F496638

General Info

Members Datasets Scaffolds Average Seq Length
2282 839 2170 119

Family's Representative Sequence

Representative Sequence 3300047447|Ga0495685_117472|Ga0495685_117472_251_607
Length 118
Sequence MPRVKRGVTARAAHKKVIARAKGFRGRRNNVFRVANEAVMRAGQYAYRDRNKKRDFRSLWITRINAAVREHGLSYSVFMNGLKKAAITVDRKVLADIAVMDKPAFTKFVEKAKASLGV

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
11 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
12 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
13 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
14 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
15 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
16 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
17 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
18 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
19 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
20 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
21 2519103095 Burkholderia sp. KJ006 Isolate Nodule
22 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
23 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
24 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
25 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
26 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
27 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
28 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
29 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
30 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
31 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
32 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
33 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
34 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
35 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
36 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
37 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
38 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
39 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
40 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
41 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
42 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
43 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
44 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
45 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
46 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
47 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
48 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
49 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
50 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
51 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
52 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
53 2818991450 Burkholderia sp. 604 Isolate Unclassified
54 2818991452 Burkholderia cepacia 561 Isolate Unclassified
55 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
56 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
57 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
58 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
59 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
60 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
61 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
62 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
63 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
64 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
65 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
66 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
67 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
68 2885266251 Ralstonia sp. SET104 Isolate Nodule
69 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
70 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
71 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
72 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
73 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
74 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
75 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
76 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
77 2904564687 Burkholderia sp. 571 Isolate Unclassified
78 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
79 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
80 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
81 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
82 2928058823 Ralstonia sp. 1138 Isolate Unclassified
83 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
84 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
85 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
86 2928163908 Burkholderia sp. 567 Isolate Unclassified
87 2928170801 Burkholderia sp. 572 Isolate Unclassified
88 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
89 2928536128 Burkholderia sola 565 Isolate Unclassified
90 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
91 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
92 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
93 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
94 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
95 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
96 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
97 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
98 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
99 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
100 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
101 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
102 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
103 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
104 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
105 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
106 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
107 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
108 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
109 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
110 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
111 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
112 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
113 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
114 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
115 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
116 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
117 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
118 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
119 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
120 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
121 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
122 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
123 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
124 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
125 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
126 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
128 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
129 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
130 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
131 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
134 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
135 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
136 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
137 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
138 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
139 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
140 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
141 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
142 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
143 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
146 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
148 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
149 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
150 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
151 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
152 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
153 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
154 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
155 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
156 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
157 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
158 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
159 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
160 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
161 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
162 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
163 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
164 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
165 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
166 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
167 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
168 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
169 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
170 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
171 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
172 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
173 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
174 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
175 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
176 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
177 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
178 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
179 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
180 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
181 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
182 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
183 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
184 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
185 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
186 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
187 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
188 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
189 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
190 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
191 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
192 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
193 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
194 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
195 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
196 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
197 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
198 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
199 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
200 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
201 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
202 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
203 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
204 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
205 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
206 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
207 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
208 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
209 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
210 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
211 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
212 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
213 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
214 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
215 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
216 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
217 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
218 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
219 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
220 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
221 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
222 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
223 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
224 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
225 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
226 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
227 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
228 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
229 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
230 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
231 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
232 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
233 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
234 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
235 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
236 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
237 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
238 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
239 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
240 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
241 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
242 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
243 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
244 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
245 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
246 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
247 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
248 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
249 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
250 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
251 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
252 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
253 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
254 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
255 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
256 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
257 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
258 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
259 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
260 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
261 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
262 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
263 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
267 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
268 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
269 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
270 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
271 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
275 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
276 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
277 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
278 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
279 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
280 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
281 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
282 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
283 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
284 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
285 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
286 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
287 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
288 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
289 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
290 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
291 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
292 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
298 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
300 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
301 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
302 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
303 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
304 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
305 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
306 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
308 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
309 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
310 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
311 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
313 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
314 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
321 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
322 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
324 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
325 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
328 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
329 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
333 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
335 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
336 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
337 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
406 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
407 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
412 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
413 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
414 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
415 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
416 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
418 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
420 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
424 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
425 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
426 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
435 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
436 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
437 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
438 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
439 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
440 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
441 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
442 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
443 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
444 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
445 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
446 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
447 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
448 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
449 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
450 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
451 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
452 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
453 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
454 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
455 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
456 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
457 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
458 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
460 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
461 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
462 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
463 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
464 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
465 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
466 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
467 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
468 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
469 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
470 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
471 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
472 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
474 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
480 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
481 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
482 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
483 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
484 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
485 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
486 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
487 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
488 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
489 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
490 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
491 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
492 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
493 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
494 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
495 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
496 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
497 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
498 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
499 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
500 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
501 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
502 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
503 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
504 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
505 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
506 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
507 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
508 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
509 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
510 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
511 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
512 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
513 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
514 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
515 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
516 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
517 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
518 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
519 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
520 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
521 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
522 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
523 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
524 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
525 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
526 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
527 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
528 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
529 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
530 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
531 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
532 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
533 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
534 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
535 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
536 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
537 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
538 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
539 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
540 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
541 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
542 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
543 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
544 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
545 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
546 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
547 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
548 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
549 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
550 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
551 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
552 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
553 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
554 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
555 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
556 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
557 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
558 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
559 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
560 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
561 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
562 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
563 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
564 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
565 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
566 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
567 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
568 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
569 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
570 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
571 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
572 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
573 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
574 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
575 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
576 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
577 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
578 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
579 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
580 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
581 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
582 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
583 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
584 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
585 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
586 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
