | Bacteria | 1200 |
| 2084 | Ga0500621_062680 | 3300053126 | Bacteria | 1502 |
| 2085 | Ga0500628_000565 | 3300053129 | Bacteria | 6750 |
| 2086 | Ga0500628_242801 | 3300053129 | Bacteria | 528 |
| 2087 | Ga0500652_000224 | 3300053131 | Bacteria | 21753 |
| 2088 | Ga0500652_339740 | 3300053131 | Bacteria | 570 |
| 2089 | Ga0500658_0005753 | 3300053134 | Bacteria | 4619 |
| 2090 | Ga0500559_0239480 | 3300053136 | Bacteria | 855 |
| 2091 | Ga0500561_0000306 | 3300053137 | Bacteria | 8416 |
| 2092 | Ga0500564_116365 | 3300053138 | Bacteria | 1169 |
| 2093 | Ga0500573_0064876 | 3300053140 | Bacteria | 2088 |
| 2094 | Ga0500573_0077749 | 3300053140 | Bacteria | 1888 |
| 2095 | Ga0500573_0174440 | 3300053140 | Bacteria | 1160 |
| 2096 | Ga0500573_0237534 | 3300053140 | Bacteria | 947 |
| 2097 | Ga0500577_0336053 | 3300053142 | Bacteria | 660 |
| 2098 | Ga0500579_073305 | 3300053143 | Bacteria | 1962 |
| 2099 | Ga0500586_049792 | 3300053145 | Bacteria | 1443 |
| 2100 | Ga0500586_170856 | 3300053145 | Bacteria | 731 |
| 2101 | Ga0500590_257113 | 3300053148 | Bacteria | 689 |
| 2102 | Ga0500600_0023373 | 3300053149 | Bacteria | 3691 |
| 2103 | Ga0500600_0061947 | 3300053149 | Bacteria | 2082 |
| 2104 | Ga0500600_0252445 | 3300053149 | Bacteria | 789 |
| 2105 | Ga0500603_052203 | 3300053150 | Bacteria | 1122 |
| 2106 | Ga0500624_004048 | 3300053157 | Bacteria | 1921 |
| 2107 | Ga0500627_0259645 | 3300053158 | Bacteria | 767 |
| 2108 | Ga0500633_0002695 | 3300053160 | Bacteria | 3715 |
| 2109 | Ga0500633_0025173 | 3300053160 | Bacteria | 1858 |
| 2110 | Ga0500634_0001104 | 3300053161 | Bacteria | 9996 |
| 2111 | Ga0500634_0135673 | 3300053161 | Bacteria | 1174 |
| 2112 | Ga0500636_0076304 | 3300053177 | Bacteria | 1938 |
| 2113 | Ga0500656_000394 | 3300053732 | Bacteria | 3175 |
| 2114 | Ga0500587_005298 | 3300053739 | Bacteria | 1740 |
| 2115 | Ga0501084_0003000 | 3300054114 | Bacteria | 13672 |
| 2116 | Ga0501084_0011286 | 3300054114 | Bacteria | 7395 |
| 2117 | Ga0501084_0012452 | 3300054114 | Bacteria | 7050 |
| 2118 | Ga0501084_0054298 | 3300054114 | Bacteria | 3351 |
| 2119 | Ga0501084_0058996 | 3300054114 | Bacteria | 3212 |
| 2120 | Ga0501084_0063427 | 3300054114 | Bacteria | 3093 |
| 2121 | Ga0501084_0135656 | 3300054114 | Bacteria | 2072 |
| 2122 | Ga0501084_0260857 | 3300054114 | Bacteria | 1463 |
| 2123 | Ga0590071_007801 | 3300059421 | Bacteria | 2530 |
| 2124 | Ga0590077_012840 | 3300059426 | Bacteria | 1739 |
| 2125 | Ga0587084_056625 | 3300059477 | Bacteria | 708 |
| 2126 | Ga0587084_071300 | 3300059477 | Bacteria | 656 |
| 2127 | Ga0587093_037219 | 3300059478 | Bacteria | 725 |
| 2128 | Ga0587093_071716 | 3300059478 | Bacteria | 583 |
| 2129 | Ga0587066_135223 | 3300059490 | Bacteria | 596 |
| 2130 | Ga0587066_204050 | 3300059490 | Bacteria | 522 |
| 2131 | Ga0587070_042295 | 3300059491 | Bacteria | 877 |
| 2132 | Ga0587070_077693 | 3300059491 | Bacteria | 722 |
| 2133 | Ga0587070_148926 | 3300059491 | Bacteria | 585 |
| 2134 | Ga0587073_0036373 | 3300059492 | Bacteria | 1049 |
| 2135 | Ga0587077_059551 | 3300059493 | Bacteria | 823 |
| 2136 | Ga0587077_064803 | 3300059493 | Bacteria | 801 |
| 2137 | Ga0587080_123904 | 3300059503 | Bacteria | 575 |
| 2138 | Ga0587082_015224 | 3300059504 | Bacteria | 1184 |
| 2139 | Ga0587082_084420 | 3300059504 | Bacteria | 667 |
| 2140 | Ga0587082_128972 | 3300059504 | Bacteria | 579 |
| 2141 | Ga0587083_0062786 | 3300059505 | Bacteria | 842 |
| 2142 | Ga0587083_0138073 | 3300059505 | Bacteria | 646 |
| 2143 | Ga0587086_060008 | 3300059507 | Bacteria | 632 |
| 2144 | Ga0587086_100781 | 3300059507 | Bacteria | 532 |
| 2145 | Ga0587086_117062 | 3300059507 | Bacteria | 506 |
| 2146 | Ga0587088_029323 | 3300059508 | Bacteria | 974 |
| 2147 | Ga0587088_079551 | 3300059508 | Bacteria | 699 |
| 2148 | Ga0587088_083515 | 3300059508 | Bacteria | 688 |
| 2149 | Ga0587089_030881 | 3300059509 | Bacteria | 790 |
| 2150 | Ga0587089_045871 | 3300059509 | Bacteria | 689 |
| 2151 | Ga0587089_097698 | 3300059509 | Bacteria | 529 |
| 2152 | Ga0587090_061073 | 3300059510 | Bacteria | 715 |
| 2153 | Ga0587090_118392 | 3300059510 | Bacteria | 572 |
| 2154 | Ga0587090_147523 | 3300059510 | Bacteria | 531 |
| 2155 | Ga0587091_033717 | 3300059511 | Bacteria | 975 |
| 2156 | Ga0587091_195216 | 3300059511 | Bacteria | 540 |
| 2157 | Ga0587092_064880 | 3300059512 | Bacteria | 691 |
| 2158 | Ga0587094_039699 | 3300059513 | Bacteria | 762 |
| 2159 | Ga0587094_092102 | 3300059513 | Bacteria | 575 |
| 2160 | Ga0587095_013316 | 3300059514 | Bacteria | 725 |
| 2161 | Ga0587095_040725 | 3300059514 | Bacteria | 507 |
| 2162 | Ga0587098_009513 | 3300059604 | Bacteria | 1058 |
| 2163 | Ga0587098_039147 | 3300059604 | Bacteria | 683 |
| 2164 | Ga0587106_011775 | 3300059605 | Bacteria | 1161 |
| 2165 | Ga0587106_162451 | 3300059605 | Bacteria | 504 |
| 2166 | Ga0587121_12050 | 3300059606 | Bacteria | 554 |
| 2167 | Ga0587129_011998 | 3300059608 | Bacteria | 688 |
| 2168 | Ga0587101_062885 | 3300059623 | Bacteria | 667 |
| 2169 | Ga0587109_040369 | 3300059624 | Bacteria | 923 |
| 2170 | Ga0587115_118606 | 3300059626 | Bacteria | 507 |
| 2171 | Ga0587117_082174 | 3300059627 | Bacteria | 589 |
| 2172 | Ga0587117_105524 | 3300059627 | Bacteria | 542 |
| 2173 | Ga0587122_004238 | 3300059628 | Bacteria | 1150 |
| 2174 | Ga0587122_037222 | 3300059628 | Bacteria | 593 |
| 2175 | Ga0587127_015289 | 3300059629 | Bacteria | 640 |
| 2176 | Ga0587127_026249 | 3300059629 | Bacteria | 540 |
| 2177 | Ga0587128_013352 | 3300059630 | Bacteria | 1158 |
| 2178 | Ga0587128_072532 | 3300059630 | Bacteria | 673 |
| 2179 | Ga0587062_009549 | 3300059639 | Bacteria | 1184 |
| 2180 | Ga0587062_123093 | 3300059639 | Bacteria | 526 |
| 2181 | Ga0587067_075859 | 3300059640 | Bacteria | 735 |
| 2182 | Ga0587068_037729 | 3300059641 | Bacteria | 863 |
| 2183 | Ga0587068_146291 | 3300059641 | Bacteria | 531 |
| 2184 | Ga0587069_045982 | 3300059642 | Bacteria | 761 |
| 2185 | Ga0587069_063928 | 3300059642 | Bacteria | 684 |
| 2186 | Ga0587072_171877 | 3300059643 | Bacteria | 536 |
| 2187 | Ga0587075_093364 | 3300059644 | Bacteria | 591 |
| 2188 | Ga0587075_097888 | 3300059644 | Bacteria | 582 |
| 2189 | Ga0587076_084261 | 3300059645 | Bacteria | 684 |
| 2190 | Ga0587076_106021 | 3300059645 | Bacteria | 634 |
| 2191 | Ga0587076_128661 | 3300059645 | Bacteria | 594 |
| 2192 | Ga0587076_133428 | 3300059645 | Bacteria | 587 |
| 2193 | Ga0587076_146340 | 3300059645 | Bacteria | 570 |
| 2194 | Ga0587078_057959 | 3300059646 | Bacteria | 581 |
| 2195 | Ga0587078_068196 | 3300059646 | Bacteria | 551 |
| 2196 | Ga0587079_060167 | 3300059647 | Bacteria | 821 |
| 2197 | Ga0587102_042439 | 3300059649 | Bacteria | 591 |
| 2198 | Ga0587102_052357 | 3300059649 | Bacteria | 553 |
| 2199 | Ga0587104_015797 | 3300059650 | Bacteria | 596 |
| 2200 | Ga0587107_020713 | 3300059652 | Bacteria | 914 |
| 2201 | Ga0587107_050157 | 3300059652 | Bacteria | 705 |
| 2202 | Ga0587107_125916 | 3300059652 | Bacteria | 533 |
| 2203 | Ga0587114_051133 | 3300059655 | Bacteria | 700 |
| 2204 | Ga0587114_055588 | 3300059655 | Bacteria | 681 |
| 2205 | Ga0587119_012126 | 3300059658 | Bacteria | 1003 |
| 2206 | Ga0587124_026868 | 3300059660 | Bacteria | 618 |
| 2207 | Ga0587071_022032 | 3300060344 | Bacteria | 1173 |
| 2208 | Ga0587111_0061708 | 3300060346 | Bacteria | 854 |
| 2209 | Ga0587111_0117750 | 3300060346 | Bacteria | 680 |
| 2210 | Ga0501082_0003349 | 3300060353 | Bacteria | 13998 |
| 2211 | Ga0501082_0006289 | 3300060353 | Bacteria | 10299 |
| 2212 | Ga0501082_0018558 | 3300060353 | Bacteria | 5995 |
| 2213 | Ga0501082_0021714 | 3300060353 | Bacteria | 5533 |
| 2214 | Ga0501082_0032005 | 3300060353 | Bacteria | 4537 |
| 2215 | Ga0501082_0559591 | 3300060353 | Bacteria | 1000 |
| 2216 | Ga0466962_0001218 | 3300061719 | Bacteria | 11836 |
| 2217 | Ga0466962_0007976 | 3300061719 | Bacteria | 5080 |
| 2218 | Ga0466962_0069553 | 3300061719 | Bacteria | 1681 |
| 2219 | Ga0466962_0550558 | 3300061719 | Bacteria | 586 |
| 2220 | Ga0530510_0000081 | 3300061734 | Bacteria | 50329 |
| 2221 | Ga0530510_0020052 | 3300061734 | Bacteria | 4753 |
| 2222 | Ga0530510_0031999 | 3300061734 | Bacteria | 3782 |
| 2223 | Ga0530510_0250432 | 3300061734 | Bacteria | 1320 |
| 2224 | 2508671868 | 2508501039 | Bacteria | 9978592 |
| 2225 | 2517761262 | 2517572101 | Bacteria | 6884336 |
| 2226 | 2547411593 | 2547132111 | Bacteria | 8013147 |
| 2227 | 2585298024 | 2582581312 | Bacteria | 7308206 |
| 2228 | 2585305216 | 2582581313 | Bacteria | 10042643 |
| 2229 | 2585313016 | 2582581314 | Bacteria | 11452267 |
| 2230 | 2616702926 | 2616644814 | Bacteria | 11555299 |
| 2231 | 2616903681 | 2616644941 | Bacteria | 8510691 |
| 2232 | 2643763442 | 2643221548 | Bacteria | 8053412 |
| 2233 | 2643824834 | 2643221561 | Bacteria | 4984412 |
| 2234 | 2643900706 | 2643221578 | Bacteria | 9213798 |
| 2235 | 2643947580 | 2643221587 | Bacteria | 7586415 |
| 2236 | 2644093270 | 2643221615 | Bacteria | 5487866 |
| 2237 | 2644266014 | 2643221647 | Bacteria | 10741251 |
| 2238 | 2644322881 | 2643221657 | Bacteria | 5490246 |
| 2239 | 2644390287 | 2643221670 | Bacteria | 6497041 |
| 2240 | 2644405073 | 2643221673 | Bacteria | 9196637 |
| 2241 | 2644435272 | 2643221677 | Bacteria | 7584031 |
| 2242 | 2644437523 | 2643221678 | Bacteria | 9540101 |
| 2243 | 2644463690 | 2643221682 | Bacteria | 6743283 |
| 2244 | 2644532615 | 2643221696 | Bacteria | 5431823 |
| 2245 | 2644628067 | 2643221714 | Bacteria | 9015452 |
| 2246 | 2671836728 | 2671180195 | Bacteria | 9757215 |
| 2247 | 2676203290 | 2675902999 | Bacteria | 9438463 |
| 2248 | 2686539328 | 2684623035 | Bacteria | 8032739 |
| 2249 | 2689961976 | 2687453737 | Bacteria | 11203906 |
| 2250 | 2689995916 | 2687453743 | Bacteria | 8361025 |
| 2251 | 2710603702 | 2710264753 | Bacteria | 5455564 |
| 2252 | 2740168484 | 2739367898 | Bacteria | 4367674 |
| 2253 | 2774847866 | 2773857921 | Bacteria | 9435764 |
| 2254 | 2774854884 | 2773857922 | Bacteria | 9757215 |
| 2255 | 2784589360 | 2784132148 | Bacteria | 8627943 |
| 2256 | 2785342239 | 2784746763 | Bacteria | 9783172 |
| 2257 | 2785370414 | 2784746768 | Bacteria | 10036182 |
| 2258 | 2786671585 | 2786546132 | Bacteria | 10419719 |
| 2259 | 2793979198 | 2791355406 | Bacteria | 11364898 |
| 2260 | 2808842986 | 2808606359 | Bacteria | 9866990 |
| 2261 | 2808921338 | 2808606375 | Bacteria | 9466072 |
| 2262 | 2809233020 | 2808606448 | Bacteria | 8656184 |
| 2263 | 2811845414 | 2808606982 | Bacteria | 7791042 |
| 2264 | 2812357134 | 2811994879 | Bacteria | 9313447 |
| 2265 | 2812479776 | 2811994917 | Bacteria | 7761064 |
| 2266 | 2819698223 | 2818991463 | Bacteria | 7948711 |
| 2267 | 2819741936 | 2818991472 | Bacteria | 10089953 |
| 2268 | 2837184624 | 2837183177 | Bacteria | 4637169 |
| 2269 | 2852639985 | 2852635781 | Bacteria | 8251373 |
| 2270 | 2855390079 | 2855386786 | Bacteria | 4752232 |
| 2271 | 2862180131 | 2862178590 | Bacteria | 8583590 |
| 2272 | 2862286582 | 2862281513 | Bacteria | 9621493 |
| 2273 | 2862294564 | 2862290372 | Bacteria | 7471434 |
| 2274 | 2862383697 | 2862382967 | Bacteria | 10317375 |
| 2275 | 2862510219 | 2862507626 | Bacteria | 9425308 |
| 2276 | 2862578497 | 2862574272 | Bacteria | 10567477 |
| 2277 | 2863411924 | 2863404153 | Bacteria | 9672205 |
| 2278 | 2867372886 | 2867369537 | Bacteria | 6501581 |
| 2279 | 2867432713 | 2867428634 | Bacteria | 9590268 |
| 2280 | 2867478289 | 2867475112 | Bacteria | 6909112 |
| 2281 | 2873155032 | 2873151551 | Bacteria | 8625867 |
| 2282 | 2875394741 | 2875391855 | Bacteria | 7600475 |
| 2283 | 2877680192 | 2877676314 | Bacteria | 9512378 |
| 2284 | 2895886600 | 2895880812 | Bacteria | 11255272 |