587 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
588 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
589 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
590 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
591 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
592 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
593 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
594 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
595 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
596 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
597 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
598 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
599 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
600 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
601 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
602 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
603 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
604 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
605 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
606 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
607 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
608 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
609 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
610 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
611 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
612 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
613 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
614 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
615 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
616 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
617 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
618 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
619 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
620 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
621 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
622 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
623 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
624 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
625 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
626 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
627 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
628 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
629 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
630 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
631 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
632 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
633 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
634 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
635 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
636 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
637 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
638 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
639 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
640 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
641 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
642 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
643 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
644 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
645 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
646 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
647 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
648 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
649 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
650 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
651 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
652 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
653 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
654 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
655 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
656 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
657 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
658 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
659 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
660 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
661 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
662 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
663 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
664 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
665 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
666 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
667 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
668 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
669 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
670 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
671 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
672 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
673 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
674 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
675 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
676 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
677 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
678 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
679 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
680 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
681 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
682 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
683 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
684 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
685 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
698 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
699 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
700 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
701 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
702 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
703 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
704 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
705 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
706 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
707 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
708 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
709 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
710 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
711 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
712 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
713 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
714 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
715 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
716 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
717 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
718 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
719 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
720 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
721 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
722 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
723 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
724 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
725 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
726 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
727 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
728 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
729 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
730 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
731 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
732 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
733 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
734 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
735 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
736 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
737 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
738 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
739 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
740 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
741 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
742 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
743 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
744 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
745 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
746 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
747 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
748 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
749 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
750 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
751 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
752 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
753 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
754 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
755 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
756 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
757 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
758 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
759 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
760 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
761 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
762 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
763 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
764 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
765 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
766 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
767 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
768 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
769 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
770 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
771 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
772 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
773 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
774 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
775 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
776 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
779 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
780 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
781 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
782 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
783 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
784 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
785 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
786 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
787 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
788 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
789 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
790 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
801 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
802 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
808 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
809 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
810 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
811 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
812 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
813 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
814 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
815 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
816 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
817 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
818 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
819 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
820 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
821 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
822 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
823 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
824 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
825 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
826 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
827 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
828 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
829 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
830 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
831 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
832 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
833 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
834 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
835 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
836 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
837 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
838 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
839 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.73
Metatranscriptomes 12.36
Isolates 4.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 1.23
Rhizoplane 4.65
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_467817 2162886011 Bacteria 1183
2 JGI24736J21556_1003566 3300001904 Bacteria 2691
3 JGI24736J21556_1016467 3300001904 Bacteria 1177
4 JGI24741J21665_1000265 3300001915 Bacteria 15670
5 JGI24741J21665_1018410 3300001915 Bacteria 1117
6 JGI24740J21852_10003024 3300001979 Bacteria 7445
7 JGI24740J21852_10004294 3300001979 Bacteria 6142
8 JGI24740J21852_10007396 3300001979 Bacteria 4468
9 JGI24735J21928_10001419 3300002067 Bacteria 8468
10 JGI24738J21930_10011781 3300002075 Bacteria 1918
11 JGI25155J39150_1000149 3300002704 Bacteria 31771
12 JGI25156J39149_1000321 3300002705 Bacteria 31772
13 JGI25156J39149_1002382 3300002705 Bacteria 6800
14 JGI25156J39149_1002718 3300002705 Bacteria 6172
15 JGI25156J39149_1017429 3300002705 Bacteria 1360
16 JGI25162J39368_1003830 3300002737 Bacteria 3962
17 JGI25154J39366_1000270 3300002738 Bacteria 32293
18 JGI25157J39369_1000205 3300002741 Bacteria 49460
19 JGI25157J39369_1018354 3300002741 Bacteria 844
20 JGI25164J39214_1005100 3300002772 Bacteria 1448
21 Ga0006778J45830_1021150 3300003162 Bacteria 794
22 Ga0006759J45824_1010099 3300003163 Bacteria 3819
23 JGI25165J46597_1003371 3300003214 Bacteria 4036
24 Ga0007428J48920_103116 3300003288 Bacteria 875
25 Ga0006758J48902_1007842 3300003300 Bacteria 1485
26 Ga0006770J48903_1012120 3300003305 Bacteria 859
27 Ga0006770J48903_1020897 3300003305 Bacteria 1443
28 Ga0006777J48905_1011266 3300003308 Bacteria 782
29 Ga0006777J48905_1013693 3300003308 Bacteria 1348
30 rootH1_10054210 3300003316 Bacteria 1588
31 rootL2_10013520 3300003322 Bacteria 1502
32 rootL2_10049225 3300003322 Bacteria 4218
33 rootL2_10096027 3300003322 Bacteria 1158
34 JGI26137J50245_101350 3300003396 Bacteria 755
35 Ga0006556J51387_1012483 3300003479 Bacteria 2184
36 Ga0006556J51387_1015829 3300003479 Bacteria 1907
37 Ga0007417J51691_1005144 3300003544 Bacteria 4400
38 Ga0006558J51389_1015687 3300003558 Bacteria 1639
39 Ga0006558J51389_1024460 3300003558 Bacteria 774
40 Ga0007427J51700_107497 3300003559 Bacteria 807
41 Ga0006560J51390_1007918 3300003565 Bacteria 2302
42 Ga0006560J51390_1017913 3300003565 Bacteria 975
43 Ga0006554J51385_1014354 3300003567 Bacteria 2019
44 Ga0007410J51695_1004741 3300003574 Bacteria 4687
45 Ga0007410J51695_1010533 3300003574 Bacteria 985
46 Ga0007410J51695_1022044 3300003574 Bacteria 764
47 Ga0007409J51694_1003076 3300003575 Bacteria 9250
48 Ga0007409J51694_1020735 3300003575 Bacteria 732
49 Ga0007416J51690_1004660 3300003577 Bacteria 7300
50 Ga0007429J51699_1011665 3300003579 Bacteria 1500
51 Ga0007411J51799_103552 3300003611 Bacteria 2271
52 Ga0032354_1015078 3300003693 Bacteria 1712
53 Ga0032354_1028937 3300003693 Bacteria 6099
54 Ga0006780_1002600 3300003735 Bacteria 870
55 Ga0055538_1001885 3300003751 Bacteria 3510
56 Ga0055539_1000061 3300003752 Bacteria 144457
57 Ga0055533_1001925 3300003756 Bacteria 5121
58 Ga0055533_1003319 3300003756 Bacteria 3274
59 Ga0055532_1000016 3300003758 Bacteria 327509
60 Ga0055532_1000042 3300003758 Bacteria 195195
61 Ga0055532_1000063 3300003758 Bacteria 147140
62 Ga0055532_1025047 3300003758 Bacteria 590
63 Ga0055525_1000476 3300003759 Bacteria 21836
64 Ga0055525_1010446 3300003759 Bacteria 783
65 Ga0055527_1000049 3300003760 Bacteria 105168
66 Ga0055527_1001614 3300003760 Bacteria 4517
67 Ga0055527_1004436 3300003760 Bacteria 1929
68 Ga0055535_1000031 3300003761 Bacteria 195195
69 Ga0055535_1000042 3300003761 Bacteria 147140
70 Ga0055535_1015444 3300003761 Bacteria 1069
71 Ga0055535_1028021 3300003761 Bacteria 610
72 Ga0055542_1000071 3300003762 Bacteria 147140
73 Ga0055542_1000412 3300003762 Bacteria 41756
74 Ga0055542_1018476 3300003762 Bacteria 1056
75 Ga0055529_1000075 3300003763 Bacteria 156291
76 Ga0055529_1000081 3300003763 Bacteria 147140
77 Ga0055529_1000098 3300003763 Bacteria 131900
78 Ga0055529_1001660 3300003763 Bacteria 5839
79 Ga0055526_1002009 3300003771 Bacteria 14004
80 Ga0055526_1043174 3300003771 Bacteria 1101
81 Ga0055537_1012165 3300003773 Bacteria 1693
82 Ga0055524_1000003 3300003775 Bacteria 399748
83 Ga0055528_1000218 3300003790 Bacteria 48330
84 Ga0055528_1000672 3300003790 Bacteria 24748
85 Ga0055541_1002037 3300003841 Bacteria 4129
86 Ga0055541_1023053 3300003841 Bacteria 700
87 Ga0058692_1002973 3300003856 Bacteria 5443
88 Ga0058692_1037743 3300003856 Bacteria 865
89 Ga0058863_10924078 3300004799 Bacteria 725
90 Ga0058863_11920116 3300004799 Bacteria 739
91 Ga0058861_10044791 3300004800 Bacteria 642
92 Ga0058861_10069241 3300004800 Bacteria 1419
93 Ga0058860_11440710 3300004801 Bacteria 718
94 Ga0058860_12096926 3300004801 Bacteria 528
95 Ga0058862_11883282 3300004803 Bacteria 590
96 Ga0058862_12801278 3300004803 Bacteria 570
97 Ga0058862_12836520 3300004803 Bacteria 941
98 Ga0065165_1000454 3300005262 Bacteria 64290
99 Ga0065165_1000487 3300005262 Bacteria 61345
100 Ga0065704_10748319 3300005289 Bacteria 543
101 Ga0065712_10137144 3300005290 Bacteria 1486
102 Ga0065712_10201792 3300005290 Bacteria 1105
103 Ga0065712_10529793 3300005290 Bacteria 630
104 Ga0065715_10011615 3300005293 Bacteria 2234
105 Ga0065715_10219956 3300005293 Bacteria 1265
106 Ga0065715_10648615 3300005293 Bacteria 680
107 Ga0065707_10192844 3300005295 Bacteria 1351
108 Ga0070658_10013202 3300005327 Bacteria 6626
109 Ga0070658_10018764 3300005327 Bacteria 5541
110 Ga0070658_10130145 3300005327 Bacteria 2097
111 Ga0070658_10246418 3300005327 Bacteria 1515
112 Ga0070658_10789240 3300005327 Bacteria 825
113 Ga0070658_11196902 3300005327 Bacteria 660
114 Ga0070676_10018449 3300005328 Bacteria 3867
115 Ga0070676_10179195 3300005328 Bacteria 1376
116 Ga0070676_10308274 3300005328 Bacteria 1075
117 Ga0070676_10836570 3300005328 Bacteria 681
118 Ga0070683_100080133 3300005329 Bacteria 3056
119 Ga0070683_100248341 3300005329 Bacteria 1692
120 Ga0070683_100423692 3300005329 Bacteria 1270
121 Ga0070690_100242253 3300005330 Bacteria 1272
122 Ga0070690_100421197 3300005330 Bacteria 984
123 Ga0070670_100096271 3300005331 Bacteria 2546
124 Ga0070670_100171970 3300005331 Bacteria 1879
125 Ga0070670_100192782 3300005331 Bacteria 1770
126 Ga0070670_100340681 3300005331 Bacteria 1316
127 Ga0070670_100463187 3300005331 Bacteria 1124
128 Ga0070670_100608948 3300005331 Bacteria 978
129 Ga0070670_100680007 3300005331 Bacteria 924
130 Ga0070677_10003837 3300005333 Bacteria 4870
131 Ga0070677_10006533 3300005333 Bacteria 3876
132 Ga0070677_10482703 3300005333 Bacteria 669
133 Ga0068869_100054417 3300005334 Bacteria 2913
134 Ga0068869_100184739 3300005334 Bacteria 1636
135 Ga0068869_100584133 3300005334 Bacteria 942
136 Ga0068869_100599516 3300005334 Bacteria 930
137 Ga0070666_10040086 3300005335 Bacteria 3125
138 Ga0070666_10051062 3300005335 Bacteria 2783
139 Ga0070680_100072484 3300005336 Bacteria 2831
140 Ga0070680_101288800 3300005336 Bacteria 632
141 Ga0070680_101643775 3300005336 Bacteria 557
142 Ga0070682_100056080 3300005337 Bacteria 2477
143 Ga0070682_100075283 3300005337 Bacteria 2170
144 Ga0070682_100133901 3300005337 Bacteria 1681
145 Ga0070682_100285571 3300005337 Bacteria 1205
146 Ga0070682_100955056 3300005337 Bacteria 708
147 Ga0068868_100090724 3300005338 Bacteria 2461
148 Ga0070660_100000238 3300005339 Bacteria 36637
149 Ga0070660_100000440 3300005339 Bacteria 27590
150 Ga0070660_100031270 3300005339 Bacteria 3997
151 Ga0070660_100035410 3300005339 Bacteria 3779
152 Ga0070660_100074378 3300005339 Bacteria 2658
153 Ga0070660_100190589 3300005339 Bacteria 1661
154 Ga0070660_100321255 3300005339 Bacteria 1272
155 Ga0070660_100529385 3300005339 Bacteria 982
156 Ga0070689_100088834 3300005340 Bacteria 2434
157 Ga0070689_100689973 3300005340 Bacteria 891
158 Ga0070691_10073539 3300005341 Bacteria 1662
159 Ga0070691_10308287 3300005341 Bacteria 867
160 Ga0070691_10694881 3300005341 Bacteria 610
161 Ga0070687_100076176 3300005343 Bacteria 1816
162 Ga0070661_100000572 3300005344 Bacteria 27977
163 Ga0070661_100000624 3300005344 Bacteria 26327
164 Ga0070661_100005857 3300005344 Bacteria 8451
165 Ga0070661_100026549 3300005344 Bacteria 4165
166 Ga0070661_100191367 3300005344 Bacteria 1560
167 Ga0070661_100254695 3300005344 Bacteria 1355
168 Ga0070661_100255088 3300005344 Bacteria 1354
169 Ga0070661_100306200 3300005344 Bacteria 1238
170 Ga0070661_100611869 3300005344 Bacteria 882
171 Ga0070661_100853318 3300005344 Bacteria 750
172 Ga0070661_101806077 3300005344 Bacteria 519
173 Ga0070692_10053704 3300005345 Bacteria 2102
174 Ga0070668_100016025 3300005347 Bacteria 5606
175 Ga0070668_100105436 3300005347 Bacteria 2238
176 Ga0070668_100281693 3300005347 Bacteria 1388
177 Ga0070668_100487652 3300005347 Bacteria 1065
178 Ga0070668_100712266 3300005347 Bacteria 886
179 Ga0070668_101342748 3300005347 Bacteria 651
180 Ga0070669_100285938 3300005353 Bacteria 1322
181 Ga0070669_100307051 3300005353 Bacteria 1277
182 Ga0070669_100330454 3300005353 Bacteria 1233
183 Ga0070675_100032138 3300005354 Bacteria 4245
184 Ga0070675_100069736 3300005354 Bacteria 2913
185 Ga0070675_100471619 3300005354 Bacteria 1128
186 Ga0070675_100529707 3300005354 Bacteria 1064
187 Ga0070675_100668516 3300005354 Bacteria 945
188 Ga0070675_102245919 3300005354 Bacteria 502
189 Ga0070671_100012952 3300005355 Bacteria 6720
190 Ga0070671_100028499 3300005355 Bacteria 4598
191 Ga0070671_100139086 3300005355 Bacteria 2048
192 Ga0070671_100214589 3300005355 Bacteria 1633
193 Ga0070671_100355745 3300005355 Bacteria 1250
194 Ga0070671_100375011 3300005355 Bacteria 1215
195 Ga0070671_100698316 3300005355 Bacteria 880
196 Ga0070671_101781463 3300005355 Bacteria 547
197 Ga0070674_100037697 3300005356 Bacteria 3253
198 Ga0070674_100215346 3300005356 Bacteria 1491
199 Ga0070673_100005235 3300005364 Bacteria 8278
200 Ga0070673_100206114 3300005364 Bacteria 1695
201 Ga0070673_101072588 3300005364 Bacteria 752
202 Ga0070673_101389910 3300005364 Bacteria 660
203 Ga0070673_101647078 3300005364 Bacteria 607
204 Ga0070659_100000423 3300005366 Bacteria 32124
205 Ga0070659_100000492 3300005366 Bacteria 29021
206 Ga0070659_100017007 3300005366 Bacteria 5467
207 Ga0070659_100049966 3300005366 Bacteria 3289
208 Ga0070659_100068749 3300005366 Bacteria 2810
209 Ga0070659_100097070 3300005366 Bacteria 2368
210 Ga0070659_100135433 3300005366 Bacteria 2003
211 Ga0070659_101182187 3300005366 Bacteria 676
212 Ga0070667_100219833 3300005367 Bacteria 1691
213 Ga0070667_100243080 3300005367 Bacteria 1608
214 Ga0070667_100414244 3300005367 Bacteria 1228
215 Ga0070667_100429326 3300005367 Bacteria 1205
216 Ga0070667_100857148 3300005367 Bacteria 845
217 Ga0070703_10006032 3300005406 Bacteria 3392
218 Ga0070703_10314245 3300005406 Bacteria 657
219 Ga0070709_10164147 3300005434 Bacteria 1547
220 Ga0070709_10495669 3300005434 Bacteria 927
221 Ga0070709_10754522 3300005434 Bacteria 761
222 Ga0070709_11220539 3300005434 Bacteria 605
223 Ga0070714_100003989 3300005435 Bacteria 11096
224 Ga0070714_101918261 3300005435 Bacteria 578
225 Ga0070713_100000144 3300005436 Bacteria 47379
226 Ga0070713_100188977 3300005436 Bacteria 1855
227 Ga0070713_100603383 3300005436 Bacteria 1043
228 Ga0070710_11018623 3300005437 Bacteria 604
229 Ga0070710_11297854 3300005437 Bacteria 541
230 Ga0070701_10017385 3300005438 Bacteria 3360
231 Ga0070701_11101119 3300005438 Bacteria 559
232 Ga0070701_11237647 3300005438 Bacteria 531
233 Ga0070705_100000110 3300005440 Bacteria 46763
234 Ga0070705_100395264 3300005440 Bacteria 1022
235 Ga0070705_101433742 3300005440 Bacteria 576
236 Ga0070700_100092259 3300005441 Bacteria 1979
237 Ga0070700_100098065 3300005441 Bacteria 1926
238 Ga0070700_100144405 3300005441 Bacteria 1620
239 Ga0070700_100329461 3300005441 Bacteria 1125
240 Ga0070700_100502171 3300005441 Bacteria 933
241 Ga0070694_100000271 3300005444 Bacteria 27422
242 Ga0070694_100256855 3300005444 Bacteria 1324
243 Ga0070694_100311945 3300005444 Bacteria 1208
244 Ga0070694_100360961 3300005444 Bacteria 1128
245 Ga0070708_100000385 3300005445 Bacteria 33275
246 Ga0070708_100006092 3300005445 Bacteria 9596
247 Ga0070708_100121566 3300005445 Bacteria 2409
248 Ga0070708_100947409 3300005445 Bacteria 808
249 Ga0070663_100000044 3300005455 Bacteria 57555
250 Ga0070663_100001435 3300005455 Bacteria 13053
251 Ga0070663_100014542 3300005455 Bacteria 5054
252 Ga0070663_100050031 3300005455 Bacteria 2971
253 Ga0070663_100079926 3300005455 Bacteria 2400
254 Ga0070663_100164610 3300005455 Bacteria 1710
255 Ga0070663_100165808 3300005455 Bacteria 1704
256 Ga0070663_100241696 3300005455 Bacteria 1425
257 Ga0070663_100802592 3300005455 Bacteria 807
258 Ga0070663_100841942 3300005455 Bacteria 789
259 Ga0070663_101086953 3300005455 Bacteria 699
260 Ga0070678_100001698 3300005456 Bacteria 11817
261 Ga0070678_100507494 3300005456 Bacteria 1065
262 Ga0070678_100520178 3300005456 Bacteria 1052
263 Ga0070678_100686075 3300005456 Bacteria 922
264 Ga0070662_100000420 3300005457 Bacteria 25184
265 Ga0070662_100100767 3300005457 Bacteria 2185
266 Ga0070662_100139118 3300005457 Bacteria 1880
267 Ga0070662_100166056 3300005457 Bacteria 1730
268 Ga0070662_100191176 3300005457 Bacteria 1619
269 Ga0070662_100288310 3300005457 Bacteria 1330
270 Ga0070662_100299613 3300005457 Bacteria 1306
271 Ga0070662_100464594 3300005457 Bacteria 1052
272 Ga0070662_100587728 3300005457 Bacteria 936
273 Ga0070662_100612385 3300005457 Bacteria 916
274 Ga0070662_101378994 3300005457 Bacteria 607
275 Ga0070662_101713572 3300005457 Bacteria 543
276 Ga0070681_10008704 3300005458 Bacteria 9954
277 Ga0070681_10012957 3300005458 Bacteria 8281
278 Ga0070681_10013778 3300005458 Bacteria 8050
279 Ga0070681_10676554 3300005458 Bacteria 947
280 Ga0068867_100009596 3300005459 Bacteria 6824
281 Ga0068867_100063854 3300005459 Bacteria 2737
282 Ga0068867_100560265 3300005459 Bacteria 991
283 Ga0068867_100731659 3300005459 Bacteria 876
284 Ga0068867_101339770 3300005459 Bacteria 662
285 Ga0068867_101451168 3300005459 Bacteria 638
286 Ga0068867_101476285 3300005459 Bacteria 632
287 Ga0070685_10112916 3300005466 Bacteria 1676
288 Ga0070706_100123251 3300005467 Bacteria 2417
289 Ga0070706_100135690 3300005467 Bacteria 2297
290 Ga0070707_100023776 3300005468 Bacteria 5796
291 Ga0070707_100028238 3300005468 Bacteria 5338
292 Ga0070707_101513131 3300005468 Bacteria 638
293 Ga0070707_101691841 3300005468 Bacteria 600
294 Ga0070698_100085478 3300005471 Bacteria 3141
295 Ga0070698_100395086 3300005471 Bacteria 1316
296 Ga0070699_100000653 3300005518 Bacteria 32414
297 Ga0070699_100181509 3300005518 Bacteria 1868
298 Ga0070699_100644367 3300005518 Bacteria 967
299 Ga0070679_100142869 3300005530 Bacteria 2372
300 Ga0070679_100209056 3300005530 Bacteria 1916
301 Ga0070679_100223654 3300005530 Bacteria 1843
302 Ga0070684_100070650 3300005535 Bacteria 3073
303 Ga0070697_100000575 3300005536 Bacteria 27699
304 Ga0070697_100029000 3300005536 Bacteria 4435
305 Ga0070697_100052698 3300005536 Bacteria 3306
306 Ga0068853_100011147 3300005539 Bacteria 7293
307 Ga0068853_100104597 3300005539 Bacteria 2506
308 Ga0068853_100826933 3300005539 Bacteria 888
309 Ga0070672_100008415 3300005543 Bacteria 7052
310 Ga0070672_100208744 3300005543 Bacteria 1635
311 Ga0070672_100531386 3300005543 Bacteria 1020
312 Ga0070686_100025561 3300005544 Bacteria 3554
313 Ga0070686_100849609 3300005544 Bacteria 739
314 Ga0070695_100033916 3300005545 Bacteria 3195
315 Ga0070695_100171680 3300005545 Bacteria 1530
316 Ga0070695_100415629 3300005545 Bacteria 1023
317 Ga0070695_100515154 3300005545 Bacteria 927
318 Ga0070695_101461484 3300005545 Bacteria 568
319 Ga0070696_100007340 3300005546 Bacteria 7362
320 Ga0070693_100295396 3300005547 Bacteria 1090
321 Ga0070693_100407649 3300005547 Bacteria 944
322 Ga0070665_100095587 3300005548 Bacteria 2977
323 Ga0070665_100123101 3300005548 Bacteria 2596
324 Ga0070665_100268510 3300005548 Bacteria 1707
325 Ga0070665_100736695 3300005548 Bacteria 999
326 Ga0070704_100000564 3300005549 Bacteria 17849
327 Ga0070704_100093131 3300005549 Bacteria 2251
328 Ga0070704_100149041 3300005549 Bacteria 1837
329 Ga0070704_100509815 3300005549 Bacteria 1045
330 Ga0068855_100006100 3300005563 Bacteria 14696
331 Ga0068855_100010916 3300005563 Bacteria 10963
332 Ga0068855_100262001 3300005563 Bacteria 1925
333 Ga0068855_100315119 3300005563 Bacteria 1730
334 Ga0068855_100368576 3300005563 Bacteria 1579
335 Ga0068855_100464012 3300005563 Bacteria 1381
336 Ga0068855_101104719 3300005563 Bacteria 829
337 Ga0068855_101266333 3300005563 Bacteria 764
338 Ga0070664_100000092 3300005564 Bacteria 57555
339 Ga0070664_100003753 3300005564 Bacteria 12251
340 Ga0070664_100024673 3300005564 Bacteria 4977
341 Ga0070664_100100665 3300005564 Bacteria 2512
342 Ga0070664_100127603 3300005564 Bacteria 2232
343 Ga0070664_100392696 3300005564 Bacteria 1268
344 Ga0070664_100806356 3300005564 Bacteria 878
345 Ga0070664_100892147 3300005564 Bacteria 833
346 Ga0070664_101801671 3300005564 Bacteria 581
347 Ga0068857_100002063 3300005577 Bacteria 16323
348 Ga0068857_100006165 3300005577 Bacteria 10250
349 Ga0068857_100116553 3300005577 Bacteria 2403
350 Ga0068857_100272816 3300005577 Bacteria 1555
351 Ga0068857_100404549 3300005577 Bacteria 1270
352 Ga0068857_100531074 3300005577 Bacteria 1107
353 Ga0068854_100000106 3300005578 Bacteria 58159
354 Ga0068854_100030518 3300005578 Bacteria 3739
355 Ga0068854_100055294 3300005578 Bacteria 2857
356 Ga0068854_100224518 3300005578 Bacteria 1488
357 Ga0068854_100234200 3300005578 Bacteria 1459
358 Ga0068856_100000261 3300005614 Bacteria 57555
359 Ga0068856_100002410 3300005614 Bacteria 19241
360 Ga0068856_100061865 3300005614 Bacteria 3698
361 Ga0068856_100074312 3300005614 Bacteria 3365
362 Ga0068856_100378596 3300005614 Bacteria 1434
363 Ga0068856_100662076 3300005614 Bacteria 1065
364 Ga0068856_101375472 3300005614 Bacteria 720
365 Ga0068856_102546178 3300005614 Bacteria 518
366 Ga0070702_100611455 3300005615 Bacteria 818
367 Ga0068852_100002265 3300005616 Bacteria 13215
368 Ga0068852_100005967 3300005616 Bacteria 8771
369 Ga0068852_100030031 3300005616 Bacteria 4470
370 Ga0068852_100060912 3300005616 Bacteria 3278
371 Ga0068852_100160392 3300005616 Bacteria 2099
372 Ga0068852_100299342 3300005616 Bacteria 1556
373 Ga0068852_101113811 3300005616 Bacteria 810
374 Ga0068852_101133374 3300005616 Bacteria 803
375 Ga0068852_101139484 3300005616 Bacteria 800
376 Ga0068852_101161903 3300005616 Bacteria 793
377 Ga0068852_101185730 3300005616 Bacteria 785
378 Ga0068859_100000897 3300005617 Bacteria 30326
379 Ga0068859_100708612 3300005617 Bacteria 1097
380 Ga0068859_100780708 3300005617 Bacteria 1043
381 Ga0068859_101730670 3300005617 Bacteria 690
382 Ga0068859_102790951 3300005617 Bacteria 536
383 Ga0068864_100023501 3300005618 Bacteria 5177
384 Ga0068864_100059375 3300005618 Bacteria 3309
385 Ga0068864_101026710 3300005618 Bacteria 818
386 Ga0068866_10186493 3300005718 Bacteria 1229
387 Ga0068866_10846525 3300005718 Bacteria 639
388 Ga0068866_11179529 3300005718 Bacteria 552
389 Ga0068861_100099224 3300005719 Bacteria 2313
390 Ga0068861_100370262 3300005719 Bacteria 1262
391 Ga0068861_100612942 3300005719 Bacteria 1001
392 Ga0068851_10010539 3300005834 Bacteria 4317
393 Ga0068851_10015690 3300005834 Bacteria 3613
394 Ga0068851_10481793 3300005834 Bacteria 742
395 Ga0068870_10061175 3300005840 Bacteria 2023
396 Ga0068870_10369473 3300005840 Bacteria 925
397 Ga0068863_100737355 3300005841 Bacteria 980
398 Ga0068863_101001983 3300005841 Bacteria 838
399 Ga0068858_100114258 3300005842 Bacteria 2522
400 Ga0068858_100220177 3300005842 Bacteria 1797
401 Ga0068858_100239013 3300005842 Bacteria 1723
402 Ga0068860_100001972 3300005843 Bacteria 21701
403 Ga0068860_100345877 3300005843 Bacteria 1463
404 Ga0068860_100466454 3300005843 Bacteria 1257
405 Ga0068862_100002028 3300005844 Bacteria 18338
406 Ga0068862_100062236 3300005844 Bacteria 3209
407 Ga0068862_100174782 3300005844 Bacteria 1924
408 Ga0068862_100254249 3300005844 Bacteria 1602
409 Ga0068862_100328136 3300005844 Bacteria 1414
410 Ga0068862_100543516 3300005844 Bacteria 1108
411 Ga0081455_10087396 3300005937 Bacteria 2536
412 Ga0081455_10491490 3300005937 Bacteria 827
413 Ga0081455_10566327 3300005937 Bacteria 748
414 Ga0081540_1002455 3300005983 Bacteria 15096
415 Ga0081540_1228965 3300005983 Bacteria 657
416 Ga0081539_10303245 3300005985 Bacteria 686
417 Ga0070717_10188080 3300006028 Bacteria 1803
418 Ga0070717_10406094 3300006028 Bacteria 1224
419 Ga0075368_10454444 3300006042 Bacteria 568
420 Ga0075363_100426748 3300006048 Bacteria 781
421 Ga0075363_100446234 3300006048 Bacteria 764
422 Ga0075364_10597857 3300006051 Bacteria 754
423 Ga0070715_10278757 3300006163 Bacteria 885
424 Ga0070716_100578420 3300006173 Bacteria 842
425 Ga0070712_101481142 3300006175 Bacteria 593
426 Ga0075362_10062759 3300006177 Bacteria 1684
427 Ga0075367_10281960 3300006178 Bacteria 1045
428 Ga0075369_10640178 3300006186 Bacteria 510
429 Ga0075366_10000901 3300006195 Bacteria 14369
430 Ga0075366_10121289 3300006195 Bacteria 1576
431 Ga0075366_10166447 3300006195 Bacteria 1337
432 Ga0075366_10176908 3300006195 Bacteria 1295
433 Ga0097621_100009363 3300006237 Bacteria 7109
434 Ga0097621_100440336 3300006237 Bacteria 1172
435 Ga0097621_100914214 3300006237 Bacteria 818
436 Ga0097621_101804448 3300006237 Bacteria 583
437 Ga0075370_10564594 3300006353 Bacteria 689
438 Ga0068871_100021123 3300006358 Bacteria 4998
439 Ga0068871_100284608 3300006358 Bacteria 1447
440 Ga0068871_100917327 3300006358 Bacteria 812
441 Ga0075428_100000852 3300006844 Bacteria 32086
442 Ga0075428_100113681 3300006844 Bacteria 2950
443 Ga0075428_100533625 3300006844 Bacteria 1255
444 Ga0075428_100995206 3300006844 Bacteria 888
445 Ga0075430_100034300 3300006846 Bacteria 4307
446 Ga0075430_100154670 3300006846 Bacteria 1910
447 Ga0075430_100238922 3300006846 Bacteria 1506
448 Ga0075430_100600421 3300006846 Bacteria 908
449 Ga0075430_100802358 3300006846 Bacteria 776
450 Ga0075430_101677485 3300006846 Bacteria 522
451 Ga0075431_100002915 3300006847 Bacteria 16563
452 Ga0075431_100006006 3300006847 Bacteria 12030
453 Ga0075431_100014702 3300006847 Bacteria 7923
454 Ga0075431_100019995 3300006847 Bacteria 6836
455 Ga0075431_100205261 3300006847 Bacteria 2015
456 Ga0075431_100223116 3300006847 Bacteria 1922
457 Ga0075431_100460818 3300006847 Bacteria 1266
458 Ga0075431_100822545 3300006847 Bacteria 901
459 Ga0075431_101589303 3300006847 Bacteria 612
460 Ga0075433_10324565 3300006852 Bacteria 1362
461 Ga0075433_10506667 3300006852 Bacteria 1062
462 Ga0075434_100029038 3300006871 Bacteria 5439
463 Ga0075434_100189888 3300006871 Bacteria 2074
464 Ga0075434_100392441 3300006871 Bacteria 1409
465 Ga0075434_100795231 3300006871 Bacteria 962
466 Ga0075434_101786727 3300006871 Bacteria 622
467 Ga0075429_100008202 3300006880 Bacteria 9081
468 Ga0075429_100016947 3300006880 Bacteria 6304
469 Ga0075429_100341891 3300006880 Bacteria 1310
470 Ga0075429_100856581 3300006880 Bacteria 796
471 Ga0068865_100535902 3300006881 Bacteria 981
472 Ga0068865_100713164 3300006881 Bacteria 858
473 Ga0068865_101108723 3300006881 Bacteria 697
474 Ga0075436_100006731 3300006914 Bacteria 7866
475 Ga0075436_101108701 3300006914 Bacteria 596
476 Ga0097620_100000897 3300006931 Bacteria 30326
477 Ga0097620_100708667 3300006931 Bacteria 1097
478 Ga0097620_100780640 3300006931 Bacteria 1043
479 Ga0097620_101730639 3300006931 Bacteria 690
480 Ga0097620_102791710 3300006931 Bacteria 536
481 Ga0099826_10000002 3300006948 Bacteria 1125830
482 Ga0075435_100103431 3300007076 Bacteria 2362
483 Ga0075435_100226647 3300007076 Bacteria 1587
484 Ga0105251_10001393 3300009011 Bacteria 20876
485 Ga0105251_10024497 3300009011 Bacteria 3099
486 Ga0105251_10038568 3300009011 Bacteria 2340
487 Ga0105251_10130788 3300009011 Bacteria 1137
488 Ga0105244_10120080 3300009036 Bacteria 1273
489 Ga0105250_10034610 3300009092 Bacteria 2027
490 Ga0105250_10160236 3300009092 Bacteria 939
491 Ga0105240_10002495 3300009093 Bacteria 29565
492 Ga0105240_10002726 3300009093 Bacteria 28013
493 Ga0105240_10008617 3300009093 Bacteria 14570
494 Ga0105240_10087499 3300009093 Bacteria 3815
495 Ga0105240_10089326 3300009093 Bacteria 3769
496 Ga0105240_10145249 3300009093 Bacteria 2831
497 Ga0105240_10156440 3300009093 Bacteria 2710
498 Ga0105240_10346619 3300009093 Bacteria 1686
499 Ga0105240_10605640 3300009093 Bacteria 1206
500 Ga0105240_11643839 3300009093 Bacteria 671
501 Ga0105240_11953099 3300009093 Bacteria 610
502 Ga0111539_10003926 3300009094 Bacteria 19545
503 Ga0111539_10025949 3300009094 Bacteria 7173
504 Ga0111539_10055661 3300009094 Bacteria 4702
505 Ga0111539_10163916 3300009094 Bacteria 2600
506 Ga0111539_10331907 3300009094 Bacteria 1770
507 Ga0111539_10551882 3300009094 Bacteria 1342
508 Ga0111539_10976885 3300009094 Bacteria 985
509 Ga0111539_11301793 3300009094 Bacteria 843
510 Ga0111539_12784206 3300009094 Bacteria 567
511 Ga0111539_12813035 3300009094 Bacteria 564
512 Ga0105245_10747172 3300009098 Bacteria 1014
513 Ga0105245_12607819 3300009098 Bacteria 559
514 Ga0105245_12966820 3300009098 Bacteria 526
515 Ga0105247_10503146 3300009101 Bacteria 883
516 Ga0105247_10568193 3300009101 Bacteria 836
517 Ga0105247_11731112 3300009101 Bacteria 518
518 Ga0114129_10008304 3300009147 Bacteria 14814
519 Ga0114129_10318588 3300009147 Bacteria 2068
520 Ga0114129_10511327 3300009147 Bacteria 1567
521 Ga0114129_10647335 3300009147 Bacteria 1364
522 Ga0114129_11949592 3300009147 Bacteria 711
523 Ga0114129_12704180 3300009147 Bacteria 591
524 Ga0105243_10015405 3300009148 Bacteria 5781
525 Ga0105243_10223912 3300009148 Bacteria 1664
526 Ga0105243_10289885 3300009148 Bacteria 1478
527 Ga0105243_10346863 3300009148 Bacteria 1362
528 Ga0105241_10078621 3300009174 Bacteria 2578
529 Ga0105241_10109842 3300009174 Bacteria 2206
530 Ga0105241_10260758 3300009174 Bacteria 1473
531 Ga0105241_10412119 3300009174 Bacteria 1187
532 Ga0105241_10557034 3300009174 Bacteria 1030
533 Ga0105241_11459999 3300009174 Bacteria 657
534 Ga0105242_10115974 3300009176 Bacteria 2290
535 Ga0105242_10236364 3300009176 Bacteria 1640
536 Ga0105242_10307881 3300009176 Bacteria 1448
537 Ga0105242_10446114 3300009176 Bacteria 1218
538 Ga0105242_10579890 3300009176 Bacteria 1080
539 Ga0105242_12374852 3300009176 Bacteria 577
540 Ga0105248_10262254 3300009177 Bacteria 1945
541 Ga0105248_10805375 3300009177 Bacteria 1060
542 Ga0105248_12067772 3300009177 Bacteria 647
543 Ga0105237_10011602 3300009545 Bacteria 9322
544 Ga0105237_10075787 3300009545 Bacteria 3354
545 Ga0105237_10082585 3300009545 Bacteria 3203
546 Ga0105237_10135813 3300009545 Bacteria 2454
547 Ga0105237_10437517 3300009545 Bacteria 1313
548 Ga0105237_10445945 3300009545 Bacteria 1300
549 Ga0105237_10761963 3300009545 Bacteria 974
550 Ga0105237_11498759 3300009545 Bacteria 681
551 Ga0105238_10007857 3300009551 Bacteria 10670
552 Ga0105238_10019620 3300009551 Bacteria 6883
553 Ga0105238_10052144 3300009551 Bacteria 4113
554 Ga0105238_10174473 3300009551 Bacteria 2126
555 Ga0105238_10263912 3300009551 Bacteria 1702
556 Ga0105249_10075862 3300009553 Bacteria 3114
557 Ga0105249_10199951 3300009553 Bacteria 1955
558 Ga0105249_10906181 3300009553 Bacteria 949
559 Ga0105249_11206400 3300009553 Bacteria 828
560 Ga0105249_11268916 3300009553 Bacteria 808
561 Ga0105249_11477936 3300009553 Bacteria 752
562 Ga0105249_13261962 3300009553 Bacteria 522
563 Ga0105147_109401 3300009982 Bacteria 830
564 Ga0105239_10002265 3300010375 Bacteria 24590
565 Ga0105239_10030758 3300010375 Bacteria 5905
566 Ga0105239_10098432 3300010375 Bacteria 3233
567 Ga0105239_10175638 3300010375 Bacteria 2396
568 Ga0105239_10579520 3300010375 Bacteria 1279
569 Ga0105239_10772404 3300010375 Bacteria 1100
570 Ga0105239_11636015 3300010375 Bacteria 745
571 Ga0105239_11766462 3300010375 Bacteria 716
572 Ga0105239_12584776 3300010375 Bacteria 592
573 Ga0105246_10080219 3300011119 Bacteria 2322
574 Ga0105246_10097182 3300011119 Bacteria 2136
575 Ga0105246_10128905 3300011119 Bacteria 1886
576 Ga0105246_10348670 3300011119 Bacteria 1212
577 Ga0105246_10868731 3300011119 Bacteria 806
578 Ga0154016_137307 3300013045 Bacteria 1532
579 Ga0154014_155826 3300013052 Bacteria 970
580 Ga0154012_173028 3300013059 Bacteria 1592
581 Ga0157373_10013769 3300013100 Bacteria 5929
582 Ga0157373_10037801 3300013100 Bacteria 3459
583 Ga0157373_10075163 3300013100 Bacteria 2384
584 Ga0157373_10075882 3300013100 Bacteria 2372
585 Ga0157373_10102807 3300013100 Bacteria 2010
586 Ga0157373_10140813 3300013100 Bacteria 1696
587 Ga0157373_10994405 3300013100 Bacteria 626
588 Ga0157371_10000362 3300013102 Bacteria 57561
589 Ga0157371_10002053 3300013102 Bacteria 19810
590 Ga0157371_10019075 3300013102 Bacteria 5063
591 Ga0157370_10000679 3300013104 Bacteria 42302
592 Ga0157370_10001049 3300013104 Bacteria 34805
593 Ga0157370_10006527 3300013104 Bacteria 12847
594 Ga0157370_10011634 3300013104 Bacteria 9187
595 Ga0157370_10045035 3300013104 Bacteria 4235
596 Ga0157370_10115295 3300013104 Bacteria 2510
597 Ga0157370_10302376 3300013104 Bacteria 1477
598 Ga0157370_10506397 3300013104 Bacteria 1109
599 Ga0157370_10674862 3300013104 Bacteria 944
600 Ga0157370_11078474 3300013104 Bacteria 726
601 Ga0157369_10000067 3300013105 Bacteria 144506
602 Ga0157369_10004807 3300013105 Bacteria 15869
603 Ga0157369_10008217 3300013105 Bacteria 11967
604 Ga0157369_10016934 3300013105 Bacteria 8192
605 Ga0157369_10152630 3300013105 Bacteria 2441
606 Ga0157369_10823554 3300013105 Bacteria 953
607 Ga0157369_12006232 3300013105 Bacteria 587
608 Ga0157374_10006139 3300013296 Bacteria 10178
609 Ga0157374_10026366 3300013296 Bacteria 5229
610 Ga0157374_10068990 3300013296 Bacteria 3328
611 Ga0157374_10146402 3300013296 Bacteria 2294
612 Ga0157374_10159671 3300013296 Bacteria 2196
613 Ga0157374_10262774 3300013296 Bacteria 1700
614 Ga0157374_10405771 3300013296 Bacteria 1360
615 Ga0157374_11310962 3300013296 Bacteria 746
616 Ga0157374_11375876 3300013296 Bacteria 728
617 Ga0157378_10056438 3300013297 Bacteria 3499
618 Ga0157378_10059592 3300013297 Bacteria 3406
619 Ga0157378_10235199 3300013297 Bacteria 1748
620 Ga0157378_10540910 3300013297 Bacteria 1169
621 Ga0157378_11285397 3300013297 Bacteria 772
622 Ga0163162_10058330 3300013306 Bacteria 3889
623 Ga0163162_10061118 3300013306 Bacteria 3805
624 Ga0163162_10064382 3300013306 Bacteria 3711
625 Ga0163162_10135330 3300013306 Bacteria 2575
626 Ga0163162_10411799 3300013306 Bacteria 1484
627 Ga0163162_10520124 3300013306 Bacteria 1319
628 Ga0163162_10651104 3300013306 Bacteria 1177
629 Ga0163162_10697418 3300013306 Bacteria 1137
630 Ga0163162_13448350 3300013306 Bacteria 504
631 Ga0157372_10000269 3300013307 Bacteria 57561
632 Ga0157372_10000840 3300013307 Bacteria 33302
633 Ga0157372_10002760 3300013307 Bacteria 18982
634 Ga0157372_10037249 3300013307 Bacteria 5363
635 Ga0157372_10157127 3300013307 Bacteria 2627
636 Ga0157372_10353925 3300013307 Bacteria 1711
637 Ga0157372_10456460 3300013307 Bacteria 1489
638 Ga0157372_10537440 3300013307 Bacteria 1363
639 Ga0157372_10797208 3300013307 Bacteria 1098
640 Ga0157372_11445118 3300013307 Bacteria 792
641 Ga0157372_13278726 3300013307 Bacteria 516
642 Ga0157375_10006015 3300013308 Bacteria 10582
643 Ga0157375_10035595 3300013308 Bacteria 4754
644 Ga0157375_10392337 3300013308 Bacteria 1555
645 Ga0157375_10508334 3300013308 Bacteria 1369
646 Ga0157375_10537653 3300013308 Bacteria 1331
647 Ga0157375_11172735 3300013308 Bacteria 900
648 Ga0157375_12408204 3300013308 Bacteria 628
649 Ga0157375_13722164 3300013308 Bacteria 507
650 Ga0163163_11814629 3300014325 Bacteria 670
651 Ga0163163_12274925 3300014325 Bacteria 601
652 Ga0163163_13048257 3300014325 Bacteria 522
653 Ga0157380_10453975 3300014326 Bacteria 1232
654 Ga0157380_10625421 3300014326 Bacteria 1070
655 Ga0157380_10653612 3300014326 Bacteria 1049
656 Ga0157380_11774590 3300014326 Bacteria 676
657 Ga0157380_12452867 3300014326 Bacteria 587
658 Ga0182008_10034870 3300014497 Bacteria 2522
659 Ga0182008_10193013 3300014497 Bacteria 1034
660 Ga0182008_10329147 3300014497 Bacteria 806
661 Ga0157377_10016655 3300014745 Bacteria 3785
662 Ga0157377_10129247 3300014745 Bacteria 1541
663 Ga0157377_10385835 3300014745 Bacteria 950
664 Ga0157379_10144243 3300014968 Bacteria 2147
665 Ga0157379_10295596 3300014968 Bacteria 1475
666 Ga0157379_10818235 3300014968 Bacteria 880
667 Ga0157379_11244005 3300014968 Bacteria 717
668 Ga0157376_10088728 3300014969 Bacteria 2672
669 Ga0157376_10100666 3300014969 Bacteria 2524
670 Ga0157376_10684424 3300014969 Bacteria 1029
671 Ga0182006_1004957 3300015261 Bacteria 6429
672 Ga0182006_1058256 3300015261 Bacteria 1465
673 Ga0182006_1159097 3300015261 Bacteria 762
674 Ga0182007_10003275 3300015262 Bacteria 7695
675 Ga0182007_10023290 3300015262 Bacteria 2178
676 Ga0182007_10059412 3300015262 Bacteria 1254
677 Ga0182007_10064952 3300015262 Bacteria 1196
678 Ga0182005_1036259 3300015265 Bacteria 1341
679 Ga0183361_10014 3300016635 Bacteria 171033
680 Ga0163161_10094436 3300017792 Bacteria 2217
681 Ga0184592_124643 3300019177 Bacteria 742
682 Ga0184594_101816 3300019181 Bacteria 779
683 Ga0184601_124142 3300019183 Bacteria 904
684 Ga0197907_10080731 3300020069 Bacteria 1332
685 Ga0197907_10209533 3300020069 Bacteria 697
686 Ga0197907_10543707 3300020069 Bacteria 670
687 Ga0197907_10570786 3300020069 Bacteria 1157
688 Ga0197907_11198229 3300020069 Bacteria 1637
689 Ga0206356_10312632 3300020070 Bacteria 1162
690 Ga0206356_10678846 3300020070 Bacteria 845
691 Ga0206356_10734784 3300020070 Bacteria 4283
692 Ga0206356_11584160 3300020070 Bacteria 943
693 Ga0206356_11850023 3300020070 Bacteria 773
694 Ga0206349_1026961 3300020075 Bacteria 1661
695 Ga0206349_1316050 3300020075 Bacteria 813
696 Ga0206355_1102112 3300020076 Bacteria 4448
697 Ga0206355_1231534 3300020076 Bacteria 871
698 Ga0206355_1501166 3300020076 Bacteria 662
699 Ga0206355_1664610 3300020076 Bacteria 1172
700 Ga0206351_10067764 3300020077 Bacteria 8112
701 Ga0206351_10152856 3300020077 Bacteria 535
702 Ga0206352_10517362 3300020078 Bacteria 1391
703 Ga0206352_10990901 3300020078 Bacteria 695
704 Ga0206350_10339102 3300020080 Bacteria 1247
705 Ga0206350_10412246 3300020080 Bacteria 1946
706 Ga0206350_10601530 3300020080 Bacteria 1595
707 Ga0206350_11401232 3300020080 Bacteria 597
708 Ga0206354_10131732 3300020081 Bacteria 1056
709 Ga0206353_10095146 3300020082 Bacteria 802
710 Ga0154015_1048785 3300020610 Bacteria 25158
711 Ga0154015_1131996 3300020610 Bacteria 936
712 Ga0154015_1183350 3300020610 Bacteria 685
713 Ga0213872_10042036 3300021361 Bacteria 2085
714 Ga0213876_10578946 3300021384 Bacteria 597
715 Ga0213871_10232425 3300021441 Bacteria 582
716 Ga0224712_10001035 3300022467 Bacteria 6100
717 Ga0224712_10122600 3300022467 Bacteria 1127
718 Ga0224712_10156721 3300022467 Bacteria 1013
719 Ga0247551_101084 3300023552 Bacteria 873
720 Ga0247514_113575 3300023560 Bacteria 799
721 Ga0247515_115509 3300023564 Bacteria 723
722 Ga0209784_100003 3300025224 Bacteria 1379451
723 Ga0209566_100002 3300025225 Bacteria 2614868
724 Ga0209566_101036 3300025225 Bacteria 11591
725 Ga0209674_100013 3300025226 Bacteria 813140
726 Ga0209674_100094 3300025226 Bacteria 169506
727 Ga0209672_100010 3300025228 Bacteria 873151
728 Ga0209672_100037 3300025228 Bacteria 287776
729 Ga0209672_100065 3300025228 Bacteria 198168
730 Ga0209672_100132 3300025228 Bacteria 73895
731 Ga0209672_101274 3300025228 Bacteria 9900
732 Ga0209147_100002 3300025229 Bacteria 2158988
733 Ga0209147_100006 3300025229 Bacteria 873276
734 Ga0209147_100023 3300025229 Bacteria 437803
735 Ga0209147_100049 3300025229 Bacteria 274980
736 Ga0209147_100180 3300025229 Bacteria 78654
737 Ga0209563_100004 3300025230 Bacteria 1814108
738 Ga0209563_102866 3300025230 Bacteria 3750
739 Ga0207427_100913 3300025231 Bacteria 12731
740 Ga0209437_100080 3300025233 Bacteria 275402
741 Ga0209258_100002 3300025242 Bacteria 2158988
742 Ga0209258_100010 3300025242 Bacteria 873276
743 Ga0209258_100031 3300025242 Bacteria 463572
744 Ga0209258_100066 3300025242 Bacteria 287776
745 Ga0209258_100179 3300025242 Bacteria 137687
746 Ga0209646_1000019 3300025246 Bacteria 475248
747 Ga0209646_1000033 3300025246 Bacteria 369507
748 Ga0209026_1000996 3300025250 Bacteria 14073
749 Ga0209026_1002578 3300025250 Bacteria 6671
750 Ga0209677_123232 3300025253 Bacteria 690
751 Ga0209148_1000018 3300025254 Bacteria 756247
752 Ga0209148_1000027 3300025254 Bacteria 616374
753 Ga0209759_1000088 3300025256 Bacteria 165748
754 Ga0209233_1000171 3300025261 Bacteria 146605
755 Ga0209233_1040156 3300025261 Bacteria 1020
756 Ga0209565_1019698 3300025263 Bacteria 1436
757 Ga0209455_1000009 3300025272 Bacteria 1042273
758 Ga0209455_1000015 3300025272 Bacteria 756128
759 Ga0209455_1000332 3300025272 Bacteria 45408
760 Ga0209455_1002415 3300025272 Bacteria 7234
761 Ga0209673_1000007 3300025273 Bacteria 634477
762 Ga0209673_1000184 3300025273 Bacteria 126036
763 Ga0209673_1124600 3300025273 Bacteria 520
764 Ga0209130_1000156 3300025284 Bacteria 101929
765 Ga0209130_1011377 3300025284 Bacteria 2387
766 Ga0209675_1000009 3300025291 Bacteria 562872
767 Ga0209675_1014612 3300025291 Bacteria 2380
768 Ga0209675_1033085 3300025291 Bacteria 1203
769 Ga0209564_1000055 3300025295 Bacteria 343782
770 Ga0209564_1004574 3300025295 Bacteria 8377
771 Ga0209564_1013076 3300025295 Bacteria 3554
772 Ga0209256_1000007 3300025299 Bacteria 1136599
773 Ga0209256_1000849 3300025299 Bacteria 38168
774 Ga0207426_1000297 3300025302 Bacteria 97932
775 Ga0207426_1008780 3300025302 Bacteria 4047
776 Ga0207697_10014823 3300025315 Bacteria 3228
777 Ga0207697_10175129 3300025315 Bacteria 939
778 Ga0207656_10002126 3300025321 Bacteria 6618
779 Ga0207656_10078068 3300025321 Bacteria 1483
780 Ga0207656_10322539 3300025321 Bacteria 767
781 Ga0207655_1112530 3300025728 Bacteria 917
782 Ga0207713_1003101 3300025735 Bacteria 11531
783 Ga0207713_1008130 3300025735 Bacteria 6082
784 Ga0207653_10003424 3300025885 Bacteria 5003
785 Ga0207682_10005952 3300025893 Bacteria 4934
786 Ga0207682_10016551 3300025893 Bacteria 2877
787 Ga0207682_10421532 3300025893 Bacteria 631
788 Ga0207692_10446936 3300025898 Bacteria 813
789 Ga0207642_10530925 3300025899 Bacteria 724
790 Ga0207642_10705879 3300025899 Bacteria 636
791 Ga0207688_10000707 3300025901 Bacteria 16484
792 Ga0207688_10199356 3300025901 Bacteria 1199
793 Ga0207688_10320296 3300025901 Bacteria 951
794 Ga0207680_10937740 3300025903 Bacteria 620
795 Ga0207680_11235875 3300025903 Bacteria 532
796 Ga0207647_10001046 3300025904 Bacteria 21411
797 Ga0207647_10003244 3300025904 Bacteria 12209
798 Ga0207647_10525842 3300025904 Bacteria 658
799 Ga0207699_10235387 3300025906 Bacteria 1256
800 Ga0207699_10430383 3300025906 Bacteria 944
801 Ga0207699_10699698 3300025906 Bacteria 742
802 Ga0207645_10013029 3300025907 Bacteria 5619
803 Ga0207645_10021102 3300025907 Bacteria 4252
804 Ga0207645_10259049 3300025907 Bacteria 1152
805 Ga0207645_10876245 3300025907 Bacteria 610
806 Ga0207643_10012369 3300025908 Bacteria 4613
807 Ga0207643_10102399 3300025908 Bacteria 1680
808 Ga0207705_10000674 3300025909 Bacteria 28353
809 Ga0207705_10098234 3300025909 Bacteria 2151
810 Ga0207705_10414031 3300025909 Bacteria 1043
811 Ga0207705_10515340 3300025909 Bacteria 929
812 Ga0207684_10099093 3300025910 Bacteria 2489
813 Ga0207684_10109842 3300025910 Bacteria 2361
814 Ga0207684_11293593 3300025910 Bacteria 601
815 Ga0207654_10019936 3300025911 Bacteria 3546
816 Ga0207654_10055057 3300025911 Bacteria 2301
817 Ga0207654_10405774 3300025911 Bacteria 948
818 Ga0207654_10989984 3300025911 Bacteria 611
819 Ga0207654_11141284 3300025911 Bacteria 568
820 Ga0207707_10009589 3300025912 Bacteria 8399
821 Ga0207707_10022517 3300025912 Bacteria 5508
822 Ga0207707_10100210 3300025912 Bacteria 2532
823 Ga0207707_10205683 3300025912 Bacteria 1716