| 2285 | 2912718773 | 2912715099 | Bacteria | 9460473 |
| 2286 | 2912731123 | 2912723979 | Bacteria | 8557534 |
| 2287 | 2912761787 | 2912757875 | Bacteria | 7940295 |
| 2288 | 2918504675 | 2918501144 | Bacteria | 8668083 |
| 2289 | 2919471411 | 2919468124 | Bacteria | 9133025 |
| 2290 | 2935392749 | 2935390628 | Bacteria | 7043367 |
| 2291 | 2946049064 | 2946045630 | Bacteria | 8527308 |
| 2292 | 2946068743 | 2946064051 | Bacteria | 8957905 |
| 2293 | 2946076745 | 2946072368 | Bacteria | 8999607 |
| 2294 | 2947228165 | 2947224130 | Bacteria | 9938529 |
| 2295 | 2954006208 | 2954002825 | Bacteria | 9173742 |
| 2296 | 2954385180 | 2954380949 | Bacteria | 10050426 |
| 2297 | 2954677869 | 2954673503 | Bacteria | 9685905 |
| 2298 | 2954686287 | 2954682443 | Bacteria | 9862841 |
| 2299 | 2954695964 | 2954691527 | Bacteria | 10720516 |
| 2300 | 2954711135 | 2954701450 | Bacteria | 10834262 |
| 2301 | 2954715371 | 2954711539 | Bacteria | 10867210 |
| 2302 | 2954725291 | 2954721474 | Bacteria | 10456478 |
| 2303 | 2954736524 | 2954731030 | Bacteria | 10243860 |
| 2304 | 2954744225 | 2954740390 | Bacteria | 10229294 |
| 2305 | 2954755353 | 2954749733 | Bacteria | 10366972 |
| 2306 | 2954763190 | 2954759201 | Bacteria | 9358192 |
| 2307 | 2966602426 | 2966598605 | Bacteria | 7676064 |
| 2308 | 2984578698 | 2984576629 | Bacteria | 4248407 |
| 2309 | 2990068047 | 2990059506 | Bacteria | 9321252 |
| 2310 | 2990090966 | 2990088156 | Bacteria | 6657676 |
| 2311 | 2990260718 | 2990256926 | Bacteria | 4252839 |
| 2312 | 2995471390 | 2995463766 | Bacteria | 8577691 |
| 2313 | 2997454359 | 2997451912 | Bacteria | 8492419 |
| 2314 | 2997600158 | 2997600082 | Bacteria | 9896405 |
| 2315 | 3003006230 | 3002998708 | Bacteria | 11715108 |
| 2316 | 3006325245 | 3006321560 | Bacteria | 8247479 |
| 2317 | 3006398051 | 3006393351 | Bacteria | 6615579 |
| 2318 | 3006486800 | 3006486233 | Bacteria | 8157040 |
| 2319 | 3006500301 | 3006493962 | Bacteria | 8825450 |
| 2320 | 8002784314 | 8002784119 | Bacteria | 9788632 |
| 2321 | 8008566142 | 8008558824 | Bacteria | 10610750 |
| 2322 | 8008578109 | 8008574985 | Bacteria | 7815457 |
| 2323 | 8023629597 | 8023623736 | Bacteria | 8593882 |
| 2324 | 8025479461 | 8025478263 | Bacteria | 8209203 |
| 2325 | 8025538206 | 8025530807 | Bacteria | 8495698 |
| 2326 | 8033686068 | 8033684223 | Bacteria | 6906479 |
| 2327 | 8047897812 | 8047893842 | Bacteria | 11723082 |
| 2328 | 8048361059 | 8048356638 | Bacteria | 11044339 |
| 2329 | 8048374798 | 8048369669 | Bacteria | 11666822 |
| 2330 | 8048383424 | 8048379754 | Bacteria | 11877923 |
| 2331 | 8048410125 | 8048406513 | Bacteria | 8936924 |
| 2332 | 8054161279 | 8054160619 | Bacteria | 7783213 |
| 2333 | 8054614154 | 8054609563 | Bacteria | 5170090 |
| 2334 | 8056669145 | 8056667051 | Bacteria | 6953971 |
| 2335 | 8056833183 | 8056829672 | Bacteria | 9045328 |
| 2336 | Ga0495653_0030612 | |||
| 2337 | JGI24739J22299_10012246 | |||
| 2338 | JGI24737J22298_10019105 | |||
| 2339 | JGI24737J22298_10192344 | |||
| 2340 | JGI24743J22301_10161148 | |||
| 2341 | JGI24735J21928_10045879 | |||
| 2342 | JGI24735J21928_10046425 | |||
| 2343 | JGI24735J21928_10137400 | |||
| 2344 | JGI24738J21930_10009224 | |||
| 2345 | Ga0006778J45830_1049852 | |||
| 2346 | Ga0006759J45824_1020748 | |||
| 2347 | JGI25406J46586_10007643 | |||
| 2348 | JGI25153J46596_10101033 | |||
| 2349 | Ga0006758J48902_1016223 | |||
| 2350 | Ga0006777J48905_1018870 | |||
| 2351 | rootH1_10072002 | |||
| 2352 | rootH2_10022780 | |||
| 2353 | rootH2_10108428 | |||
| 2354 | rootH1_10031505 | |||
| 2355 | JGI25160J50197_1022315 | |||
| 2356 | JGI25160J50197_1039249 | |||
| 2357 | JGI25407J50210_10018107 | |||
| 2358 | JGI25407J50210_10037302 | |||
| 2359 | Ga0007427J51700_111976 | |||
| 2360 | Ga0006781J51513_1031642 | |||
| 2361 | Ga0007409J51694_1021866 | |||
| 2362 | Ga0006562J51391_1046289 | |||
| 2363 | Ga0007429J51699_1015173 | |||
| 2364 | Ga0007429J51699_1022622 | |||
| 2365 | JGI25404J52841_10003762 | |||
| 2366 | Ga0032354_1015897 | |||
| 2367 | Ga0032354_1034030 | |||
| 2368 | Ga0032354_1078986 | |||
| 2369 | Ga0006780_1022200 | |||
| 2370 | Ga0058692_1043303 | |||
| 2371 | Ga0058859_10015040 | |||
| 2372 | Ga0058859_10049176 | |||
| 2373 | Ga0058863_10065640 | |||
| 2374 | Ga0058863_11976483 | |||
| 2375 | Ga0058861_10164303 | |||
| 2376 | Ga0058861_10176188 | |||
| 2377 | Ga0058860_10007162 | |||
| 2378 | Ga0058860_10028903 | |||
| 2379 | Ga0058860_10033454 | |||
| 2380 | Ga0058860_12110909 | |||
| 2381 | Ga0058860_12209150 | |||
| 2382 | Ga0058862_10234175 | |||
| 2383 | Ga0058862_12842049 | |||
| 2384 | Ga0070658_10057941 | |||
| 2385 | Ga0070658_11647721 | |||
| 2386 | Ga0070683_100046631 | |||
| 2387 | Ga0070683_100072608 | |||
| 2388 | Ga0070683_100190097 | |||
| 2389 | Ga0070683_100202004 | |||
| 2390 | Ga0070683_100396927 | |||
| 2391 | Ga0070683_100563340 | |||
| 2392 | Ga0070670_100578960 | |||
| 2393 | Ga0070670_101515613 | |||
| 2394 | Ga0070677_10529932 | |||
| 2395 | Ga0068869_100122565 | |||
| 2396 | Ga0068869_100504708 | |||
| 2397 | Ga0070680_100608737 | |||
| 2398 | Ga0070682_100003432 | |||
| 2399 | Ga0070682_100117787 | |||
| 2400 | Ga0070682_100284955 | |||
| 2401 | Ga0070682_100449172 | |||
| 2402 | Ga0068868_100178637 | |||
| 2403 | Ga0068868_100542817 | |||
| 2404 | Ga0070660_100032354 | |||
| 2405 | Ga0070660_100064698 | |||
| 2406 | Ga0070660_100080638 | |||
| 2407 | Ga0070660_100099506 | |||
| 2408 | Ga0070687_100026149 | |||
| 2409 | Ga0070687_100727747 | |||
| 2410 | Ga0070661_100067814 | |||
| 2411 | Ga0070661_100224898 | |||
| 2412 | Ga0070692_10029363 | |||
| 2413 | Ga0070692_10117879 | |||
| 2414 | Ga0070668_100005274 | |||
| 2415 | Ga0070668_100323680 | |||
| 2416 | Ga0070668_101343155 | |||
| 2417 | Ga0070668_101377431 | |||
| 2418 | Ga0070668_101646027 | |||
| 2419 | Ga0070671_100119704 | |||
| 2420 | Ga0070671_100385026 | |||
| 2421 | Ga0070671_100438242 | |||
| 2422 | Ga0070674_100123743 | |||
| 2423 | Ga0070674_100160241 | |||
| 2424 | Ga0070673_100113602 | |||
| 2425 | Ga0070673_100786336 | |||
| 2426 | Ga0070673_102039575 | |||
| 2427 | Ga0070659_100037012 | |||
| 2428 | Ga0070659_100652007 | |||
| 2429 | Ga0070703_10006853 | |||
| 2430 | Ga0070709_10071599 | |||
| 2431 | Ga0070709_10349223 | |||
| 2432 | Ga0070714_100307734 | |||
| 2433 | Ga0070714_101061487 | |||
| 2434 | Ga0070713_100016958 | |||
| 2435 | Ga0070710_10049761 | |||
| 2436 | Ga0070711_100347531 | |||
| 2437 | Ga0070711_101219286 | |||
| 2438 | Ga0070705_101717572 | |||
| 2439 | Ga0070700_100306162 | |||
| 2440 | Ga0070700_100382422 | |||
| 2441 | Ga0070708_100029105 | |||
| 2442 | Ga0070708_100191338 | |||
| 2443 | Ga0070708_100224162 | |||
| 2444 | Ga0070663_100180106 | |||
| 2445 | Ga0070663_100242842 | |||
| 2446 | Ga0070663_100365984 | |||
| 2447 | Ga0070663_100612767 | |||
| 2448 | Ga0070678_100148612 | |||
| 2449 | Ga0070678_100369594 | |||
| 2450 | Ga0070662_100033040 | |||
| 2451 | Ga0070662_100091588 | |||
| 2452 | Ga0070662_100140800 | |||
| 2453 | Ga0070681_10041790 | |||
| 2454 | Ga0070681_10301002 | |||
| 2455 | Ga0068867_100173855 | |||
| 2456 | Ga0070685_10121605 | |||
| 2457 | Ga0070685_10219788 | |||
| 2458 | Ga0070706_100002754 | |||
| 2459 | Ga0070706_100003951 | |||
| 2460 | Ga0070706_100050706 | |||
| 2461 | Ga0070706_100230597 | |||
| 2462 | Ga0070707_100001503 | |||
| 2463 | Ga0070707_100049280 | |||
| 2464 | Ga0070707_100051048 | |||
| 2465 | Ga0070707_100098856 | |||
| 2466 | Ga0070698_100000665 | |||
| 2467 | Ga0070698_100005898 | |||
| 2468 | Ga0070698_100022580 | |||
| 2469 | Ga0070698_100055599 | |||
| 2470 | Ga0070698_100421835 | |||
| 2471 | Ga0070698_101679557 | |||
| 2472 | Ga0070699_100321904 | |||
| 2473 | Ga0070699_100540722 | |||
| 2474 | Ga0070679_100019803 | |||
| 2475 | Ga0070679_100104922 | |||
| 2476 | Ga0070679_100605866 | |||
| 2477 | Ga0070684_100001778 | |||
| 2478 | Ga0070684_100112941 | |||
| 2479 | Ga0070684_100187049 | |||
| 2480 | Ga0070684_100266179 | |||
| 2481 | Ga0070684_100545705 | |||
| 2482 | Ga0070697_100037989 | |||
| 2483 | Ga0070697_101046319 | |||
| 2484 | Ga0070697_102030489 | |||
| 2485 | Ga0068853_100074255 | |||
| 2486 | Ga0068853_100194347 | |||
| 2487 | Ga0070672_100160740 | |||
| 2488 | Ga0070672_100458414 | |||
| 2489 | Ga0070686_100238808 | |||
| 2490 | Ga0070686_101494516 | |||
| 2491 | Ga0070695_100081265 | |||
| 2492 | Ga0070693_100077237 | |||
| 2493 | Ga0070665_100319651 | |||
| 2494 | Ga0070665_100665089 | |||
| 2495 | Ga0070665_101998709 | |||
| 2496 | Ga0070704_100123917 | |||
| 2497 | Ga0070704_100455370 | |||
| 2498 | Ga0068855_100164436 | |||
| 2499 | Ga0068855_100386020 | |||
| 2500 | Ga0068855_100493428 | |||
| 2501 | Ga0070664_100045018 | |||
| 2502 | Ga0070664_100078162 | |||
| 2503 | Ga0068857_100116012 | |||
| 2504 | Ga0068857_101740702 | |||
| 2505 | Ga0068854_100215677 | |||
| 2506 | Ga0068854_100343671 | |||
| 2507 | Ga0068854_100512768 | |||
| 2508 | Ga0068856_100259101 | |||
| 2509 | Ga0068856_100354654 | |||
| 2510 | Ga0068856_100470378 | |||
| 2511 | Ga0070702_100075402 | |||
| 2512 | Ga0070702_100094259 | |||
| 2513 | Ga0070702_100333963 | |||
| 2514 | Ga0070702_100974962 | |||
| 2515 | Ga0068852_100259966 | |||
| 2516 | Ga0068852_100342361 | |||
| 2517 | Ga0068852_100370667 | |||
| 2518 | Ga0068852_100464297 | |||
| 2519 | Ga0068852_100798769 | |||
| 2520 | Ga0068859_100000094 | |||
| 2521 | Ga0068859_100019463 | |||
| 2522 | Ga0068859_100760623 | |||
| 2523 | Ga0068864_100036467 | |||
| 2524 | Ga0068864_100197116 | |||
| 2525 | Ga0068864_101881533 | |||
| 2526 | Ga0068864_102396079 | |||
| 2527 | Ga0068866_10137407 | |||
| 2528 | Ga0068861_100019697 | |||
| 2529 | Ga0068861_100260870 | |||
| 2530 | Ga0068851_10153942 | |||
| 2531 | Ga0068870_10235019 | |||
| 2532 | Ga0068863_100064425 | |||
| 2533 | Ga0068863_100114583 | |||
| 2534 | Ga0068863_101454095 | |||
| 2535 | Ga0068858_100000036 | |||
| 2536 | Ga0068858_100163957 | |||
| 2537 | Ga0068858_100674869 | |||
| 2538 | Ga0068858_100781556 | |||
| 2539 | Ga0068860_100058211 | |||
| 2540 | Ga0068862_100000204 | |||
| 2541 | Ga0068862_100710697 | |||
| 2542 | Ga0081455_10014212 | |||
| 2543 | Ga0081455_10030364 | |||
| 2544 | Ga0081455_10226962 | |||
| 2545 | Ga0081538_10003619 | |||
| 2546 | Ga0081538_10011320 | |||
| 2547 | Ga0081538_10016741 | |||
| 2548 | Ga0081538_10029722 | |||
| 2549 | Ga0081538_10047756 | |||
| 2550 | Ga0081538_10058335 | |||
| 2551 | Ga0081538_10066451 | |||
| 2552 | Ga0081538_10283081 | |||
| 2553 | Ga0081540_1000345 | |||
| 2554 | Ga0081540_1009692 | |||
| 2555 | Ga0081539_10002843 | |||
| 2556 | Ga0081539_10028367 | |||
| 2557 | Ga0081539_10030867 | |||
| 2558 | Ga0081539_10208914 | |||
| 2559 | Ga0081539_10248166 | |||
| 2560 | Ga0081539_10275591 | |||
| 2561 | Ga0070717_10045967 | |||
| 2562 | Ga0070717_10046247 | |||
| 2563 | Ga0070717_10323441 | |||
| 2564 | Ga0070717_10611810 | |||
| 2565 | Ga0070717_12018596 | |||
| 2566 | Ga0075365_10082094 | |||
| 2567 | Ga0075365_10132046 | |||
| 2568 | Ga0075365_10153204 | |||
| 2569 | Ga0075368_10000813 | |||
| 2570 | Ga0075368_10070273 | |||
| 2571 | Ga0075363_100029174 | |||
| 2572 | Ga0075363_100033261 | |||
| 2573 | Ga0075364_10202207 | |||
| 2574 | Ga0075364_10929506 | |||
| 2575 | Ga0075432_10003211 | |||
| 2576 | Ga0070715_10016810 | |||
| 2577 | Ga0070715_10070916 | |||
| 2578 | Ga0070715_10085671 | |||
| 2579 | Ga0070716_100016224 | |||
| 2580 | Ga0070716_100098885 | |||
| 2581 | Ga0070712_100003387 | |||
| 2582 | Ga0070712_100165125 | |||
| 2583 | Ga0070712_100182981 | |||
| 2584 | Ga0070712_100195468 | |||
| 2585 | Ga0070712_100395491 | |||
| 2586 | Ga0070712_100708388 | |||
| 2587 | Ga0075367_10013875 | |||
| 2588 | Ga0075367_10044898 | |||
| 2589 | Ga0075367_10185529 | |||
| 2590 | Ga0097621_100063674 | |||
| 2591 | Ga0097621_100316810 | |||
| 2592 | Ga0075370_10061581 | |||
| 2593 | Ga0068871_100311016 | |||
| 2594 | Ga0068871_100467349 | |||
| 2595 | Ga0068871_100473318 | |||
| 2596 | Ga0068871_101132021 | |||
| 2597 | Ga0075428_100775684 | |||
| 2598 | Ga0075428_100805111 | |||
| 2599 | Ga0075430_100008819 | |||
| 2600 | Ga0075431_100014880 | |||
| 2601 | Ga0075433_10042000 | |||
| 2602 | Ga0075433_10321934 | |||
| 2603 | Ga0075434_100018311 | |||
| 2604 | Ga0075434_100693747 | |||
| 2605 | Ga0075434_102227245 | |||
| 2606 | Ga0075429_100062979 | |||
| 2607 | Ga0068865_100024075 | |||
| 2608 | Ga0068865_100079207 | |||
| 2609 | Ga0068865_100153696 | |||
| 2610 | Ga0068865_100175399 | |||
| 2611 | Ga0068865_100519429 | |||
| 2612 | Ga0068865_100605044 | |||
| 2613 | Ga0075436_100900585 | |||
| 2614 | Ga0097620_100000094 | |||
| 2615 | Ga0097620_100019463 | |||
| 2616 | Ga0097620_100760619 | |||
| 2617 | Ga0099826_10081983 | |||
| 2618 | Ga0075435_100013330 | |||
| 2619 | Ga0075435_100185638 | |||
| 2620 | Ga0075435_100202372 | |||
| 2621 | Ga0099794_10153458 | |||
| 2622 | Ga0105251_10019082 | |||
| 2623 | Ga0105251_10024110 | |||
| 2624 | Ga0105244_10149676 | |||
| 2625 | Ga0105244_10359605 | |||
| 2626 | Ga0105250_10069781 | |||
| 2627 | Ga0105250_10342843 | |||
| 2628 | Ga0105240_10813749 | |||
| 2629 | Ga0105240_11086267 | |||
| 2630 | Ga0111539_10021256 | |||
| 2631 | Ga0111539_10434718 | |||
| 2632 | Ga0111539_11374947 | |||
| 2633 | Ga0111539_11439641 | |||
| 2634 | Ga0105245_10007936 | |||
| 2635 | Ga0105245_10320361 | |||
| 2636 | Ga0105245_10452189 | |||
| 2637 | Ga0105245_10486061 | |||
| 2638 | Ga0105245_10625204 | |||
| 2639 | Ga0105245_10631309 | |||
| 2640 | Ga0105245_12684384 | |||
| 2641 | Ga0105247_10000357 | |||
| 2642 | Ga0105247_10091356 | |||
| 2643 | Ga0105247_10097314 | |||
| 2644 | Ga0105247_10101372 | |||
| 2645 | Ga0105247_10150418 | |||
| 2646 | Ga0114129_10100488 | |||
| 2647 | Ga0114129_10316525 | |||
| 2648 | Ga0114129_10785511 | |||
| 2649 | Ga0105243_10057425 | |||
| 2650 | Ga0105243_10065756 | |||
| 2651 | Ga0105243_10078129 | |||
| 2652 | Ga0105243_10636481 | |||
| 2653 | Ga0105243_11981364 | |||
| 2654 | Ga0105241_10718168 | |||
| 2655 | Ga0105241_11168071 | |||
| 2656 | Ga0105242_10074221 | |||
| 2657 | Ga0105242_10085779 | |||
| 2658 | Ga0105242_10668381 | |||
| 2659 | Ga0105248_10000023 | |||
| 2660 | Ga0105248_10066086 | |||
| 2661 | Ga0105248_10496689 | |||
| 2662 | Ga0105248_11048756 | |||
| 2663 | Ga0105248_11188340 | |||
| 2664 | Ga0105248_11191354 | |||
| 2665 | Ga0105248_12202217 | |||
| 2666 | Ga0105237_10249366 | |||
| 2667 | Ga0105237_10625757 | |||
| 2668 | Ga0105237_10932331 | |||
| 2669 | Ga0105237_11864646 | |||
| 2670 | Ga0105238_10282092 | |||
| 2671 | Ga0105238_10283855 | |||
| 2672 | Ga0105238_10629320 | |||
| 2673 | Ga0105238_10688085 | |||
| 2674 | Ga0105238_11053877 | |||
| 2675 | Ga0105238_12939657 | |||
| 2676 | Ga0105249_10010731 | |||
| 2677 | Ga0105249_10012128 | |||
| 2678 | Ga0105249_10039691 | |||
| 2679 | Ga0105249_10548091 | |||
| 2680 | Ga0105249_11522334 | |||
| 2681 | Ga0105249_13263324 | |||
| 2682 | Ga0130087_1098055 | |||
| 2683 | Ga0130086_1044473 | |||
| 2684 | Ga0130086_1084162 | |||
| 2685 | Ga0130084_1020040 | |||
| 2686 | Ga0130084_1048495 | |||
| 2687 | Ga0130084_1110514 | |||
| 2688 | Ga0130085_1024196 | |||
| 2689 | Ga0130085_1052010 | |||
| 2690 | Ga0130085_1129671 | |||
| 2691 | Ga0105239_10002802 | |||
| 2692 | Ga0105239_10009298 | |||
| 2693 | Ga0105239_10321094 | |||
| 2694 | Ga0105239_11106345 | |||
| 2695 | Ga0105239_11310043 | |||
| 2696 | Ga0105239_11514965 | |||
| 2697 | Ga0105239_11903700 | |||
| 2698 | Ga0105239_12832811 | |||
| 2699 | Ga0105239_13111368 | |||
| 2700 | Ga0105246_10002099 | |||
| 2701 | Ga0105246_10004538 | |||
| 2702 | Ga0105246_10098480 | |||
| 2703 | Ga0105246_10441200 | |||
| 2704 | Ga0105246_10540377 | |||
| 2705 | Ga0105246_10555756 | |||
| 2706 | Ga0105246_11213661 | |||
| 2707 | Ga0105246_11225005 | |||
| 2708 | Ga0157344_1004298 | |||
| 2709 | Ga0157346_1004194 | |||
| 2710 | Ga0157337_1008906 | |||
| 2711 | Ga0157322_1021079 | |||
| 2712 | Ga0157322_1022184 | |||
| 2713 | Ga0157329_1000987 | |||
| 2714 | Ga0157335_1010443 | |||
| 2715 | Ga0157341_1001858 | |||
| 2716 | Ga0157347_1013750 | |||
| 2717 | Ga0157313_1011014 | |||
| 2718 | Ga0157313_1060641 | |||
| 2719 | Ga0157342_1018677 | |||
| 2720 | Ga0157315_1003551 | |||
| 2721 | Ga0157338_1003156 | |||
| 2722 | Ga0154016_137542 | |||
| 2723 | Ga0154014_128446 | |||
| 2724 | Ga0154012_175242 | |||
| 2725 | Ga0157373_10134868 | |||
| 2726 | Ga0157373_10611236 | |||
| 2727 | Ga0157371_10022428 | |||
| 2728 | Ga0157371_10228025 | |||
| 2729 | Ga0157371_10318380 | |||
| 2730 | Ga0157370_10857027 | |||
| 2731 | Ga0157369_10033117 | |||
| 2732 | Ga0157369_10144213 | |||
| 2733 | Ga0157369_10194793 | |||
| 2734 | Ga0157369_10431851 | |||
| 2735 | Ga0157369_11119600 | |||
| 2736 | Ga0157369_12013227 | |||
| 2737 | Ga0157369_12527135 | |||
| 2738 | Ga0157374_10298902 | |||
| 2739 | Ga0157374_10431547 | |||
| 2740 | Ga0157374_11725263 | |||
| 2741 | Ga0157374_12433564 | |||
| 2742 | Ga0157374_12704085 | |||
| 2743 | Ga0157378_10512846 | |||
| 2744 | Ga0157378_10577237 | |||
| 2745 | Ga0157378_11176869 | |||
| 2746 | Ga0163162_10074982 | |||
| 2747 | Ga0163162_10174935 | |||
| 2748 | Ga0163162_10422012 | |||
| 2749 | Ga0163162_10528100 | |||
| 2750 | Ga0163162_10707313 | |||
| 2751 | Ga0163162_10880805 | |||
| 2752 | Ga0163162_11036780 | |||
| 2753 | Ga0163162_11105428 | |||
| 2754 | Ga0163162_11248765 | |||
| 2755 | Ga0163162_11465456 | |||
| 2756 | Ga0157372_10007431 | |||
| 2757 | Ga0157372_10674551 | |||
| 2758 | Ga0157372_10708110 | |||
| 2759 | Ga0157372_10735542 | |||
| 2760 | Ga0157372_10795537 | |||
| 2761 | Ga0157372_11104390 | |||
| 2762 | Ga0157375_10023903 | |||
| 2763 | Ga0157375_10070571 | |||
| 2764 | Ga0157375_10141322 | |||
| 2765 | Ga0157375_10143340 | |||
| 2766 | Ga0157375_10177777 | |||
| 2767 | Ga0157375_10774101 | |||
| 2768 | Ga0157375_11189236 | |||
| 2769 | Ga0163163_10001744 | |||
| 2770 | Ga0163163_10202231 | |||
| 2771 | Ga0163163_10324433 | |||
| 2772 | Ga0163163_10517480 | |||
| 2773 | Ga0163163_10748687 | |||
| 2774 | Ga0163163_12323148 | |||
| 2775 | Ga0163163_12386739 | |||
| 2776 | Ga0157380_10046543 | |||
| 2777 | Ga0157380_10130229 | |||
| 2778 | Ga0157380_10706118 | |||
| 2779 | Ga0182008_10010449 | |||
| 2780 | Ga0182008_10068144 | |||
| 2781 | Ga0182008_10120977 | |||
| 2782 | Ga0182008_10157872 | |||
| 2783 | Ga0182008_10513336 | |||
| 2784 | Ga0157377_10153939 | |||
| 2785 | Ga0157377_10182311 | |||
| 2786 | Ga0157379_10000244 | |||
| 2787 | Ga0157379_10298909 | |||
| 2788 | Ga0157379_10339812 | |||
| 2789 | Ga0157379_11446460 | |||
| 2790 | Ga0157376_10504131 | |||
| 2791 | Ga0157376_10635148 | |||
| 2792 | Ga0157376_10913189 | |||
| 2793 | Ga0157376_11125065 | |||
| 2794 | Ga0157376_11497346 | |||
| 2795 | Ga0157376_12770240 | |||
| 2796 | Ga0182006_1083626 | |||
| 2797 | Ga0182007_10001790 | |||
| 2798 | Ga0182005_1044350 | |||
| 2799 | Ga0182005_1146324 | |||
| 2800 | Ga0183367_1015 | |||
| 2801 | Ga0163161_10201301 | |||
| 2802 | Ga0163161_10299895 | |||
| 2803 | Ga0163161_10414064 | |||
| 2804 | Ga0163161_10639507 | |||
| 2805 | Ga0163161_12055477 | |||
| 2806 | Ga0184602_108449 | |||
| 2807 | Ga0184597_117329 | |||
| 2808 | Ga0184592_115343 | |||
| 2809 | Ga0184594_112558 | |||
| 2810 | Ga0184598_143521 | |||
| 2811 | Ga0184601_110102 | |||
| 2812 | Ga0184601_113589 | |||
| 2813 | Ga0184600_107951 | |||
| 2814 | Ga0184603_137011 | |||
| 2815 | Ga0184603_143072 | |||
| 2816 | Ga0197907_10020944 | |||
| 2817 | Ga0197907_10330890 | |||
| 2818 | Ga0197907_11191419 | |||
| 2819 | Ga0206356_10190986 | |||
| 2820 | Ga0206356_10961423 | |||
| 2821 | Ga0206356_10999422 | |||
| 2822 | Ga0206356_11074086 | |||
| 2823 | Ga0206349_1348860 | |||
| 2824 | Ga0206349_1883902 | |||
| 2825 | Ga0206355_1091284 | |||
| 2826 | Ga0206351_10065153 | |||
| 2827 | Ga0206351_10146335 | |||
| 2828 | Ga0206352_10089945 | |||
| 2829 | Ga0206352_10201730 | |||
| 2830 | Ga0206352_10411800 | |||
| 2831 | Ga0206352_10622047 | |||
| 2832 | Ga0206350_10023960 | |||
| 2833 | Ga0206350_10191192 | |||
| 2834 | Ga0206350_10683474 | |||
| 2835 | Ga0206350_11029574 | |||
| 2836 | Ga0206350_11489402 | |||
| 2837 | Ga0206350_11630090 | |||
| 2838 | Ga0206354_10543560 | |||
| 2839 | Ga0206354_10709520 | |||
| 2840 | Ga0206354_11311593 | |||
| 2841 | Ga0206353_10288552 | |||
| 2842 | Ga0206353_10468191 | |||
| 2843 | Ga0206353_11120483 | |||
| 2844 | Ga0206353_11270550 | |||
| 2845 | Ga0206353_12052037 | |||
| 2846 | Ga0213874_10388286 | |||
| 2847 | Ga0213876_10446852 | |||
| 2848 | Ga0213875_10010893 | |||
| 2849 | Ga0213875_10014384 | |||
| 2850 | Ga0213875_10021112 | |||
| 2851 | Ga0213875_10043268 | |||
| 2852 | Ga0213875_10091833 | |||
| 2853 | Ga0256744_107144 | |||
| 2854 | Ga0256720_106636 | |||
| 2855 | Ga0247551_104190 | |||
| 2856 | Ga0247550_104409 | |||
| 2857 | Ga0224572_1023820 | |||
| 2858 | Ga0228598_1052773 | |||
| 2859 | Ga0209758_1007513 | |||
| 2860 | Ga0207426_1002952 | |||
| 2861 | Ga0207426_1023641 | |||
| 2862 | Ga0207697_10179633 | |||
| 2863 | Ga0207656_10166207 | |||
| 2864 | Ga0207696_1079044 | |||
| 2865 | Ga0207655_1112249 | |||
| 2866 | Ga0207713_1122796 | |||
| 2867 | Ga0207713_1143564 | |||
| 2868 | Ga0207653_10012809 | |||
| 2869 | Ga0207692_10022809 | |||
| 2870 | Ga0207642_10018159 | |||
| 2871 | Ga0207642_10588149 | |||
| 2872 | Ga0207710_10000063 | |||
| 2873 | Ga0207710_10053403 | |||
| 2874 | Ga0207710_10314609 | |||
| 2875 | Ga0207688_10009737 | |||
| 2876 | Ga0207688_10123060 | |||
| 2877 | Ga0207680_10607719 | |||
| 2878 | Ga0207647_10014108 | |||
| 2879 | Ga0207647_10037539 | |||
| 2880 | Ga0207647_10041665 | |||
| 2881 | Ga0207647_10223703 | |||
| 2882 | Ga0207647_10225604 | |||
| 2883 | Ga0207685_10359099 | |||
| 2884 | Ga0207699_10085697 | |||
| 2885 | Ga0207699_10144157 | |||
| 2886 | Ga0207699_10145888 | |||
| 2887 | Ga0207699_10199061 | |||
| 2888 | Ga0207645_10210798 | |||
| 2889 | Ga0207645_10806729 | |||
| 2890 | Ga0207643_10012094 | |||
| 2891 | Ga0207643_10360401 | |||
| 2892 | Ga0207705_10044132 | |||
| 2893 | Ga0207705_10068197 | |||
| 2894 | Ga0207684_10000323 | |||
| 2895 | Ga0207684_10003999 | |||
| 2896 | Ga0207684_10025297 | |||
| 2897 | Ga0207684_10026466 | |||
| 2898 | Ga0207684_10290158 | |||
| 2899 | Ga0207654_10140334 | |||
| 2900 | Ga0207654_10996818 | |||
| 2901 | Ga0207654_11169214 | |||
| 2902 | Ga0207707_10129156 | |||
| 2903 | Ga0207707_10255224 | |||
| 2904 | Ga0207671_10092256 | |||
| 2905 | Ga0207671_10527437 | |||
| 2906 | Ga0207693_10136892 | |||
| 2907 | Ga0207663_10037969 | |||
| 2908 | Ga0207663_10196750 | |||
| 2909 | Ga0207663_10271298 | |||
| 2910 | Ga0207660_10166316 | |||
| 2911 | Ga0207660_10498001 | |||
| 2912 | Ga0207662_10010759 | |||
| 2913 | Ga0207662_10021726 | |||
| 2914 | Ga0207662_10406991 | |||
| 2915 | Ga0207657_10359817 | |||
| 2916 | Ga0207649_10315744 | |||
| 2917 | Ga0207652_10048985 | |||
| 2918 | Ga0207652_10245227 | |||
| 2919 | Ga0207652_10468835 | |||
| 2920 | Ga0207652_10569951 | |||
| 2921 | Ga0207646_10000050 | |||
| 2922 | Ga0207646_10010964 | |||
| 2923 | Ga0207646_10049754 | |||
| 2924 | Ga0207646_10080435 | |||
| 2925 | Ga0207681_10486294 | |||
| 2926 | Ga0207694_10377850 | |||
| 2927 | Ga0207694_10522052 | |||
| 2928 | Ga0207694_10624516 | |||
| 2929 | Ga0207694_10870613 | |||
| 2930 | Ga0207694_11852782 | |||
| 2931 | Ga0207659_10060860 | |||