824 Ga0207695_10003361 3300025913 Bacteria 22613
825 Ga0207695_10004551 3300025913 Bacteria 18863
826 Ga0207695_10005318 3300025913 Bacteria 17142
827 Ga0207695_10013836 3300025913 Bacteria 9598
828 Ga0207695_10020125 3300025913 Bacteria 7655
829 Ga0207695_10117849 3300025913 Bacteria 2627
830 Ga0207695_10120471 3300025913 Bacteria 2593
831 Ga0207695_10936114 3300025913 Bacteria 746
832 Ga0207695_10944002 3300025913 Bacteria 742
833 Ga0207671_10030332 3300025914 Bacteria 4032
834 Ga0207671_10144880 3300025914 Bacteria 1832
835 Ga0207671_10234915 3300025914 Bacteria 1439
836 Ga0207671_10278057 3300025914 Bacteria 1320
837 Ga0207671_10307847 3300025914 Bacteria 1252
838 Ga0207671_10584467 3300025914 Bacteria 890
839 Ga0207693_10764635 3300025915 Bacteria 746
840 Ga0207693_10988049 3300025915 Bacteria 643
841 Ga0207663_11602140 3300025916 Bacteria 524
842 Ga0207660_10050114 3300025917 Bacteria 2964
843 Ga0207660_10437418 3300025917 Bacteria 1056
844 Ga0207662_10014245 3300025918 Bacteria 4459
845 Ga0207657_10000078 3300025919 Bacteria 92019
846 Ga0207657_10001465 3300025919 Bacteria 25262
847 Ga0207657_10003688 3300025919 Bacteria 16288
848 Ga0207657_10039699 3300025919 Bacteria 4180
849 Ga0207657_10051381 3300025919 Bacteria 3583
850 Ga0207657_10064053 3300025919 Bacteria 3140
851 Ga0207657_10082549 3300025919 Bacteria 2697
852 Ga0207657_10547435 3300025919 Bacteria 905
853 Ga0207649_10000082 3300025920 Bacteria 81508
854 Ga0207649_10008379 3300025920 Bacteria 5634
855 Ga0207649_10011378 3300025920 Bacteria 4907
856 Ga0207649_10079727 3300025920 Bacteria 2116
857 Ga0207649_10087929 3300025920 Bacteria 2028
858 Ga0207649_10236056 3300025920 Bacteria 1310
859 Ga0207649_10890825 3300025920 Bacteria 697
860 Ga0207649_10963076 3300025920 Bacteria 671
861 Ga0207652_10059916 3300025921 Bacteria 3282
862 Ga0207652_10193347 3300025921 Bacteria 1830
863 Ga0207652_11206320 3300025921 Bacteria 658
864 Ga0207646_10026207 3300025922 Bacteria 5322
865 Ga0207646_10044711 3300025922 Bacteria 3975
866 Ga0207646_10322754 3300025922 Bacteria 1395
867 Ga0207646_11878064 3300025922 Bacteria 511
868 Ga0207681_10348730 3300025923 Bacteria 1184
869 Ga0207694_10005179 3300025924 Bacteria 10069
870 Ga0207694_10007319 3300025924 Bacteria 8376
871 Ga0207694_10223324 3300025924 Bacteria 1537
872 Ga0207694_10227722 3300025924 Bacteria 1522
873 Ga0207650_10109664 3300025925 Bacteria 2135
874 Ga0207650_10168534 3300025925 Bacteria 1739
875 Ga0207650_10258300 3300025925 Bacteria 1412
876 Ga0207650_10310020 3300025925 Bacteria 1291
877 Ga0207650_10482743 3300025925 Bacteria 1034
878 Ga0207659_10025057 3300025926 Bacteria 4004
879 Ga0207659_10028376 3300025926 Bacteria 3803
880 Ga0207659_10054358 3300025926 Bacteria 2859
881 Ga0207659_10190508 3300025926 Bacteria 1632
882 Ga0207659_11811371 3300025926 Bacteria 518
883 Ga0207687_10310125 3300025927 Bacteria 1274
884 Ga0207700_10000049 3300025928 Bacteria 80608
885 Ga0207700_10388759 3300025928 Bacteria 1221
886 Ga0207700_10618875 3300025928 Bacteria 964
887 Ga0207664_10055578 3300025929 Bacteria 3141
888 Ga0207664_10716232 3300025929 Bacteria 900
889 Ga0207644_10014701 3300025931 Bacteria 5245
890 Ga0207644_10016507 3300025931 Bacteria 4968
891 Ga0207644_10125933 3300025931 Bacteria 1955
892 Ga0207644_10237130 3300025931 Bacteria 1451
893 Ga0207644_10336341 3300025931 Bacteria 1223
894 Ga0207690_10000026 3300025932 Bacteria 175904
895 Ga0207690_10000505 3300025932 Bacteria 25301
896 Ga0207690_10006601 3300025932 Bacteria 6871
897 Ga0207690_10020191 3300025932 Bacteria 4112
898 Ga0207690_10107523 3300025932 Bacteria 2003
899 Ga0207690_10178599 3300025932 Bacteria 1596
900 Ga0207690_10217628 3300025932 Bacteria 1460
901 Ga0207690_10235205 3300025932 Bacteria 1409
902 Ga0207690_10256515 3300025932 Bacteria 1353
903 Ga0207690_10808449 3300025932 Bacteria 775
904 Ga0207706_10000008 3300025933 Bacteria 201940
905 Ga0207706_10020307 3300025933 Bacteria 5971
906 Ga0207706_10131379 3300025933 Bacteria 2202
907 Ga0207706_10140316 3300025933 Bacteria 2126
908 Ga0207706_10158542 3300025933 Bacteria 1990
909 Ga0207706_10249030 3300025933 Bacteria 1552
910 Ga0207706_10432267 3300025933 Bacteria 1140
911 Ga0207706_10559215 3300025933 Bacteria 984
912 Ga0207706_10579916 3300025933 Bacteria 964
913 Ga0207686_10030277 3300025934 Bacteria 3202
914 Ga0207686_10071609 3300025934 Bacteria 2232
915 Ga0207686_10327941 3300025934 Bacteria 1146
916 Ga0207686_10981690 3300025934 Bacteria 685
917 Ga0207686_11375263 3300025934 Bacteria 581
918 Ga0207709_10024616 3300025935 Bacteria 3438
919 Ga0207709_10064773 3300025935 Bacteria 2296
920 Ga0207709_10375343 3300025935 Bacteria 1080
921 Ga0207709_11065202 3300025935 Bacteria 663
922 Ga0207670_11602456 3300025936 Bacteria 554
923 Ga0207670_11622401 3300025936 Bacteria 550
924 Ga0207669_10187720 3300025937 Bacteria 1488
925 Ga0207669_10300399 3300025937 Bacteria 1220
926 Ga0207669_10513619 3300025937 Bacteria 961
927 Ga0207704_10289380 3300025938 Bacteria 1249
928 Ga0207704_11025819 3300025938 Bacteria 699
929 Ga0207704_11107573 3300025938 Bacteria 673
930 Ga0207665_10092556 3300025939 Bacteria 2098
931 Ga0207691_10001213 3300025940 Bacteria 25685
932 Ga0207691_10057083 3300025940 Bacteria 3554
933 Ga0207691_10117953 3300025940 Bacteria 2354
934 Ga0207711_10064262 3300025941 Bacteria 3170
935 Ga0207711_10159964 3300025941 Bacteria 2038
936 Ga0207711_10295848 3300025941 Bacteria 1492
937 Ga0207711_10750821 3300025941 Bacteria 909
938 Ga0207711_10939321 3300025941 Bacteria 803
939 Ga0207689_10030888 3300025942 Bacteria 4463
940 Ga0207689_10035496 3300025942 Bacteria 4142
941 Ga0207689_10075222 3300025942 Bacteria 2776
942 Ga0207661_10353310 3300025944 Bacteria 1326
943 Ga0207661_10849639 3300025944 Bacteria 840
944 Ga0207661_11863587 3300025944 Bacteria 547
945 Ga0207679_10000619 3300025945 Bacteria 23689
946 Ga0207679_10001556 3300025945 Bacteria 14346
947 Ga0207679_10523194 3300025945 Bacteria 1061
948 Ga0207679_10767515 3300025945 Bacteria 878
949 Ga0207679_10819192 3300025945 Bacteria 849
950 Ga0207667_10000347 3300025949 Bacteria 63149
951 Ga0207667_10001617 3300025949 Bacteria 28337
952 Ga0207667_10007693 3300025949 Bacteria 12897
953 Ga0207667_10022263 3300025949 Bacteria 7005
954 Ga0207667_10031203 3300025949 Bacteria 5754
955 Ga0207667_10070424 3300025949 Bacteria 3640
956 Ga0207667_10237831 3300025949 Bacteria 1864
957 Ga0207667_11383325 3300025949 Bacteria 678
958 Ga0207651_10015954 3300025960 Bacteria 4384
959 Ga0207651_10018049 3300025960 Bacteria 4187
960 Ga0207651_10213471 3300025960 Bacteria 1555
961 Ga0207651_10250582 3300025960 Bacteria 1449
962 Ga0207712_10015247 3300025961 Bacteria 4954
963 Ga0207712_10114120 3300025961 Bacteria 2031
964 Ga0207712_10209896 3300025961 Bacteria 1550
965 Ga0207712_10211786 3300025961 Bacteria 1544
966 Ga0207712_11181979 3300025961 Bacteria 682
967 Ga0207668_10145804 3300025972 Bacteria 1826
968 Ga0207668_10251457 3300025972 Bacteria 1436
969 Ga0207640_10000127 3300025981 Bacteria 58175
970 Ga0207640_10013945 3300025981 Bacteria 4616
971 Ga0207640_10041717 3300025981 Bacteria 2921
972 Ga0207640_10468647 3300025981 Bacteria 1042
973 Ga0207640_10518395 3300025981 Bacteria 996
974 Ga0207640_11545093 3300025981 Bacteria 597
975 Ga0207658_10027217 3300025986 Bacteria 4015
976 Ga0207658_10198288 3300025986 Bacteria 1674
977 Ga0207658_10485555 3300025986 Bacteria 1098
978 Ga0207677_10184171 3300026023 Bacteria 1645
979 Ga0207677_10342658 3300026023 Bacteria 1249
980 Ga0207677_10399991 3300026023 Bacteria 1164
981 Ga0207677_11016517 3300026023 Bacteria 752
982 Ga0207677_11339083 3300026023 Bacteria 658
983 Ga0207703_10102763 3300026035 Bacteria 2425
984 Ga0207703_10406946 3300026035 Bacteria 1263
985 Ga0207703_11042132 3300026035 Bacteria 785
986 Ga0207703_11941142 3300026035 Bacteria 565
987 Ga0207639_10027098 3300026041 Bacteria 4171
988 Ga0207639_10258017 3300026041 Bacteria 1523
989 Ga0207639_10802156 3300026041 Bacteria 877
990 Ga0207678_10000148 3300026067 Bacteria 57513
991 Ga0207678_10008723 3300026067 Bacteria 8929
992 Ga0207678_10028033 3300026067 Bacteria 4918
993 Ga0207678_10143588 3300026067 Bacteria 2037
994 Ga0207678_10191512 3300026067 Bacteria 1748
995 Ga0207678_10196797 3300026067 Bacteria 1723
996 Ga0207678_10298393 3300026067 Bacteria 1384
997 Ga0207678_10427316 3300026067 Bacteria 1149
998 Ga0207678_10451462 3300026067 Bacteria 1117
999 Ga0207678_10483209 3300026067 Bacteria 1079
1000 Ga0207708_10019211 3300026075 Bacteria 5147
1001 Ga0207708_10492314 3300026075 Bacteria 1026
1002 Ga0207708_11461668 3300026075 Bacteria 600
1003 Ga0207708_11755472 3300026075 Bacteria 545
1004 Ga0207708_12029599 3300026075 Bacteria 503
1005 Ga0207702_10000296 3300026078 Bacteria 57562
1006 Ga0207702_10004303 3300026078 Bacteria 12690
1007 Ga0207702_10004494 3300026078 Bacteria 12380
1008 Ga0207702_10064528 3300026078 Bacteria 3134
1009 Ga0207702_10147310 3300026078 Bacteria 2138
1010 Ga0207702_10258165 3300026078 Bacteria 1639
1011 Ga0207702_10443278 3300026078 Bacteria 1259
1012 Ga0207641_10114456 3300026088 Bacteria 2397
1013 Ga0207641_11235290 3300026088 Bacteria 747
1014 Ga0207648_10016708 3300026089 Bacteria 6696
1015 Ga0207648_10045516 3300026089 Bacteria 3849
1016 Ga0207648_10139876 3300026089 Bacteria 2133
1017 Ga0207648_10800775 3300026089 Bacteria 877
1018 Ga0207648_11346495 3300026089 Bacteria 671
1019 Ga0207648_11393178 3300026089 Bacteria 659
1020 Ga0207676_10050850 3300026095 Bacteria 3233
1021 Ga0207676_10181284 3300026095 Bacteria 1844
1022 Ga0207676_10499766 3300026095 Bacteria 1154
1023 Ga0207676_12259996 3300026095 Bacteria 542
1024 Ga0207674_10000518 3300026116 Bacteria 50635
1025 Ga0207674_10021274 3300026116 Bacteria 6991
1026 Ga0207674_10025655 3300026116 Bacteria 6277
1027 Ga0207674_10200273 3300026116 Bacteria 1946
1028 Ga0207674_10234320 3300026116 Bacteria 1783
1029 Ga0207674_10239990 3300026116 Bacteria 1759
1030 Ga0207674_10604124 3300026116 Bacteria 1060
1031 Ga0207675_100098256 3300026118 Bacteria 2757
1032 Ga0207675_100217489 3300026118 Bacteria 1840
1033 Ga0207675_100378755 3300026118 Bacteria 1391
1034 Ga0207675_100503502 3300026118 Bacteria 1206
1035 Ga0207675_100675888 3300026118 Bacteria 1040
1036 Ga0207683_10000668 3300026121 Bacteria 31505
1037 Ga0207683_10037871 3300026121 Bacteria 4201
1038 Ga0207683_10200411 3300026121 Bacteria 1814
1039 Ga0207683_10364513 3300026121 Bacteria 1327
1040 Ga0207698_10009025 3300026142 Bacteria 6333
1041 Ga0207698_10048002 3300026142 Bacteria 3239
1042 Ga0207698_10109583 3300026142 Bacteria 2311
1043 Ga0207698_10176949 3300026142 Bacteria 1885
1044 Ga0207698_10199034 3300026142 Bacteria 1792
1045 Ga0207698_10835692 3300026142 Bacteria 925
1046 Ga0207698_11002755 3300026142 Bacteria 846
1047 Ga0207698_12000202 3300026142 Bacteria 594
1048 Ga0209371_1000506 3300027312 Bacteria 37305
1049 Ga0209371_1003800 3300027312 Bacteria 7016
1050 Ga0209969_1001507 3300027360 Bacteria 3211
1051 Ga0209969_1012546 3300027360 Bacteria 1223
1052 Ga0209969_1048354 3300027360 Bacteria 666
1053 Ga0209967_1001595 3300027364 Bacteria 2910
1054 Ga0210000_1000234 3300027462 Bacteria 7898
1055 Ga0209995_1000807 3300027471 Bacteria 4820
1056 Ga0209995_1025502 3300027471 Bacteria 985
1057 Ga0209968_1048415 3300027526 Bacteria 735
1058 Ga0209999_1012445 3300027543 Bacteria 1541
1059 Ga0209999_1017154 3300027543 Bacteria 1320
1060 Ga0209982_1027778 3300027552 Bacteria 885
1061 Ga0209970_1042959 3300027614 Bacteria 807
1062 Ga0209970_1055800 3300027614 Bacteria 720
1063 Ga0209983_1008174 3300027665 Bacteria 2139
1064 Ga0209983_1011042 3300027665 Bacteria 1847
1065 Ga0209983_1083997 3300027665 Bacteria 715
1066 Ga0209282_1000001 3300027666 Bacteria 2450367
1067 Ga0209971_1004357 3300027682 Bacteria 3362
1068 Ga0209971_1018772 3300027682 Bacteria 1642
1069 Ga0209998_10055701 3300027717 Bacteria 923
1070 Ga0209974_10011244 3300027876 Bacteria 3012
1071 Ga0209974_10315256 3300027876 Bacteria 601
1072 Ga0207428_10001855 3300027907 Bacteria 21581
1073 Ga0207428_10053668 3300027907 Bacteria 3213
1074 Ga0268266_10027108 3300028379 Bacteria 4875
1075 Ga0268266_10082780 3300028379 Bacteria 2800
1076 Ga0268266_10226014 3300028379 Bacteria 1722
1077 Ga0268266_10336067 3300028379 Bacteria 1417
1078 Ga0268265_10000395 3300028380 Bacteria 46647
1079 Ga0268265_10142621 3300028380 Bacteria 2008
1080 Ga0268265_10161153 3300028380 Bacteria 1906
1081 Ga0268265_10202145 3300028380 Bacteria 1724
1082 Ga0268265_10295480 3300028380 Bacteria 1456
1083 Ga0268265_10300919 3300028380 Bacteria 1444
1084 Ga0268265_10800319 3300028380 Bacteria 919
1085 Ga0268265_11987846 3300028380 Bacteria 588
1086 Ga0268264_10002277 3300028381 Bacteria 17007
1087 Ga0268264_10841677 3300028381 Bacteria 918
1088 Ga0307515_10213388 3300028794 Bacteria 1768
1089 Ga0265338_10000692 3300028800 Bacteria 57956
1090 Ga0265338_10001739 3300028800 Bacteria 34426
1091 Ga0268256_1001284 3300030500 Bacteria 15551
1092 Ga0268256_1003682 3300030500 Bacteria 6763
1093 Ga0265767_102088 3300030836 Bacteria 1041
1094 Ga0265767_105420 3300030836 Bacteria 774
1095 Ga0265766_1005155 3300030863 Bacteria 821
1096 Ga0265766_1008702 3300030863 Bacteria 700
1097 Ga0265766_1017675 3300030863 Bacteria 567
1098 Ga0265765_1014967 3300030879 Bacteria 899
1099 Ga0265776_106120 3300030880 Bacteria 645
1100 Ga0265769_116277 3300030888 Bacteria 561
1101 Ga0265769_120167 3300030888 Bacteria 525
1102 Ga0265769_120411 3300030888 Bacteria 523
1103 Ga0247549_101077 3300030942 Bacteria 869
1104 Ga0265774_100709 3300031011 Bacteria 1029
1105 Ga0265773_1022264 3300031018 Bacteria 632
1106 Ga0265330_10069532 3300031235 Bacteria 1524
1107 Ga0265332_10016765 3300031238 Bacteria 3232
1108 Ga0265328_10013367 3300031239 Bacteria 3250
1109 Ga0265328_10367155 3300031239 Bacteria 562
1110 Ga0265320_10049087 3300031240 Bacteria 2056
1111 Ga0265325_10021324 3300031241 Bacteria 3560
1112 Ga0265325_10096364 3300031241 Bacteria 1453
1113 Ga0265329_10012186 3300031242 Bacteria 3100
1114 Ga0265340_10008541 3300031247 Bacteria 5528
1115 Ga0265339_10149325 3300031249 Bacteria 1183
1116 Ga0265331_10005094 3300031250 Bacteria 8020
1117 Ga0265331_10097747 3300031250 Bacteria 1353
1118 Ga0265331_10460101 3300031250 Bacteria 572
1119 Ga0265327_10096364 3300031251 Bacteria 1435
1120 Ga0265316_10034802 3300031344 Bacteria 4090
1121 Ga0265316_10112987 3300031344 Bacteria 2056
1122 Ga0307513_10033342 3300031456 Bacteria 5789
1123 Ga0307408_100019328 3300031548 Bacteria 4586
1124 Ga0307408_100160675 3300031548 Bacteria 1784
1125 Ga0310108_119035 3300031633 Bacteria 644
1126 Ga0310113_124117 3300031636 Bacteria 612
1127 Ga0316575_10134047 3300031665 Bacteria 1017
1128 Ga0316575_10162475 3300031665 Bacteria 924
1129 Ga0316575_10191270 3300031665 Bacteria 851
1130 Ga0316575_10259355 3300031665 Bacteria 730
1131 Ga0316579_10003056 3300031691 Bacteria 6447
1132 Ga0316579_10110036 3300031691 Bacteria 1322
1133 Ga0316579_10358743 3300031691 Bacteria 705
1134 Ga0316579_10388212 3300031691 Bacteria 675
1135 Ga0265314_10003603 3300031711 Bacteria 14898
1136 Ga0265342_10070815 3300031712 Bacteria 2033
1137 Ga0316576_10010708 3300031727 Bacteria 5974
1138 Ga0316576_10071550 3300031727 Bacteria 2558
1139 Ga0316576_10758987 3300031727 Bacteria 700
1140 Ga0316578_10009997 3300031728 Bacteria 4907
1141 Ga0307516_10108622 3300031730 Bacteria 2581
1142 Ga0307405_10051823 3300031731 Bacteria 2548
1143 Ga0307405_10749345 3300031731 Bacteria 813
1144 Ga0316577_10119384 3300031733 Bacteria 1481
1145 Ga0316577_10187892 3300031733 Bacteria 1167
1146 Ga0247548_102148 3300031814 Bacteria 840
1147 Ga0307413_10054441 3300031824 Bacteria 2428
1148 Ga0307413_10067137 3300031824 Bacteria 2241
1149 Ga0307413_11185988 3300031824 Bacteria 663
1150 Ga0307413_12194619 3300031824 Bacteria 501
1151 Ga0307518_10081948 3300031838 Bacteria 2329
1152 Ga0307410_10156697 3300031852 Bacteria 1702
1153 Ga0307406_10062493 3300031901 Bacteria 2409
1154 Ga0307406_10343267 3300031901 Bacteria 1164
1155 Ga0307406_10649791 3300031901 Bacteria 875
1156 Ga0307406_12012218 3300031901 Bacteria 516
1157 Ga0307407_10058816 3300031903 Bacteria 2236
1158 Ga0307412_10000008 3300031911 Bacteria 461034
1159 Ga0307412_10137020 3300031911 Bacteria 1787
1160 Ga0307409_100084410 3300031995 Bacteria 2578
1161 Ga0307409_101033297 3300031995 Bacteria 841
1162 Ga0307409_102650556 3300031995 Bacteria 530
1163 Ga0307416_100146426 3300032002 Bacteria 2157
1164 Ga0307416_100154826 3300032002 Bacteria 2108
1165 Ga0307416_100272793 3300032002 Bacteria 1662
1166 Ga0307416_100366861 3300032002 Bacteria 1464
1167 Ga0307416_101435611 3300032002 Bacteria 796
1168 Ga0307416_102149929 3300032002 Bacteria 660
1169 Ga0307416_103203079 3300032002 Unclassified 548
1170 Ga0307414_10115265 3300032004 Bacteria 2055
1171 Ga0307414_10200044 3300032004 Bacteria 1624
1172 Ga0307411_10089197 3300032005 Bacteria 2147
1173 Ga0307411_10600712 3300032005 Bacteria 946
1174 Ga0307411_10614311 3300032005 Bacteria 936
1175 Ga0307411_10679181 3300032005 Bacteria 895
1176 Ga0316053_108651 3300032120 Bacteria 690
1177 Ga0316583_10040682 3300032133 Bacteria 1646
1178 Ga0316583_10099769 3300032133 Bacteria 1012
1179 Ga0316583_10119472 3300032133 Bacteria 919
1180 Ga0316583_10211499 3300032133 Bacteria 673
1181 Ga0316585_10005778 3300032137 Bacteria 3504
1182 Ga0316585_10069217 3300032137 Bacteria 1144
1183 Ga0316585_10197000 3300032137 Bacteria 666
1184 Ga0316593_10000361 3300032168 Bacteria 8014
1185 Ga0316593_10007195 3300032168 Bacteria 3048
1186 Ga0316593_10022315 3300032168 Bacteria 1988
1187 Ga0316593_10048682 3300032168 Bacteria 1427
1188 Ga0316593_10053230 3300032168 Bacteria 1371
1189 Ga0316593_10253313 3300032168 Bacteria 659
1190 Ga0316593_10430795 3300032168 Bacteria 513
1191 Ga0307510_10124828 3300033180 Bacteria 2267
1192 Ga0316592_1015277 3300033524 Bacteria 1597
1193 Ga0316592_1090047 3300033524 Bacteria 701
1194 Ga0316586_1006608 3300033527 Bacteria 1668
1195 Ga0316588_1130265 3300033528 Bacteria 639
1196 Ga0316588_1219715 3300033528 Bacteria 500
1197 Ga0316587_1002789 3300033529 Bacteria 2378
1198 Ga0316587_1005542 3300033529 Bacteria 1897
1199 Ga0316587_1005922 3300033529 Bacteria 1851
1200 Ga0316587_1006744 3300033529 Bacteria 1765
1201 Ga0316587_1012346 3300033529 Bacteria 1388
1202 Ga0316587_1030581 3300033529 Bacteria 950
1203 Ga0316587_1085927 3300033529 Bacteria 597
1204 Ga0316596_1018273 3300033541 Bacteria 1771
1205 Ga0316596_1018300 3300033541 Bacteria 1770
1206 Ga0316596_1022203 3300033541 Bacteria 1621
1207 Ga0316596_1024541 3300033541 Bacteria 1548
1208 Ga0316596_1024641 3300033541 Bacteria 1545
1209 Ga0316596_1027601 3300033541 Bacteria 1465
1210 Ga0316596_1028569 3300033541 Bacteria 1442
1211 Ga0316596_1035767 3300033541 Bacteria 1298
1212 Ga0316596_1053987 3300033541 Bacteria 1066
1213 Ga0316596_1094113 3300033541 Bacteria 808
1214 Ga0316596_1123332 3300033541 Bacteria 706
1215 Ga0316596_1152039 3300033541 Bacteria 636
1216 Ga0373930_0085821 3300034816 Bacteria 733
1217 Ga0373948_0153039 3300034817 Bacteria 577
1218 Ga0373938_0184962 3300034957 Bacteria 571
1219 Ga0373938_0208712 3300034957 Bacteria 544
1220 Ga0373940_0283470 3300035088 Bacteria 566
1221 Ga0373949_0303260 3300035090 Bacteria 507
1222 Ga0373951_0039078 3300035091 Bacteria 1140
1223 Ga0373951_0225601 3300035091 Bacteria 555
1224 Ga0373952_0000792 3300035092 Bacteria 5684
1225 Ga0373923_0147708 3300035111 Bacteria 1066
1226 Ga0373932_0089968 3300035112 Bacteria 983
1227 Ga0373932_0097006 3300035112 Bacteria 954
1228 Ga0373945_0413339 3300035116 Unclassified 592
1229 Ga0373954_0489304 3300035118 Bacteria 609
1230 Ga0373957_0482369 3300035120 Bacteria 539
1231 Ga0373960_0101288 3300035121 Bacteria 934
1232 Ga0373960_0273068 3300035121 Bacteria 621
1233 Ga0373942_0077279 3300035207 Bacteria 982
1234 Ga0373942_0127178 3300035207 Bacteria 801
1235 Ga0316574_0002731 3300035398 Bacteria 8940
1236 Ga0316574_0037143 3300035398 Bacteria 2986
1237 Ga0316574_0040060 3300035398 Bacteria 2883
1238 Ga0316574_0049546 3300035398 Bacteria 2612
1239 Ga0316574_0068932 3300035398 Bacteria 2231
1240 Ga0316574_0161833 3300035398 Bacteria 1441
1241 Ga0316574_0181279 3300035398 Bacteria 1355
1242 Ga0316574_0475537 3300035398 Bacteria 781
1243 Ga0316574_0493217 3300035398 Bacteria 764
1244 Ga0316574_0554990 3300035398 Bacteria 713
1245 Ga0316574_0802057 3300035398 Bacteria 573
1246 Ga0373931_0098346 3300035691 Bacteria 1642
1247 Ga0373931_0107397 3300035691 Bacteria 1579
1248 Ga0373931_0149538 3300035691 Bacteria 1360
1249 Ga0373931_0178958 3300035691 Bacteria 1255
1250 Ga0373931_0811266 3300035691 Bacteria 624
1251 Ga0373927_0802008 3300035695 Bacteria 622
1252 Ga0373933_1027120 3300035724 Bacteria 543
1253 Ga0373937_0109075 3300036401 Bacteria 2574
1254 Ga0373937_0293103 3300036401 Bacteria 1537
1255 Ga0373937_0891476 3300036401 Bacteria 838
1256 Ga0373937_1737440 3300036401 Bacteria 571
1257 Ga0310112_024546 3300036458 Bacteria 837
1258 Ga0310109_027908 3300036534 Bacteria 752
1259 Ga0310110_018599 3300036535 Bacteria 973
1260 Ga0316582_0016790 3300036647 Bacteria 4219
1261 Ga0316582_0028834 3300036647 Bacteria 3367
1262 Ga0316582_0030603 3300036647 Bacteria 3280
1263 Ga0316582_0035296 3300036647 Bacteria 3086
1264 Ga0316582_0043553 3300036647 Bacteria 2816
1265 Ga0316582_0243649 3300036647 Bacteria 1232
1266 Ga0316582_0274836 3300036647 Bacteria 1156
1267 Ga0316582_0279479 3300036647 Bacteria 1146
1268 Ga0316582_0369298 3300036647 Bacteria 987
1269 Ga0316582_0893055 3300036647 Bacteria 608
1270 Ga0316582_0982471 3300036647 Bacteria 576
1271 Ga0316582_1120467 3300036647 Bacteria 536
1272 Ga0316584_0002080 3300036712 Bacteria 12539
1273 Ga0316584_0026514 3300036712 Bacteria 4260
1274 Ga0316584_0048003 3300036712 Bacteria 3190
1275 Ga0316584_0064885 3300036712 Bacteria 2735
1276 Ga0316584_0192676 3300036712 Bacteria 1506
1277 Ga0316584_0365296 3300036712 Unclassified 1034
1278 Ga0316584_0632277 3300036712 Bacteria 739
1279 Ga0373925_0465568 3300037068 Bacteria 1036
1280 Ga0395899_0000029 3300037312 Bacteria 329371
1281 Ga0395899_0037055 3300037312 Bacteria 3656
1282 Ga0395899_0187825 3300037312 Bacteria 1447
1283 Ga0395899_0278458 3300037312 Bacteria 1139
1284 Ga0395900_0000085 3300037418 Bacteria 172265
1285 Ga0395900_0004512 3300037418 Bacteria 14731
1286 Ga0395900_0041887 3300037418 Bacteria 4719
1287 Ga0395900_0081759 3300037418 Bacteria 3318
1288 Ga0395900_1137061 3300037418 Bacteria 697
1289 Ga0395898_0000086 3300037466 Bacteria 239895
1290 Ga0395898_0025032 3300037466 Bacteria 6017
1291 Ga0395898_0151376 3300037466 Bacteria 2219
1292 Ga0395898_0277571 3300037466 Bacteria 1598
1293 Ga0395905_0000206 3300037471 Bacteria 91775
1294 Ga0395905_0009326 3300037471 Bacteria 9599
1295 Ga0395905_0024135 3300037471 Bacteria 5739
1296 Ga0395905_0069139 3300037471 Bacteria 3307
1297 Ga0395905_0493851 3300037471 Bacteria 1124
1298 Ga0395905_0790199 3300037471 Bacteria 852
1299 Ga0395905_0840326 3300037471 Bacteria 821
1300 Ga0316581_0001335 3300037588 Bacteria 5480
1301 Ga0316581_0120728 3300037588 Bacteria 808
1302 Ga0436364_0870173 3300037853 Bacteria 611
1303 Ga0436364_1034295 3300037853 Bacteria 2987
1304 Ga0395901_0000104 3300038443 Bacteria 114939
1305 Ga0395901_0000592 3300038443 Bacteria 42272
1306 Ga0395901_0003716 3300038443 Bacteria 15380
1307 Ga0395901_0006585 3300038443 Bacteria 11737
1308 Ga0395901_0013420 3300038443 Bacteria 8328
1309 Ga0395901_0109255 3300038443 Bacteria 2904
1310 Ga0395901_0225134 3300038443 Bacteria 1959
1311 Ga0395901_0260641 3300038443 Bacteria 1804
1312 Ga0395901_1831331 3300038443 Bacteria 556
1313 Ga0400490_41985 3300038726 Bacteria 2040
1314 Ga0400486_21858 3300038742 Bacteria 1879
1315 Ga0400483_084617 3300039062 Bacteria 1282
1316 Ga0436365_0475849 3300039437 Bacteria 2037
1317 Ga0436365_0821095 3300039437 Bacteria 2453
1318 Ga0436360_0483198 3300039438 Bacteria 1265
1319 Ga0436360_1217037 3300039438 Bacteria 760
1320 Ga0436361_0186356 3300039447 Bacteria 2502
1321 Ga0436361_0602607 3300039447 Bacteria 596
1322 Ga0436361_0841103 3300039447 Bacteria 2400
1323 Ga0436361_0949341 3300039447 Bacteria 946
1324 Ga0436363_0085530 3300039450 Bacteria 923
1325 Ga0436362_1253569 3300039453 Bacteria 1125
1326 Ga0439438_067666 3300041405 Bacteria 887
1327 Ga0439466_0062487 3300041411 Bacteria 1197
1328 Ga0451798_1012432 3300041458 Bacteria 795
1329 Ga0451802_0139250 3300041460 Bacteria 905
1330 Ga0451802_0142920 3300041460 Bacteria 1023
1331 Ga0451802_0771863 3300041460 Bacteria 504
1332 Ga0451833_0582454 3300041491 Bacteria 867
1333 Ga0451845_0442828 3300041501 Bacteria 740
1334 Ga0439441_015651 3300042001 Bacteria 1344
1335 Ga0439441_115838 3300042001 Bacteria 611
1336 Ga0439448_0007343 3300042005 Bacteria 3190
1337 Ga0439432_052820 3300042006 Bacteria 1265
1338 Ga0439450_181802 3300042008 Bacteria 559
1339 Ga0439451_018101 3300042009 Bacteria 1421
1340 Ga0439462_0037132 3300042015 Bacteria 1297
1341 Ga0450920_016025 3300042122 Bacteria 1427
1342 Ga0450923_019390 3300042125 Bacteria 1310
1343 Ga0450923_102140 3300042125 Bacteria 662
1344 Ga0450898_031674 3300042134 Bacteria 973
1345 Ga0439458_0212365 3300042157 Bacteria 532
1346 Ga0439434_0114362 3300042435 Bacteria 876
1347 Ga0439444_0052595 3300042437 Bacteria 832
1348 Ga0439464_0049073 3300042439 Bacteria 1217
1349 Ga0439464_0183230 3300042439 Bacteria 664
1350 Ga0439460_0052243 3300042461 Bacteria 1228
1351 Ga0439460_0146061 3300042461 Bacteria 787
1352 Ga0451577_0012652 3300042876 Bacteria 7918
1353 Ga0451577_0128687 3300042876 Bacteria 2270
1354 Ga0451577_0272807 3300042876 Bacteria 1532
1355 Ga0451577_0333524 3300042876 Bacteria 1376
1356 Ga0451577_0404485 3300042876 Bacteria 1239
1357 Ga0466969_0007576 3300044656 Bacteria 5767
1358 Ga0466969_0038644 3300044656 Bacteria 2400
1359 Ga0466969_0495268 3300044656 Bacteria 557
1360 Ga0466972_0099947 3300044658 Bacteria 1373
1361 Ga0466972_0133389 3300044658 Bacteria 1169
1362 Ga0466973_0345251 3300044659 Bacteria 960
1363 Ga0466977_0059828 3300044666 Bacteria 2500
1364 Ga0466980_0103120 3300044668 Bacteria 1954
1365 Ga0453683_0024196 3300044673 Bacteria 3867
1366 Ga0453683_0032697 3300044673 Bacteria 3281
1367 Ga0453683_0108687 3300044673 Bacteria 1743
1368 Ga0466965_0001015 3300044683 Bacteria 10856
1369 Ga0466965_0107515 3300044683 Bacteria 1431
1370 Ga0466965_0651967 3300044683 Bacteria 601
1371 Ga0466966_0000005 3300044684 Bacteria 193939
1372 Ga0466966_0007421 3300044684 Bacteria 7275
1373 Ga0466966_0038430 3300044684 Bacteria 3085