| 2932 | Ga0207659_11507007 | |||
| 2933 | Ga0207687_10028232 | |||
| 2934 | Ga0207687_10402100 | |||
| 2935 | Ga0207687_10456677 | |||
| 2936 | Ga0207687_10701281 | |||
| 2937 | Ga0207687_11623537 | |||
| 2938 | Ga0207687_11873861 | |||
| 2939 | Ga0207700_10009909 | |||
| 2940 | Ga0207700_10049581 | |||
| 2941 | Ga0207700_10059951 | |||
| 2942 | Ga0207700_10282417 | |||
| 2943 | Ga0207664_10019743 | |||
| 2944 | Ga0207664_10054930 | |||
| 2945 | Ga0207664_10111576 | |||
| 2946 | Ga0207664_10209663 | |||
| 2947 | Ga0207664_10866446 | |||
| 2948 | Ga0207644_10879720 | |||
| 2949 | Ga0207690_10104502 | |||
| 2950 | Ga0207706_10007021 | |||
| 2951 | Ga0207706_10030756 | |||
| 2952 | Ga0207706_10361206 | |||
| 2953 | Ga0207706_11058925 | |||
| 2954 | Ga0207686_10700334 | |||
| 2955 | Ga0207709_10376918 | |||
| 2956 | Ga0207709_10489606 | |||
| 2957 | Ga0207670_10563490 | |||
| 2958 | Ga0207670_11814002 | |||
| 2959 | Ga0207669_10094765 | |||
| 2960 | Ga0207669_10280657 | |||
| 2961 | Ga0207669_10500645 | |||
| 2962 | Ga0207669_10764015 | |||
| 2963 | Ga0207704_10017490 | |||
| 2964 | Ga0207704_10285045 | |||
| 2965 | Ga0207704_10495950 | |||
| 2966 | Ga0207704_11124433 | |||
| 2967 | Ga0207691_10049713 | |||
| 2968 | Ga0207691_10064364 | |||
| 2969 | Ga0207691_10093203 | |||
| 2970 | Ga0207711_10000262 | |||
| 2971 | Ga0207711_10172030 | |||
| 2972 | Ga0207711_10218658 | |||
| 2973 | Ga0207711_10220819 | |||
| 2974 | Ga0207711_10579701 | |||
| 2975 | Ga0207711_11430804 | |||
| 2976 | Ga0207689_10086579 | |||
| 2977 | Ga0207689_10389027 | |||
| 2978 | Ga0207661_10006353 | |||
| 2979 | Ga0207661_10037782 | |||
| 2980 | Ga0207661_10075721 | |||
| 2981 | Ga0207661_10161016 | |||
| 2982 | Ga0207661_10220843 | |||
| 2983 | Ga0207661_10273270 | |||
| 2984 | Ga0207661_10793411 | |||
| 2985 | Ga0207661_11252526 | |||
| 2986 | Ga0207661_11779833 | |||
| 2987 | Ga0207679_10028246 | |||
| 2988 | Ga0207679_10117036 | |||
| 2989 | Ga0207679_10405464 | |||
| 2990 | Ga0207679_10631475 | |||
| 2991 | Ga0207667_10136334 | |||
| 2992 | Ga0207667_10547594 | |||
| 2993 | Ga0207651_10465055 | |||
| 2994 | Ga0207651_11157811 | |||
| 2995 | Ga0207651_11219586 | |||
| 2996 | Ga0207712_10003504 | |||
| 2997 | Ga0207712_10070104 | |||
| 2998 | Ga0207712_10084335 | |||
| 2999 | Ga0207712_10339816 | |||
| 3000 | Ga0207712_10377343 | |||
| 3001 | Ga0207712_10516901 | |||
| 3002 | Ga0207668_10241812 | |||
| 3003 | Ga0207668_10385891 | |||
| 3004 | Ga0207668_10550797 | |||
| 3005 | Ga0207668_11055284 | |||
| 3006 | Ga0207668_11366594 | |||
| 3007 | Ga0207640_10119910 | |||
| 3008 | Ga0207640_10597600 | |||
| 3009 | Ga0207658_10100738 | |||
| 3010 | Ga0207658_10146621 | |||
| 3011 | Ga0207677_10534649 | |||
| 3012 | Ga0207677_10859690 | |||
| 3013 | Ga0207677_12110009 | |||
| 3014 | Ga0207703_10000177 | |||
| 3015 | Ga0207703_10060180 | |||
| 3016 | Ga0207703_10291059 | |||
| 3017 | Ga0207703_10435284 | |||
| 3018 | Ga0207639_10194589 | |||
| 3019 | Ga0207639_10307058 | |||
| 3020 | Ga0207639_10526472 | |||
| 3021 | Ga0207639_10533025 | |||
| 3022 | Ga0207639_10677230 | |||
| 3023 | Ga0207639_10812575 | |||
| 3024 | Ga0207678_10176582 | |||
| 3025 | Ga0207678_10703577 | |||
| 3026 | Ga0207708_10394412 | |||
| 3027 | Ga0207702_10055808 | |||
| 3028 | Ga0207702_10705408 | |||
| 3029 | Ga0207702_10968486 | |||
| 3030 | Ga0207641_10114337 | |||
| 3031 | Ga0207641_10164144 | |||
| 3032 | Ga0207648_10757287 | |||
| 3033 | Ga0207648_10916306 | |||
| 3034 | Ga0207676_10203983 | |||
| 3035 | Ga0207676_10875729 | |||
| 3036 | Ga0207676_11596193 | |||
| 3037 | Ga0207676_11690920 | |||
| 3038 | Ga0207674_10007680 | |||
| 3039 | Ga0207674_10127860 | |||
| 3040 | Ga0207674_10271280 | |||
| 3041 | Ga0207674_10679861 | |||
| 3042 | Ga0207675_100004621 | |||
| 3043 | Ga0207675_100341405 | |||
| 3044 | Ga0207683_10018022 | |||
| 3045 | Ga0207683_10047963 | |||
| 3046 | Ga0207683_10617663 | |||
| 3047 | Ga0207683_11168306 | |||
| 3048 | Ga0207698_10164039 | |||
| 3049 | Ga0207698_10431400 | |||
| 3050 | Ga0207698_10595612 | |||
| 3051 | Ga0207698_11102703 | |||
| 3052 | Ga0209371_1010646 | |||
| 3053 | Ga0209371_1048649 | |||
| 3054 | Ga0209179_1046444 | |||
| 3055 | Ga0209813_10006215 | |||
| 3056 | Ga0209813_10046968 | |||
| 3057 | Ga0207428_10000746 | |||
| 3058 | Ga0207428_11065745 | |||
| 3059 | Ga0265358_103167 | |||
| 3060 | Ga0268266_10006911 | |||
| 3061 | Ga0268266_10471278 | |||
| 3062 | Ga0268266_10656186 | |||
| 3063 | Ga0268266_10920754 | |||
| 3064 | Ga0268266_11023416 | |||
| 3065 | Ga0268266_11687320 | |||
| 3066 | Ga0268265_10000157 | |||
| 3067 | Ga0268265_10705489 | |||
| 3068 | Ga0268264_10199983 | |||
| 3069 | Ga0268264_10213603 | |||
| 3070 | Ga0307517_10005207 | |||
| 3071 | Ga0307517_10020973 | |||
| 3072 | Ga0307517_10640450 | |||
| 3073 | Ga0307515_10002733 | |||
| 3074 | Ga0307515_10180880 | |||
| 3075 | Ga0307515_10198377 | |||
| 3076 | Ga0311004_111916 | |||
| 3077 | Ga0311011_118056 | |||
| 3078 | Ga0311003_171176 | |||
| 3079 | Ga0310981_1001123 | |||
| 3080 | Ga0268256_1027239 | |||
| 3081 | Ga0268256_1045482 | |||
| 3082 | Ga0307511_10009089 | |||
| 3083 | Ga0307511_10056074 | |||
| 3084 | Ga0307511_10064446 | |||
| 3085 | Ga0307512_10000978 | |||
| 3086 | Ga0307512_10106890 | |||
| 3087 | Ga0307512_10116842 | |||
| 3088 | Ga0316176_1020167 | |||
| 3089 | Ga0314311_1121511 | |||
| 3090 | Ga0316181_1125764 | |||
| 3091 | Ga0265762_1031578 | |||
| 3092 | Ga0265767_113326 | |||
| 3093 | Ga0265766_1025010 | |||
| 3094 | Ga0265777_120614 | |||
| 3095 | Ga0265769_103274 | |||
| 3096 | Ga0265769_111646 | |||
| 3097 | Ga0247549_101801 | |||
| 3098 | Ga0265773_1013629 | |||
| 3099 | Ga0265760_10260592 | |||
| 3100 | Ga0265760_10384268 | |||
| 3101 | Ga0307513_10004736 | |||
| 3102 | Ga0307513_10113346 | |||
| 3103 | Ga0307509_10152597 | |||
| 3104 | Ga0307509_10358154 | |||
| 3105 | Ga0307408_100098861 | |||
| 3106 | Ga0307408_100369173 | |||
| 3107 | Ga0307408_101808301 | |||
| 3108 | Ga0310117_130551 | |||
| 3109 | Ga0307508_10003041 | |||
| 3110 | Ga0307508_10006924 | |||
| 3111 | Ga0307508_10021357 | |||
| 3112 | Ga0307508_10031756 | |||
| 3113 | Ga0307508_10032362 | |||
| 3114 | Ga0307514_10004614 | |||
| 3115 | Ga0307514_10065598 | |||
| 3116 | Ga0307514_10079606 | |||
| 3117 | Ga0307514_10150704 | |||
| 3118 | Ga0307514_10193945 | |||
| 3119 | Ga0307514_10470290 | |||
| 3120 | Ga0316579_10000328 | |||
| 3121 | Ga0307516_10006026 | |||
| 3122 | Ga0307516_10042521 | |||
| 3123 | Ga0307516_10045929 | |||
| 3124 | Ga0307516_10174417 | |||
| 3125 | Ga0307516_10270151 | |||
| 3126 | Ga0307405_10070066 | |||
| 3127 | Ga0307405_10130872 | |||
| 3128 | Ga0307405_10238915 | |||
| 3129 | Ga0307405_10353959 | |||
| 3130 | Ga0307405_11153043 | |||
| 3131 | Ga0247548_109156 | |||
| 3132 | Ga0307413_10208780 | |||
| 3133 | Ga0307413_10318519 | |||
| 3134 | Ga0307413_10959959 | |||
| 3135 | Ga0307413_11079886 | |||
| 3136 | Ga0307413_11144871 | |||
| 3137 | Ga0307413_12099579 | |||
| 3138 | Ga0307518_10271667 | |||
| 3139 | Ga0307518_10496883 | |||
| 3140 | Ga0307410_10307516 | |||
| 3141 | Ga0307410_10313855 | |||
| 3142 | Ga0307410_10349428 | |||
| 3143 | Ga0307410_10741692 | |||
| 3144 | Ga0307410_10746639 | |||
| 3145 | Ga0307410_10948187 | |||
| 3146 | Ga0307406_10002457 | |||
| 3147 | Ga0307406_10236338 | |||
| 3148 | Ga0307406_10344747 | |||
| 3149 | Ga0307406_10366146 | |||
| 3150 | Ga0307406_10931124 | |||
| 3151 | Ga0307407_10004890 | |||
| 3152 | Ga0307407_10118915 | |||
| 3153 | Ga0307407_10186109 | |||
| 3154 | Ga0307407_10188999 | |||
| 3155 | Ga0307407_10264749 | |||
| 3156 | Ga0307407_11673987 | |||
| 3157 | Ga0307412_12164622 | |||
| 3158 | Ga0307412_12179546 | |||
| 3159 | Ga0307409_100086978 | |||
| 3160 | Ga0307409_100117795 | |||
| 3161 | Ga0307409_100125730 | |||
| 3162 | Ga0307409_100175929 | |||
| 3163 | Ga0307409_100185185 | |||
| 3164 | Ga0307409_100219696 | |||
| 3165 | Ga0307409_100250976 | |||
| 3166 | Ga0307409_100536155 | |||
| 3167 | Ga0307409_101069328 | |||
| 3168 | Ga0307409_101496822 | |||
| 3169 | Ga0307409_101504080 | |||
| 3170 | Ga0307416_100013543 | |||
| 3171 | Ga0307416_100084802 | |||
| 3172 | Ga0307416_100132425 | |||
| 3173 | Ga0307416_100172457 | |||
| 3174 | Ga0307416_100185041 | |||
| 3175 | Ga0307416_100268549 | |||
| 3176 | Ga0307416_100513117 | |||
| 3177 | Ga0307416_100739515 | |||
| 3178 | Ga0307416_103849482 | |||
| 3179 | Ga0307414_10053800 | |||
| 3180 | Ga0307414_10518567 | |||
| 3181 | Ga0307414_10614309 | |||
| 3182 | Ga0307414_10622902 | |||
| 3183 | Ga0307414_10784003 | |||
| 3184 | Ga0307411_10399432 | |||
| 3185 | Ga0316053_110460 | |||
| 3186 | Ga0316053_116349 | |||
| 3187 | Ga0307415_100205662 | |||
| 3188 | Ga0307415_100300998 | |||
| 3189 | Ga0307415_100341059 | |||
| 3190 | Ga0307415_100438127 | |||
| 3191 | Ga0307415_102440217 | |||
| 3192 | Ga0307507_10202106 | |||
| 3193 | Ga0307510_10076999 | |||
| 3194 | Ga0307510_10168105 | |||
| 3195 | Ga0307510_10209614 | |||
| 3196 | Ga0373930_0015524 | |||
| 3197 | Ga0373948_0001671 | |||
| 3198 | Ga0373958_0009242 | |||
| 3199 | Ga0373958_0132026 | |||
| 3200 | Ga0373926_0004416 | |||
| 3201 | Ga0373926_0010520 | |||
| 3202 | Ga0373926_0241544 | |||
| 3203 | Ga0373929_0021923 | |||
| 3204 | Ga0373934_0004079 | |||
| 3205 | Ga0373934_0004937 | |||
| 3206 | Ga0373934_0016920 | |||
| 3207 | Ga0373940_0069054 | |||
| 3208 | Ga0373944_0012091 | |||
| 3209 | Ga0373944_0016653 | |||
| 3210 | Ga0373949_0021772 | |||
| 3211 | Ga0373951_0084344 | |||
| 3212 | Ga0373952_0043549 | |||
| 3213 | Ga0373923_0000472 | |||
| 3214 | Ga0373932_0013806 | |||
| 3215 | Ga0373936_0001921 | |||
| 3216 | Ga0373936_0001930 | |||
| 3217 | Ga0373936_0006056 | |||
| 3218 | Ga0373936_0101916 | |||
| 3219 | Ga0373939_0219320 | |||
| 3220 | Ga0373945_0000693 | |||
| 3221 | Ga0373945_0003551 | |||
| 3222 | Ga0373953_0009915 | |||
| 3223 | Ga0373953_0033274 | |||
| 3224 | Ga0373953_0124333 | |||
| 3225 | Ga0373954_0011407 | |||
| 3226 | Ga0373954_0036506 | |||
| 3227 | Ga0373956_0199385 | |||
| 3228 | Ga0373956_0385432 | |||
| 3229 | Ga0373957_0003369 | |||
| 3230 | Ga0373957_0005890 | |||
| 3231 | Ga0373957_0036898 | |||
| 3232 | Ga0373957_0160119 | |||
| 3233 | Ga0373960_0025527 | |||
| 3234 | Ga0373943_0000869 | |||
| 3235 | Ga0373943_0222164 | |||
| 3236 | Ga0373946_0002754 | |||
| 3237 | Ga0373946_0005561 | |||
| 3238 | Ga0373946_0067320 | |||
| 3239 | Ga0373946_0223373 | |||
| 3240 | Ga0373955_0013636 | |||
| 3241 | Ga0373955_0025416 | |||
| 3242 | Ga0373955_0032656 | |||
| 3243 | Ga0373955_0047998 | |||
| 3244 | Ga0373961_0145265 | |||
| 3245 | Ga0373962_0041763 | |||
| 3246 | Ga0373924_0015260 | |||
| 3247 | Ga0373924_0036299 | |||
| 3248 | Ga0373924_0216213 | |||
| 3249 | Ga0373931_0912112 | |||
| 3250 | Ga0373935_0002772 | |||
| 3251 | Ga0373935_0019853 | |||
| 3252 | Ga0373935_0246278 | |||
| 3253 | Ga0373927_0005785 | |||
| 3254 | Ga0373927_0011649 | |||
| 3255 | Ga0373927_0182495 | |||
| 3256 | Ga0373933_0069093 | |||
| 3257 | Ga0373933_0160858 | |||
| 3258 | Ga0373933_0200322 | |||
| 3259 | Ga0373947_0002525 | |||
| 3260 | Ga0373947_0068140 | |||
| 3261 | Ga0373937_0035993 | |||
| 3262 | Ga0373937_0044269 | |||
| 3263 | Ga0373937_0065143 | |||
| 3264 | Ga0265778_025943 | |||
| 3265 | Ga0373925_0005148 | |||
| 3266 | Ga0373925_0100426 | |||
| 3267 | Ga0395899_0101344 | |||
| 3268 | Ga0395899_0195572 | |||
| 3269 | Ga0395899_0481338 | |||
| 3270 | Ga0395900_0486195 | |||
| 3271 | Ga0395900_0556238 | |||
| 3272 | Ga0395898_0003814 | |||
| 3273 | Ga0395898_0004885 | |||
| 3274 | Ga0395898_0232005 | |||
| 3275 | Ga0395898_0280786 | |||
| 3276 | Ga0395898_0316753 | |||
| 3277 | Ga0395898_0386549 | |||
| 3278 | Ga0395898_0576635 | |||
| 3279 | Ga0395905_0138778 | |||
| 3280 | Ga0395905_0508205 | |||
| 3281 | Ga0395905_1108171 | |||
| 3282 | Ga0395905_1151314 | |||
| 3283 | Ga0436364_0009738 | |||
| 3284 | Ga0436364_0136351 | |||
| 3285 | Ga0436364_0304869 | |||
| 3286 | Ga0436364_1303572 | |||
| 3287 | Ga0436364_1308949 | |||
| 3288 | Ga0436364_1353616 | |||
| 3289 | Ga0395901_0014451 | |||
| 3290 | Ga0395901_0044449 | |||
| 3291 | Ga0395901_0221123 | |||
| 3292 | Ga0395901_0299275 | |||
| 3293 | Ga0395901_1162619 | |||
| 3294 | Ga0242420_076493 | |||
| 3295 | Ga0436365_0611199 | |||
| 3296 | Ga0436365_1289663 | |||
| 3297 | Ga0436365_1705129 | |||
| 3298 | Ga0436360_0110487 | |||
| 3299 | Ga0436361_0211931 | |||
| 3300 | Ga0436361_0675330 | |||
| 3301 | Ga0436361_0858626 | |||
| 3302 | Ga0436363_0086959 | |||
| 3303 | Ga0436363_0244953 | |||
| 3304 | Ga0436363_0313187 | |||
| 3305 | Ga0436363_0879846 | |||
| 3306 | Ga0436363_0992871 | |||
| 3307 | Ga0436362_0069517 | |||
| 3308 | Ga0436362_0387930 | |||
| 3309 | Ga0436362_0934528 | |||
| 3310 | Ga0436362_1211610 | |||
| 3311 | Ga0439436_0000928 | |||
| 3312 | Ga0439436_0018153 | |||
| 3313 | Ga0439439_0002357 | |||
| 3314 | Ga0439439_0002711 | |||
| 3315 | Ga0439465_0122188 | |||
| 3316 | Ga0451788_01963 | |||
| 3317 | Ga0451789_1198906 | |||
| 3318 | Ga0451789_1288683 | |||
| 3319 | Ga0451794_30334 | |||
| 3320 | Ga0451791_0817771 | |||
| 3321 | Ga0451791_0998527 | |||
| 3322 | Ga0451791_1596303 | |||
| 3323 | Ga0451793_0272600 | |||
| 3324 | Ga0451797_0242638 | |||
| 3325 | Ga0451797_0372023 | |||
| 3326 | Ga0451802_0005448 | |||
| 3327 | Ga0451802_1713972 | |||
| 3328 | Ga0451805_034483 | |||
| 3329 | Ga0451807_1271743 | |||
| 3330 | Ga0451807_1844026 | |||
| 3331 | Ga0451837_0720473 | |||
| 3332 | Ga0451839_0156761 | |||
| 3333 | Ga0451839_0530653 | |||
| 3334 | Ga0451841_0024364 | |||
| 3335 | Ga0451841_0930514 | |||
| 3336 | Ga0451845_0978105 | |||
| 3337 | Ga0451846_26990 | |||
| 3338 | Ga0451849_0428000 | |||
| 3339 | Ga0451849_0889599 | |||
| 3340 | Ga0451851_1130574 | |||
| 3341 | Ga0451851_1369277 | |||
| 3342 | Ga0451843_1183826 | |||
| 3343 | Ga0451853_2683550 | |||
| 3344 | Ga0451853_3445873 | |||
| 3345 | Ga0451853_3531906 | |||
| 3346 | Ga0452271_73204 | |||
| 3347 | Ga0439431_0160109 | |||
| 3348 | Ga0439433_0003361 | |||
| 3349 | Ga0439433_0021509 | |||
| 3350 | Ga0439433_0118153 | |||
| 3351 | Ga0439442_009151 | |||
| 3352 | Ga0439445_0277711 | |||
| 3353 | Ga0439448_0001957 | |||
| 3354 | Ga0439448_0008132 | |||
| 3355 | Ga0439448_0063851 | |||
| 3356 | Ga0439448_0222206 | |||
| 3357 | Ga0439432_026577 | |||
| 3358 | Ga0439449_0001280 | |||
| 3359 | Ga0439449_0018673 | |||
| 3360 | Ga0439449_0024590 | |||
| 3361 | Ga0439449_0086552 | |||
| 3362 | Ga0439450_017797 | |||
| 3363 | Ga0439454_000513 | |||
| 3364 | Ga0439454_037620 | |||
| 3365 | Ga0439454_096559 | |||
| 3366 | Ga0439455_0001760 | |||
| 3367 | Ga0439455_0049166 | |||
| 3368 | Ga0439457_001493 | |||
| 3369 | Ga0439457_001678 | |||
| 3370 | Ga0439463_034875 | |||
| 3371 | Ga0439463_109687 | |||
| 3372 | Ga0439463_121685 | |||
| 3373 | Ga0439463_174448 | |||
| 3374 | Ga0450920_022188 | |||
| 3375 | Ga0450920_132262 | |||
| 3376 | Ga0450888_011212 | |||
| 3377 | Ga0450897_034417 | |||
| 3378 | Ga0450894_000082 | |||
| 3379 | Ga0450895_002600 | |||
| 3380 | Ga0450898_001847 | |||
| 3381 | Ga0450899_001163 | |||
| 3382 | Ga0450900_002001 | |||
| 3383 | Ga0450900_085106 | |||
| 3384 | Ga0450903_000408 | |||
| 3385 | Ga0450903_025346 | |||
| 3386 | Ga0450904_023073 | |||
| 3387 | Ga0450905_001111 | |||
| 3388 | Ga0450905_067121 | |||
| 3389 | Ga0450889_049024 | |||
| 3390 | Ga0450906_005337 | |||
| 3391 | Ga0450906_041222 | |||
| 3392 | Ga0450907_014293 | |||
| 3393 | Ga0450910_023603 | |||
| 3394 | Ga0450910_040113 | |||
| 3395 | Ga0439458_0000894 | |||
| 3396 | Ga0439458_0135142 | |||
| 3397 | Ga0450908_000754 | |||
| 3398 | Ga0450909_078172 | |||
| 3399 | Ga0439435_0010445 | |||
| 3400 | Ga0439444_0041891 | |||
| 3401 | Ga0439459_0059541 | |||
| 3402 | Ga0439459_0172004 | |||
| 3403 | Ga0439464_0318780 | |||
| 3404 | Ga0439460_0116379 | |||
| 3405 | Ga0450916_023589 | |||
| 3406 | Ga0450893_0128390 | |||
| 3407 | Ga0439440_0008474 | |||
| 3408 | Ga0466969_0002289 | |||
| 3409 | Ga0466969_0018579 | |||
| 3410 | Ga0466969_0029433 | |||
| 3411 | Ga0466969_0041253 | |||
| 3412 | Ga0466972_0079512 | |||
| 3413 | Ga0466965_0007538 | |||
| 3414 | Ga0466965_0014029 | |||
| 3415 | Ga0466965_0038532 | |||
| 3416 | Ga0466965_0247725 | |||
| 3417 | Ga0466965_0416359 | |||
| 3418 | Ga0466966_0026669 | |||
| 3419 | Ga0466966_0032011 | |||
| 3420 | Ga0466966_0082062 | |||
| 3421 | Ga0466966_0151591 | |||
| 3422 | Ga0466966_0497092 | |||
| 3423 | Ga0466961_0004342 | |||
| 3424 | Ga0466961_0010303 | |||
| 3425 | Ga0466961_0029559 | |||
| 3426 | Ga0466961_0046293 | |||
| 3427 | Ga0466961_0076857 | |||
| 3428 | Ga0466961_0130585 | |||
| 3429 | Ga0466961_0229629 | |||
| 3430 | Ga0466961_0278371 | |||
| 3431 | Ga0466961_0355647 | |||
| 3432 | Ga0466961_0476154 | |||
| 3433 | Ga0466961_0527097 | |||
| 3434 | Ga0466963_0004564 | |||
| 3435 | Ga0466963_0004744 | |||
| 3436 | Ga0466963_0053926 | |||
| 3437 | Ga0466963_0054762 | |||
| 3438 | Ga0466963_0129790 | |||
| 3439 | Ga0466963_0149257 | |||
| 3440 | Ga0466963_0172532 | |||
| 3441 | Ga0466963_0203279 | |||
| 3442 | Ga0466963_0275343 | |||
| 3443 | Ga0466963_0299986 | |||
| 3444 | Ga0466963_0348773 | |||
| 3445 | Ga0466963_1284936 | |||
| 3446 | Ga0466964_0006896 | |||
| 3447 | Ga0466964_0007424 | |||
| 3448 | Ga0466964_0314268 | |||
| 3449 | Ga0466964_0754552 | |||
| 3450 | Ga0466971_0002170 | |||
| 3451 | Ga0466971_0070749 | |||
| 3452 | Ga0466971_0115327 | |||
| 3453 | Ga0466971_0178830 | |||
| 3454 | Ga0466971_0247718 | |||
| 3455 | Ga0466968_0049997 | |||
| 3456 | Ga0466968_0130633 | |||
| 3457 | Ga0466968_0166062 | |||
| 3458 | Ga0466970_0003663 | |||
| 3459 | Ga0466970_0005692 | |||
| 3460 | Ga0466970_0020231 | |||
| 3461 | Ga0466970_0099930 | |||
| 3462 | Ga0466970_0104529 | |||
| 3463 | Ga0466970_0195015 | |||
| 3464 | Ga0466970_0249677 | |||
| 3465 | Ga0466970_0378347 | |||
| 3466 | Ga0466957_0000092 | |||
| 3467 | Ga0466957_0010996 | |||
| 3468 | Ga0466957_0019419 | |||
| 3469 | Ga0466957_0245730 | |||
| 3470 | Ga0466957_1365479 | |||
| 3471 | Ga0466960_0017520 | |||
| 3472 | Ga0466960_0033394 | |||
| 3473 | Ga0466960_0087602 | |||
| 3474 | Ga0466960_0104006 | |||
| 3475 | Ga0466960_0422329 | |||
| 3476 | Ga0466960_0580970 | |||
| 3477 | Ga0466959_0023604 | |||
| 3478 | Ga0466959_0040116 | |||
| 3479 | Ga0466959_0071128 | |||
| 3480 | Ga0466959_0071597 | |||
| 3481 | Ga0466959_0165319 | |||
| 3482 | Ga0466959_0190702 | |||
| 3483 | Ga0466959_0821559 | |||
| 3484 | Ga0451576_0046672 | |||
| 3485 | Ga0466958_0010114 | |||
| 3486 | Ga0466958_0256331 | |||
| 3487 | Ga0466958_0393430 | |||
| 3488 | Ga0466958_0860448 | |||
| 3489 | Ga0466967_0018221 | |||
| 3490 | Ga0466967_0064396 | |||
| 3491 | Ga0466967_0093693 | |||
| 3492 | Ga0466967_0123331 | |||
| 3493 | Ga0466967_0239113 | |||
| 3494 | Ga0466967_0253272 | |||
| 3495 | Ga0466967_0268287 | |||
| 3496 | Ga0466967_0368551 | |||
| 3497 | Ga0466967_0375305 | |||
| 3498 | Ga0466967_0793549 | |||
| 3499 | Ga0466967_0866240 | |||
| 3500 | Ga0466967_0895234 | |||
| 3501 | Ga0466967_1031217 | |||
| 3502 | Ga0466967_1471241 | |||
| 3503 | Ga0466967_1493603 | |||
| 3504 | Ga0466967_1594002 | |||
| 3505 | Ga0466967_1800516 | |||
| 3506 | Ga0466967_2154901 | |||
| 3507 | Ga0466967_2284396 | |||
| 3508 | Ga0495617_014510 | |||
| 3509 | Ga0495617_165754 | |||
| 3510 | Ga0495617_206518 | |||
| 3511 | Ga0495627_020039 | |||
| 3512 | Ga0495627_146848 | |||
| 3513 | Ga0495592_0005557 | |||
| 3514 | Ga0495592_0018798 | |||
| 3515 | Ga0495592_0030916 | |||
| 3516 | Ga0495592_0061761 | |||
| 3517 | Ga0495592_0086491 | |||
| 3518 | Ga0495592_0104331 | |||
| 3519 | Ga0495603_0006510 | |||
| 3520 | Ga0495603_0085584 | |||
| 3521 | Ga0495603_0118056 | |||
| 3522 | Ga0495603_0205771 | |||
| 3523 | Ga0495603_0362164 | |||
| 3524 | Ga0495629_0001307 | |||
| 3525 | Ga0495629_0007156 | |||
| 3526 | Ga0495629_0007564 | |||
| 3527 | Ga0495629_0026501 | |||
| 3528 | Ga0495629_0048183 | |||
| 3529 | Ga0495629_0093663 | |||
| 3530 | Ga0495629_0111863 | |||
| 3531 | Ga0495629_0254193 | |||
| 3532 | Ga0495629_0749212 | |||
| 3533 | Ga0495638_0043781 | |||
| 3534 | Ga0495638_0056602 | |||
| 3535 | Ga0495638_0138403 | |||
| 3536 | Ga0495638_0154209 | |||
| 3537 | Ga0495641_0003608 | |||
| 3538 | Ga0495641_0118217 | |||
| 3539 | Ga0495641_0185141 | |||
| 3540 | Ga0495651_0001137 | |||
| 3541 | Ga0495651_0004063 | |||
| 3542 | Ga0495651_0004096 | |||
| 3543 | Ga0495651_0015483 | |||
| 3544 | Ga0495651_0046184 | |||
| 3545 | Ga0495651_0163331 | |||
| 3546 | Ga0495653_0004863 | |||
| 3547 | Ga0495653_0029402 | |||
| 3548 | Ga0495653_0038966 | |||
| 3549 | Ga0495653_0042270 | |||
| 3550 | Ga0495653_0071907 | |||
| 3551 | Ga0495653_0223937 | |||
| 3552 | Ga0495653_0329739 | |||
| 3553 | Ga0495653_0391850 | |||
| 3554 | Ga0495580_0057637 | |||
| 3555 | Ga0495580_0183058 | |||
| 3556 | Ga0495582_0005652 | |||
| 3557 | Ga0495582_0040378 | |||
| 3558 | Ga0495582_0099402 | |||
| 3559 | Ga0495582_0104365 | |||
| 3560 | Ga0495582_0161218 | |||
| 3561 | Ga0495582_0236395 | |||
| 3562 | Ga0495582_0556672 | |||
| 3563 | Ga0495605_0027760 | |||
| 3564 | Ga0495639_0012462 | |||
| 3565 | Ga0495639_0031522 | |||
| 3566 | Ga0495639_0193208 | |||
| 3567 | Ga0495639_0588160 | |||
| 3568 | Ga0495662_0000585 | |||
| 3569 | Ga0495662_0000600 | |||
| 3570 | Ga0495662_0012967 | |||
| 3571 | Ga0495662_0027110 | |||
| 3572 | Ga0495662_0053026 | |||
| 3573 | Ga0495662_0080275 | |||
| 3574 | Ga0495662_0159693 | |||
| 3575 | Ga0495664_0003849 | |||
| 3576 | Ga0495664_0012427 | |||
| 3577 | Ga0495664_0017674 | |||
| 3578 | Ga0495664_0017854 | |||
| 3579 | Ga0495664_0022249 | |||
| 3580 | Ga0495664_0029664 | |||
| 3581 | Ga0495664_0105905 | |||
| 3582 | Ga0495584_0125282 | |||
| 3583 | Ga0495585_0070321 | |||
| 3584 | Ga0495585_0075451 | |||
| 3585 | Ga0495585_0075605 | |||
| 3586 | Ga0495585_0258624 | |||
| 3587 | Ga0495585_0259622 | |||
| 3588 | Ga0495585_0454749 | |||
| 3589 | Ga0495594_0002440 | |||
| 3590 | Ga0495594_0005436 | |||
| 3591 | Ga0495594_0057416 | |||
| 3592 | Ga0495594_0091639 | |||
| 3593 | Ga0495594_0204491 | |||
| 3594 | Ga0495594_0227954 | |||
| 3595 | Ga0495594_0426196 | |||
| 3596 | Ga0495596_0018896 | |||
| 3597 | Ga0495596_0057813 | |||
| 3598 | Ga0495596_0177004 | |||
| 3599 | Ga0495607_0048872 | |||
| 3600 | Ga0495607_0051739 | |||
| 3601 | Ga0495607_0072728 | |||
| 3602 | Ga0495583_0061795 | |||
| 3603 | Ga0495606_0006375 | |||
| 3604 | Ga0495608_0000457 | |||
| 3605 | Ga0495608_0019897 | |||
| 3606 | Ga0495608_0035781 | |||
| 3607 | Ga0495608_0039886 | |||
| 3608 | Ga0495608_0527612 | |||
| 3609 | Ga0495610_0063004 | |||
| 3610 | Ga0495616_0003801 | |||
| 3611 | Ga0495616_0357371 | |||
| 3612 | Ga0495618_0007498 | |||
| 3613 | Ga0495618_0019010 | |||
| 3614 | Ga0495618_0025441 | |||
| 3615 | Ga0495618_0079095 | |||
| 3616 | Ga0495618_0127174 | |||
| 3617 | Ga0495620_0054153 | |||
| 3618 | Ga0495620_0165499 | |||
| 3619 | Ga0495620_0169227 | |||
| 3620 | Ga0495628_0027669 | |||
| 3621 | Ga0495628_0042985 | |||
| 3622 | Ga0495628_0048987 | |||
| 3623 | Ga0495628_0070625 | |||
| 3624 | Ga0495628_0084215 | |||
| 3625 | Ga0495628_0498540 | |||
| 3626 | Ga0495630_0041563 | |||
| 3627 | Ga0495630_0058292 | |||
| 3628 | Ga0495630_0062191 | |||
| 3629 | Ga0495630_0222869 | |||
| 3630 | Ga0495630_0344043 | |||
| 3631 | Ga0495630_0631393 | |||
| 3632 | Ga0495631_0004163 | |||