1374 Ga0466966_0181384 3300044684 Bacteria 1277
1375 Ga0466961_0005719 3300044693 Bacteria 7869
1376 Ga0466961_0029933 3300044693 Bacteria 3497
1377 Ga0466961_0175446 3300044693 Bacteria 1332
1378 Ga0466961_0205175 3300044693 Bacteria 1218
1379 Ga0466961_0244110 3300044693 Bacteria 1103
1380 Ga0466963_0027515 3300044694 Bacteria 3642
1381 Ga0466963_0074012 3300044694 Bacteria 2297
1382 Ga0466963_0201770 3300044694 Bacteria 1391
1383 Ga0466963_0342758 3300044694 Bacteria 1052
1384 Ga0466963_0598664 3300044694 Bacteria 779
1385 Ga0466964_0102205 3300044706 Bacteria 1265
1386 Ga0466964_0193626 3300044706 Bacteria 972
1387 Ga0453684_0000195 3300044712 Bacteria 265496
1388 Ga0453684_0000331 3300044712 Bacteria 197952
1389 Ga0453684_0148264 3300044712 Bacteria 2791
1390 Ga0453684_1284049 3300044712 Bacteria 764
1391 Ga0453684_2076795 3300044712 Bacteria 570
1392 Ga0453684_2093068 3300044712 Bacteria 568
1393 Ga0453684_2346524 3300044712 Bacteria 529
1394 Ga0466971_0000244 3300044719 Bacteria 20819
1395 Ga0466971_0004178 3300044719 Bacteria 6221
1396 Ga0466968_0067503 3300044735 Bacteria 1551
1397 Ga0466968_0279752 3300044735 Bacteria 798
1398 Ga0466970_0067366 3300044765 Bacteria 1922
1399 Ga0466970_0154903 3300044765 Bacteria 1266
1400 Ga0466970_0170662 3300044765 Bacteria 1205
1401 Ga0466970_0893307 3300044765 Bacteria 522
1402 Ga0466957_0060226 3300044842 Bacteria 2327
1403 Ga0466957_0125561 3300044842 Bacteria 1639
1404 Ga0466957_0135864 3300044842 Bacteria 1580
1405 Ga0466957_0141228 3300044842 Bacteria 1551
1406 Ga0466957_0316185 3300044842 Bacteria 1052
1407 Ga0466957_0417979 3300044842 Bacteria 919
1408 Ga0466957_0510550 3300044842 Bacteria 834
1409 Ga0466957_0973498 3300044842 Bacteria 608
1410 Ga0466960_0072353 3300044901 Bacteria 1718
1411 Ga0466960_0078891 3300044901 Bacteria 1654
1412 Ga0466959_0025614 3300045049 Bacteria 4373
1413 Ga0466959_0029242 3300045049 Bacteria 4083
1414 Ga0466959_0425135 3300045049 Bacteria 901
1415 Ga0451576_0006371 3300045051 Bacteria 14494
1416 Ga0451576_0016776 3300045051 Bacteria 8073
1417 Ga0451576_0058227 3300045051 Bacteria 4038
1418 Ga0451576_0125653 3300045051 Bacteria 2672
1419 Ga0451576_0345693 3300045051 Bacteria 1557
1420 Ga0451576_0368977 3300045051 Bacteria 1504
1421 Ga0451576_0436543 3300045051 Bacteria 1374
1422 Ga0451576_1120471 3300045051 Bacteria 823
1423 Ga0451576_1122632 3300045051 Bacteria 822
1424 Ga0451576_2158582 3300045051 Bacteria 572
1425 Ga0466958_0014918 3300045836 Bacteria 4442
1426 Ga0466958_0111543 3300045836 Bacteria 1707
1427 Ga0466958_0209264 3300045836 Bacteria 1242
1428 Ga0466958_0334854 3300045836 Bacteria 973
1429 Ga0466958_0705954 3300045836 Bacteria 657
1430 Ga0466967_0135710 3300045976 Bacteria 2288
1431 Ga0466967_0489823 3300045976 Bacteria 1205
1432 Ga0466967_0511870 3300045976 Bacteria 1179
1433 Ga0466967_0676319 3300045976 Bacteria 1022
1434 Ga0466967_1355507 3300045976 Bacteria 708
1435 Ga0495603_0003010 3300046455 Bacteria 9982
1436 Ga0495603_0029293 3300046455 Bacteria 3320
1437 Ga0495590_0006590 3300046457 Bacteria 4524
1438 Ga0495590_0122072 3300046457 Bacteria 934
1439 Ga0495591_047806 3300046458 Bacteria 1183
1440 Ga0495629_0003843 3300046459 Bacteria 11329
1441 Ga0495629_0031071 3300046459 Bacteria 3783
1442 Ga0495629_0383377 3300046459 Bacteria 956
1443 Ga0495638_0115055 3300046460 Bacteria 1594
1444 Ga0495638_0168290 3300046460 Bacteria 1259
1445 Ga0495653_0131466 3300046463 Bacteria 1771
1446 Ga0495653_0593494 3300046463 Bacteria 681
1447 Ga0495650_0000224 3300046471 Bacteria 118058
1448 Ga0495650_0017045 3300046471 Bacteria 3653
1449 Ga0495650_0017850 3300046471 Bacteria 3544
1450 Ga0495580_0000102 3300046472 Bacteria 57201
1451 Ga0495580_0010696 3300046472 Bacteria 7126
1452 Ga0495580_0185159 3300046472 Bacteria 1437
1453 Ga0495580_0465097 3300046472 Bacteria 847
1454 Ga0495582_0361988 3300046473 Bacteria 835
1455 Ga0495605_0032818 3300046474 Bacteria 2640
1456 Ga0495605_0051406 3300046474 Bacteria 2007
1457 Ga0495605_0152338 3300046474 Bacteria 1031
1458 Ga0495662_0099054 3300046476 Bacteria 1425
1459 Ga0495662_0158796 3300046476 Bacteria 1114
1460 Ga0495662_0271034 3300046476 Bacteria 835
1461 Ga0495664_0075653 3300046477 Bacteria 2014
1462 Ga0495664_0446686 3300046477 Bacteria 774
1463 Ga0495584_0017143 3300046491 Bacteria 3691
1464 Ga0495584_0236515 3300046491 Bacteria 929
1465 Ga0495584_0393320 3300046491 Bacteria 704
1466 Ga0495585_0048322 3300046492 Bacteria 2366
1467 Ga0495594_0612746 3300046499 Bacteria 617
1468 Ga0495596_0070852 3300046500 Bacteria 1354
1469 Ga0495607_0003935 3300046501 Bacteria 11183
1470 Ga0495607_0304065 3300046501 Bacteria 750
1471 Ga0495583_0005764 3300046506 Bacteria 8283
1472 Ga0495583_0009849 3300046506 Bacteria 5658
1473 Ga0495583_0033761 3300046506 Bacteria 2458
1474 Ga0495583_0121288 3300046506 Bacteria 1100
1475 Ga0495606_0000549 3300046507 Bacteria 60133
1476 Ga0495606_0032364 3300046507 Bacteria 3623
1477 Ga0495606_0101709 3300046507 Bacteria 1748
1478 Ga0495606_0103958 3300046507 Bacteria 1724
1479 Ga0495608_0044694 3300046511 Bacteria 2955
1480 Ga0495610_0077838 3300046512 Bacteria 1531
1481 Ga0495616_0038911 3300046513 Bacteria 2439
1482 Ga0495616_0064795 3300046513 Bacteria 1782
1483 Ga0495618_0005352 3300046514 Bacteria 7830
1484 Ga0495620_0013524 3300046515 Bacteria 4176
1485 Ga0495620_0108112 3300046515 Bacteria 1104
1486 Ga0495628_0232777 3300046516 Bacteria 1380
1487 Ga0495628_0596769 3300046516 Bacteria 789
1488 Ga0495630_0019419 3300046517 Bacteria 4996
1489 Ga0495630_0159190 3300046517 Bacteria 1719
1490 Ga0495630_0553436 3300046517 Bacteria 882
1491 Ga0495630_0925325 3300046517 Bacteria 664
1492 Ga0495632_0217988 3300046519 Bacteria 864
1493 Ga0495643_0117075 3300046522 Bacteria 1349
1494 Ga0495643_0369535 3300046522 Bacteria 638
1495 Ga0495648_0036697 3300046524 Bacteria 3157
1496 Ga0495648_0064495 3300046524 Bacteria 2157
1497 Ga0495666_0006981 3300046526 Bacteria 5671
1498 Ga0495666_0331613 3300046526 Bacteria 686
1499 Ga0495642_0021794 3300046528 Bacteria 2522
1500 Ga0495642_0079669 3300046528 Bacteria 1377
1501 Ga0495642_0324585 3300046528 Bacteria 675
1502 Ga0495642_0368290 3300046528 Bacteria 632
1503 Ga0495652_0018942 3300046529 Bacteria 6133
1504 Ga0495652_0342583 3300046529 Bacteria 1073
1505 Ga0495654_0019534 3300046530 Bacteria 3544
1506 Ga0495654_0060101 3300046530 Bacteria 1827
1507 Ga0495665_0014430 3300046531 Bacteria 4261
1508 Ga0495665_0492809 3300046531 Bacteria 617
1509 Ga0495640_0234002 3300046533 Bacteria 1154
1510 Ga0495586_0008387 3300046535 Bacteria 5499
1511 Ga0495586_0047317 3300046535 Bacteria 2321
1512 Ga0495586_0416697 3300046535 Bacteria 773
1513 Ga0495587_0030449 3300046536 Bacteria 3272
1514 Ga0495598_0031043 3300046537 Bacteria 1501
1515 Ga0495609_0000474 3300046538 Bacteria 32477
1516 Ga0495609_0058393 3300046538 Bacteria 1706
1517 Ga0495621_0029506 3300046539 Bacteria 1870
1518 Ga0495597_0047779 3300046542 Bacteria 1894
1519 Ga0495597_0131855 3300046542 Bacteria 1036
1520 Ga0495645_0001442 3300046543 Bacteria 16052
1521 Ga0495645_0101673 3300046543 Bacteria 2043
1522 Ga0495645_0401509 3300046543 Bacteria 873
1523 Ga0495622_0000206 3300046557 Bacteria 46650
1524 Ga0495622_0024818 3300046557 Bacteria 2799
1525 Ga0495622_0083637 3300046557 Bacteria 1468
1526 Ga0495622_0108793 3300046557 Bacteria 1269
1527 Ga0495667_0131309 3300046559 Bacteria 1615
1528 Ga0495656_0141036 3300046615 Bacteria 1156
1529 Ga0495668_0000028 3300046616 Bacteria 286629
1530 Ga0495668_0007007 3300046616 Bacteria 7280
1531 Ga0495668_0024485 3300046616 Bacteria 3433
1532 Ga0495668_0346822 3300046616 Bacteria 815
1533 Ga0495611_0027706 3300046648 Bacteria 2478
1534 Ga0495611_0154967 3300046648 Bacteria 1070
1535 Ga0495611_0270364 3300046648 Bacteria 786
1536 Ga0495625_0380382 3300046660 Bacteria 886
1537 Ga0495635_0097010 3300046663 Bacteria 2015
1538 Ga0495635_0538547 3300046663 Bacteria 766
1539 Ga0495659_0000736 3300046664 Bacteria 11745
1540 Ga0495659_0177530 3300046664 Bacteria 866
1541 Ga0495659_0547058 3300046664 Bacteria 510
1542 Ga0495661_0017640 3300046665 Bacteria 4710
1543 Ga0495661_0023120 3300046665 Bacteria 4039
1544 Ga0495588_0308809 3300046674 Bacteria 832
1545 Ga0495588_0338299 3300046674 Bacteria 791
1546 Ga0495657_0162428 3300046675 Bacteria 1381
1547 Ga0495657_0838622 3300046675 Bacteria 524
1548 Ga0495599_0006192 3300046678 Bacteria 7213
1549 Ga0495599_0048822 3300046678 Bacteria 2653
1550 Ga0495599_0779503 3300046678 Bacteria 547
1551 Ga0495623_0001428 3300046679 Bacteria 16190
1552 Ga0495623_0045944 3300046679 Bacteria 2772
1553 Ga0495646_0007988 3300046680 Bacteria 6723
1554 Ga0495646_0164634 3300046680 Bacteria 1225
1555 Ga0495646_0219294 3300046680 Bacteria 1029
1556 Ga0495658_0008882 3300046683 Bacteria 4997
1557 Ga0495669_0002022 3300046684 Bacteria 8308
1558 Ga0495669_0030511 3300046684 Bacteria 2367
1559 Ga0495669_0210139 3300046684 Bacteria 931
1560 Ga0495669_0230982 3300046684 Bacteria 887
1561 Ga0495669_0629965 3300046684 Bacteria 521
1562 Ga0495624_0022277 3300046690 Bacteria 4191
1563 Ga0495624_0262928 3300046690 Bacteria 1042
1564 Ga0495670_0045783 3300046691 Bacteria 2184
1565 Ga0495671_0015472 3300046692 Bacteria 4086
1566 Ga0495671_0132470 3300046692 Bacteria 1215
1567 Ga0495649_0011346 3300046694 Bacteria 5231
1568 Ga0495649_0049978 3300046694 Bacteria 2270
1569 Ga0495649_0072687 3300046694 Bacteria 1843
1570 Ga0495649_0232797 3300046694 Bacteria 950
1571 Ga0495589_0001053 3300046794 Bacteria 16591
1572 Ga0495589_0023233 3300046794 Bacteria 3161
1573 Ga0495589_0361350 3300046794 Bacteria 668
1574 Ga0495600_0073258 3300046809 Bacteria 2236
1575 Ga0495600_0266881 3300046809 Bacteria 1086
1576 Ga0495600_0642873 3300046809 Bacteria 642
1577 Ga0495660_0048313 3300046810 Bacteria 2327
1578 Ga0495660_0155617 3300046810 Bacteria 1125
1579 Ga0495604_0060759 3300047317 Bacteria 2892
1580 Ga0495636_0032063 3300047318 Bacteria 2154
1581 Ga0495636_0379590 3300047318 Bacteria 671
1582 Ga0495674_0024131 3300047319 Bacteria 5595
1583 Ga0495674_0211866 3300047319 Bacteria 1604
1584 Ga0495674_0506112 3300047319 Bacteria 965
1585 Ga0495672_0000021 3300047320 Bacteria 422795
1586 Ga0495672_0025674 3300047320 Bacteria 3766
1587 Ga0495672_0031323 3300047320 Bacteria 3321
1588 Ga0495672_0214821 3300047320 Bacteria 953
1589 Ga0495676_0113135 3300047321 Bacteria 1987
1590 Ga0495680_0021527 3300047322 Bacteria 5395
1591 Ga0495680_0122818 3300047322 Bacteria 1916
1592 Ga0495680_0261658 3300047322 Bacteria 1223
1593 Ga0495683_0013523 3300047323 Bacteria 4265
1594 Ga0495683_0022267 3300047323 Bacteria 3258
1595 Ga0495683_0032118 3300047323 Bacteria 2674
1596 Ga0495687_000015 3300047443 Bacteria 365627
1597 Ga0495687_027203 3300047443 Bacteria 2679
1598 Ga0495675_0005478 3300047444 Bacteria 7744
1599 Ga0495677_0007397 3300047445 Bacteria 4108
1600 Ga0495677_0183169 3300047445 Bacteria 812
1601 Ga0495677_0290334 3300047445 Bacteria 642
1602 Ga0495679_002832 3300047446 Bacteria 8597
1603 Ga0495679_033687 3300047446 Bacteria 1634
1604 Ga0495679_080529 3300047446 Bacteria 925
1605 Ga0495685_010565 3300047447 Bacteria 3099
1606 Ga0495685_097742 3300047447 Bacteria 970
1607 Ga0495685_117472 3300047447 Bacteria 874
1608 Ga0495673_0009134 3300047469 Bacteria 5502
1609 Ga0495673_0020433 3300047469 Bacteria 3296
1610 Ga0495681_0010575 3300047470 Bacteria 5580
1611 Ga0495681_0092125 3300047470 Bacteria 1336
1612 Ga0495681_0164344 3300047470 Bacteria 922
1613 Ga0495684_0213544 3300047471 Bacteria 1417
1614 Ga0495686_0000076 3300047472 Bacteria 206039
1615 Ga0495686_0008093 3300047472 Bacteria 7777
1616 Ga0495686_0141647 3300047472 Bacteria 1418
1617 Ga0495593_0013978 3300047673 Bacteria 4573
1618 Ga0495602_0076445 3300048088 Bacteria 2836
1619 Ga0495602_0130396 3300048088 Bacteria 2006
1620 Ga0495614_0006763 3300048089 Bacteria 5128
1621 Ga0495626_0026600 3300048091 Bacteria 2817
1622 Ga0496100_0005704 3300048903 Bacteria 6734
1623 Ga0496100_0044832 3300048903 Bacteria 2835
1624 Ga0496100_0089496 3300048903 Bacteria 2097
1625 Ga0496100_0156284 3300048903 Bacteria 1631
1626 Ga0496100_0163444 3300048903 Bacteria 1597
1627 Ga0496100_0452627 3300048903 Bacteria 984
1628 Ga0496101_0333797 3300048904 Bacteria 1190
1629 Ga0496101_0388397 3300048904 Bacteria 1098
1630 Ga0496101_0435084 3300048904 Bacteria 1034
1631 Ga0496101_0440060 3300048904 Bacteria 1028
1632 Ga0496101_0710969 3300048904 Bacteria 793
1633 Ga0496101_0891521 3300048904 Bacteria 700
1634 Ga0496102_0000728 3300048905 Bacteria 32366
1635 Ga0496102_0019771 3300048905 Bacteria 5936
1636 Ga0496102_0034126 3300048905 Bacteria 4575
1637 Ga0496102_0269146 3300048905 Bacteria 1606
1638 Ga0496102_0343789 3300048905 Bacteria 1405
1639 Ga0496102_0680551 3300048905 Bacteria 952
1640 Ga0496102_0711240 3300048905 Bacteria 927
1641 Ga0496103_0003258 3300048906 Bacteria 9947
1642 Ga0496103_0077124 3300048906 Bacteria 2092
1643 Ga0496103_0094623 3300048906 Bacteria 1887
1644 Ga0496103_0113851 3300048906 Bacteria 1719
1645 Ga0496103_0347261 3300048906 Bacteria 954
1646 Ga0496104_0070267 3300048907 Bacteria 3328
1647 Ga0496104_0115324 3300048907 Bacteria 2577
1648 Ga0496104_0173067 3300048907 Bacteria 2070
1649 Ga0496104_0189831 3300048907 Bacteria 1966
1650 Ga0496104_0255372 3300048907 Bacteria 1665
1651 Ga0496104_0287439 3300048907 Bacteria 1557
1652 Ga0496104_0908851 3300048907 Bacteria 785
1653 Ga0496105_0300066 3300048908 Bacteria 1291
1654 Ga0496105_0321714 3300048908 Bacteria 1240
1655 Ga0496105_0378503 3300048908 Bacteria 1127
1656 Ga0496105_0401037 3300048908 Bacteria 1089
1657 Ga0496105_0426398 3300048908 Bacteria 1049
1658 Ga0496105_0961852 3300048908 Bacteria 641
1659 Ga0496105_1136125 3300048908 Bacteria 578
1660 Ga0496105_1231958 3300048908 Bacteria 549
1661 Ga0496106_0000023 3300048909 Bacteria 165457
1662 Ga0496106_0003495 3300048909 Bacteria 11705
1663 Ga0496106_0007426 3300048909 Bacteria 8098
1664 Ga0496106_0014546 3300048909 Bacteria 5814
1665 Ga0496106_0596126 3300048909 Bacteria 885
1666 Ga0496106_0637280 3300048909 Bacteria 852
1667 Ga0496107_0044617 3300048910 Bacteria 3187
1668 Ga0496107_0053370 3300048910 Bacteria 2916
1669 Ga0496107_0232328 3300048910 Bacteria 1372
1670 Ga0496107_0243300 3300048910 Bacteria 1339
1671 Ga0496108_0002023 3300048911 Bacteria 16235
1672 Ga0496108_0288774 3300048911 Bacteria 1428
1673 Ga0496108_0413577 3300048911 Bacteria 1178
1674 Ga0496108_0806921 3300048911 Bacteria 809
1675 Ga0496108_0996643 3300048911 Bacteria 716
1676 Ga0496108_1384631 3300048911 Bacteria 589
1677 Ga0496108_1616843 3300048911 Bacteria 536
1678 Ga0496109_0003005 3300048912 Bacteria 14079
1679 Ga0496109_0127039 3300048912 Bacteria 2377
1680 Ga0496109_0129605 3300048912 Bacteria 2354
1681 Ga0496109_0161025 3300048912 Bacteria 2102
1682 Ga0496109_0333293 3300048912 Bacteria 1433
1683 Ga0496109_0668046 3300048912 Bacteria 976
1684 Ga0496110_0008942 3300048913 Bacteria 8077
1685 Ga0496110_0009344 3300048913 Bacteria 7933
1686 Ga0496110_0166617 3300048913 Bacteria 1998
1687 Ga0496110_0450359 3300048913 Bacteria 1173
1688 Ga0496110_0596788 3300048913 Bacteria 1002
1689 Ga0496110_0762495 3300048913 Bacteria 871
1690 Ga0496110_1411378 3300048913 Bacteria 606
1691 Ga0496110_1442358 3300048913 Bacteria 598
1692 Ga0496111_0009231 3300048914 Bacteria 6572
1693 Ga0496111_0501220 3300048914 Bacteria 894
1694 Ga0496112_0379519 3300048915 Bacteria 1355
1695 Ga0496112_0383309 3300048915 Bacteria 1347
1696 Ga0496112_0544798 3300048915 Bacteria 1094
1697 Ga0496112_0551366 3300048915 Bacteria 1086
1698 Ga0496112_0777514 3300048915 Bacteria 883
1699 Ga0496113_0017415 3300048916 Bacteria 4987
1700 Ga0496113_0045203 3300048916 Bacteria 3265
1701 Ga0496113_0211136 3300048916 Bacteria 1545
1702 Ga0496113_0267767 3300048916 Bacteria 1365
1703 Ga0496113_0417348 3300048916 Bacteria 1078
1704 Ga0496113_0860781 3300048916 Bacteria 718
1705 Ga0496113_0929113 3300048916 Bacteria 687
1706 Ga0496114_0001789 3300048917 Bacteria 16306
1707 Ga0496114_0002868 3300048917 Bacteria 13211
1708 Ga0496114_0046362 3300048917 Bacteria 3612
1709 Ga0496114_0047933 3300048917 Bacteria 3554
1710 Ga0496114_0358364 3300048917 Bacteria 1290
1711 Ga0496114_0485547 3300048917 Bacteria 1093
1712 Ga0496114_0968744 3300048917 Bacteria 733
1713 Ga0496115_0038262 3300048918 Bacteria 3806
1714 Ga0496115_0181681 3300048918 Bacteria 1739
1715 Ga0496115_0188308 3300048918 Bacteria 1705
1716 Ga0496115_0601289 3300048918 Bacteria 874
1717 Ga0496115_1422479 3300048918 Bacteria 511
1718 Ga0496116_0004799 3300048919 Bacteria 12758
1719 Ga0496116_0042050 3300048919 Bacteria 3129
1720 Ga0496116_0100985 3300048919 Bacteria 1723
1721 Ga0496116_0288017 3300048919 Bacteria 790
1722 Ga0496117_0000800 3300048920 Bacteria 48902
1723 Ga0496117_0001551 3300048920 Bacteria 32632
1724 Ga0496117_0094414 3300048920 Bacteria 1914
1725 Ga0496117_0593296 3300048920 Bacteria 519
1726 Ga0496118_0000916 3300048921 Bacteria 46090
1727 Ga0496118_0003442 3300048921 Bacteria 19919
1728 Ga0496118_0004447 3300048921 Bacteria 16621
1729 Ga0496118_0149258 3300048921 Bacteria 1466
1730 Ga0496118_0159892 3300048921 Bacteria 1395
1731 Ga0496118_0161558 3300048921 Bacteria 1384
1732 Ga0496118_0377067 3300048921 Bacteria 745
1733 Ga0496119_0000916 3300048922 Bacteria 38180
1734 Ga0496119_0042497 3300048922 Bacteria 2881
1735 Ga0496119_0296126 3300048922 Bacteria 799
1736 Ga0496120_0215252 3300048923 Bacteria 921
1737 Ga0496121_0003621 3300048924 Bacteria 21786
1738 Ga0496121_0028586 3300048924 Bacteria 5187
1739 Ga0496121_0116743 3300048924 Bacteria 2023
1740 Ga0496121_0128593 3300048924 Bacteria 1900
1741 Ga0496121_0151960 3300048924 Bacteria 1702
1742 Ga0496121_0182234 3300048924 Bacteria 1514
1743 Ga0496122_0001793 3300048925 Bacteria 32882
1744 Ga0496122_0010409 3300048925 Bacteria 9595
1745 Ga0496122_0016789 3300048925 Bacteria 6895
1746 Ga0496123_0003792 3300048926 Bacteria 16553
1747 Ga0496123_0015690 3300048926 Bacteria 6198
1748 Ga0496123_0050885 3300048926 Bacteria 2764
1749 Ga0496123_0177662 3300048926 Bacteria 1115
1750 Ga0496124_0177879 3300048927 Bacteria 1640
1751 Ga0496124_0337987 3300048927 Bacteria 1071
1752 Ga0496124_0423576 3300048927 Bacteria 916
1753 Ga0496124_0559737 3300048927 Bacteria 753
1754 Ga0496125_0001452 3300048928 Bacteria 34470
1755 Ga0496125_0001533 3300048928 Bacteria 33123
1756 Ga0496125_0003857 3300048928 Bacteria 17773
1757 Ga0496125_0208377 3300048928 Bacteria 1272
1758 Ga0496126_0000230 3300048929 Bacteria 120323
1759 Ga0496126_0000628 3300048929 Bacteria 66034
1760 Ga0496126_0005369 3300048929 Bacteria 14648
1761 Ga0496126_0215964 3300048929 Bacteria 1613
1762 Ga0496126_1193648 3300048929 Bacteria 560
1763 Ga0466983_0358327 3300048986 Bacteria 1075
1764 Ga0501306_018015 3300049127 Bacteria 963
1765 Ga0501308_070500 3300049128 Bacteria 542
1766 Ga0501310_009001 3300049130 Bacteria 1093
1767 Ga0501343_008559 3300049132 Bacteria 819
1768 Ga0501343_011319 3300049132 Bacteria 733
1769 Ga0501304_011627 3300049160 Bacteria 785
1770 Ga0501305_023118 3300049161 Bacteria 929
1771 Ga0501305_031175 3300049161 Bacteria 832
1772 Ga0501307_018705 3300049162 Bacteria 883
1773 Ga0495678_004420 3300049459 Bacteria 8135
1774 Ga0495678_087481 3300049459 Bacteria 1105
1775 Ga0495678_219484 3300049459 Bacteria 577
1776 Ga0495682_0277459 3300049460 Bacteria 592
1777 Ga0501312_090381 3300049528 Bacteria 564
1778 Ga0501314_010688 3300049530 Bacteria 858
1779 Ga0501314_011384 3300049530 Bacteria 840
1780 Ga0501314_012099 3300049530 Bacteria 824
1781 Ga0501315_079864 3300049531 Bacteria 554
1782 Ga0501317_051650 3300049533 Bacteria 655
1783 Ga0501320_004911 3300049536 Bacteria 1197
1784 Ga0501320_011097 3300049536 Bacteria 928
1785 Ga0501320_029684 3300049536 Bacteria 675
1786 Ga0501322_010438 3300049538 Bacteria 715
1787 Ga0501322_013562 3300049538 Bacteria 658
1788 Ga0501323_056717 3300049539 Bacteria 604
1789 Ga0501324_010567 3300049540 Bacteria 842
1790 Ga0501324_012657 3300049540 Bacteria 792
1791 Ga0501324_032305 3300049540 Bacteria 575
1792 Ga0501325_012586 3300049541 Bacteria 798
1793 Ga0501325_021852 3300049541 Bacteria 680
1794 Ga0501325_034563 3300049541 Bacteria 593
1795 Ga0501326_09967 3300049542 Bacteria 566
1796 Ga0501327_04138 3300049543 Bacteria 822
1797 Ga0501335_021095 3300049551 Bacteria 696
1798 Ga0501336_002530 3300049552 Bacteria 1180
1799 Ga0501336_013390 3300049552 Bacteria 686
1800 Ga0501340_009988 3300049556 Bacteria 691
1801 Ga0501031_0622669 3300049568 Bacteria 694
1802 Ga0501032_0000167 3300049569 Bacteria 53430
1803 Ga0501032_0003957 3300049569 Bacteria 11235
1804 Ga0501032_0047999 3300049569 Bacteria 2883
1805 Ga0501032_0121771 3300049569 Bacteria 1724
1806 Ga0501032_0164262 3300049569 Bacteria 1457
1807 Ga0501032_1029710 3300049569 Bacteria 517
1808 Ga0501033_0002160 3300049570 Bacteria 17013
1809 Ga0501033_0002995 3300049570 Bacteria 14106
1810 Ga0501033_0545170 3300049570 Bacteria 799
1811 Ga0501033_1005627 3300049570 Bacteria 557
1812 Ga0501034_0005615 3300049571 Bacteria 13662
1813 Ga0501034_0014914 3300049571 Bacteria 7992
1814 Ga0501034_0128617 3300049571 Bacteria 2517
1815 Ga0501034_0151756 3300049571 Bacteria 2292
1816 Ga0501034_1269077 3300049571 Bacteria 614
1817 Ga0501036_0000725 3300049572 Bacteria 24359
1818 Ga0501036_0006699 3300049572 Bacteria 9362
1819 Ga0501036_0013243 3300049572 Bacteria 6847
1820 Ga0501036_0140269 3300049572 Bacteria 2040
1821 Ga0501036_0321791 3300049572 Bacteria 1292
1822 Ga0501036_0464622 3300049572 Bacteria 1054
1823 Ga0501036_0750995 3300049572 Bacteria 805
1824 Ga0501037_0000255 3300049573 Bacteria 45740
1825 Ga0501037_0014295 3300049573 Bacteria 5849
1826 Ga0501037_0045350 3300049573 Bacteria 3227
1827 Ga0501037_0112980 3300049573 Bacteria 1956
1828 Ga0501037_0138840 3300049573 Bacteria 1740
1829 Ga0501037_0141510 3300049573 Bacteria 1721
1830 Ga0501037_0205648 3300049573 Bacteria 1390
1831 Ga0501037_0275971 3300049573 Bacteria 1172
1832 Ga0501038_0000229 3300049574 Bacteria 47553
1833 Ga0501038_0009184 3300049574 Bacteria 9073
1834 Ga0501038_0024813 3300049574 Bacteria 5345
1835 Ga0501038_0041834 3300049574 Bacteria 3995
1836 Ga0501038_0171918 3300049574 Bacteria 1753
1837 Ga0501038_0180846 3300049574 Bacteria 1701
1838 Ga0501038_0264815 3300049574 Bacteria 1357
1839 Ga0501038_0357125 3300049574 Bacteria 1137
1840 Ga0501038_0611207 3300049574 Bacteria 824
1841 Ga0501038_0784180 3300049574 Bacteria 709
1842 Ga0501039_0001409 3300049575 Bacteria 17691
1843 Ga0501039_0002294 3300049575 Bacteria 14191
1844 Ga0501039_0034022 3300049575 Bacteria 3932
1845 Ga0501039_0037204 3300049575 Bacteria 3756
1846 Ga0501039_0315056 3300049575 Bacteria 1230
1847 Ga0501039_0488744 3300049575 Bacteria 967
1848 Ga0501039_0575309 3300049575 Bacteria 883
1849 Ga0501040_0000182 3300049576 Bacteria 35992
1850 Ga0501040_0007883 3300049576 Bacteria 6904
1851 Ga0501040_0011714 3300049576 Bacteria 5737
1852 Ga0501040_0845819 3300049576 Bacteria 662
1853 Ga0501041_0001065 3300049577 Bacteria 15011
1854 Ga0501041_0222888 3300049577 Bacteria 1183
1855 Ga0501041_0290883 3300049577 Bacteria 1029
1856 Ga0501041_0465983 3300049577 Bacteria 802
1857 Ga0501041_0584325 3300049577 Bacteria 713
1858 Ga0501042_0000708 3300049578 Bacteria 18084
1859 Ga0501042_0027122 3300049578 Bacteria 4026
1860 Ga0501042_0043437 3300049578 Bacteria 3201
1861 Ga0501042_0661315 3300049578 Bacteria 760
1862 Ga0501042_0852029 3300049578 Bacteria 664
1863 Ga0501042_1426657 3300049578 Bacteria 505
1864 Ga0501043_0002561 3300049579 Bacteria 15363
1865 Ga0501043_0015028 3300049579 Bacteria 6062
1866 Ga0501043_0514821 3300049579 Bacteria 892
1867 Ga0501043_0750322 3300049579 Bacteria 709
1868 Ga0501046_0000422 3300049580 Bacteria 42250
1869 Ga0501046_0011518 3300049580 Bacteria 7561
1870 Ga0501046_0029044 3300049580 Bacteria 4499
1871 Ga0501046_0045566 3300049580 Bacteria 3484
1872 Ga0501046_0076436 3300049580 Bacteria 2594
1873 Ga0501046_0631081 3300049580 Bacteria 758
1874 Ga0501046_0688276 3300049580 Bacteria 721
1875 Ga0501047_0002269 3300049581 Bacteria 18404
1876 Ga0501047_0283885 3300049581 Bacteria 1500
1877 Ga0501047_0642751 3300049581 Bacteria 880
1878 Ga0501047_0651317 3300049581 Bacteria 873
1879 Ga0501047_0744766 3300049581 Bacteria 796
1880 Ga0501047_1329280 3300049581 Bacteria 533
1881 Ga0501048_0001780 3300049582 Bacteria 16370
1882 Ga0501048_0032686 3300049582 Bacteria 3760
1883 Ga0501048_0069158 3300049582 Bacteria 2494
1884 Ga0501048_0561437 3300049582 Bacteria 819
1885 Ga0501048_1153619 3300049582 Bacteria 557
1886 Ga0501067_0047612 3300049583 Bacteria 2378
1887 Ga0501067_0134259 3300049583 Bacteria 1378
1888 Ga0501068_0000334 3300049584 Bacteria 23668
1889 Ga0501068_0013973 3300049584 Bacteria 4580
1890 Ga0501068_0287545 3300049584 Bacteria 1051
1891 Ga0501068_0657680 3300049584 Bacteria 684
1892 Ga0501068_0829455 3300049584 Bacteria 607
1893 Ga0501069_0051494 3300049585 Bacteria 2291
1894 Ga0501070_0016320 3300049586 Bacteria 6237
1895 Ga0501070_0021676 3300049586 Bacteria 5387
1896 Ga0501070_0186240 3300049586 Bacteria 1707
1897 Ga0501071_0040118 3300049587 Bacteria 3350
1898 Ga0501071_0055255 3300049587 Bacteria 2866
1899 Ga0501071_0219316 3300049587 Bacteria 1431
1900 Ga0501071_0799846 3300049587 Bacteria 727
1901 Ga0501072_0011283 3300049588 Bacteria 6824
1902 Ga0501072_0031892 3300049588 Bacteria 4125
1903 Ga0501073_0100989 3300049589 Bacteria 2003
1904 Ga0501073_0281194 3300049589 Bacteria 1148
1905 Ga0501073_0394049 3300049589 Bacteria 957
1906 Ga0501073_0746213 3300049589 Bacteria 675
1907 Ga0501074_0000764 3300049590 Bacteria 20238
1908 Ga0501074_0175664 3300049590 Bacteria 1528
1909 Ga0501074_0403524 3300049590 Bacteria 969
1910 Ga0501074_0435151 3300049590 Bacteria 930
1911 Ga0501074_0727746 3300049590 Bacteria 700
1912 Ga0501075_0007076 3300049591 Bacteria 7754
1913 Ga0501075_0013582 3300049591 Bacteria 5815
1914 Ga0501075_0352453 3300049591 Bacteria 1121
1915 Ga0501075_0492065 3300049591 Bacteria 936
1916 Ga0501075_0565913 3300049591 Bacteria 867
1917 Ga0501075_0680076 3300049591 Bacteria 784
1918 Ga0501076_0003180 3300049592 Bacteria 11461
1919 Ga0501076_1035120 3300049592 Bacteria 676
1920 Ga0501076_1071707 3300049592 Bacteria 664
1921 Ga0501076_1707610 3300049592 Bacteria 516
1922 Ga0501077_0006382 3300049593 Bacteria 7231
1923 Ga0501077_0119890 3300049593 Bacteria 1667
1924 Ga0501077_0529278 3300049593 Bacteria 756
1925 Ga0501077_0941655 3300049593 Bacteria 556
1926 Ga0501238_012775 3300049671 Bacteria 1139