| 3633 | Ga0495632_0025649 | |||
| 3634 | Ga0495632_0134282 | |||
| 3635 | Ga0495632_0303866 | |||
| 3636 | Ga0495637_0027376 | |||
| 3637 | Ga0495637_0037354 | |||
| 3638 | Ga0495643_0005977 | |||
| 3639 | Ga0495643_0008022 | |||
| 3640 | Ga0495644_0023028 | |||
| 3641 | Ga0495644_0041104 | |||
| 3642 | Ga0495648_0068206 | |||
| 3643 | Ga0495663_0009942 | |||
| 3644 | Ga0495666_0000906 | |||
| 3645 | Ga0495666_0080579 | |||
| 3646 | Ga0495666_0093330 | |||
| 3647 | Ga0495666_0112439 | |||
| 3648 | Ga0495666_0183954 | |||
| 3649 | Ga0495666_0280107 | |||
| 3650 | Ga0495642_0055136 | |||
| 3651 | Ga0495642_0084633 | |||
| 3652 | Ga0495652_0010842 | |||
| 3653 | Ga0495652_0091587 | |||
| 3654 | Ga0495652_0093017 | |||
| 3655 | Ga0495652_0103996 | |||
| 3656 | Ga0495652_0107955 | |||
| 3657 | Ga0495652_0138834 | |||
| 3658 | Ga0495652_0240179 | |||
| 3659 | Ga0495652_0306836 | |||
| 3660 | Ga0495652_0981747 | |||
| 3661 | Ga0495654_0007370 | |||
| 3662 | Ga0495665_0004964 | |||
| 3663 | Ga0495665_0005298 | |||
| 3664 | Ga0495665_0005836 | |||
| 3665 | Ga0495665_0005892 | |||
| 3666 | Ga0495640_0003461 | |||
| 3667 | Ga0495640_0006110 | |||
| 3668 | Ga0495640_0012238 | |||
| 3669 | Ga0495640_0023619 | |||
| 3670 | Ga0495640_0036241 | |||
| 3671 | Ga0495640_0105248 | |||
| 3672 | Ga0495640_0240139 | |||
| 3673 | Ga0495640_0683267 | |||
| 3674 | Ga0495586_0010989 | |||
| 3675 | Ga0495586_0031312 | |||
| 3676 | Ga0495586_0141080 | |||
| 3677 | Ga0495586_0323491 | |||
| 3678 | Ga0495586_0425138 | |||
| 3679 | Ga0495587_0003258 | |||
| 3680 | Ga0495587_0013451 | |||
| 3681 | Ga0495587_0013762 | |||
| 3682 | Ga0495587_0061468 | |||
| 3683 | Ga0495587_0143557 | |||
| 3684 | Ga0495587_0376824 | |||
| 3685 | Ga0495598_0021468 | |||
| 3686 | Ga0495609_0023685 | |||
| 3687 | Ga0495609_0044610 | |||
| 3688 | Ga0495609_0097363 | |||
| 3689 | Ga0495609_0130440 | |||
| 3690 | Ga0495597_0075657 | |||
| 3691 | Ga0495597_0162614 | |||
| 3692 | Ga0495645_0006394 | |||
| 3693 | Ga0495645_0059565 | |||
| 3694 | Ga0495645_0146946 | |||
| 3695 | Ga0495645_0319987 | |||
| 3696 | Ga0495645_0389810 | |||
| 3697 | Ga0495622_0015255 | |||
| 3698 | Ga0495622_0019042 | |||
| 3699 | Ga0495622_0045225 | |||
| 3700 | Ga0495622_0257484 | |||
| 3701 | Ga0495633_0005358 | |||
| 3702 | Ga0495633_0030269 | |||
| 3703 | Ga0495667_0005090 | |||
| 3704 | Ga0495667_0009929 | |||
| 3705 | Ga0495667_0029960 | |||
| 3706 | Ga0495667_0072945 | |||
| 3707 | Ga0495667_0140948 | |||
| 3708 | Ga0495667_0230183 | |||
| 3709 | Ga0495667_0242635 | |||
| 3710 | Ga0495667_0405590 | |||
| 3711 | Ga0495667_0593328 | |||
| 3712 | Ga0495656_0072026 | |||
| 3713 | Ga0495656_0233741 | |||
| 3714 | Ga0495656_0234142 | |||
| 3715 | Ga0495668_0286789 | |||
| 3716 | Ga0495634_0000626 | |||
| 3717 | Ga0495634_0004108 | |||
| 3718 | Ga0495634_0020442 | |||
| 3719 | Ga0495634_0023454 | |||
| 3720 | Ga0495634_0028120 | |||
| 3721 | Ga0495634_0131367 | |||
| 3722 | Ga0495634_0136447 | |||
| 3723 | Ga0495634_0156768 | |||
| 3724 | Ga0495634_0183060 | |||
| 3725 | Ga0495634_0545153 | |||
| 3726 | Ga0495611_0017753 | |||
| 3727 | Ga0495611_0022394 | |||
| 3728 | Ga0495611_0048988 | |||
| 3729 | Ga0495611_0167329 | |||
| 3730 | Ga0495611_0292772 | |||
| 3731 | Ga0495625_0011293 | |||
| 3732 | Ga0495625_0036984 | |||
| 3733 | Ga0495635_0004539 | |||
| 3734 | Ga0495635_0013510 | |||
| 3735 | Ga0495635_0042090 | |||
| 3736 | Ga0495635_0049734 | |||
| 3737 | Ga0495635_0057761 | |||
| 3738 | Ga0495635_0060270 | |||
| 3739 | Ga0495635_0116887 | |||
| 3740 | Ga0495635_0182623 | |||
| 3741 | Ga0495635_0558659 | |||
| 3742 | Ga0495661_0039646 | |||
| 3743 | Ga0495661_0046389 | |||
| 3744 | Ga0495661_0118639 | |||
| 3745 | Ga0495588_0022151 | |||
| 3746 | Ga0495588_0068342 | |||
| 3747 | Ga0495588_0091973 | |||
| 3748 | Ga0495588_0125782 | |||
| 3749 | Ga0495657_0002383 | |||
| 3750 | Ga0495657_0007140 | |||
| 3751 | Ga0495657_0022451 | |||
| 3752 | Ga0495657_0040887 | |||
| 3753 | Ga0495657_0058343 | |||
| 3754 | Ga0495657_0120993 | |||
| 3755 | Ga0495657_0211605 | |||
| 3756 | Ga0495657_0725320 | |||
| 3757 | Ga0495599_0030374 | |||
| 3758 | Ga0495599_0081661 | |||
| 3759 | Ga0495599_0244800 | |||
| 3760 | Ga0495599_0282347 | |||
| 3761 | Ga0495599_0442633 | |||
| 3762 | Ga0495623_0009174 | |||
| 3763 | Ga0495623_0085990 | |||
| 3764 | Ga0495623_0155803 | |||
| 3765 | Ga0495623_0234736 | |||
| 3766 | Ga0495623_0264130 | |||
| 3767 | Ga0495646_0001371 | |||
| 3768 | Ga0495646_0011902 | |||
| 3769 | Ga0495646_0025764 | |||
| 3770 | Ga0495646_0115853 | |||
| 3771 | Ga0495646_0255970 | |||
| 3772 | Ga0495646_0281571 | |||
| 3773 | Ga0495646_0570288 | |||
| 3774 | Ga0495647_0020907 | |||
| 3775 | Ga0495658_0005567 | |||
| 3776 | Ga0495658_0069363 | |||
| 3777 | Ga0495658_0163759 | |||
| 3778 | Ga0495658_0252413 | |||
| 3779 | Ga0495658_0514031 | |||
| 3780 | Ga0495613_0000704 | |||
| 3781 | Ga0495613_0005089 | |||
| 3782 | Ga0495613_0005645 | |||
| 3783 | Ga0495613_0010257 | |||
| 3784 | Ga0495613_0018023 | |||
| 3785 | Ga0495613_0034477 | |||
| 3786 | Ga0495613_0037380 | |||
| 3787 | Ga0495613_0093191 | |||
| 3788 | Ga0495613_0388726 | |||
| 3789 | Ga0495613_0517385 | |||
| 3790 | Ga0495613_0746430 | |||
| 3791 | Ga0495624_0007123 | |||
| 3792 | Ga0495624_0007746 | |||
| 3793 | Ga0495624_0011024 | |||
| 3794 | Ga0495624_0028664 | |||
| 3795 | Ga0495624_0084490 | |||
| 3796 | Ga0495624_0131734 | |||
| 3797 | Ga0495670_0039461 | |||
| 3798 | Ga0495670_0115907 | |||
| 3799 | Ga0495670_0260622 | |||
| 3800 | Ga0495670_0406880 | |||
| 3801 | Ga0495670_0768335 | |||
| 3802 | Ga0495671_0008610 | |||
| 3803 | Ga0495671_0090667 | |||
| 3804 | Ga0495649_0031629 | |||
| 3805 | Ga0495649_0075816 | |||
| 3806 | Ga0495589_0011786 | |||
| 3807 | Ga0495589_0105099 | |||
| 3808 | Ga0495589_0152336 | |||
| 3809 | Ga0495589_0174702 | |||
| 3810 | Ga0495589_0228315 | |||
| 3811 | Ga0495589_0321088 | |||
| 3812 | Ga0495600_0004210 | |||
| 3813 | Ga0495600_0006730 | |||
| 3814 | Ga0495600_0014374 | |||
| 3815 | Ga0495600_0114315 | |||
| 3816 | Ga0495600_0163115 | |||
| 3817 | Ga0495600_0224615 | |||
| 3818 | Ga0495600_0237698 | |||
| 3819 | Ga0495600_0246758 | |||
| 3820 | Ga0495660_0034851 | |||
| 3821 | Ga0495660_0063398 | |||
| 3822 | Ga0495581_0002245 | |||
| 3823 | Ga0495581_0004730 | |||
| 3824 | Ga0495581_0037892 | |||
| 3825 | Ga0495581_0045158 | |||
| 3826 | Ga0495581_0046927 | |||
| 3827 | Ga0495581_0056765 | |||
| 3828 | Ga0495581_0080075 | |||
| 3829 | Ga0495581_0092440 | |||
| 3830 | Ga0495581_0102572 | |||
| 3831 | Ga0495581_0179610 | |||
| 3832 | Ga0495581_0333787 | |||
| 3833 | Ga0495604_0000590 | |||
| 3834 | Ga0495604_0012749 | |||
| 3835 | Ga0495604_0024988 | |||
| 3836 | Ga0495604_0035517 | |||
| 3837 | Ga0495604_0041000 | |||
| 3838 | Ga0495604_0059394 | |||
| 3839 | Ga0495604_0213397 | |||
| 3840 | Ga0495604_0508706 | |||
| 3841 | Ga0495636_0008517 | |||
| 3842 | Ga0495636_0019828 | |||
| 3843 | Ga0495636_0020521 | |||
| 3844 | Ga0495636_0043369 | |||
| 3845 | Ga0495636_0099816 | |||
| 3846 | Ga0495636_0262880 | |||
| 3847 | Ga0495674_0014793 | |||
| 3848 | Ga0495674_0020722 | |||
| 3849 | Ga0495674_0026819 | |||
| 3850 | Ga0495674_0147512 | |||
| 3851 | Ga0495674_0453210 | |||
| 3852 | Ga0495674_0554436 | |||
| 3853 | Ga0495672_0098197 | |||
| 3854 | Ga0495676_0014737 | |||
| 3855 | Ga0495676_0023696 | |||
| 3856 | Ga0495676_0031255 | |||
| 3857 | Ga0495676_0068779 | |||
| 3858 | Ga0495676_0070119 | |||
| 3859 | Ga0495676_0072120 | |||
| 3860 | Ga0495676_0120682 | |||
| 3861 | Ga0495676_0165295 | |||
| 3862 | Ga0495676_0347052 | |||
| 3863 | Ga0495676_0494845 | |||
| 3864 | Ga0495680_0003256 | |||
| 3865 | Ga0495680_0011499 | |||
| 3866 | Ga0495680_0012358 | |||
| 3867 | Ga0495680_0044700 | |||
| 3868 | Ga0495680_0047383 | |||
| 3869 | Ga0495680_0061680 | |||
| 3870 | Ga0495680_0142478 | |||
| 3871 | Ga0495683_0025758 | |||
| 3872 | Ga0495683_0033477 | |||
| 3873 | Ga0495683_0352302 | |||
| 3874 | Ga0495687_001001 | |||
| 3875 | Ga0495687_001560 | |||
| 3876 | Ga0495687_016118 | |||
| 3877 | Ga0495675_0018440 | |||
| 3878 | Ga0495675_0029863 | |||
| 3879 | Ga0495675_0042833 | |||
| 3880 | Ga0495675_0066288 | |||
| 3881 | Ga0495675_0120467 | |||
| 3882 | Ga0495675_0139361 | |||
| 3883 | Ga0495675_0218783 | |||
| 3884 | Ga0495675_0224849 | |||
| 3885 | Ga0495675_0425703 | |||
| 3886 | Ga0495677_0023235 | |||
| 3887 | Ga0495677_0029557 | |||
| 3888 | Ga0495677_0036035 | |||
| 3889 | Ga0495679_056845 | |||
| 3890 | Ga0495679_093091 | |||
| 3891 | Ga0495685_000403 | |||
| 3892 | Ga0495685_004718 | |||
| 3893 | Ga0495685_019035 | |||
| 3894 | Ga0495685_022874 | |||
| 3895 | Ga0495685_114301 | |||
| 3896 | Ga0495685_292351 | |||
| 3897 | Ga0495681_0002670 | |||
| 3898 | Ga0495681_0003065 | |||
| 3899 | Ga0495681_0070949 | |||
| 3900 | Ga0495684_0004164 | |||
| 3901 | Ga0495684_0004873 | |||
| 3902 | Ga0495684_0028859 | |||
| 3903 | Ga0495684_0030673 | |||
| 3904 | Ga0495684_0064631 | |||
| 3905 | Ga0495684_0107181 | |||
| 3906 | Ga0495684_0147989 | |||
| 3907 | Ga0495686_0005934 | |||
| 3908 | Ga0495686_0038034 | |||
| 3909 | Ga0495686_0048999 | |||
| 3910 | Ga0495593_0003014 | |||
| 3911 | Ga0495593_0012250 | |||
| 3912 | Ga0495593_0020518 | |||
| 3913 | Ga0495593_0061868 | |||
| 3914 | Ga0495593_0134453 | |||
| 3915 | Ga0495593_0164734 | |||
| 3916 | Ga0495593_0182618 | |||
| 3917 | Ga0495593_0350494 | |||
| 3918 | Ga0495602_0030856 | |||
| 3919 | Ga0495602_0063495 | |||
| 3920 | Ga0495602_0083248 | |||
| 3921 | Ga0495602_0129994 | |||
| 3922 | Ga0495602_0150723 | |||
| 3923 | Ga0495602_0410626 | |||
| 3924 | Ga0495602_0452118 | |||
| 3925 | Ga0495602_1011200 | |||
| 3926 | Ga0495614_0003507 | |||
| 3927 | Ga0495614_0005517 | |||
| 3928 | Ga0495614_0192948 | |||
| 3929 | Ga0495614_0261666 | |||
| 3930 | Ga0495615_0244012 | |||
| 3931 | Ga0495626_0006925 | |||
| 3932 | Ga0496100_0041269 | |||
| 3933 | Ga0496100_0475212 | |||
| 3934 | Ga0496100_0607451 | |||
| 3935 | Ga0496101_0021655 | |||
| 3936 | Ga0496101_0420429 | |||
| 3937 | Ga0496101_0476444 | |||
| 3938 | Ga0496102_0005198 | |||
| 3939 | Ga0496102_0008637 | |||
| 3940 | Ga0496102_0274201 | |||
| 3941 | Ga0496102_0357818 | |||
| 3942 | Ga0496102_0445174 | |||
| 3943 | Ga0496102_1417763 | |||
| 3944 | Ga0496103_0011644 | |||
| 3945 | Ga0496103_0053998 | |||
| 3946 | Ga0496103_0372240 | |||
| 3947 | Ga0496104_0061932 | |||
| 3948 | Ga0496104_0087405 | |||
| 3949 | Ga0496104_0188230 | |||
| 3950 | Ga0496105_0029690 | |||
| 3951 | Ga0496105_0106953 | |||
| 3952 | Ga0496105_0119990 | |||
| 3953 | Ga0496105_0146114 | |||
| 3954 | Ga0496105_0431586 | |||
| 3955 | Ga0496105_0647516 | |||
| 3956 | Ga0496106_0008319 | |||
| 3957 | Ga0496106_0029464 | |||
| 3958 | Ga0496106_0167415 | |||
| 3959 | Ga0496106_0562035 | |||
| 3960 | Ga0496106_0569376 | |||
| 3961 | Ga0496106_0835702 | |||
| 3962 | Ga0496106_1166206 | |||
| 3963 | Ga0496107_0019893 | |||
| 3964 | Ga0496107_0069211 | |||
| 3965 | Ga0496107_0154792 | |||
| 3966 | Ga0496107_0606519 | |||
| 3967 | Ga0496107_0820445 | |||
| 3968 | Ga0496108_0019165 | |||
| 3969 | Ga0496108_0024157 | |||
| 3970 | Ga0496108_0029657 | |||
| 3971 | Ga0496108_0089356 | |||
| 3972 | Ga0496108_0107297 | |||
| 3973 | Ga0496108_0707495 | |||
| 3974 | Ga0496108_1223311 | |||
| 3975 | Ga0496108_1270374 | |||
| 3976 | Ga0496109_0006258 | |||
| 3977 | Ga0496109_0015250 | |||
| 3978 | Ga0496109_0020477 | |||
| 3979 | Ga0496109_0035248 | |||
| 3980 | Ga0496109_0044001 | |||
| 3981 | Ga0496109_0139412 | |||
| 3982 | Ga0496109_0230614 | |||
| 3983 | Ga0496109_0230971 | |||
| 3984 | Ga0496109_0387387 | |||
| 3985 | Ga0496109_0480538 | |||
| 3986 | Ga0496109_0486350 | |||
| 3987 | Ga0496109_0696529 | |||
| 3988 | Ga0496110_0019268 | |||
| 3989 | Ga0496110_0036101 | |||
| 3990 | Ga0496110_0062954 | |||
| 3991 | Ga0496110_0686512 | |||
| 3992 | Ga0496110_1226679 | |||
| 3993 | Ga0496110_1643964 | |||
| 3994 | Ga0496111_0016124 | |||
| 3995 | Ga0496111_0125687 | |||
| 3996 | Ga0496111_0148683 | |||
| 3997 | Ga0496111_0242637 | |||
| 3998 | Ga0496111_0256985 | |||
| 3999 | Ga0496111_0849291 | |||
| 4000 | Ga0496112_0189334 | |||
| 4001 | Ga0496112_0518419 | |||
| 4002 | Ga0496112_1036803 | |||
| 4003 | Ga0496112_1241449 | |||
| 4004 | Ga0496113_0061466 | |||
| 4005 | Ga0496113_0068519 | |||
| 4006 | Ga0496113_0132351 | |||
| 4007 | Ga0496113_0143982 | |||
| 4008 | Ga0496113_0798236 | |||
| 4009 | Ga0496113_1150326 | |||
| 4010 | Ga0496113_1594223 | |||
| 4011 | Ga0496114_0002916 | |||
| 4012 | Ga0496114_0083131 | |||
| 4013 | Ga0496114_0308065 | |||
| 4014 | Ga0496114_0391521 | |||
| 4015 | Ga0496114_0593570 | |||
| 4016 | Ga0496114_0624165 | |||
| 4017 | Ga0496114_0720898 | |||
| 4018 | Ga0496114_1081728 | |||
| 4019 | Ga0496114_1108601 | |||
| 4020 | Ga0496114_1176212 | |||
| 4021 | Ga0496114_1352114 | |||
| 4022 | Ga0496115_0061447 | |||
| 4023 | Ga0496115_0365229 | |||
| 4024 | Ga0496115_0688494 | |||
| 4025 | Ga0496115_0770546 | |||
| 4026 | Ga0496115_0955967 | |||
| 4027 | Ga0496117_0028846 | |||
| 4028 | Ga0496119_0020275 | |||
| 4029 | Ga0496120_0369915 | |||
| 4030 | Ga0496121_0007510 | |||
| 4031 | Ga0496125_0468259 | |||
| 4032 | Ga0496126_0726524 | |||
| 4033 | Ga0496126_0835989 | |||
| 4034 | Ga0501306_016193 | |||
| 4035 | Ga0501306_026302 | |||
| 4036 | Ga0501306_056781 | |||
| 4037 | Ga0501306_073855 | |||
| 4038 | Ga0501308_006777 | |||
| 4039 | Ga0501309_068821 | |||
| 4040 | Ga0501310_022788 | |||
| 4041 | Ga0501310_079142 | |||
| 4042 | Ga0501304_003547 | |||
| 4043 | Ga0501304_006443 | |||
| 4044 | Ga0501305_119111 | |||
| 4045 | Ga0501307_008271 | |||
| 4046 | Ga0495678_055852 | |||
| 4047 | Ga0495682_0005869 | |||
| 4048 | Ga0501311_012937 | |||
| 4049 | Ga0501312_046384 | |||
| 4050 | Ga0501312_110483 | |||
| 4051 | Ga0501313_011751 | |||
| 4052 | Ga0501314_017874 | |||
| 4053 | Ga0501314_034440 | |||
| 4054 | Ga0501315_017434 | |||
| 4055 | Ga0501316_013954 | |||
| 4056 | Ga0501316_031134 | |||
| 4057 | Ga0501317_018717 | |||
| 4058 | Ga0501317_019041 | |||
| 4059 | Ga0501317_020531 | |||
| 4060 | Ga0501318_017683 | |||
| 4061 | Ga0501318_019601 | |||
| 4062 | Ga0501319_010169 | |||
| 4063 | Ga0501320_041643 | |||
| 4064 | Ga0501321_057297 | |||
| 4065 | Ga0501322_010682 | |||
| 4066 | Ga0501323_038698 | |||
| 4067 | Ga0501323_066488 | |||
| 4068 | Ga0501324_006319 | |||
| 4069 | Ga0501325_028288 | |||
| 4070 | Ga0501340_018923 | |||
| 4071 | Ga0501031_0001520 | |||
| 4072 | Ga0501031_0001758 | |||
| 4073 | Ga0501031_0005016 | |||
| 4074 | Ga0501031_0020667 | |||
| 4075 | Ga0501031_0032383 | |||
| 4076 | Ga0501031_0042680 | |||
| 4077 | Ga0501031_0101799 | |||
| 4078 | Ga0501031_0129984 | |||
| 4079 | Ga0501031_0332064 | |||
| 4080 | Ga0501032_0008150 | |||
| 4081 | Ga0501032_0009602 | |||
| 4082 | Ga0501032_0032281 | |||
| 4083 | Ga0501032_0057997 | |||
| 4084 | Ga0501032_0083003 | |||
| 4085 | Ga0501032_0096678 | |||
| 4086 | Ga0501032_0097421 | |||
| 4087 | Ga0501032_0188587 | |||
| 4088 | Ga0501032_0336681 | |||
| 4089 | Ga0501033_0004033 | |||
| 4090 | Ga0501033_0005389 | |||
| 4091 | Ga0501033_0032839 | |||
| 4092 | Ga0501033_0036941 | |||
| 4093 | Ga0501033_0045703 | |||
| 4094 | Ga0501033_0057628 | |||
| 4095 | Ga0501033_0061928 | |||
| 4096 | Ga0501033_0076409 | |||
| 4097 | Ga0501033_0620529 | |||
| 4098 | Ga0501033_0626025 | |||
| 4099 | Ga0501033_0683149 | |||
| 4100 | Ga0501034_0004686 | |||
| 4101 | Ga0501034_0010199 | |||
| 4102 | Ga0501034_0026116 | |||
| 4103 | Ga0501034_0028993 | |||
| 4104 | Ga0501034_0029673 | |||
| 4105 | Ga0501034_0087674 | |||
| 4106 | Ga0501034_0120148 | |||
| 4107 | Ga0501034_0147390 | |||
| 4108 | Ga0501034_0644284 | |||
| 4109 | Ga0501036_0001218 | |||
| 4110 | Ga0501036_0002529 | |||
| 4111 | Ga0501036_0008870 | |||
| 4112 | Ga0501036_0012043 | |||
| 4113 | Ga0501036_0035396 | |||
| 4114 | Ga0501036_0158590 | |||
| 4115 | Ga0501036_0167218 | |||
| 4116 | Ga0501036_0591824 | |||
| 4117 | Ga0501037_0001902 | |||
| 4118 | Ga0501037_0010995 | |||
| 4119 | Ga0501037_0018548 | |||
| 4120 | Ga0501037_0028718 | |||
| 4121 | Ga0501037_0058249 | |||
| 4122 | Ga0501037_0065314 | |||
| 4123 | Ga0501037_0070515 | |||
| 4124 | Ga0501037_0120552 | |||
| 4125 | Ga0501037_0384395 | |||
| 4126 | Ga0501037_0772692 | |||
| 4127 | Ga0501037_0987404 | |||
| 4128 | Ga0501038_0001782 | |||
| 4129 | Ga0501038_0006639 | |||
| 4130 | Ga0501038_0019013 | |||
| 4131 | Ga0501038_0019466 | |||
| 4132 | Ga0501038_0037045 | |||
| 4133 | Ga0501038_0058879 | |||
| 4134 | Ga0501038_0115696 | |||
| 4135 | Ga0501038_0187204 | |||
| 4136 | Ga0501038_0773577 | |||
| 4137 | Ga0501038_1041324 | |||
| 4138 | Ga0501039_0003824 | |||
| 4139 | Ga0501039_0007568 | |||
| 4140 | Ga0501039_0009657 | |||
| 4141 | Ga0501039_0010002 | |||
| 4142 | Ga0501039_0017425 | |||
| 4143 | Ga0501039_0022464 | |||
| 4144 | Ga0501039_0154128 | |||
| 4145 | Ga0501039_0279446 | |||
| 4146 | Ga0501039_0414711 | |||
| 4147 | Ga0501039_0797700 | |||
| 4148 | Ga0501040_0000579 | |||
| 4149 | Ga0501040_0006040 | |||
| 4150 | Ga0501040_0047011 | |||
| 4151 | Ga0501040_0049450 | |||
| 4152 | Ga0501040_0105028 | |||
| 4153 | Ga0501041_0001041 | |||
| 4154 | Ga0501041_0001449 | |||
| 4155 | Ga0501041_0035608 | |||
| 4156 | Ga0501041_0118468 | |||
| 4157 | Ga0501041_1101466 | |||
| 4158 | Ga0501042_0000607 | |||
| 4159 | Ga0501042_0007272 | |||
| 4160 | Ga0501042_0008352 | |||
| 4161 | Ga0501042_0013528 | |||
| 4162 | Ga0501042_0022365 | |||
| 4163 | Ga0501042_0106831 | |||
| 4164 | Ga0501042_0209058 | |||
| 4165 | Ga0501042_0248216 | |||
| 4166 | Ga0501042_0784358 | |||
| 4167 | Ga0501043_0003568 | |||
| 4168 | Ga0501043_0008028 | |||
| 4169 | Ga0501043_0011123 | |||
| 4170 | Ga0501043_0062277 | |||
| 4171 | Ga0501043_0067156 | |||
| 4172 | Ga0501043_0146826 | |||
| 4173 | Ga0501043_0185774 | |||
| 4174 | Ga0501043_0464413 | |||
| 4175 | Ga0501046_0000350 | |||
| 4176 | Ga0501046_0001971 | |||
| 4177 | Ga0501046_0006649 | |||
| 4178 | Ga0501046_0009788 | |||
| 4179 | Ga0501046_0269366 | |||
| 4180 | Ga0501047_0000082 | |||
| 4181 | Ga0501047_0027981 | |||
| 4182 | Ga0501047_0040432 | |||
| 4183 | Ga0501047_0043725 | |||
| 4184 | Ga0501047_0056039 | |||
| 4185 | Ga0501047_0174784 | |||
| 4186 | Ga0501047_0176285 | |||
| 4187 | Ga0501047_0846179 | |||
| 4188 | Ga0501048_0003167 | |||
| 4189 | Ga0501048_0025475 | |||
| 4190 | Ga0501048_0028799 | |||
| 4191 | Ga0501048_0114008 | |||
| 4192 | Ga0501067_0000588 | |||
| 4193 | Ga0501067_0006519 | |||
| 4194 | Ga0501067_0011450 | |||
| 4195 | Ga0501067_0129624 | |||
| 4196 | Ga0501067_0162598 | |||
| 4197 | Ga0501067_0289061 | |||
| 4198 | Ga0501067_0298539 | |||
| 4199 | Ga0501067_0341550 | |||
| 4200 | Ga0501068_0002952 | |||
| 4201 | Ga0501068_0005119 | |||
| 4202 | Ga0501068_0016559 | |||
| 4203 | Ga0501068_0029090 | |||
| 4204 | Ga0501068_0033245 | |||
| 4205 | Ga0501068_0403671 | |||
| 4206 | Ga0501069_0015331 | |||
| 4207 | Ga0501069_0039069 | |||
| 4208 | Ga0501069_0068075 | |||
| 4209 | Ga0501069_0162964 | |||
| 4210 | Ga0501069_0199757 | |||
| 4211 | Ga0501069_0300642 | |||
| 4212 | Ga0501069_0758572 | |||
| 4213 | Ga0501069_0855057 | |||
| 4214 | Ga0501070_0001374 | |||
| 4215 | Ga0501070_0001688 | |||
| 4216 | Ga0501070_0003396 | |||
| 4217 | Ga0501070_0004501 | |||
| 4218 | Ga0501070_0016792 | |||
| 4219 | Ga0501070_0062709 | |||
| 4220 | Ga0501070_0072239 | |||
| 4221 | Ga0501070_0168938 | |||
| 4222 | Ga0501070_0260878 | |||
| 4223 | Ga0501070_0369077 | |||
| 4224 | Ga0501070_0549610 | |||
| 4225 | Ga0501070_0811722 | |||
| 4226 | Ga0501070_1337098 | |||
| 4227 | Ga0501071_0005647 | |||
| 4228 | Ga0501071_0016929 | |||
| 4229 | Ga0501071_0032668 | |||
| 4230 | Ga0501071_0039679 | |||
| 4231 | Ga0501071_0051445 | |||
| 4232 | Ga0501071_0219565 | |||
| 4233 | Ga0501071_0490613 | |||
| 4234 | Ga0501072_0000270 | |||
| 4235 | Ga0501072_0005882 | |||
| 4236 | Ga0501072_0008909 | |||
| 4237 | Ga0501072_0020558 | |||
| 4238 | Ga0501072_0022030 | |||
| 4239 | Ga0501072_0400957 | |||
| 4240 | Ga0501073_0005761 | |||
| 4241 | Ga0501073_0026507 | |||
| 4242 | Ga0501073_0049763 | |||
| 4243 | Ga0501073_0195689 | |||
| 4244 | Ga0501073_0205868 | |||
| 4245 | Ga0501073_0212647 | |||
| 4246 | Ga0501073_0504434 | |||
| 4247 | Ga0501073_0576558 | |||
| 4248 | Ga0501073_0978170 | |||
| 4249 | Ga0501074_0000467 | |||
| 4250 | Ga0501074_0001013 | |||
| 4251 | Ga0501074_0004839 | |||
| 4252 | Ga0501074_0006802 | |||
| 4253 | Ga0501074_0022949 | |||
| 4254 | Ga0501074_0046101 | |||
| 4255 | Ga0501074_0065394 | |||
| 4256 | Ga0501074_0073103 | |||
| 4257 | Ga0501074_0095789 | |||
| 4258 | Ga0501074_0620009 | |||
| 4259 | Ga0501075_0000637 | |||
| 4260 | Ga0501075_0009333 | |||
| 4261 | Ga0501075_0023189 | |||
| 4262 | Ga0501076_0001351 | |||
| 4263 | Ga0501076_0003185 | |||
| 4264 | Ga0501076_0004713 | |||
| 4265 | Ga0501076_0100103 | |||
| 4266 | Ga0501076_0104276 | |||
| 4267 | Ga0501076_0776127 | |||
| 4268 | Ga0501077_0001343 | |||
| 4269 | Ga0501077_0001967 | |||
| 4270 | Ga0501077_0005313 | |||
| 4271 | Ga0501077_0006715 | |||
| 4272 | Ga0501077_0031918 | |||
| 4273 | Ga0501077_0033465 | |||
| 4274 | Ga0501077_0348454 | |||
| 4275 | Ga0501077_0362636 | |||
| 4276 | Ga0501223_115543 | |||
| 4277 | Ga0501079_0000101 | |||
| 4278 | Ga0501079_0000116 | |||
| 4279 | Ga0501079_0004539 | |||
| 4280 | Ga0501079_0032784 | |||
| 4281 | Ga0501079_0039279 | |||
| 4282 | Ga0501079_0116421 | |||
| 4283 | Ga0501079_0117223 | |||
| 4284 | Ga0501079_1209836 | |||
| 4285 | Ga0501080_0001308 | |||
| 4286 | Ga0501080_0005935 | |||
| 4287 | Ga0501080_0010008 | |||
| 4288 | Ga0501080_0022122 | |||
| 4289 | Ga0501080_0023020 | |||
| 4290 | Ga0501080_0046099 | |||
| 4291 | Ga0501080_0059335 | |||
| 4292 | Ga0501080_0078415 | |||
| 4293 | Ga0501080_0104595 | |||
| 4294 | Ga0501080_0157590 | |||
| 4295 | Ga0501081_0006102 | |||
| 4296 | Ga0501081_0011066 | |||
| 4297 | Ga0501081_0059195 | |||
| 4298 | Ga0501081_0800379 | |||
| 4299 | Ga0501081_0871279 | |||
| 4300 | Ga0501083_0017262 | |||
| 4301 | Ga0501083_0025869 | |||
| 4302 | Ga0501083_0049351 | |||
| 4303 | Ga0501083_0080653 | |||
| 4304 | Ga0501269_050554 | |||
| 4305 | Ga0501035_0001438 | |||
| 4306 | Ga0501035_0008434 | |||
| 4307 | Ga0501035_0019377 | |||
| 4308 | Ga0501035_0022376 | |||
| 4309 | Ga0501035_0037050 | |||
| 4310 | Ga0501035_0041418 | |||
| 4311 | Ga0501035_0077993 | |||
| 4312 | Ga0501035_0269160 | |||
| 4313 | Ga0501035_0321346 | |||
| 4314 | Ga0501035_0480666 | |||
| 4315 | Ga0501044_0004514 | |||
| 4316 | Ga0501044_0038471 | |||
| 4317 | Ga0501044_0040381 | |||
| 4318 | Ga0501044_0047320 | |||
| 4319 | Ga0501044_0048427 | |||
| 4320 | Ga0501044_0101227 | |||
| 4321 | Ga0501044_0133427 | |||
| 4322 | Ga0501044_0140994 | |||
| 4323 | Ga0501044_0203404 | |||
| 4324 | Ga0501044_0255597 | |||
| 4325 | Ga0501044_0283851 | |||
| 4326 | Ga0501044_0605989 | |||
| 4327 | Ga0501044_0824696 | |||
| 4328 | Ga0501044_1211710 | |||
| 4329 | Ga0501045_0001819 | |||
| 4330 | Ga0501045_0005729 | |||
| 4331 | Ga0501045_0024980 | |||
| 4332 | Ga0501045_0111857 | |||
| 4333 | Ga0501045_0160595 | |||
| 4334 | Ga0501045_0251326 | |||
| 4335 | Ga0501045_0346534 | |||
| 4336 | Ga0501045_0946683 | |||
| 4337 | nmdc:mga03n38_187029_c1 | |||
| 4338 | nmdc:mga03n38_310903_c1 | |||
| 4339 | nmdc:mga03n38_50941_c1 | |||
| 4340 | nmdc:mga00v17_119642_c1 | |||