1927 Ga0501079_0008683 3300049741 Bacteria 7705
1928 Ga0501079_0010995 3300049741 Bacteria 6897
1929 Ga0501079_0016502 3300049741 Bacteria 5641
1930 Ga0501079_0032753 3300049741 Bacteria 3997
1931 Ga0501079_0037809 3300049741 Bacteria 3721
1932 Ga0501079_0246577 3300049741 Bacteria 1396
1933 Ga0501079_1300996 3300049741 Bacteria 572
1934 Ga0501080_0066614 3300049742 Bacteria 3350
1935 Ga0501080_0137960 3300049742 Bacteria 2256
1936 Ga0501080_0898770 3300049742 Bacteria 772
1937 Ga0501081_0005996 3300049743 Bacteria 7868
1938 Ga0501081_0006427 3300049743 Bacteria 7625
1939 Ga0501081_0095340 3300049743 Bacteria 2097
1940 Ga0501081_0680131 3300049743 Bacteria 772
1941 Ga0501083_0060966 3300049744 Bacteria 2520
1942 Ga0501083_0126302 3300049744 Bacteria 1677
1943 Ga0501083_0501850 3300049744 Bacteria 790
1944 Ga0501083_0568702 3300049744 Bacteria 738
1945 Ga0501083_0720437 3300049744 Bacteria 649
1946 Ga0501083_0762668 3300049744 Bacteria 629
1947 Ga0501083_1019057 3300049744 Bacteria 539
1948 Ga0501035_0008885 3300049822 Bacteria 9351
1949 Ga0501035_0087436 3300049822 Bacteria 2747
1950 Ga0501035_0162363 3300049822 Bacteria 1933
1951 Ga0501035_0264870 3300049822 Bacteria 1456
1952 Ga0501035_0765901 3300049822 Bacteria 773
1953 Ga0501035_0853483 3300049822 Bacteria 724
1954 Ga0501044_0000323 3300049823 Bacteria 60420
1955 Ga0501044_0000514 3300049823 Bacteria 47072
1956 Ga0501044_0047371 3300049823 Bacteria 4446
1957 Ga0501044_0065798 3300049823 Bacteria 3697
1958 Ga0501044_0215280 3300049823 Bacteria 1874
1959 Ga0501044_1129712 3300049823 Bacteria 652
1960 Ga0501045_0001098 3300049824 Bacteria 17886
1961 Ga0501045_0002945 3300049824 Bacteria 11645
1962 Ga0501045_0079987 3300049824 Bacteria 2410
1963 Ga0501045_0087702 3300049824 Bacteria 2298
1964 Ga0501045_0175535 3300049824 Bacteria 1596
1965 Ga0501045_0548832 3300049824 Bacteria 857
1966 nmdc:mga03683_126396_c1 3300050489 Bacteria 1141
1967 nmdc:mga03n38_629546_c1 3300050490 Bacteria 613
1968 nmdc:mga0k408_1091_c1 3300050493 Bacteria 14886
1969 nmdc:mga0k408_159856_c1 3300050493 Bacteria 1342
1970 nmdc:mga0k408_396788_c1 3300050493 Bacteria 821
1971 nmdc:mga0k408_828043_c1 3300050493 Bacteria 539
1972 nmdc:mga06z11_709447_c1 3300050494 Bacteria 613
1973 nmdc:mga06z11_85224_c1 3300050494 Bacteria 1704
1974 nmdc:mga04h51_271078_c1 3300050495 Bacteria 685
1975 nmdc:mga07m45_504808_c1 3300050496 Bacteria 700
1976 nmdc:mga07m45_755414_c1 3300050496 Bacteria 558
1977 nmdc:mga05p37_2276100_c1 3300050507 Bacteria 500
1978 nmdc:mga05p37_31263_c1 3300050507 Bacteria 6503
1979 nmdc:mga05p37_327403_c1 3300050507 Bacteria 1811
1980 nmdc:mga05p37_367533_c1 3300050507 Bacteria 1689
1981 nmdc:mga09592_127593_c1 3300050508 Bacteria 2187
1982 nmdc:mga09592_16545_c1 3300050508 Bacteria 6035
1983 nmdc:mga09592_32093_c1 3300050508 Bacteria 4377
1984 nmdc:mga09592_777822_c1 3300050508 Bacteria 811
1985 nmdc:mga09592_84040_c1 3300050508 Bacteria 2714
1986 nmdc:mga0qj67_1096223_c1 3300050509 Bacteria 622
1987 nmdc:mga0qj67_76015_c1 3300050509 Bacteria 2685
1988 nmdc:mga06r32_1296341_c1 3300050510 Bacteria 672
1989 nmdc:mga06r32_135484_c1 3300050510 Bacteria 2437
1990 nmdc:mga06r32_1364421_c1 3300050510 Bacteria 651
1991 nmdc:mga06r32_1697797_c1 3300050510 Bacteria 569
1992 nmdc:mga06r32_40012_c1 3300050510 Bacteria 4450
1993 nmdc:mga06r32_63453_c1 3300050510 Bacteria 3561
1994 nmdc:mga06r32_8364_c1 3300050510 Bacteria 9317
1995 nmdc:mga06r32_904031_c1 3300050510 Bacteria 839
1996 nmdc:mga06r32_962346_c1 3300050510 Bacteria 808
1997 nmdc:mga08y16_139558_c1 3300050511 Bacteria 2520
1998 nmdc:mga08y16_1586545_c1 3300050511 Bacteria 613
1999 nmdc:mga08y16_17296_c1 3300050511 Bacteria 7591
2000 nmdc:mga08y16_58729_c1 3300050511 Bacteria 4019
2001 nmdc:mga0n895_127011_c1 3300050512 Bacteria 2574
2002 nmdc:mga0n895_315278_c1 3300050512 Bacteria 1585
2003 nmdc:mga0n895_400856_c1 3300050512 Bacteria 1387
2004 nmdc:mga0n895_623117_c1 3300050512 Bacteria 1079
2005 nmdc:mga0n895_972364_c1 3300050512 Bacteria 831
2006 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
2007 nmdc:mga0a205_112287_c1 3300050515 Bacteria 2624
2008 nmdc:mga0a205_734793_c1 3300050515 Bacteria 836
2009 nmdc:mga0sz30_172166_c1 3300050516 Bacteria 960
2010 Ga0500651_0214096 3300053093 Bacteria 1132
2011 Ga0500555_045556 3300053103 Bacteria 1212
2012 Ga0500556_0000033 3300053104 Bacteria 147801
2013 Ga0500562_167312 3300053108 Bacteria 598
2014 Ga0500607_005038 3300053121 Bacteria 8773
2015 Ga0500652_240855 3300053131 Bacteria 720
2016 Ga0500559_0011735 3300053136 Bacteria 3736
2017 Ga0500616_0152870 3300053153 Bacteria 1066
2018 Ga0500622_0158207 3300053156 Bacteria 1065
2019 Ga0500624_016588 3300053157 Bacteria 1139
2020 Ga0500627_0150628 3300053158 Bacteria 1051
2021 Ga0500636_0000049 3300053177 Bacteria 57130
2022 Ga0500637_0004248 3300053178 Bacteria 6767
2023 Ga0500625_153787 3300053729 Bacteria 859
2024 Ga0500645_066676 3300053730 Bacteria 1036
2025 Ga0501084_0004691 3300054114 Bacteria 11162
2026 Ga0501084_0165198 3300054114 Bacteria 1868
2027 Ga0501084_0849633 3300054114 Bacteria 768
2028 Ga0501084_1627020 3300054114 Bacteria 540
2029 Ga0501084_1871409 3300054114 Bacteria 501
2030 Ga0590071_052947 3300059421 Bacteria 986
2031 Ga0590075_211524 3300059424 Bacteria 513
2032 Ga0590077_040002 3300059426 Bacteria 1040
2033 Ga0587084_026488 3300059477 Bacteria 906
2034 Ga0587093_010879 3300059478 Bacteria 1080
2035 Ga0587066_043318 3300059490 Bacteria 857
2036 Ga0587066_103968 3300059490 Bacteria 649
2037 Ga0587070_149386 3300059491 Bacteria 584
2038 Ga0587073_0040742 3300059492 Bacteria 1011
2039 Ga0587073_0158320 3300059492 Bacteria 647
2040 Ga0587073_0176197 3300059492 Bacteria 624
2041 Ga0587077_149422 3300059493 Bacteria 609
2042 Ga0587077_212075 3300059493 Bacteria 542
2043 Ga0587077_223312 3300059493 Bacteria 532
2044 Ga0587080_031821 3300059503 Bacteria 923
2045 Ga0587080_108543 3300059503 Bacteria 602
2046 Ga0587080_136717 3300059503 Bacteria 556
2047 Ga0587082_003080 3300059504 Bacteria 1963
2048 Ga0587082_109485 3300059504 Bacteria 612
2049 Ga0587083_0004429 3300059505 Bacteria 1951
2050 Ga0587083_0041675 3300059505 Bacteria 965
2051 Ga0587085_099862 3300059506 Bacteria 611
2052 Ga0587085_120796 3300059506 Bacteria 575
2053 Ga0587086_029667 3300059507 Bacteria 797
2054 Ga0587086_077904 3300059507 Bacteria 580
2055 Ga0587088_032384 3300059508 Bacteria 942
2056 Ga0587088_055242 3300059508 Bacteria 789
2057 Ga0587088_111688 3300059508 Bacteria 622
2058 Ga0587088_128192 3300059508 Bacteria 594
2059 Ga0587089_002312 3300059509 Bacteria 1911
2060 Ga0587089_034908 3300059509 Bacteria 757
2061 Ga0587090_003256 3300059510 Bacteria 1872
2062 Ga0587090_006629 3300059510 Bacteria 1495
2063 Ga0587090_047844 3300059510 Bacteria 775
2064 Ga0587091_079124 3300059511 Bacteria 734
2065 Ga0587091_094627 3300059511 Bacteria 691
2066 Ga0587091_110383 3300059511 Bacteria 656
2067 Ga0587092_054918 3300059512 Bacteria 731
2068 Ga0587092_106009 3300059512 Bacteria 585
2069 Ga0587094_003525 3300059513 Bacteria 1715
2070 Ga0587094_037558 3300059513 Bacteria 776
2071 Ga0587095_013877 3300059514 Bacteria 715
2072 Ga0587095_032742 3300059514 Bacteria 543
2073 Ga0587097_03736 3300059603 Bacteria 663
2074 Ga0587097_06083 3300059603 Bacteria 581
2075 Ga0587098_011791 3300059604 Bacteria 990
2076 Ga0587098_017987 3300059604 Bacteria 871
2077 Ga0587098_020772 3300059604 Bacteria 832
2078 Ga0587106_039349 3300059605 Bacteria 796
2079 Ga0587106_072914 3300059605 Bacteria 654
2080 Ga0587106_098454 3300059605 Bacteria 594
2081 Ga0587106_110743 3300059605 Bacteria 572
2082 Ga0587129_000781 3300059608 Bacteria 1550
2083 Ga0587099_022221 3300059622 Bacteria 723
2084 Ga0587101_017996 3300059623 Bacteria 985
2085 Ga0587101_022858 3300059623 Bacteria 916
2086 Ga0587109_081650 3300059624 Bacteria 716
2087 Ga0587109_089662 3300059624 Bacteria 692
2088 Ga0587109_173221 3300059624 Bacteria 547
2089 Ga0587113_005054 3300059625 Bacteria 1074
2090 Ga0587113_039889 3300059625 Bacteria 559
2091 Ga0587113_049473 3300059625 Bacteria 522
2092 Ga0587115_123254 3300059626 Bacteria 500
2093 Ga0587117_122812 3300059627 Bacteria 516
2094 Ga0587122_016602 3300059628 Bacteria 763
2095 Ga0587122_023836 3300059628 Bacteria 683
2096 Ga0587128_020710 3300059630 Bacteria 1008
2097 Ga0587128_054106 3300059630 Bacteria 741
2098 Ga0587128_072527 3300059630 Bacteria 673
2099 Ga0587130_021766 3300059631 Bacteria 698
2100 Ga0587062_076961 3300059639 Bacteria 614
2101 Ga0587067_008104 3300059640 Bacteria 1525
2102 Ga0587067_047685 3300059640 Bacteria 856
2103 Ga0587067_049438 3300059640 Bacteria 846
2104 Ga0587067_080796 3300059640 Bacteria 719
2105 Ga0587068_027370 3300059641 Bacteria 970
2106 Ga0587068_042973 3300059641 Bacteria 823
2107 Ga0587068_092645 3300059641 Bacteria 625
2108 Ga0587068_121371 3300059641 Bacteria 567
2109 Ga0587068_145449 3300059641 Bacteria 532
2110 Ga0587068_153351 3300059641 Bacteria 522
2111 Ga0587069_040389 3300059642 Bacteria 794
2112 Ga0587069_050126 3300059642 Bacteria 740
2113 Ga0587069_153938 3300059642 Bacteria 513
2114 Ga0587072_001295 3300059643 Bacteria 3043
2115 Ga0587072_048028 3300059643 Bacteria 848
2116 Ga0587072_094549 3300059643 Bacteria 663
2117 Ga0587075_003940 3300059644 Bacteria 1693
2118 Ga0587075_020008 3300059644 Bacteria 985
2119 Ga0587075_032987 3300059644 Bacteria 834
2120 Ga0587075_066002 3300059644 Bacteria 663
2121 Ga0587076_040825 3300059645 Bacteria 867
2122 Ga0587078_003684 3300059646 Bacteria 1569
2123 Ga0587078_016640 3300059646 Bacteria 897
2124 Ga0587079_043767 3300059647 Bacteria 915
2125 Ga0587079_050781 3300059647 Bacteria 870
2126 Ga0587100_018779 3300059648 Bacteria 659
2127 Ga0587100_041239 3300059648 Bacteria 520
2128 Ga0587102_002930 3300059649 Bacteria 1358
2129 Ga0587102_015472 3300059649 Bacteria 811
2130 Ga0587102_016524 3300059649 Bacteria 795
2131 Ga0587104_002966 3300059650 Bacteria 1017
2132 Ga0587104_007994 3300059650 Bacteria 743
2133 Ga0587105_009361 3300059651 Bacteria 726
2134 Ga0587107_021137 3300059652 Bacteria 909
2135 Ga0587107_078591 3300059652 Bacteria 616
2136 Ga0587107_096566 3300059652 Bacteria 579
2137 Ga0587108_007298 3300059653 Bacteria 874
2138 Ga0587108_008497 3300059653 Bacteria 833
2139 Ga0587108_023537 3300059653 Bacteria 598
2140 Ga0587116_03086 3300059656 Bacteria 913
2141 Ga0587118_04248 3300059657 Bacteria 986
2142 Ga0587119_031512 3300059658 Bacteria 727
2143 Ga0587119_049573 3300059658 Bacteria 624
2144 Ga0587120_020883 3300059659 Bacteria 622
2145 Ga0587120_022259 3300059659 Bacteria 609
2146 Ga0587124_020728 3300059660 Bacteria 670
2147 Ga0587124_035786 3300059660 Bacteria 565
2148 Ga0587071_046941 3300060344 Bacteria 883
2149 Ga0587111_0011632 3300060346 Bacteria 1538
2150 Ga0587111_0021366 3300060346 Bacteria 1247
2151 Ga0587111_0060186 3300060346 Bacteria 861
2152 Ga0587111_0081390 3300060346 Bacteria 774
2153 Ga0501082_0011534 3300060353 Bacteria 7604
2154 Ga0501082_0013108 3300060353 Bacteria 7128
2155 Ga0501082_0076117 3300060353 Bacteria 2892
2156 Ga0501082_0100692 3300060353 Bacteria 2499
2157 Ga0501082_0104606 3300060353 Bacteria 2449
2158 Ga0501082_0140665 3300060353 Bacteria 2095
2159 Ga0501082_0148439 3300060353 Bacteria 2036
2160 Ga0501082_0509872 3300060353 Bacteria 1051
2161 Ga0501082_0927295 3300060353 Bacteria 762
2162 Ga0501082_1203942 3300060353 Bacteria 662
2163 Ga0466962_0002750 3300061719 Bacteria 8349
2164 Ga0466962_0019452 3300061719 Bacteria 3263
2165 Ga0530510_0058538 3300061734 Bacteria 2786
2166 Ga0530510_0305415 3300061734 Bacteria 1191
2167 Ga0530510_0336416 3300061734 Bacteria 1133
2168 Ga0530510_1160480 3300061734 Bacteria 592
2169 Ga0530510_1365854 3300061734 Bacteria 544
2170 Ga0530510_1526722 3300061734 Bacteria 513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_11268916 Ga0105249_112689162 102
2 3300042876 Ga0451577_0272807 Ga0451577_0272807_34_366 102
3 3300044712 Ga0453684_2093068 Ga0453684_2093068_35_367 102
4 3300046675 Ga0495657_0838622 Ga0495657_0838622_180_512 102
5 3300036647 Ga0316582_0893055 Ga0316582_0893055_272_586 104
6 3300050515 nmdc:mga0a205_112287_c1 nmdc:mga0a205_112287_c1_1740_2054 104
7 3300036647 Ga0316582_0982471 Ga0316582_0982471_49_384 111
8 3300045051 Ga0451576_1120471 Ga0451576_1120471_75_410 111
9 3300046678 Ga0495599_0779503 Ga0495599_0779503_60_395 111
10 3300048918 Ga0496115_1422479 Ga0496115_1422479_38_373 111
11 3300042876 Ga0451577_0333524 Ga0451577_0333524_12_350 112
12 3300061734 Ga0530510_1526722 Ga0530510_1526722_53_421 112
13 3300049575 Ga0501039_0315056 Ga0501039_0315056_218_586 113
14 3300049824 Ga0501045_0548832 Ga0501045_0548832_236_604 113
15 iso_pu_bacteria 2513237150 2513952817 114
16 iso_pu_bacteria 2513237165 2514042330 114
17 iso_pu_bacteria 2596583598 2597032040 114
18 iso_pu_bacteria 2599185178 2599444157 114
19 iso_pu_bacteria 2834641062 2834641894 114
20 iso_pu_bacteria 2858688981 2858695014 114
21 iso_pu_bacteria 2885266251 2885268434 114
22 iso_pu_bacteria 2900577576 2900579417 114
23 iso_pu_bacteria 2901300506 2901306989 114
24 iso_pu_bacteria 2901300506 2901313376 114
25 iso_pu_bacteria 2928058823 2928063294 114
26 iso_pu_bacteria 644736347 644747578 114
27 iso_pu_bacteria 8003400568 8003404562 114
28 iso_pu_bacteria 2501025501 2501074816 115
29 iso_pu_bacteria 2501025502 2501077252 115
30 iso_pu_bacteria 2501025504 2501410309 115
31 iso_pu_bacteria 2508501125 2509128521 115
32 iso_pu_bacteria 2510065045 2510251623 115
33 iso_pu_bacteria 2510917013 2511087122 115
34 iso_pu_bacteria 2510917014 2511097218 115
35 iso_pu_bacteria 2510917015 2511103895 115
36 iso_pu_bacteria 2511231003 2511251343 115
37 iso_pu_bacteria 2512047030 2512345400 115
38 iso_pu_bacteria 2513237082 2513552329 115
39 iso_pu_bacteria 2513237083 2513561117 115
40 iso_pu_bacteria 2513237151 2513963175 115
41 iso_pu_bacteria 2513237166 2514052250 115
42 iso_pu_bacteria 2515154122 2515680645 115
43 iso_pu_bacteria 2515154123 2515691177 115
44 iso_pu_bacteria 2515154189 2516019563 115
45 iso_pu_bacteria 2519103095 2519458565 115
46 iso_pu_bacteria 2526164713 2527075669 115
47 iso_pu_bacteria 2548876994 2550694279 115
48 iso_pu_bacteria 2562617112 2563058936 115
49 iso_pu_bacteria 2582581311 2585295040 115
50 iso_pu_bacteria 2599185239 2599737385 115
51 iso_pu_bacteria 2599185240 2599746890 115
52 iso_pu_bacteria 2599185355 2600208955 115
53 iso_pu_bacteria 2600255067 2600815279 115
54 iso_pu_bacteria 2643221603 2644028943 115
55 iso_pu_bacteria 2675903129 2676744453 115
56 iso_pu_bacteria 2711768613 2713480013 115
57 iso_pu_bacteria 2718217991 2719640738 115
58 iso_pu_bacteria 2721755763 2723878493 115
59 iso_pu_bacteria 2738541296 2738818808 115
60 iso_pu_bacteria 2738541298 2738831036 115
61 iso_pu_bacteria 2738541306 2738872563 115
62 iso_pu_bacteria 2738543002 2739184193 115
63 iso_pu_bacteria 2738543008 2739219163 115
64 iso_pu_bacteria 2744054900 2746086257 115
65 iso_pu_bacteria 2744054901 2746096990 115
66 iso_pu_bacteria 2751185846 2753567005 115
67 iso_pu_bacteria 2791355137 2792834174 115
68 iso_pu_bacteria 2808606384 2808971164 115
69 iso_pu_bacteria 2808606390 2809005933 115
70 iso_pu_bacteria 2808606391 2809013131 115
71 iso_pu_bacteria 2816332253 2817260791 115
72 iso_pu_bacteria 2816332256 2817278426 115
73 iso_pu_bacteria 2816332286 2817455062 115
74 iso_pu_bacteria 2818991445 2819591242 115
75 iso_pu_bacteria 2818991450 2819623197 115
76 iso_pu_bacteria 2818991452 2819635040 115
77 iso_pu_bacteria 2842324504 2842328431 115
78 iso_pu_bacteria 2842348783 2842352747 115
79 iso_pu_bacteria 2842454564 2842459716 115
80 iso_pu_bacteria 2856287931 2856294117 115
81 iso_pu_bacteria 2857357740 2857366264 115
82 iso_pu_bacteria 2863421361 2863424392 115
83 iso_pu_bacteria 2870068957 2870071742 115
84 iso_pu_bacteria 2883087390 2883093159 115
85 iso_pu_bacteria 2884811622 2884812882 115
86 iso_pu_bacteria 2884836552 2884837030 115
87 iso_pu_bacteria 2884852848 2884853322 115
88 iso_pu_bacteria 2885270888 2885275753 115
89 iso_pu_bacteria 2896154374 2896155561 115
90 iso_pu_bacteria 2900634093 2900637992 115
91 iso_pu_bacteria 2902682994 2902683854 115
92 iso_pu_bacteria 2904434214 2904436829 115
93 iso_pu_bacteria 2904483920 2904487232 115
94 iso_pu_bacteria 2904564687 2904568831 115
95 iso_pu_bacteria 2904571731 2904575873 115
96 iso_pu_bacteria 2904615490 2904623377 115
97 iso_pu_bacteria 2919527303 2919528538 115
98 iso_pu_bacteria 2921643360 2921645748 115
99 iso_pu_bacteria 2928108538 2928112295 115
100 iso_pu_bacteria 2928135762 2928137783 115
101 iso_pu_bacteria 2928157003 2928160620 115
102 iso_pu_bacteria 2928163908 2928164842 115
103 iso_pu_bacteria 2928170801 2928172919 115
104 iso_pu_bacteria 2928503688 2928507521 115
105 iso_pu_bacteria 2928536128 2928540890 115
106 iso_pu_bacteria 2939593269 2939595297 115
107 iso_pu_bacteria 2945934425 2945937508 115
108 iso_pu_bacteria 2981990288 2981996410 115
109 iso_pu_bacteria 2990703756 2990705773 115
110 iso_pu_bacteria 641736151 642426824 115
111 iso_pu_bacteria 641736154 642418077 115
112 iso_pu_bacteria 642555112 642593340 115
113 iso_pu_bacteria 642555113 642622314 115
114 iso_pu_bacteria 8001845381 8001847378 115
115 iso_pu_bacteria 8003955200 8003955689 115
116 iso_pu_bacteria 8018845410 8018845768 115
117 iso_pu_bacteria 8020807995 8020812344 115
118 iso_pu_bacteria 8020938398 8020941126 115
119 iso_pu_bacteria 8020945358 8020950743 115
120 iso_pu_bacteria 8020953355 8020958100 115
121 iso_pu_bacteria 8021120328 8021124187 115
122 iso_pu_bacteria 8039098773 8039101087 115
123 iso_pu_bacteria 8040167225 8040172169 115
124 iso_pu_bacteria 8040173305 8040177931 115
125 iso_pu_bacteria 8055266321 8055272195 115
126 iso_pu_bacteria 8055301274 8055301889 115
127 3300009176 Ga0105242_10307881 Ga0105242_103078811 116
128 3300025934 Ga0207686_10981690 Ga0207686_109816902 116
129 3300005331 Ga0070670_100096271 Ga0070670_1000962712 117
130 3300005334 Ga0068869_100584133 Ga0068869_1005841331 117
131 3300005336 Ga0070680_101288800 Ga0070680_1012888001 117
132 3300005347 Ga0070668_100016025 Ga0070668_1000160253 117
133 3300005353 Ga0070669_100307051 Ga0070669_1003070512 117
134 3300005355 Ga0070671_100698316 Ga0070671_1006983162 117
135 3300005356 Ga0070674_100215346 Ga0070674_1002153462 117
136 3300005367 Ga0070667_100219833 Ga0070667_1002198331 117
137 3300005367 Ga0070667_100857148 Ga0070667_1008571482 117
138 3300005444 Ga0070694_100360961 Ga0070694_1003609612 117
139 3300005445 Ga0070708_100947409 Ga0070708_1009474092 117
140 3300005457 Ga0070662_100191176 Ga0070662_1001911762 117
141 3300005459 Ga0068867_100731659 Ga0068867_1007316591 117
142 3300005468 Ga0070707_100028238 Ga0070707_1000282383 117
143 3300005471 Ga0070698_100085478 Ga0070698_1000854783 117
144 3300005518 Ga0070699_100181509 Ga0070699_1001815092 117
145 3300005548 Ga0070665_100123101 Ga0070665_1001231012 117
146 3300005549 Ga0070704_100149041 Ga0070704_1001490412 117
147 3300005617 Ga0068859_101730670 Ga0068859_1017306702 117
148 3300005719 Ga0068861_100099224 Ga0068861_1000992242 117
149 3300005843 Ga0068860_100345877 Ga0068860_1003458772 117
150 3300005937 Ga0081455_10087396 Ga0081455_100873963 117
151 3300005937 Ga0081455_10491490 Ga0081455_104914902 117
152 3300006048 Ga0075363_100446234 Ga0075363_1004462342 117
153 3300006178 Ga0075367_10281960 Ga0075367_102819601 117
154 3300006195 Ga0075366_10121289 Ga0075366_101212892 117
155 3300006844 Ga0075428_100113681 Ga0075428_1001136812 117
156 3300006844 Ga0075428_100995206 Ga0075428_1009952063 117
157 3300006846 Ga0075430_100154670 Ga0075430_1001546703 117
158 3300006846 Ga0075430_100600421 Ga0075430_1006004211 117
159 3300006847 Ga0075431_100006006 Ga0075431_1000060065 117
160 3300006847 Ga0075431_100014702 Ga0075431_1000147026 117
161 3300006852 Ga0075433_10506667 Ga0075433_105066672 117
162 3300006871 Ga0075434_100029038 Ga0075434_1000290384 117
163 3300006871 Ga0075434_100795231 Ga0075434_1007952312 117
164 3300006880 Ga0075429_100016947 Ga0075429_1000169478 117
165 3300006880 Ga0075429_100856581 Ga0075429_1008565812 117
166 3300006914 Ga0075436_101108701 Ga0075436_1011087012 117
167 3300006931 Ga0097620_101730639 Ga0097620_1017306392 117
168 3300009093 Ga0105240_10346619 Ga0105240_103466193 117
169 3300009094 Ga0111539_10055661 Ga0111539_100556615 117
170 3300009147 Ga0114129_10008304 Ga0114129_1000830414 117
171 3300009147 Ga0114129_10511327 Ga0114129_105113272 117
172 3300009147 Ga0114129_10647335 Ga0114129_106473352 117
173 3300009176 Ga0105242_10115974 Ga0105242_101159744 117
174 3300009545 Ga0105237_11498759 Ga0105237_114987592 117
175 3300011119 Ga0105246_10868731 Ga0105246_108687312 117
176 3300013306 Ga0163162_10697418 Ga0163162_106974183 117
177 3300014325 Ga0163163_11814629 Ga0163163_118146292 117
178 3300014326 Ga0157380_12452867 Ga0157380_124528672 117
179 3300025910 Ga0207684_11293593 Ga0207684_112935931 117
180 3300025922 Ga0207646_10026207 Ga0207646_100262075 117
181 3300025922 Ga0207646_11878064 Ga0207646_118780641 117
182 3300025925 Ga0207650_10258300 Ga0207650_102583003 117
183 3300025933 Ga0207706_10131379 Ga0207706_101313792 117
184 3300025934 Ga0207686_10071609 Ga0207686_100716093 117
185 3300025935 Ga0207709_10375343 Ga0207709_103753431 117
186 3300025937 Ga0207669_10300399 Ga0207669_103003993 117
187 3300025944 Ga0207661_10849639 Ga0207661_108496391 117
188 3300025945 Ga0207679_10819192 Ga0207679_108191921 117
189 3300025960 Ga0207651_10250582 Ga0207651_102505821 117
190 3300025961 Ga0207712_10209896 Ga0207712_102098962 117
191 3300025981 Ga0207640_11545093 Ga0207640_115450932 117
192 3300025986 Ga0207658_10027217 Ga0207658_100272172 117
193 3300025986 Ga0207658_10485555 Ga0207658_104855551 117
194 3300026067 Ga0207678_10427316 Ga0207678_104273162 117
195 3300026075 Ga0207708_11461668 Ga0207708_114616682 117
196 3300026075 Ga0207708_11755472 Ga0207708_117554721 117
197 3300026089 Ga0207648_10800775 Ga0207648_108007751 117
198 3300026118 Ga0207675_100217489 Ga0207675_1002174893 117
199 3300027907 Ga0207428_10053668 Ga0207428_100536684 117
200 3300028379 Ga0268266_10027108 Ga0268266_100271085 117
201 3300028380 Ga0268265_10800319 Ga0268265_108003192 117
202 3300028381 Ga0268264_10841677 Ga0268264_108416772 117
203 3300031995 Ga0307409_101033297 Ga0307409_1010332972 117
204 3300032002 Ga0307416_101435611 Ga0307416_1014356111 117
205 3300032002 Ga0307416_102149929 Ga0307416_1021499292 117
206 3300033529 Ga0316587_1012346 Ga0316587_10123464 117
207 3300034957 Ga0373938_0208712 Ga0373938_0208712_172_525 117
208 3300035112 Ga0373932_0097006 Ga0373932_0097006_324_677 117
209 3300035398 Ga0316574_0554990 Ga0316574_0554990_224_577 117
210 3300035691 Ga0373931_0098346 Ga0373931_0098346_30_383 117
211 3300035691 Ga0373931_0178958 Ga0373931_0178958_458_811 117
212 3300041405 Ga0439438_067666 Ga0439438_067666_498_851 117
213 3300041411 Ga0439466_0062487 Ga0439466_0062487_128_481 117
214 3300041491 Ga0451833_0582454 Ga0451833_0582454_69_422 117
215 3300042001 Ga0439441_115838 Ga0439441_115838_65_418 117
216 3300042006 Ga0439432_052820 Ga0439432_052820_196_549 117
217 3300042008 Ga0439450_181802 Ga0439450_181802_50_403 117
218 3300042009 Ga0439451_018101 Ga0439451_018101_64_417 117
219 3300042435 Ga0439434_0114362 Ga0439434_0114362_484_837 117
220 3300042439 Ga0439464_0049073 Ga0439464_0049073_460_813 117
221 3300042461 Ga0439460_0052243 Ga0439460_0052243_336_689 117
222 3300046616 Ga0495668_0024485 Ga0495668_0024485_618_971 117
223 3300046660 Ga0495625_0380382 Ga0495625_0380382_408_761 117
224 3300048905 Ga0496102_0343789 Ga0496102_0343789_145_498 117
225 3300048906 Ga0496103_0347261 Ga0496103_0347261_344_697 117
226 3300048909 Ga0496106_0637280 Ga0496106_0637280_266_619 117
227 3300048911 Ga0496108_1616843 Ga0496108_1616843_71_424 117
228 3300048913 Ga0496110_1442358 Ga0496110_1442358_19_372 117
229 3300048915 Ga0496112_0777514 Ga0496112_0777514_193_546 117
230 3300048916 Ga0496113_0929113 Ga0496113_0929113_88_441 117
231 3300049569 Ga0501032_1029710 Ga0501032_1029710_61_414 117
232 3300049570 Ga0501033_0545170 Ga0501033_0545170_186_539 117
233 3300049572 Ga0501036_0013243 Ga0501036_0013243_5606_5959 117
234 3300049574 Ga0501038_0041834 Ga0501038_0041834_1506_1859 117
235 3300049575 Ga0501039_0034022 Ga0501039_0034022_3330_3683 117
236 3300049576 Ga0501040_0011714 Ga0501040_0011714_1707_2060 117
237 3300049577 Ga0501041_0222888 Ga0501041_0222888_522_875 117
238 3300049577 Ga0501041_0465983 Ga0501041_0465983_135_488 117
239 3300049578 Ga0501042_0043437 Ga0501042_0043437_1805_2158 117
240 3300049579 Ga0501043_0514821 Ga0501043_0514821_367_720 117
241 3300049580 Ga0501046_0029044 Ga0501046_0029044_2355_2708 117
242 3300049580 Ga0501046_0631081 Ga0501046_0631081_267_620 117
243 3300049581 Ga0501047_1329280 Ga0501047_1329280_17_373 117
244 3300049582 Ga0501048_0032686 Ga0501048_0032686_253_606 117
245 3300049582 Ga0501048_1153619 Ga0501048_1153619_13_366 117
246 3300049584 Ga0501068_0287545 Ga0501068_0287545_385_738 117
247 3300049584 Ga0501068_0657680 Ga0501068_0657680_81_434 117
248 3300049587 Ga0501071_0055255 Ga0501071_0055255_1875_2228 117
249 3300049587 Ga0501071_0219316 Ga0501071_0219316_355_708 117
250 3300049587 Ga0501071_0799846 Ga0501071_0799846_218_571 117
251 3300049588 Ga0501072_0031892 Ga0501072_0031892_3315_3668 117
252 3300049589 Ga0501073_0394049 Ga0501073_0394049_347_700 117
253 3300049590 Ga0501074_0175664 Ga0501074_0175664_540_893 117
254 3300049590 Ga0501074_0727746 Ga0501074_0727746_97_450 117
255 3300049591 Ga0501075_0013582 Ga0501075_0013582_635_988 117
256 3300049591 Ga0501075_0565913 Ga0501075_0565913_57_410 117
257 3300049592 Ga0501076_0003180 Ga0501076_0003180_8981_9334 117
258 3300049593 Ga0501077_0006382 Ga0501077_0006382_1593_1946 117
259 3300049741 Ga0501079_0008683 Ga0501079_0008683_6757_7110 117
260 3300049742 Ga0501080_0066614 Ga0501080_0066614_2033_2386 117
261 3300049743 Ga0501081_0006427 Ga0501081_0006427_5746_6099 117
262 3300049743 Ga0501081_0680131 Ga0501081_0680131_110_463 117
263 3300049744 Ga0501083_0762668 Ga0501083_0762668_92_445 117
264 3300049744 Ga0501083_1019057 Ga0501083_1019057_163_516 117
265 3300049822 Ga0501035_0765901 Ga0501035_0765901_346_699 117
266 3300049824 Ga0501045_0002945 Ga0501045_0002945_4587_4940 117
267 3300049824 Ga0501045_0175535 Ga0501045_0175535_212_565 117
268 3300050490 nmdc:mga03n38_629546_c1 nmdc:mga03n38_629546_c1_163_516 117
269 3300050493 nmdc:mga0k408_396788_c1 nmdc:mga0k408_396788_c1_213_566 117
270 3300050494 nmdc:mga06z11_709447_c1 nmdc:mga06z11_709447_c1_226_579 117