| 4341 | nmdc:mga00v17_352928_c1 | |||
| 4342 | nmdc:mga00v17_548062_c1 | |||
| 4343 | nmdc:mga0yw44_11283_c1 | |||
| 4344 | nmdc:mga0yw44_123625_c1 | |||
| 4345 | nmdc:mga0yw44_175697_c1 | |||
| 4346 | nmdc:mga0yw44_684704_c1 | |||
| 4347 | nmdc:mga0yw44_818351_c1 | |||
| 4348 | nmdc:mga06z11_15925_c1 | |||
| 4349 | nmdc:mga06z11_19310_c1 | |||
| 4350 | nmdc:mga06z11_5215_c1 | |||
| 4351 | nmdc:mga04h51_465981_c1 | |||
| 4352 | nmdc:mga04h51_51127_c1 | |||
| 4353 | nmdc:mga04h51_62512_c1 | |||
| 4354 | nmdc:mga07m45_191974_c1 | |||
| 4355 | nmdc:mga07m45_87073_c1 | |||
| 4356 | nmdc:mga05p37_114478_c1 | |||
| 4357 | nmdc:mga05p37_6462_c1 | |||
| 4358 | nmdc:mga09592_10546_c1 | |||
| 4359 | nmdc:mga09592_499059_c1 | |||
| 4360 | nmdc:mga0qj67_257874_c1 | |||
| 4361 | nmdc:mga06r32_2732_c1 | |||
| 4362 | nmdc:mga08y16_12139_c1 | |||
| 4363 | nmdc:mga08y16_515666_c1 | |||
| 4364 | nmdc:mga08y16_699681_c1 | |||
| 4365 | nmdc:mga0n895_111117_c1 | |||
| 4366 | nmdc:mga0n895_174320_c1 | |||
| 4367 | nmdc:mga0n895_34608_c1 | |||
| 4368 | nmdc:mga0n895_904729_c1 | |||
| 4369 | nmdc:mga0rr50_1236835_c1 | |||
| 4370 | nmdc:mga0rr50_143507_c1 | |||
| 4371 | nmdc:mga0rr50_653046_c1 | |||
| 4372 | nmdc:mga08x19_300406_c1 | |||
| 4373 | nmdc:mga08x19_608140_c1 | |||
| 4374 | nmdc:mga0a205_159293_c1 | |||
| 4375 | nmdc:mga0a205_3754_c1 | |||
| 4376 | nmdc:mga0a205_568603_c1 | |||
| 4377 | Ga0495601_0007727 | |||
| 4378 | Ga0495601_0071684 | |||
| 4379 | Ga0495601_0098757 | |||
| 4380 | Ga0495601_0330064 | |||
| 4381 | Ga0495601_0827590 | |||
| 4382 | Ga0495612_0003458 | |||
| 4383 | Ga0495612_0007651 | |||
| 4384 | Ga0495612_0085043 | |||
| 4385 | Ga0495612_0147651 | |||
| 4386 | Ga0500610_0035252 | |||
| 4387 | Ga0500610_0080827 | |||
| 4388 | Ga0495655_0001784 | |||
| 4389 | Ga0495655_0012525 | |||
| 4390 | Ga0495655_0045842 | |||
| 4391 | Ga0495595_0007432 | |||
| 4392 | Ga0495595_0009129 | |||
| 4393 | Ga0495619_0010762 | |||
| 4394 | Ga0495619_0011748 | |||
| 4395 | Ga0495619_0030603 | |||
| 4396 | Ga0495619_0042518 | |||
| 4397 | Ga0495619_0120465 | |||
| 4398 | Ga0495619_0452760 | |||
| 4399 | Ga0500578_0006859 | |||
| 4400 | Ga0500578_0126045 | |||
| 4401 | Ga0500647_0110949 | |||
| 4402 | Ga0500583_0038758 | |||
| 4403 | Ga0500583_0061881 | |||
| 4404 | Ga0500566_0136760 | |||
| 4405 | Ga0500566_0515526 | |||
| 4406 | Ga0500640_109154 | |||
| 4407 | Ga0500641_0135438 | |||
| 4408 | Ga0500650_0054083 | |||
| 4409 | Ga0500654_039757 | |||
| 4410 | Ga0500660_096080 | |||
| 4411 | Ga0500553_031442 | |||
| 4412 | Ga0500558_032856 | |||
| 4413 | Ga0500560_004604 | |||
| 4414 | Ga0500560_072902 | |||
| 4415 | Ga0500569_004849 | |||
| 4416 | Ga0500582_113048 | |||
| 4417 | Ga0500614_012437 | |||
| 4418 | Ga0500614_038919 | |||
| 4419 | Ga0500621_062680 | |||
| 4420 | Ga0500628_000565 | |||
| 4421 | Ga0500628_242801 | |||
| 4422 | Ga0500652_000224 | |||
| 4423 | Ga0500652_339740 | |||
| 4424 | Ga0500658_0005753 | |||
| 4425 | Ga0500559_0239480 | |||
| 4426 | Ga0500561_0000306 | |||
| 4427 | Ga0500564_116365 | |||
| 4428 | Ga0500573_0064876 | |||
| 4429 | Ga0500573_0077749 | |||
| 4430 | Ga0500573_0174440 | |||
| 4431 | Ga0500573_0237534 | |||
| 4432 | Ga0500577_0336053 | |||
| 4433 | Ga0500579_073305 | |||
| 4434 | Ga0500586_049792 | |||
| 4435 | Ga0500586_170856 | |||
| 4436 | Ga0500590_257113 | |||
| 4437 | Ga0500600_0023373 | |||
| 4438 | Ga0500600_0061947 | |||
| 4439 | Ga0500600_0252445 | |||
| 4440 | Ga0500603_052203 | |||
| 4441 | Ga0500624_004048 | |||
| 4442 | Ga0500627_0259645 | |||
| 4443 | Ga0500633_0002695 | |||
| 4444 | Ga0500633_0025173 | |||
| 4445 | Ga0500634_0001104 | |||
| 4446 | Ga0500634_0135673 | |||
| 4447 | Ga0500636_0076304 | |||
| 4448 | Ga0500656_000394 | |||
| 4449 | Ga0500587_005298 | |||
| 4450 | Ga0501084_0003000 | |||
| 4451 | Ga0501084_0011286 | |||
| 4452 | Ga0501084_0012452 | |||
| 4453 | Ga0501084_0054298 | |||
| 4454 | Ga0501084_0058996 | |||
| 4455 | Ga0501084_0063427 | |||
| 4456 | Ga0501084_0135656 | |||
| 4457 | Ga0501084_0260857 | |||
| 4458 | Ga0590071_007801 | |||
| 4459 | Ga0590077_012840 | |||
| 4460 | Ga0587084_056625 | |||
| 4461 | Ga0587084_071300 | |||
| 4462 | Ga0587093_037219 | |||
| 4463 | Ga0587093_071716 | |||
| 4464 | Ga0587066_135223 | |||
| 4465 | Ga0587066_204050 | |||
| 4466 | Ga0587070_042295 | |||
| 4467 | Ga0587070_077693 | |||
| 4468 | Ga0587070_148926 | |||
| 4469 | Ga0587073_0036373 | |||
| 4470 | Ga0587077_059551 | |||
| 4471 | Ga0587077_064803 | |||
| 4472 | Ga0587080_123904 | |||
| 4473 | Ga0587082_015224 | |||
| 4474 | Ga0587082_084420 | |||
| 4475 | Ga0587082_128972 | |||
| 4476 | Ga0587083_0062786 | |||
| 4477 | Ga0587083_0138073 | |||
| 4478 | Ga0587086_060008 | |||
| 4479 | Ga0587086_100781 | |||
| 4480 | Ga0587086_117062 | |||
| 4481 | Ga0587088_029323 | |||
| 4482 | Ga0587088_079551 | |||
| 4483 | Ga0587088_083515 | |||
| 4484 | Ga0587089_030881 | |||
| 4485 | Ga0587089_045871 | |||
| 4486 | Ga0587089_097698 | |||
| 4487 | Ga0587090_061073 | |||
| 4488 | Ga0587090_118392 | |||
| 4489 | Ga0587090_147523 | |||
| 4490 | Ga0587091_033717 | |||
| 4491 | Ga0587091_195216 | |||
| 4492 | Ga0587092_064880 | |||
| 4493 | Ga0587094_039699 | |||
| 4494 | Ga0587094_092102 | |||
| 4495 | Ga0587095_013316 | |||
| 4496 | Ga0587095_040725 | |||
| 4497 | Ga0587098_009513 | |||
| 4498 | Ga0587098_039147 | |||
| 4499 | Ga0587106_011775 | |||
| 4500 | Ga0587106_162451 | |||
| 4501 | Ga0587121_12050 | |||
| 4502 | Ga0587129_011998 | |||
| 4503 | Ga0587101_062885 | |||
| 4504 | Ga0587109_040369 | |||
| 4505 | Ga0587115_118606 | |||
| 4506 | Ga0587117_082174 | |||
| 4507 | Ga0587117_105524 | |||
| 4508 | Ga0587122_004238 | |||
| 4509 | Ga0587122_037222 | |||
| 4510 | Ga0587127_015289 | |||
| 4511 | Ga0587127_026249 | |||
| 4512 | Ga0587128_013352 | |||
| 4513 | Ga0587128_072532 | |||
| 4514 | Ga0587062_009549 | |||
| 4515 | Ga0587062_123093 | |||
| 4516 | Ga0587067_075859 | |||
| 4517 | Ga0587068_037729 | |||
| 4518 | Ga0587068_146291 | |||
| 4519 | Ga0587069_045982 | |||
| 4520 | Ga0587069_063928 | |||
| 4521 | Ga0587072_171877 | |||
| 4522 | Ga0587075_093364 | |||
| 4523 | Ga0587075_097888 | |||
| 4524 | Ga0587076_084261 | |||
| 4525 | Ga0587076_106021 | |||
| 4526 | Ga0587076_128661 | |||
| 4527 | Ga0587076_133428 | |||
| 4528 | Ga0587076_146340 | |||
| 4529 | Ga0587078_057959 | |||
| 4530 | Ga0587078_068196 | |||
| 4531 | Ga0587079_060167 | |||
| 4532 | Ga0587102_042439 | |||
| 4533 | Ga0587102_052357 | |||
| 4534 | Ga0587104_015797 | |||
| 4535 | Ga0587107_020713 | |||
| 4536 | Ga0587107_050157 | |||
| 4537 | Ga0587107_125916 | |||
| 4538 | Ga0587114_051133 | |||
| 4539 | Ga0587114_055588 | |||
| 4540 | Ga0587119_012126 | |||
| 4541 | Ga0587124_026868 | |||
| 4542 | Ga0587071_022032 | |||
| 4543 | Ga0587111_0061708 | |||
| 4544 | Ga0587111_0117750 | |||
| 4545 | Ga0501082_0003349 | |||
| 4546 | Ga0501082_0006289 | |||
| 4547 | Ga0501082_0018558 | |||
| 4548 | Ga0501082_0021714 | |||
| 4549 | Ga0501082_0032005 | |||
| 4550 | Ga0501082_0559591 | |||
| 4551 | Ga0466962_0001218 | |||
| 4552 | Ga0466962_0007976 | |||
| 4553 | Ga0466962_0069553 | |||
| 4554 | Ga0466962_0550558 | |||
| 4555 | Ga0530510_0000081 | |||
| 4556 | Ga0530510_0020052 | |||
| 4557 | Ga0530510_0031999 | |||
| 4558 | Ga0530510_0250432 | |||
| 4559 | 2508671868 | |||
| 4560 | 2517761262 | |||
| 4561 | 2547411593 | |||
| 4562 | 2585298024 | |||
| 4563 | 2585305216 | |||
| 4564 | 2585313016 | |||
| 4565 | 2616702926 | |||
| 4566 | 2616903681 | |||
| 4567 | 2643763442 | |||
| 4568 | 2643824834 | |||
| 4569 | 2643900706 | |||
| 4570 | 2643947580 | |||
| 4571 | 2644093270 | |||
| 4572 | 2644266014 | |||
| 4573 | 2644322881 | |||
| 4574 | 2644390287 | |||
| 4575 | 2644405073 | |||
| 4576 | 2644435272 | |||
| 4577 | 2644437523 | |||
| 4578 | 2644463690 | |||
| 4579 | 2644532615 | |||
| 4580 | 2644628067 | |||
| 4581 | 2671836728 | |||
| 4582 | 2676203290 | |||
| 4583 | 2686539328 | |||
| 4584 | 2689961976 | |||
| 4585 | 2689995916 | |||
| 4586 | 2710603702 | |||
| 4587 | 2740168484 | |||
| 4588 | 2774847866 | |||
| 4589 | 2774854884 | |||
| 4590 | 2784589360 | |||
| 4591 | 2785342239 | |||
| 4592 | 2785370414 | |||
| 4593 | 2786671585 | |||
| 4594 | 2793979198 | |||
| 4595 | 2808842986 | |||
| 4596 | 2808921338 | |||
| 4597 | 2809233020 | |||
| 4598 | 2811845414 | |||
| 4599 | 2812357134 | |||
| 4600 | 2812479776 | |||
| 4601 | 2819698223 | |||
| 4602 | 2819741936 | |||
| 4603 | 2837184624 | |||
| 4604 | 2852639985 | |||
| 4605 | 2855390079 | |||
| 4606 | 2862180131 | |||
| 4607 | 2862286582 | |||
| 4608 | 2862294564 | |||
| 4609 | 2862383697 | |||
| 4610 | 2862510219 | |||
| 4611 | 2862578497 | |||
| 4612 | 2863411924 | |||
| 4613 | 2867372886 | |||
| 4614 | 2867432713 | |||
| 4615 | 2867478289 | |||
| 4616 | 2873155032 | |||
| 4617 | 2875394741 | |||
| 4618 | 2877680192 | |||
| 4619 | 2895886600 | |||
| 4620 | 2912718773 | |||
| 4621 | 2912731123 | |||
| 4622 | 2912761787 | |||
| 4623 | 2918504675 | |||
| 4624 | 2919471411 | |||
| 4625 | 2935392749 | |||
| 4626 | 2946049064 | |||
| 4627 | 2946068743 | |||
| 4628 | 2946076745 | |||
| 4629 | 2947228165 | |||
| 4630 | 2954006208 | |||
| 4631 | 2954385180 | |||
| 4632 | 2954677869 | |||
| 4633 | 2954686287 | |||
| 4634 | 2954695964 | |||
| 4635 | 2954711135 | |||
| 4636 | 2954715371 | |||
| 4637 | 2954725291 | |||
| 4638 | 2954736524 | |||
| 4639 | 2954744225 | |||
| 4640 | 2954755353 | |||
| 4641 | 2954763190 | |||
| 4642 | 2966602426 | |||
| 4643 | 2984578698 | |||
| 4644 | 2990068047 | |||
| 4645 | 2990090966 | |||
| 4646 | 2990260718 | |||
| 4647 | 2995471390 | |||
| 4648 | 2997454359 | |||
| 4649 | 2997600158 | |||
| 4650 | 3003006230 | |||
| 4651 | 3006325245 | |||
| 4652 | 3006398051 | |||
| 4653 | 3006486800 | |||
| 4654 | 3006500301 | |||
| 4655 | 8002784314 | |||
| 4656 | 8008566142 | |||
| 4657 | 8008578109 | |||
| 4658 | 8023629597 | |||
| 4659 | 8025479461 | |||
| 4660 | 8025538206 | |||
| 4661 | 8033686068 | |||
| 4662 | 8047897812 | |||
| 4663 | 8048361059 | |||
| 4664 | 8048374798 | |||
| 4665 | 8048383424 | |||
| 4666 | 8048410125 | |||
| 4667 | 8054161279 | |||
| 4668 | 8054614154 | |||
| 4669 | 8056669145 | |||
| 4670 | 8056833183 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f43-assembly1.cif.gz_A-2 | crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution | 0.9531 | 5 | 109 |
| 4qtp-assembly3.cif.gz_C | crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis | 0.9444 | 1 | 109 |
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.939 | 2 | 109 |
| 6m36-assembly1.cif.gz_F | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.936 | 2 | 99 |
| 1til-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii | 0.9344 | 2 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qtpB00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9457 | 2 | 109 | 3.30.750.24 |
| 3f43A01 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9374 | 8 | 109 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9278 | 3 | 109 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.913 | 1 | 105 | 3.30.750.24 |
| af_I1KV89_512_657_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9014 | 8 | 110 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838E4J6-F1-model_v4 | Anti-sigma factor antagonist | 1.003 | 1 | 109 |
GO:0043856
|
| AF-A0A4R2IXC1-F1-model_v4 | Anti-sigma factor antagonist | 1.003 | 1 | 108 |
GO:0043856
|
| AF-A0A1I3DT39-F1-model_v4 | Anti-sigma factor antagonist | 0.9998 | 1 | 110 |
GO:0043856
|
| AF-A0A367FCX8-F1-model_v4 | Anti-sigma factor antagonist | 0.9988 | 1 | 109 |
GO:0043856
|
| AF-A0A6N7I5W0-F1-model_v4 | Anti-sigma factor antagonist | 0.9985 | 1 | 109 |
GO:0043856
|