271 3300050496 nmdc:mga07m45_504808_c1 nmdc:mga07m45_504808_c1_140_493 117
272 3300050507 nmdc:mga05p37_31263_c1 nmdc:mga05p37_31263_c1_2708_3061 117
273 3300050507 nmdc:mga05p37_327403_c1 nmdc:mga05p37_327403_c1_802_1155 117
274 3300050507 nmdc:mga05p37_367533_c1 nmdc:mga05p37_367533_c1_560_913 117
275 3300050508 nmdc:mga09592_127593_c1 nmdc:mga09592_127593_c1_406_759 117
276 3300050508 nmdc:mga09592_32093_c1 nmdc:mga09592_32093_c1_1084_1437 117
277 3300050508 nmdc:mga09592_777822_c1 nmdc:mga09592_777822_c1_198_551 117
278 3300050509 nmdc:mga0qj67_76015_c1 nmdc:mga0qj67_76015_c1_1640_1993 117
279 3300050510 nmdc:mga06r32_135484_c1 nmdc:mga06r32_135484_c1_416_769 117
280 3300050510 nmdc:mga06r32_63453_c1 nmdc:mga06r32_63453_c1_1619_1972 117
281 3300050511 nmdc:mga08y16_58729_c1 nmdc:mga08y16_58729_c1_1430_1783 117
282 3300050512 nmdc:mga0n895_315278_c1 nmdc:mga0n895_315278_c1_942_1295 117
283 3300050515 nmdc:mga0a205_734793_c1 nmdc:mga0a205_734793_c1_155_508 117
284 3300050516 nmdc:mga0sz30_172166_c1 nmdc:mga0sz30_172166_c1_480_833 117
285 3300054114 Ga0501084_0004691 Ga0501084_0004691_5492_5845 117
286 3300059421 Ga0590071_052947 Ga0590071_052947_271_624 117
287 3300059426 Ga0590077_040002 Ga0590077_040002_240_593 117
288 3300059624 Ga0587109_173221 Ga0587109_173221_13_366 117
289 3300059658 Ga0587119_031512 Ga0587119_031512_244_597 117
290 3300060346 Ga0587111_0060186 Ga0587111_0060186_34_387 117
291 3300060353 Ga0501082_0013108 Ga0501082_0013108_255_608 117
292 3300061734 Ga0530510_0058538 Ga0530510_0058538_313_666 117
293 3300061734 Ga0530510_0305415 Ga0530510_0305415_288_641 117
294 3300061734 Ga0530510_1365854 Ga0530510_1365854_139_492 117
295 3300001915 JGI24741J21665_1000265 JGI24741J21665_10002656 118
296 3300001979 JGI24740J21852_10003024 JGI24740J21852_100030243 118
297 3300002705 JGI25156J39149_1002382 JGI25156J39149_10023824 118
298 3300002705 JGI25156J39149_1017429 JGI25156J39149_10174291 118
299 3300002738 JGI25154J39366_1000270 JGI25154J39366_100027026 118
300 3300002741 JGI25157J39369_1018354 JGI25157J39369_10183542 118
301 3300003316 rootH1_10054210 rootH1_100542103 118
302 3300003322 rootL2_10013520 rootL2_100135202 118
303 3300003479 Ga0006556J51387_1012483 Ga0006556J51387_10124834 118
304 3300003558 Ga0006558J51389_1015687 Ga0006558J51389_10156874 118
305 3300003565 Ga0006560J51390_1007918 Ga0006560J51390_10079184 118
306 3300003751 Ga0055538_1001885 Ga0055538_10018854 118
307 3300003752 Ga0055539_1000061 Ga0055539_1000061138 118
308 3300003756 Ga0055533_1003319 Ga0055533_10033194 118
309 3300003758 Ga0055532_1000042 Ga0055532_1000042149 118
310 3300003759 Ga0055525_1000476 Ga0055525_100047619 118
311 3300003760 Ga0055527_1004436 Ga0055527_10044362 118
312 3300003761 Ga0055535_1000031 Ga0055535_100003155 118
313 3300003762 Ga0055542_1000412 Ga0055542_100041221 118
314 3300003763 Ga0055529_1000075 Ga0055529_10000756 118
315 3300003763 Ga0055529_1000098 Ga0055529_100009897 118
316 3300003841 Ga0055541_1002037 Ga0055541_10020373 118
317 3300004800 Ga0058861_10069241 Ga0058861_100692411 118
318 3300005290 Ga0065712_10201792 Ga0065712_102017923 118
319 3300005293 Ga0065715_10219956 Ga0065715_102199562 118
320 3300005293 Ga0065715_10648615 Ga0065715_106486152 118
321 3300005327 Ga0070658_10130145 Ga0070658_101301452 118
322 3300005327 Ga0070658_11196902 Ga0070658_111969021 118
323 3300005328 Ga0070676_10018449 Ga0070676_100184493 118
324 3300005328 Ga0070676_10836570 Ga0070676_108365701 118
325 3300005331 Ga0070670_100608948 Ga0070670_1006089482 118
326 3300005333 Ga0070677_10482703 Ga0070677_104827032 118
327 3300005339 Ga0070660_100035410 Ga0070660_1000354103 118
328 3300005339 Ga0070660_100074378 Ga0070660_1000743783 118
329 3300005339 Ga0070660_100190589 Ga0070660_1001905892 118
330 3300005344 Ga0070661_100000572 Ga0070661_1000005723 118
331 3300005344 Ga0070661_100000624 Ga0070661_10000062419 118
332 3300005344 Ga0070661_100005857 Ga0070661_1000058576 118
333 3300005344 Ga0070661_100191367 Ga0070661_1001913673 118
334 3300005344 Ga0070661_100611869 Ga0070661_1006118691 118
335 3300005347 Ga0070668_100712266 Ga0070668_1007122662 118
336 3300005353 Ga0070669_100330454 Ga0070669_1003304542 118
337 3300005354 Ga0070675_100069736 Ga0070675_1000697364 118
338 3300005354 Ga0070675_100529707 Ga0070675_1005297072 118
339 3300005355 Ga0070671_100012952 Ga0070671_1000129529 118
340 3300005355 Ga0070671_100214589 Ga0070671_1002145892 118
341 3300005364 Ga0070673_100206114 Ga0070673_1002061142 118
342 3300005364 Ga0070673_101647078 Ga0070673_1016470781 118
343 3300005366 Ga0070659_100000423 Ga0070659_10000042313 118
344 3300005366 Ga0070659_100017007 Ga0070659_1000170074 118
345 3300005366 Ga0070659_100068749 Ga0070659_1000687493 118
346 3300005367 Ga0070667_100414244 Ga0070667_1004142443 118
347 3300005434 Ga0070709_10164147 Ga0070709_101641472 118
348 3300005434 Ga0070709_10754522 Ga0070709_107545221 118
349 3300005436 Ga0070713_100000144 Ga0070713_10000014425 118
350 3300005436 Ga0070713_100603383 Ga0070713_1006033833 118
351 3300005445 Ga0070708_100000385 Ga0070708_10000038530 118
352 3300005455 Ga0070663_100000044 Ga0070663_10000004411 118
353 3300005455 Ga0070663_100001435 Ga0070663_10000143514 118
354 3300005455 Ga0070663_100079926 Ga0070663_1000799262 118
355 3300005457 Ga0070662_100000420 Ga0070662_10000042031 118
356 3300005457 Ga0070662_100100767 Ga0070662_1001007672 118
357 3300005457 Ga0070662_100299613 Ga0070662_1002996133 118
358 3300005457 Ga0070662_100612385 Ga0070662_1006123852 118
359 3300005458 Ga0070681_10013778 Ga0070681_100137783 118
360 3300005468 Ga0070707_101691841 Ga0070707_1016918411 118
361 3300005530 Ga0070679_100209056 Ga0070679_1002090562 118
362 3300005530 Ga0070679_100223654 Ga0070679_1002236542 118
363 3300005535 Ga0070684_100070650 Ga0070684_1000706503 118
364 3300005536 Ga0070697_100000575 Ga0070697_10000057525 118
365 3300005539 Ga0068853_100104597 Ga0068853_1001045974 118
366 3300005539 Ga0068853_100826933 Ga0068853_1008269333 118
367 3300005543 Ga0070672_100531386 Ga0070672_1005313863 118
368 3300005545 Ga0070695_100033916 Ga0070695_1000339165 118
369 3300005548 Ga0070665_100736695 Ga0070665_1007366952 118
370 3300005563 Ga0068855_100006100 Ga0068855_1000061002 118
371 3300005563 Ga0068855_100010916 Ga0068855_1000109164 118
372 3300005563 Ga0068855_101266333 Ga0068855_1012663332 118
373 3300005564 Ga0070664_100000092 Ga0070664_10000009212 118
374 3300005564 Ga0070664_100003753 Ga0070664_1000037534 118
375 3300005564 Ga0070664_100100665 Ga0070664_1001006652 118
376 3300005564 Ga0070664_100892147 Ga0070664_1008921471 118
377 3300005564 Ga0070664_101801671 Ga0070664_1018016712 118
378 3300005577 Ga0068857_100002063 Ga0068857_1000020634 118
379 3300005577 Ga0068857_100116553 Ga0068857_1001165532 118
380 3300005577 Ga0068857_100404549 Ga0068857_1004045492 118
381 3300005578 Ga0068854_100000106 Ga0068854_10000010615 118
382 3300005578 Ga0068854_100030518 Ga0068854_1000305184 118
383 3300005578 Ga0068854_100055294 Ga0068854_1000552943 118
384 3300005614 Ga0068856_100000261 Ga0068856_10000026112 118
385 3300005614 Ga0068856_100002410 Ga0068856_10000241010 118
386 3300005614 Ga0068856_100074312 Ga0068856_1000743123 118
387 3300005614 Ga0068856_100662076 Ga0068856_1006620763 118
388 3300005616 Ga0068852_100002265 Ga0068852_10000226512 118
389 3300005616 Ga0068852_100030031 Ga0068852_1000300312 118
390 3300005616 Ga0068852_100160392 Ga0068852_1001603924 118
391 3300005616 Ga0068852_101161903 Ga0068852_1011619032 118
392 3300005618 Ga0068864_101026710 Ga0068864_1010267102 118
393 3300005719 Ga0068861_100612942 Ga0068861_1006129422 118
394 3300005834 Ga0068851_10010539 Ga0068851_100105394 118
395 3300005844 Ga0068862_100174782 Ga0068862_1001747822 118
396 3300005985 Ga0081539_10303245 Ga0081539_103032451 118
397 3300006042 Ga0075368_10454444 Ga0075368_104544442 118
398 3300006048 Ga0075363_100426748 Ga0075363_1004267481 118
399 3300006051 Ga0075364_10597857 Ga0075364_105978572 118
400 3300006173 Ga0070716_100578420 Ga0070716_1005784202 118
401 3300006195 Ga0075366_10176908 Ga0075366_101769082 118
402 3300006237 Ga0097621_100914214 Ga0097621_1009142142 118
403 3300006844 Ga0075428_100533625 Ga0075428_1005336253 118
404 3300006846 Ga0075430_100238922 Ga0075430_1002389222 118
405 3300006846 Ga0075430_101677485 Ga0075430_1016774851 118
406 3300006847 Ga0075431_100019995 Ga0075431_1000199953 118
407 3300006871 Ga0075434_100392441 Ga0075434_1003924412 118
408 3300006914 Ga0075436_100006731 Ga0075436_1000067313 118
409 3300007076 Ga0075435_100226647 Ga0075435_1002266472 118
410 3300009093 Ga0105240_10008617 Ga0105240_1000861713 118
411 3300009093 Ga0105240_10145249 Ga0105240_101452492 118
412 3300009093 Ga0105240_11953099 Ga0105240_119530992 118
413 3300009094 Ga0111539_12784206 Ga0111539_127842062 118
414 3300009094 Ga0111539_12813035 Ga0111539_128130351 118
415 3300009098 Ga0105245_12966820 Ga0105245_129668201 118
416 3300009174 Ga0105241_10109842 Ga0105241_101098421 118
417 3300009174 Ga0105241_10412119 Ga0105241_104121192 118
418 3300009177 Ga0105248_12067772 Ga0105248_120677722 118
419 3300009545 Ga0105237_10135813 Ga0105237_101358131 118
420 3300009551 Ga0105238_10007857 Ga0105238_100078573 118
421 3300009553 Ga0105249_11477936 Ga0105249_114779362 118
422 3300010375 Ga0105239_12584776 Ga0105239_125847761 118
423 3300013100 Ga0157373_10037801 Ga0157373_100378012 118
424 3300013100 Ga0157373_10102807 Ga0157373_101028072 118
425 3300013102 Ga0157371_10000362 Ga0157371_1000036212 118
426 3300013102 Ga0157371_10002053 Ga0157371_1000205323 118
427 3300013104 Ga0157370_10000679 Ga0157370_1000067956 118
428 3300013104 Ga0157370_10006527 Ga0157370_1000652711 118
429 3300013104 Ga0157370_10011634 Ga0157370_100116346 118
430 3300013104 Ga0157370_10115295 Ga0157370_101152953 118
431 3300013104 Ga0157370_10674862 Ga0157370_106748623 118
432 3300013104 Ga0157370_11078474 Ga0157370_110784742 118
433 3300013105 Ga0157369_10008217 Ga0157369_100082174 118
434 3300013105 Ga0157369_10016934 Ga0157369_100169341 118
435 3300013105 Ga0157369_10152630 Ga0157369_101526304 118
436 3300013296 Ga0157374_10405771 Ga0157374_104057713 118
437 3300013307 Ga0157372_10000269 Ga0157372_1000026913 118
438 3300013307 Ga0157372_10000840 Ga0157372_1000084025 118
439 3300013307 Ga0157372_10037249 Ga0157372_100372494 118
440 3300013307 Ga0157372_10157127 Ga0157372_101571273 118
441 3300013307 Ga0157372_10353925 Ga0157372_103539252 118
442 3300013307 Ga0157372_10537440 Ga0157372_105374402 118
443 3300013308 Ga0157375_11172735 Ga0157375_111727353 118
444 3300014497 Ga0182008_10193013 Ga0182008_101930132 118
445 3300014745 Ga0157377_10129247 Ga0157377_101292473 118
446 3300015261 Ga0182006_1004957 Ga0182006_10049572 118
447 3300015262 Ga0182007_10064952 Ga0182007_100649522 118
448 3300020069 Ga0197907_10570786 Ga0197907_105707862 118
449 3300020069 Ga0197907_11198229 Ga0197907_111982291 118
450 3300020070 Ga0206356_10312632 Ga0206356_103126322 118
451 3300020070 Ga0206356_11850023 Ga0206356_118500233 118
452 3300020076 Ga0206355_1102112 Ga0206355_11021122 118
453 3300020077 Ga0206351_10067764 Ga0206351_100677645 118
454 3300020078 Ga0206352_10990901 Ga0206352_109909012 118
455 3300020080 Ga0206350_10339102 Ga0206350_103391022 118
456 3300020610 Ga0154015_1048785 Ga0154015_104878522 118
457 3300022467 Ga0224712_10156721 Ga0224712_101567213 118
458 3300025224 Ga0209784_100003 Ga0209784_1000031260 118
459 3300025225 Ga0209566_100002 Ga0209566_1000022214 118
460 3300025226 Ga0209674_100094 Ga0209674_10009431 118
461 3300025228 Ga0209672_101274 Ga0209672_1012744 118
462 3300025229 Ga0209147_100002 Ga0209147_1000021083 118
463 3300025230 Ga0209563_100004 Ga0209563_1000041631 118
464 3300025242 Ga0209258_100002 Ga0209258_1000021083 118
465 3300025246 Ga0209646_1000019 Ga0209646_1000019128 118
466 3300025272 Ga0209455_1000009 Ga0209455_1000009964 118
467 3300025321 Ga0207656_10002126 Ga0207656_100021263 118
468 3300025321 Ga0207656_10078068 Ga0207656_100780682 118
469 3300025893 Ga0207682_10421532 Ga0207682_104215322 118
470 3300025904 Ga0207647_10525842 Ga0207647_105258422 118
471 3300025906 Ga0207699_10235387 Ga0207699_102353872 118
472 3300025906 Ga0207699_10430383 Ga0207699_104303832 118
473 3300025906 Ga0207699_10699698 Ga0207699_106996982 118
474 3300025907 Ga0207645_10013029 Ga0207645_100130293 118
475 3300025909 Ga0207705_10098234 Ga0207705_100982343 118
476 3300025909 Ga0207705_10414031 Ga0207705_104140311 118
477 3300025909 Ga0207705_10515340 Ga0207705_105153403 118
478 3300025911 Ga0207654_10405774 Ga0207654_104057742 118
479 3300025911 Ga0207654_11141284 Ga0207654_111412841 118
480 3300025912 Ga0207707_10100210 Ga0207707_101002103 118
481 3300025913 Ga0207695_10004551 Ga0207695_1000455125 118
482 3300025913 Ga0207695_10020125 Ga0207695_100201257 118
483 3300025913 Ga0207695_10936114 Ga0207695_109361142 118
484 3300025914 Ga0207671_10234915 Ga0207671_102349151 118
485 3300025915 Ga0207693_10764635 Ga0207693_107646353 118
486 3300025916 Ga0207663_11602140 Ga0207663_116021401 118
487 3300025917 Ga0207660_10437418 Ga0207660_104374181 118
488 3300025919 Ga0207657_10003688 Ga0207657_1000368815 118
489 3300025919 Ga0207657_10039699 Ga0207657_100396994 118
490 3300025919 Ga0207657_10082549 Ga0207657_100825493 118
491 3300025920 Ga0207649_10000082 Ga0207649_1000008259 118
492 3300025920 Ga0207649_10008379 Ga0207649_100083795 118
493 3300025920 Ga0207649_10011378 Ga0207649_100113783 118
494 3300025921 Ga0207652_10059916 Ga0207652_100599163 118
495 3300025921 Ga0207652_10193347 Ga0207652_101933471 118
496 3300025923 Ga0207681_10348730 Ga0207681_103487302 118
497 3300025924 Ga0207694_10005179 Ga0207694_100051799 118
498 3300025925 Ga0207650_10310020 Ga0207650_103100202 118
499 3300025926 Ga0207659_10025057 Ga0207659_100250573 118
500 3300025926 Ga0207659_10054358 Ga0207659_100543584 118
501 3300025928 Ga0207700_10000049 Ga0207700_1000004932 118
502 3300025928 Ga0207700_10618875 Ga0207700_106188751 118
503 3300025929 Ga0207664_10055578 Ga0207664_100555783 118
504 3300025931 Ga0207644_10014701 Ga0207644_100147012 118
505 3300025931 Ga0207644_10336341 Ga0207644_103363412 118
506 3300025932 Ga0207690_10000505 Ga0207690_1000050518 118
507 3300025932 Ga0207690_10006601 Ga0207690_100066016 118
508 3300025932 Ga0207690_10020191 Ga0207690_100201914 118
509 3300025932 Ga0207690_10217628 Ga0207690_102176283 118
510 3300025932 Ga0207690_10256515 Ga0207690_102565152 118
511 3300025933 Ga0207706_10000008 Ga0207706_100000087 118
512 3300025933 Ga0207706_10140316 Ga0207706_101403162 118
513 3300025933 Ga0207706_10249030 Ga0207706_102490302 118
514 3300025937 Ga0207669_10513619 Ga0207669_105136193 118
515 3300025939 Ga0207665_10092556 Ga0207665_100925563 118
516 3300025940 Ga0207691_10117953 Ga0207691_101179534 118
517 3300025941 Ga0207711_10750821 Ga0207711_107508212 118
518 3300025945 Ga0207679_10000619 Ga0207679_1000061918 118
519 3300025945 Ga0207679_10001556 Ga0207679_100015568 118
520 3300025949 Ga0207667_10001617 Ga0207667_1000161731 118
521 3300025949 Ga0207667_10007693 Ga0207667_100076938 118
522 3300025949 Ga0207667_10070424 Ga0207667_100704242 118
523 3300025960 Ga0207651_10015954 Ga0207651_100159543 118
524 3300025960 Ga0207651_10213471 Ga0207651_102134711 118
525 3300025972 Ga0207668_10251457 Ga0207668_102514572 118
526 3300025981 Ga0207640_10000127 Ga0207640_1000012758 118
527 3300025981 Ga0207640_10013945 Ga0207640_100139453 118
528 3300025981 Ga0207640_10041717 Ga0207640_100417172 118
529 3300025981 Ga0207640_10468647 Ga0207640_104686472 118
530 3300025986 Ga0207658_10198288 Ga0207658_101982883 118
531 3300026023 Ga0207677_11339083 Ga0207677_113390832 118
532 3300026041 Ga0207639_10802156 Ga0207639_108021562 118
533 3300026067 Ga0207678_10000148 Ga0207678_1000014858 118
534 3300026067 Ga0207678_10008723 Ga0207678_100087237 118
535 3300026067 Ga0207678_10191512 Ga0207678_101915123 118
536 3300026067 Ga0207678_10298393 Ga0207678_102983933 118
537 3300026078 Ga0207702_10000296 Ga0207702_1000029612 118
538 3300026078 Ga0207702_10004303 Ga0207702_100043037 118
539 3300026078 Ga0207702_10004494 Ga0207702_1000449410 118
540 3300026088 Ga0207641_11235290 Ga0207641_112352902 118
541 3300026116 Ga0207674_10000518 Ga0207674_1000051837 118
542 3300026116 Ga0207674_10025655 Ga0207674_100256554 118
543 3300026116 Ga0207674_10200273 Ga0207674_102002734 118
544 3300026116 Ga0207674_10234320 Ga0207674_102343202 118
545 3300026118 Ga0207675_100503502 Ga0207675_1005035021 118
546 3300026142 Ga0207698_10009025 Ga0207698_100090253 118
547 3300026142 Ga0207698_10199034 Ga0207698_101990343 118
548 3300027360 Ga0209969_1012546 Ga0209969_10125463 118
549 3300027526 Ga0209968_1048415 Ga0209968_10484153 118
550 3300027543 Ga0209999_1012445 Ga0209999_10124452 118
551 3300027614 Ga0209970_1042959 Ga0209970_10429592 118
552 3300027665 Ga0209983_1011042 Ga0209983_10110425 118
553 3300027717 Ga0209998_10055701 Ga0209998_100557012 118
554 3300028380 Ga0268265_10295480 Ga0268265_102954803 118
555 3300031241 Ga0265325_10021324 Ga0265325_100213243 118
556 3300031241 Ga0265325_10096364 Ga0265325_100963643 118
557 3300031344 Ga0265316_10112987 Ga0265316_101129873 118
558 3300031548 Ga0307408_100019328 Ga0307408_1000193288 118
559 3300031665 Ga0316575_10134047 Ga0316575_101340471 118
560 3300031665 Ga0316575_10191270 Ga0316575_101912702 118
561 3300031665 Ga0316575_10259355 Ga0316575_102593551 118
562 3300031727 Ga0316576_10010708 Ga0316576_100107083 118
563 3300031727 Ga0316576_10758987 Ga0316576_107589872 118
564 3300031731 Ga0307405_10051823 Ga0307405_100518232 118
565 3300031733 Ga0316577_10187892 Ga0316577_101878922 118
566 3300031824 Ga0307413_10067137 Ga0307413_100671375 118
567 3300031824 Ga0307413_12194619 Ga0307413_121946191 118
568 3300031901 Ga0307406_10062493 Ga0307406_100624932 118
569 3300031903 Ga0307407_10058816 Ga0307407_100588163 118
570 3300031911 Ga0307412_10137020 Ga0307412_101370202 118
571 3300031995 Ga0307409_100084410 Ga0307409_1000844102 118
572 3300032002 Ga0307416_100366861 Ga0307416_1003668611 118
573 3300032004 Ga0307414_10115265 Ga0307414_101152655 118
574 3300032137 Ga0316585_10005778 Ga0316585_100057784 118
575 3300033541 Ga0316596_1022203 Ga0316596_10222034 118
576 3300033541 Ga0316596_1094113 Ga0316596_10941132 118
577 3300033541 Ga0316596_1123332 Ga0316596_11233322 118
578 3300034816 Ga0373930_0085821 Ga0373930_0085821_10_366 118
579 3300035091 Ga0373951_0039078 Ga0373951_0039078_649_1005 118
580 3300035207 Ga0373942_0127178 Ga0373942_0127178_401_757 118
581 3300035398 Ga0316574_0002731 Ga0316574_0002731_7261_7617 118
582 3300035398 Ga0316574_0049546 Ga0316574_0049546_701_1057 118
583 3300035398 Ga0316574_0181279 Ga0316574_0181279_416_772 118
584 3300035398 Ga0316574_0493217 Ga0316574_0493217_167_523 118
585 3300035691 Ga0373931_0107397 Ga0373931_0107397_958_1314 118
586 3300036401 Ga0373937_0293103 Ga0373937_0293103_365_721 118
587 3300036401 Ga0373937_0891476 Ga0373937_0891476_171_527 118
588 3300036647 Ga0316582_0043553 Ga0316582_0043553_1577_1933 118
589 3300036647 Ga0316582_0243649 Ga0316582_0243649_295_651 118
590 3300036647 Ga0316582_1120467 Ga0316582_1120467_56_412 118
591 3300036712 Ga0316584_0026514 Ga0316584_0026514_1151_1507 118
592 3300036712 Ga0316584_0192676 Ga0316584_0192676_1031_1387 118
593 3300037418 Ga0395900_0081759 Ga0395900_0081759_2808_3164 118
594 3300037466 Ga0395898_0025032 Ga0395898_0025032_2933_3289 118
595 3300037471 Ga0395905_0840326 Ga0395905_0840326_115_471 118
596 3300038443 Ga0395901_0013420 Ga0395901_0013420_1509_1865 118
597 3300039437 Ga0436365_0821095 Ga0436365_0821095_745_1101 118
598 3300041501 Ga0451845_0442828 Ga0451845_0442828_177_533 118
599 3300042134 Ga0450898_031674 Ga0450898_031674_83_439 118
600 3300042437 Ga0439444_0052595 Ga0439444_0052595_444_800 118
601 3300042876 Ga0451577_0404485 Ga0451577_0404485_618_974 118
602 3300044694 Ga0466963_0201770 Ga0466963_0201770_997_1353 118
603 3300044694 Ga0466963_0598664 Ga0466963_0598664_55_411 118
604 3300044706 Ga0466964_0193626 Ga0466964_0193626_547_903 118
605 3300044712 Ga0453684_0000331 Ga0453684_0000331_181671_182027 118
606 3300044712 Ga0453684_1284049 Ga0453684_1284049_130_486 118
607 3300045051 Ga0451576_0436543 Ga0451576_0436543_574_930 118
608 3300045051 Ga0451576_1122632 Ga0451576_1122632_334_690 118
609 3300045976 Ga0466967_0135710 Ga0466967_0135710_435_791 118
610 3300045976 Ga0466967_0511870 Ga0466967_0511870_557_913 118
611 3300046491 Ga0495584_0236515 Ga0495584_0236515_243_599 118
612 3300046516 Ga0495628_0596769 Ga0495628_0596769_165_521 118
613 3300046517 Ga0495630_0019419 Ga0495630_0019419_4604_4960 118
614 3300046519 Ga0495632_0217988 Ga0495632_0217988_378_734 118
615 3300046543 Ga0495645_0401509 Ga0495645_0401509_493_849 118
616 3300046557 Ga0495622_0024818 Ga0495622_0024818_721_1077 118
617 3300046557 Ga0495622_0083637 Ga0495622_0083637_892_1248 118
618 3300046557 Ga0495622_0108793 Ga0495622_0108793_281_637 118
619 3300046648 Ga0495611_0154967 Ga0495611_0154967_469_825 118
620 3300046794 Ga0495589_0023233 Ga0495589_0023233_1519_1875 118
621 3300047322 Ga0495680_0122818 Ga0495680_0122818_1305_1661 118
622 3300047447 Ga0495685_117472 Ga0495685_117472_251_607 118
623 3300048906 Ga0496103_0077124 Ga0496103_0077124_1280_1636 118
624 3300048909 Ga0496106_0014546 Ga0496106_0014546_85_441 118
625 3300048910 Ga0496107_0044617 Ga0496107_0044617_708_1064 118
626 3300048911 Ga0496108_1384631 Ga0496108_1384631_72_428 118
627 3300048912 Ga0496109_0668046 Ga0496109_0668046_608_964 118
628 3300048913 Ga0496110_0762495 Ga0496110_0762495_216_572 118
629 3300048917 Ga0496114_0485547 Ga0496114_0485547_597_953 118
630 3300049460 Ga0495682_0277459 Ga0495682_0277459_191_547 118
631 3300049571 Ga0501034_0151756 Ga0501034_0151756_473_829 118
632 3300049578 Ga0501042_1426657 Ga0501042_1426657_10_366 118
633 3300049581 Ga0501047_0651317 Ga0501047_0651317_403_759 118
634 3300049583 Ga0501067_0047612 Ga0501067_0047612_992_1348 118
635 3300049584 Ga0501068_0829455 Ga0501068_0829455_17_373 118
636 3300049591 Ga0501075_0492065 Ga0501075_0492065_276_632 118
637 3300049592 Ga0501076_1035120 Ga0501076_1035120_195_551 118
638 3300049593 Ga0501077_0529278 Ga0501077_0529278_337_693 118
639 3300049741 Ga0501079_0246577 Ga0501079_0246577_807_1163 118
640 3300049742 Ga0501080_0898770 Ga0501080_0898770_131_487 118
641 3300049744 Ga0501083_0126302 Ga0501083_0126302_123_479 118
642 3300049822 Ga0501035_0853483 Ga0501035_0853483_326_682 118
643 3300050493 nmdc:mga0k408_159856_c1 nmdc:mga0k408_159856_c1_705_1061 118
644 3300050494 nmdc:mga06z11_85224_c1 nmdc:mga06z11_85224_c1_273_629 118
645 3300050495 nmdc:mga04h51_271078_c1 nmdc:mga04h51_271078_c1_63_419 118
646 3300050508 nmdc:mga09592_84040_c1 nmdc:mga09592_84040_c1_429_788 118
647 3300050510 nmdc:mga06r32_8364_c1 nmdc:mga06r32_8364_c1_6284_6643 118
648 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_234565_234921 118
649 3300059477 Ga0587084_026488 Ga0587084_026488_146_502 118
650 3300059478 Ga0587093_010879 Ga0587093_010879_403_759 118
651 3300059490 Ga0587066_043318 Ga0587066_043318_331_687 118
652 3300059491 Ga0587070_149386 Ga0587070_149386_81_437 118
653 3300059492 Ga0587073_0040742 Ga0587073_0040742_252_608 118
654 3300059493 Ga0587077_223312 Ga0587077_223312_47_403 118
655 3300059503 Ga0587080_136717 Ga0587080_136717_146_502 118
656 3300059504 Ga0587082_109485 Ga0587082_109485_115_471 118
657 3300059505 Ga0587083_0004429 Ga0587083_0004429_1481_1837 118
658 3300059506 Ga0587085_099862 Ga0587085_099862_142_498 118
659 3300059507 Ga0587086_077904 Ga0587086_077904_52_408 118
660 3300059508 Ga0587088_032384 Ga0587088_032384_147_503 118
661 3300059510 Ga0587090_047844 Ga0587090_047844_262_618 118
662 3300059511 Ga0587091_079124 Ga0587091_079124_258_614 118
663 3300059512 Ga0587092_054918 Ga0587092_054918_233_589 118
664 3300059513 Ga0587094_003525 Ga0587094_003525_165_521 118
665 3300059514 Ga0587095_032742 Ga0587095_032742_108_464 118
666 3300059603 Ga0587097_06083 Ga0587097_06083_83_439 118
667 3300059604 Ga0587098_017987 Ga0587098_017987_403_759 118
668 3300059605 Ga0587106_039349 Ga0587106_039349_111_467 118
669 3300059623 Ga0587101_022858 Ga0587101_022858_158_514 118
670 3300059624 Ga0587109_081650 Ga0587109_081650_261_617 118
671 3300059625 Ga0587113_039889 Ga0587113_039889_61_417 118
672 3300059625 Ga0587113_049473 Ga0587113_049473_21_377 118
673 3300059627 Ga0587117_122812 Ga0587117_122812_70_426 118
674 3300059628 Ga0587122_023836 Ga0587122_023836_254_610 118
675 3300059630 Ga0587128_020710 Ga0587128_020710_472_828 118
676 3300059640 Ga0587067_049438 Ga0587067_049438_367_723 118
677 3300059641 Ga0587068_027370 Ga0587068_027370_199_555 118
678 3300059642 Ga0587069_040389 Ga0587069_040389_338_694 118
679 3300059643 Ga0587072_001295 Ga0587072_001295_714_1070 118
680 3300059644 Ga0587075_066002 Ga0587075_066002_182_538 118
681 3300059645 Ga0587076_040825 Ga0587076_040825_139_495 118
682 3300059646 Ga0587078_016640 Ga0587078_016640_139_495 118
683 3300059647 Ga0587079_050781 Ga0587079_050781_401_757 118
684 3300059649 Ga0587102_016524 Ga0587102_016524_142_498 118
685 3300059650 Ga0587104_002966 Ga0587104_002966_176_532 118
686 3300059651 Ga0587105_009361 Ga0587105_009361_108_464 118
687 3300059652 Ga0587107_078591 Ga0587107_078591_136_492 118
688 3300059653 Ga0587108_023537 Ga0587108_023537_138_494 118
689 3300059659 Ga0587120_022259 Ga0587120_022259_111_467 118
690 3300059660 Ga0587124_035786 Ga0587124_035786_72_428 118
691 3300060344 Ga0587071_046941 Ga0587071_046941_389_745 118
692 3300060346 Ga0587111_0011632 Ga0587111_0011632_470_826 118
693 3300060353 Ga0501082_0076117 Ga0501082_0076117_1691_2047 118
694 3300060353 Ga0501082_0104606 Ga0501082_0104606_1349_1705 118
695 3300060353 Ga0501082_0927295 Ga0501082_0927295_172_528 118
696 3300061734 Ga0530510_1160480 Ga0530510_1160480_156_512 118
697 2162886011 MRS1b_contig_467817 MRS1b_0978.00002760 119
698 3300001904 JGI24736J21556_1003566 JGI24736J21556_10035664 119
699 3300001904 JGI24736J21556_1016467 JGI24736J21556_10164672 119
700 3300001915 JGI24741J21665_1018410 JGI24741J21665_10184102 119
701 3300001979 JGI24740J21852_10004294 JGI24740J21852_100042943 119
702 3300001979 JGI24740J21852_10007396 JGI24740J21852_100073964 119
703 3300002067 JGI24735J21928_10001419 JGI24735J21928_100014195 119
704 3300002075 JGI24738J21930_10011781 JGI24738J21930_100117813 119
705 3300002704 JGI25155J39150_1000149 JGI25155J39150_100014927 119
706 3300002705 JGI25156J39149_1000321 JGI25156J39149_100032127 119
707 3300002705 JGI25156J39149_1002718 JGI25156J39149_10027184 119
708 3300002737 JGI25162J39368_1003830 JGI25162J39368_10038302 119
709 3300002741 JGI25157J39369_1000205 JGI25157J39369_100020546 119
710 3300002772 JGI25164J39214_1005100 JGI25164J39214_10051002 119
711 3300003162 Ga0006778J45830_1021150 Ga0006778J45830_10211503 119
712 3300003163 Ga0006759J45824_1010099 Ga0006759J45824_10100994 119
713 3300003214 JGI25165J46597_1003371 JGI25165J46597_10033714 119
714 3300003288 Ga0007428J48920_103116 Ga0007428J48920_1031163 119
715 3300003300 Ga0006758J48902_1007842 Ga0006758J48902_10078423 119
716 3300003305 Ga0006770J48903_1012120 Ga0006770J48903_10121203 119
717 3300003305 Ga0006770J48903_1020897 Ga0006770J48903_10208973 119
718 3300003308 Ga0006777J48905_1011266 Ga0006777J48905_10112662 119
719 3300003308 Ga0006777J48905_1013693 Ga0006777J48905_10136933 119
720 3300003322 rootL2_10049225 rootL2_100492254 119
721 3300003322 rootL2_10096027 rootL2_100960271 119
722 3300003396 JGI26137J50245_101350 JGI26137J50245_1013502 119
723 3300003479 Ga0006556J51387_1015829 Ga0006556J51387_10158294 119
724 3300003544 Ga0007417J51691_1005144 Ga0007417J51691_10051446 119
725 3300003558 Ga0006558J51389_1024460 Ga0006558J51389_10244602 119
726 3300003559 Ga0007427J51700_107497 Ga0007427J51700_1074973 119
727 3300003565 Ga0006560J51390_1017913 Ga0006560J51390_10179132 119
728 3300003567 Ga0006554J51385_1014354 Ga0006554J51385_10143544 119
729 3300003574 Ga0007410J51695_1004741 Ga0007410J51695_10047415 119
730 3300003574 Ga0007410J51695_1010533 Ga0007410J51695_10105332 119
731 3300003574 Ga0007410J51695_1022044 Ga0007410J51695_10220442 119
732 3300003575 Ga0007409J51694_1003076 Ga0007409J51694_10030765 119
733 3300003575 Ga0007409J51694_1020735 Ga0007409J51694_10207352 119
734 3300003577 Ga0007416J51690_1004660 Ga0007416J51690_10046604 119
735 3300003579 Ga0007429J51699_1011665 Ga0007429J51699_10116653 119
736 3300003611 Ga0007411J51799_103552 Ga0007411J51799_1035524 119
737 3300003693 Ga0032354_1015078 Ga0032354_10150783 119
738 3300003693 Ga0032354_1028937 Ga0032354_10289375 119
739 3300003735 Ga0006780_1002600 Ga0006780_10026002 119
740 3300003756 Ga0055533_1001925 Ga0055533_10019253 119
741 3300003758 Ga0055532_1000016 Ga0055532_1000016117 119
742 3300003758 Ga0055532_1000063 Ga0055532_1000063101 119
743 3300003758 Ga0055532_1025047 Ga0055532_10250472 119
744 3300003759 Ga0055525_1010446 Ga0055525_10104462 119
745 3300003760 Ga0055527_1000049 Ga0055527_10000495 119
746 3300003760 Ga0055527_1001614 Ga0055527_10016142 119
747 3300003761 Ga0055535_1000042 Ga0055535_1000042101 119
748 3300003761 Ga0055535_1015444 Ga0055535_10154443 119
749 3300003761 Ga0055535_1028021 Ga0055535_10280212 119
750 3300003762 Ga0055542_1000071 Ga0055542_1000071101 119
751 3300003762 Ga0055542_1018476 Ga0055542_10184762 119
752 3300003763 Ga0055529_1000081 Ga0055529_1000081101 119
753 3300003763 Ga0055529_1001660 Ga0055529_10016603 119
754 3300003771 Ga0055526_1002009 Ga0055526_100200916 119
755 3300003771 Ga0055526_1043174 Ga0055526_10431742 119
756 3300003773 Ga0055537_1012165 Ga0055537_10121653 119
757 3300003775 Ga0055524_1000003 Ga0055524_100000335 119
758 3300003790 Ga0055528_1000218 Ga0055528_100021818 119
759 3300003790 Ga0055528_1000672 Ga0055528_10006728 119
760 3300003841 Ga0055541_1023053 Ga0055541_10230532 119
761 3300003856 Ga0058692_1002973 Ga0058692_10029735 119
762 3300003856 Ga0058692_1037743 Ga0058692_10377431 119
763 3300004799 Ga0058863_10924078 Ga0058863_109240782 119
764 3300004799 Ga0058863_11920116 Ga0058863_119201161 119
765 3300004800 Ga0058861_10044791 Ga0058861_100447912 119
766 3300004801 Ga0058860_11440710 Ga0058860_114407102 119
767 3300004801 Ga0058860_12096926 Ga0058860_120969262 119
768 3300004803 Ga0058862_11883282 Ga0058862_118832822 119
769 3300004803 Ga0058862_12801278 Ga0058862_128012781 119
770 3300004803 Ga0058862_12836520 Ga0058862_128365201 119
771 3300005262 Ga0065165_1000454 Ga0065165_10004548 119
772 3300005262 Ga0065165_1000487 Ga0065165_100048740 119
773 3300005289 Ga0065704_10748319 Ga0065704_107483191 119
774 3300005290 Ga0065712_10137144 Ga0065712_101371441 119
775 3300005290 Ga0065712_10529793 Ga0065712_105297932 119
776 3300005293 Ga0065715_10011615 Ga0065715_100116152 119
777 3300005295 Ga0065707_10192844 Ga0065707_101928442 119
778 3300005327 Ga0070658_10013202 Ga0070658_100132026 119
779 3300005327 Ga0070658_10018764 Ga0070658_100187642 119
780 3300005327 Ga0070658_10246418 Ga0070658_102464181 119
781 3300005327 Ga0070658_10789240 Ga0070658_107892402 119
782 3300005328 Ga0070676_10179195 Ga0070676_101791953 119
783 3300005328 Ga0070676_10308274 Ga0070676_103082741 119
784 3300005329 Ga0070683_100080133 Ga0070683_1000801334 119
785 3300005329 Ga0070683_100248341 Ga0070683_1002483413 119
786 3300005329 Ga0070683_100423692 Ga0070683_1004236922 119
787 3300005330 Ga0070690_100242253 Ga0070690_1002422533 119
788 3300005330 Ga0070690_100421197 Ga0070690_1004211972 119
789 3300005331 Ga0070670_100171970 Ga0070670_1001719702 119
790 3300005331 Ga0070670_100192782 Ga0070670_1001927822 119
791 3300005331 Ga0070670_100340681 Ga0070670_1003406812 119
792 3300005331 Ga0070670_100463187 Ga0070670_1004631872 119
793 3300005331 Ga0070670_100680007 Ga0070670_1006800072 119
794 3300005333 Ga0070677_10003837 Ga0070677_100038374 119
795 3300005333 Ga0070677_10006533 Ga0070677_100065332 119
796 3300005334 Ga0068869_100054417 Ga0068869_1000544172 119
797 3300005334 Ga0068869_100184739 Ga0068869_1001847393 119
798 3300005334 Ga0068869_100599516 Ga0068869_1005995162 119
799 3300005335 Ga0070666_10040086 Ga0070666_100400863 119
800 3300005335 Ga0070666_10051062 Ga0070666_100510622 119
801 3300005336 Ga0070680_100072484 Ga0070680_1000724843 119
802 3300005336 Ga0070680_101643775 Ga0070680_1016437751 119
803 3300005337 Ga0070682_100056080 Ga0070682_1000560802 119
804 3300005337 Ga0070682_100075283 Ga0070682_1000752834 119
805 3300005337 Ga0070682_100133901 Ga0070682_1001339012 119
806 3300005337 Ga0070682_100285571 Ga0070682_1002855711 119
807 3300005337 Ga0070682_100955056 Ga0070682_1009550562 119
808 3300005338 Ga0068868_100090724 Ga0068868_1000907244 119
809 3300005339 Ga0070660_100000238 Ga0070660_10000023824 119
810 3300005339 Ga0070660_100000440 Ga0070660_10000044011 119
811 3300005339 Ga0070660_100031270 Ga0070660_1000312704 119
812 3300005339 Ga0070660_100321255 Ga0070660_1003212552 119
813 3300005339 Ga0070660_100529385 Ga0070660_1005293852 119
814 3300005340 Ga0070689_100088834 Ga0070689_1000888343 119
815 3300005340 Ga0070689_100689973 Ga0070689_1006899732 119
816 3300005341 Ga0070691_10073539 Ga0070691_100735392 119
817 3300005341 Ga0070691_10308287 Ga0070691_103082873 119
818 3300005341 Ga0070691_10694881 Ga0070691_106948811 119
819 3300005343 Ga0070687_100076176 Ga0070687_1000761763 119
820 3300005344 Ga0070661_100026549 Ga0070661_1000265494 119
821 3300005344 Ga0070661_100254695 Ga0070661_1002546953 119
822 3300005344 Ga0070661_100255088 Ga0070661_1002550883 119
823 3300005344 Ga0070661_100306200 Ga0070661_1003062002 119
824 3300005344 Ga0070661_100853318 Ga0070661_1008533181 119
825 3300005344 Ga0070661_101806077 Ga0070661_1018060771 119
826 3300005345 Ga0070692_10053704 Ga0070692_100537042 119
827 3300005347 Ga0070668_100105436 Ga0070668_1001054362 119
828 3300005347 Ga0070668_100281693 Ga0070668_1002816931 119
829 3300005347 Ga0070668_100487652 Ga0070668_1004876522 119
830 3300005347 Ga0070668_101342748 Ga0070668_1013427481 119
831 3300005353 Ga0070669_100285938 Ga0070669_1002859382 119
832 3300005354 Ga0070675_100032138 Ga0070675_1000321381 119
833 3300005354 Ga0070675_100471619 Ga0070675_1004716192 119
834 3300005354 Ga0070675_100668516 Ga0070675_1006685161 119
835 3300005354 Ga0070675_102245919 Ga0070675_1022459191 119
836 3300005355 Ga0070671_100028499 Ga0070671_1000284993 119
837 3300005355 Ga0070671_100139086 Ga0070671_1001390862 119
838 3300005355 Ga0070671_100355745 Ga0070671_1003557451 119
839 3300005355 Ga0070671_100375011 Ga0070671_1003750112 119
840 3300005355 Ga0070671_101781463 Ga0070671_1017814631 119
841 3300005356 Ga0070674_100037697 Ga0070674_1000376971 119
842 3300005364 Ga0070673_100005235 Ga0070673_1000052356 119
843 3300005364 Ga0070673_101072588 Ga0070673_1010725881 119
844 3300005364 Ga0070673_101389910 Ga0070673_1013899102 119
845 3300005366 Ga0070659_100000492 Ga0070659_1000004929 119
846 3300005366 Ga0070659_100049966 Ga0070659_1000499661 119
847 3300005366 Ga0070659_100097070 Ga0070659_1000970704 119
848 3300005366 Ga0070659_100135433 Ga0070659_1001354333 119
849 3300005366 Ga0070659_101182187 Ga0070659_1011821872 119
850 3300005367 Ga0070667_100243080 Ga0070667_1002430802 119
851 3300005367 Ga0070667_100429326 Ga0070667_1004293261 119
852 3300005406 Ga0070703_10006032 Ga0070703_100060323 119
853 3300005406 Ga0070703_10314245 Ga0070703_103142451 119
854 3300005434 Ga0070709_10495669 Ga0070709_104956692 119
855 3300005434 Ga0070709_11220539 Ga0070709_112205392 119
856 3300005435 Ga0070714_100003989 Ga0070714_1000039891 119
857 3300005435 Ga0070714_101918261 Ga0070714_1019182611 119
858 3300005436 Ga0070713_100188977 Ga0070713_1001889773 119
859 3300005437 Ga0070710_11018623 Ga0070710_110186232 119
860 3300005437 Ga0070710_11297854 Ga0070710_112978541 119
861 3300005438 Ga0070701_10017385 Ga0070701_100173853 119
862 3300005438 Ga0070701_11101119 Ga0070701_111011191 119
863 3300005438 Ga0070701_11237647 Ga0070701_112376471 119
864 3300005440 Ga0070705_100000110 Ga0070705_10000011024 119
865 3300005440 Ga0070705_100395264 Ga0070705_1003952641 119
866 3300005440 Ga0070705_101433742 Ga0070705_1014337422 119
867 3300005441 Ga0070700_100092259 Ga0070700_1000922592 119
868 3300005441 Ga0070700_100098065 Ga0070700_1000980651 119
869 3300005441 Ga0070700_100144405 Ga0070700_1001444052 119
870 3300005441 Ga0070700_100329461 Ga0070700_1003294612 119
871 3300005441 Ga0070700_100502171 Ga0070700_1005021713 119
872 3300005444 Ga0070694_100000271 Ga0070694_1000002714 119
873 3300005444 Ga0070694_100256855 Ga0070694_1002568553 119
874 3300005444 Ga0070694_100311945 Ga0070694_1003119451 119
875 3300005445 Ga0070708_100006092 Ga0070708_1000060927 119
876 3300005445 Ga0070708_100121566 Ga0070708_1001215663 119
877 3300005455 Ga0070663_100014542 Ga0070663_1000145426 119
878 3300005455 Ga0070663_100050031 Ga0070663_1000500313 119
879 3300005455 Ga0070663_100164610 Ga0070663_1001646102 119
880 3300005455 Ga0070663_100165808 Ga0070663_1001658081 119
881 3300005455 Ga0070663_100241696 Ga0070663_1002416962 119
882 3300005455 Ga0070663_100802592 Ga0070663_1008025922 119
883 3300005455 Ga0070663_100841942 Ga0070663_1008419421 119
884 3300005455 Ga0070663_101086953 Ga0070663_1010869532 119
885 3300005456 Ga0070678_100001698 Ga0070678_1000016984 119
886 3300005456 Ga0070678_100507494 Ga0070678_1005074942 119
887 3300005456 Ga0070678_100520178 Ga0070678_1005201782 119
888 3300005456 Ga0070678_100686075 Ga0070678_1006860752 119
889 3300005457 Ga0070662_100139118 Ga0070662_1001391183 119
890 3300005457 Ga0070662_100166056 Ga0070662_1001660563 119
891 3300005457 Ga0070662_100288310 Ga0070662_1002883102 119
892 3300005457 Ga0070662_100464594 Ga0070662_1004645942 119
893 3300005457 Ga0070662_100587728 Ga0070662_1005877281 119
894 3300005457 Ga0070662_101378994 Ga0070662_1013789942 119
895 3300005457 Ga0070662_101713572 Ga0070662_1017135721 119
896 3300005458 Ga0070681_10008704 Ga0070681_100087045 119
897 3300005458 Ga0070681_10012957 Ga0070681_100129577 119
898 3300005458 Ga0070681_10676554 Ga0070681_106765541 119
899 3300005459 Ga0068867_100009596 Ga0068867_1000095966 119
900 3300005459 Ga0068867_100063854 Ga0068867_1000638544 119
901 3300005459 Ga0068867_100560265 Ga0068867_1005602651 119
902 3300005459 Ga0068867_101339770 Ga0068867_1013397701 119
903 3300005459 Ga0068867_101451168 Ga0068867_1014511681 119
904 3300005459 Ga0068867_101476285 Ga0068867_1014762851 119
905 3300005466 Ga0070685_10112916 Ga0070685_101129163 119
906 3300005467 Ga0070706_100123251 Ga0070706_1001232514 119
907 3300005467 Ga0070706_100135690 Ga0070706_1001356904 119
908 3300005468 Ga0070707_100023776 Ga0070707_1000237764 119
909 3300005468 Ga0070707_101513131 Ga0070707_1015131311 119
910 3300005471 Ga0070698_100395086 Ga0070698_1003950862 119
911 3300005518 Ga0070699_100000653 Ga0070699_10000065325 119
912 3300005518 Ga0070699_100644367 Ga0070699_1006443672 119
913 3300005530 Ga0070679_100142869 Ga0070679_1001428692 119
914 3300005536 Ga0070697_100029000 Ga0070697_1000290003 119
915 3300005536 Ga0070697_100052698 Ga0070697_1000526982 119
916 3300005539 Ga0068853_100011147 Ga0068853_1000111473 119
917 3300005543 Ga0070672_100008415 Ga0070672_1000084158 119
918 3300005543 Ga0070672_100208744 Ga0070672_1002087441 119
919 3300005544 Ga0070686_100025561 Ga0070686_1000255612 119
920 3300005544 Ga0070686_100849609 Ga0070686_1008496091 119
921 3300005545 Ga0070695_100171680 Ga0070695_1001716802 119
922 3300005545 Ga0070695_100415629 Ga0070695_1004156292 119
923 3300005545 Ga0070695_100515154 Ga0070695_1005151541 119
924 3300005545 Ga0070695_101461484 Ga0070695_1014614842 119
925 3300005546 Ga0070696_100007340 Ga0070696_1000073408 119
926 3300005547 Ga0070693_100295396 Ga0070693_1002953962 119
927 3300005547 Ga0070693_100407649 Ga0070693_1004076492 119
928 3300005548 Ga0070665_100095587 Ga0070665_1000955874 119
929 3300005548 Ga0070665_100268510 Ga0070665_1002685102 119
930 3300005549 Ga0070704_100000564 Ga0070704_1000005645 119
931 3300005549 Ga0070704_100093131 Ga0070704_1000931312 119
932 3300005549 Ga0070704_100509815 Ga0070704_1005098152 119
933 3300005563 Ga0068855_100262001 Ga0068855_1002620012 119
934 3300005563 Ga0068855_100315119 Ga0068855_1003151192 119
935 3300005563 Ga0068855_100368576 Ga0068855_1003685762 119
936 3300005563 Ga0068855_100464012 Ga0068855_1004640122 119
937 3300005563 Ga0068855_101104719 Ga0068855_1011047192 119
938 3300005564 Ga0070664_100024673 Ga0070664_1000246733 119
939 3300005564 Ga0070664_100127603 Ga0070664_1001276032 119
940 3300005564 Ga0070664_100392696 Ga0070664_1003926962 119
941 3300005564 Ga0070664_100806356 Ga0070664_1008063562 119
942 3300005577 Ga0068857_100006165 Ga0068857_10000616512 119
943 3300005577 Ga0068857_100272816 Ga0068857_1002728165 119
944 3300005577 Ga0068857_100531074 Ga0068857_1005310741 119
945 3300005578 Ga0068854_100224518 Ga0068854_1002245183 119
946 3300005578 Ga0068854_100234200 Ga0068854_1002342001 119
947 3300005614 Ga0068856_100061865 Ga0068856_1000618651 119
948 3300005614 Ga0068856_100378596 Ga0068856_1003785964 119
949 3300005614 Ga0068856_101375472 Ga0068856_1013754721 119
950 3300005614 Ga0068856_102546178 Ga0068856_1025461781 119
951 3300005615 Ga0070702_100611455 Ga0070702_1006114551 119
952 3300005616 Ga0068852_100005967 Ga0068852_1000059672 119
953 3300005616 Ga0068852_100060912 Ga0068852_1000609124 119
954 3300005616 Ga0068852_100299342 Ga0068852_1002993422 119
955 3300005616 Ga0068852_101113811 Ga0068852_1011138112 119
956 3300005616 Ga0068852_101133374 Ga0068852_1011333741 119
957 3300005616 Ga0068852_101139484 Ga0068852_1011394841 119
958 3300005616 Ga0068852_101185730 Ga0068852_1011857301 119
959 3300005617 Ga0068859_100000897 Ga0068859_10000089711 119
960 3300005617 Ga0068859_100708612 Ga0068859_1007086123 119
961 3300005617 Ga0068859_100780708 Ga0068859_1007807081 119
962 3300005617 Ga0068859_102790951 Ga0068859_1027909512 119
963 3300005618 Ga0068864_100023501 Ga0068864_1000235013 119
964 3300005618 Ga0068864_100059375 Ga0068864_1000593754 119
965 3300005718 Ga0068866_10186493 Ga0068866_101864932 119
966 3300005718 Ga0068866_10846525 Ga0068866_108465252 119
967 3300005718 Ga0068866_11179529 Ga0068866_111795291 119
968 3300005719 Ga0068861_100370262 Ga0068861_1003702622 119
969 3300005834 Ga0068851_10015690 Ga0068851_100156904 119
970 3300005834 Ga0068851_10481793 Ga0068851_104817931 119
971 3300005840 Ga0068870_10061175 Ga0068870_100611754 119
972 3300005840 Ga0068870_10369473 Ga0068870_103694732 119
973 3300005841 Ga0068863_100737355 Ga0068863_1007373551 119
974 3300005841 Ga0068863_101001983 Ga0068863_1010019832 119
975 3300005842 Ga0068858_100114258 Ga0068858_1001142581 119
976 3300005842 Ga0068858_100220177 Ga0068858_1002201772 119
977 3300005842 Ga0068858_100239013 Ga0068858_1002390133 119
978 3300005843 Ga0068860_100001972 Ga0068860_1000019727 119
979 3300005843 Ga0068860_100466454 Ga0068860_1004664542 119
980 3300005844 Ga0068862_100002028 Ga0068862_10000202814 119
981 3300005844 Ga0068862_100062236 Ga0068862_1000622363 119
982 3300005844 Ga0068862_100254249 Ga0068862_1002542492 119
983 3300005844 Ga0068862_100328136 Ga0068862_1003281363 119
984 3300005844 Ga0068862_100543516 Ga0068862_1005435162 119
985 3300005937 Ga0081455_10566327 Ga0081455_105663273 119
986 3300005983 Ga0081540_1002455 Ga0081540_10024558 119
987 3300005983 Ga0081540_1228965 Ga0081540_12289651 119
988 3300006028 Ga0070717_10188080 Ga0070717_101880802 119
989 3300006028 Ga0070717_10406094 Ga0070717_104060942 119
990 3300006163 Ga0070715_10278757 Ga0070715_102787571 119
991 3300006175 Ga0070712_101481142 Ga0070712_1014811421 119
992 3300006177 Ga0075362_10062759 Ga0075362_100627593 119
993 3300006186 Ga0075369_10640178 Ga0075369_106401781 119
994 3300006195 Ga0075366_10000901 Ga0075366_100009012 119
995 3300006195 Ga0075366_10166447 Ga0075366_101664472 119
996 3300006237 Ga0097621_100009363 Ga0097621_1000093638 119
997 3300006237 Ga0097621_100440336 Ga0097621_1004403362 119
998 3300006237 Ga0097621_101804448 Ga0097621_1018044481 119
999 3300006353 Ga0075370_10564594 Ga0075370_105645942 119
1000 3300006358 Ga0068871_100021123 Ga0068871_1000211233 119
1001 3300006358 Ga0068871_100284608 Ga0068871_1002846083 119
1002 3300006358 Ga0068871_100917327 Ga0068871_1009173272 119
1003 3300006844 Ga0075428_100000852 Ga0075428_10000085211 119
1004 3300006846 Ga0075430_100034300 Ga0075430_1000343004 119
1005 3300006846 Ga0075430_100802358 Ga0075430_1008023581 119
1006 3300006847 Ga0075431_100002915 Ga0075431_10000291519 119
1007 3300006847 Ga0075431_100205261 Ga0075431_1002052611 119
1008 3300006847 Ga0075431_100223116 Ga0075431_1002231161 119
1009 3300006847 Ga0075431_100460818 Ga0075431_1004608182 119
1010 3300006847 Ga0075431_100822545 Ga0075431_1008225451 119
1011 3300006847 Ga0075431_101589303 Ga0075431_1015893031 119
1012 3300006852 Ga0075433_10324565 Ga0075433_103245652 119
1013 3300006871 Ga0075434_100189888 Ga0075434_1001898882 119
1014 3300006871 Ga0075434_101786727 Ga0075434_1017867271 119
1015 3300006880 Ga0075429_100008202 Ga0075429_1000082022 119
1016 3300006880 Ga0075429_100341891 Ga0075429_1003418912 119
1017 3300006881 Ga0068865_100535902 Ga0068865_1005359022 119
1018 3300006881 Ga0068865_100713164 Ga0068865_1007131642 119
1019 3300006881 Ga0068865_101108723 Ga0068865_1011087231 119
1020 3300006931 Ga0097620_100000897 Ga0097620_10000089726 119
1021 3300006931 Ga0097620_100708667 Ga0097620_1007086673 119
1022 3300006931 Ga0097620_100780640 Ga0097620_1007806401 119
1023 3300006931 Ga0097620_102791710 Ga0097620_1027917102 119
1024 3300006948 Ga0099826_10000002 Ga0099826_10000002482 119
1025 3300007076 Ga0075435_100103431 Ga0075435_1001034314 119
1026 3300009011 Ga0105251_10001393 Ga0105251_100013934 119
1027 3300009011 Ga0105251_10024497 Ga0105251_100244975 119
1028 3300009011 Ga0105251_10038568 Ga0105251_100385683 119
1029 3300009011 Ga0105251_10130788 Ga0105251_101307882 119
1030 3300009036 Ga0105244_10120080 Ga0105244_101200803 119
1031 3300009092 Ga0105250_10034610 Ga0105250_100346104 119
1032 3300009092 Ga0105250_10160236 Ga0105250_101602362 119
1033 3300009093 Ga0105240_10002495 Ga0105240_1000249520 119
1034 3300009093 Ga0105240_10002726 Ga0105240_1000272624 119
1035 3300009093 Ga0105240_10087499 Ga0105240_100874995 119
1036 3300009093 Ga0105240_10089326 Ga0105240_100893262 119
1037 3300009093 Ga0105240_10156440 Ga0105240_101564404 119
1038 3300009093 Ga0105240_10605640 Ga0105240_106056402 119
1039 3300009093 Ga0105240_11643839 Ga0105240_116438391 119
1040 3300009094 Ga0111539_10003926 Ga0111539_1000392612 119
1041 3300009094 Ga0111539_10025949 Ga0111539_100259498 119
1042 3300009094 Ga0111539_10163916 Ga0111539_101639162 119
1043 3300009094 Ga0111539_10331907 Ga0111539_103319074 119
1044 3300009094 Ga0111539_10551882 Ga0111539_105518823 119
1045 3300009094 Ga0111539_10976885 Ga0111539_109768852 119
1046 3300009094 Ga0111539_11301793 Ga0111539_113017932 119
1047 3300009098 Ga0105245_10747172 Ga0105245_107471722 119
1048 3300009098 Ga0105245_12607819 Ga0105245_126078191 119
1049 3300009101 Ga0105247_10503146 Ga0105247_105031461 119
1050 3300009101 Ga0105247_10568193 Ga0105247_105681932 119
1051 3300009101 Ga0105247_11731112 Ga0105247_117311121 119
1052 3300009147 Ga0114129_10318588 Ga0114129_103185881 119
1053 3300009147 Ga0114129_11949592 Ga0114129_119495922 119
1054 3300009147 Ga0114129_12704180 Ga0114129_127041802 119
1055 3300009148 Ga0105243_10015405 Ga0105243_100154055 119
1056 3300009148 Ga0105243_10223912 Ga0105243_102239122 119
1057 3300009148 Ga0105243_10289885 Ga0105243_102898852 119
1058 3300009148 Ga0105243_10346863 Ga0105243_103468632 119
1059 3300009174 Ga0105241_10078621 Ga0105241_100786212 119
1060 3300009174 Ga0105241_10260758 Ga0105241_102607582 119
1061 3300009174 Ga0105241_10557034 Ga0105241_105570341 119
1062 3300009174 Ga0105241_11459999 Ga0105241_114599991 119
1063 3300009176 Ga0105242_10236364 Ga0105242_102363642 119
1064 3300009176 Ga0105242_10446114 Ga0105242_104461142 119
1065 3300009176 Ga0105242_10579890 Ga0105242_105798901 119
1066 3300009176 Ga0105242_12374852 Ga0105242_123748521 119
1067 3300009177 Ga0105248_10262254 Ga0105248_102622543 119
1068 3300009177 Ga0105248_10805375 Ga0105248_108053753 119
1069 3300009545 Ga0105237_10011602 Ga0105237_100116028 119
1070 3300009545 Ga0105237_10075787 Ga0105237_100757873 119
1071 3300009545 Ga0105237_10082585 Ga0105237_100825854 119
1072 3300009545 Ga0105237_10437517 Ga0105237_104375172 119
1073 3300009545 Ga0105237_10445945 Ga0105237_104459452 119
1074 3300009545 Ga0105237_10761963 Ga0105237_107619632 119
1075 3300009551 Ga0105238_10019620 Ga0105238_100196206 119
1076 3300009551 Ga0105238_10052144 Ga0105238_100521444 119
1077 3300009551 Ga0105238_10174473 Ga0105238_101744733 119
1078 3300009551 Ga0105238_10263912 Ga0105238_102639122 119
1079 3300009553 Ga0105249_10075862 Ga0105249_100758623 119
1080 3300009553 Ga0105249_10199951 Ga0105249_101999512 119
1081 3300009553 Ga0105249_10906181 Ga0105249_109061813 119
1082 3300009553 Ga0105249_11206400 Ga0105249_112064002 119
1083 3300009553 Ga0105249_13261962 Ga0105249_132619621 119
1084 3300009982 Ga0105147_109401 Ga0105147_1094011 119
1085 3300010375 Ga0105239_10002265 Ga0105239_100022656 119
1086 3300010375 Ga0105239_10030758 Ga0105239_100307583 119
1087 3300010375 Ga0105239_10098432 Ga0105239_100984324 119
1088 3300010375 Ga0105239_10175638 Ga0105239_101756383 119
1089 3300010375 Ga0105239_10579520 Ga0105239_105795203 119
1090 3300010375 Ga0105239_10772404 Ga0105239_107724042 119
1091 3300010375 Ga0105239_11636015 Ga0105239_116360152 119
1092 3300010375 Ga0105239_11766462 Ga0105239_117664622 119
1093 3300011119 Ga0105246_10080219 Ga0105246_100802192 119
1094 3300011119 Ga0105246_10097182 Ga0105246_100971822 119
1095 3300011119 Ga0105246_10128905 Ga0105246_101289054 119
1096 3300011119 Ga0105246_10348670 Ga0105246_103486702 119
1097 3300013045 Ga0154016_137307 Ga0154016_1373071 119
1098 3300013052 Ga0154014_155826 Ga0154014_1558261 119
1099 3300013059 Ga0154012_173028 Ga0154012_1730284 119
1100 3300013100 Ga0157373_10013769 Ga0157373_100137693 119
1101 3300013100 Ga0157373_10075163 Ga0157373_100751634 119
1102 3300013100 Ga0157373_10075882 Ga0157373_100758822 119
1103 3300013100 Ga0157373_10140813 Ga0157373_101408131 119
1104 3300013100 Ga0157373_10994405 Ga0157373_109944052 119
1105 3300013102 Ga0157371_10019075 Ga0157371_100190754 119
1106 3300013104 Ga0157370_10001049 Ga0157370_1000104915 119
1107 3300013104 Ga0157370_10045035 Ga0157370_100450354 119
1108 3300013104 Ga0157370_10302376 Ga0157370_103023762 119
1109 3300013104 Ga0157370_10506397 Ga0157370_105063971 119
1110 3300013105 Ga0157369_10000067 Ga0157369_10000067135 119
1111 3300013105 Ga0157369_10004807 Ga0157369_100048073 119
1112 3300013105 Ga0157369_10823554 Ga0157369_108235542 119
1113 3300013105 Ga0157369_12006232 Ga0157369_120062322 119
1114 3300013296 Ga0157374_10006139 Ga0157374_100061399 119
1115 3300013296 Ga0157374_10026366 Ga0157374_100263662 119
1116 3300013296 Ga0157374_10068990 Ga0157374_100689904 119
1117 3300013296 Ga0157374_10146402 Ga0157374_101464021 119
1118 3300013296 Ga0157374_10159671 Ga0157374_101596713 119
1119 3300013296 Ga0157374_10262774 Ga0157374_102627741 119
1120 3300013296 Ga0157374_11310962 Ga0157374_113109622 119
1121 3300013296 Ga0157374_11375876 Ga0157374_113758762 119
1122 3300013297 Ga0157378_10056438 Ga0157378_100564384 119
1123 3300013297 Ga0157378_10059592 Ga0157378_100595924 119
1124 3300013297 Ga0157378_10235199 Ga0157378_102351992 119
1125 3300013297 Ga0157378_10540910 Ga0157378_105409102 119
1126 3300013297 Ga0157378_11285397 Ga0157378_112853972 119
1127 3300013306 Ga0163162_10058330 Ga0163162_100583305 119
1128 3300013306 Ga0163162_10061118 Ga0163162_100611182 119
1129 3300013306 Ga0163162_10064382 Ga0163162_100643822 119
1130 3300013306 Ga0163162_10135330 Ga0163162_101353304 119
1131 3300013306 Ga0163162_10411799 Ga0163162_104117993 119
1132 3300013306 Ga0163162_10520124 Ga0163162_105201243 119
1133 3300013306 Ga0163162_10651104 Ga0163162_106511042 119
1134 3300013306 Ga0163162_13448350 Ga0163162_134483502 119
1135 3300013307 Ga0157372_10002760 Ga0157372_1000276015 119
1136 3300013307 Ga0157372_10456460 Ga0157372_104564601 119
1137 3300013307 Ga0157372_10797208 Ga0157372_107972083 119
1138 3300013307 Ga0157372_11445118 Ga0157372_114451182 119
1139 3300013307 Ga0157372_13278726 Ga0157372_132787261 119
1140 3300013308 Ga0157375_10006015 Ga0157375_100060152 119
1141 3300013308 Ga0157375_10035595 Ga0157375_100355953 119
1142 3300013308 Ga0157375_10392337 Ga0157375_103923374 119
1143 3300013308 Ga0157375_10508334 Ga0157375_105083341 119
1144 3300013308 Ga0157375_10537653 Ga0157375_105376532 119
1145 3300013308 Ga0157375_12408204 Ga0157375_124082042 119
1146 3300013308 Ga0157375_13722164 Ga0157375_137221641 119
1147 3300014325 Ga0163163_12274925 Ga0163163_122749251 119
1148 3300014325 Ga0163163_13048257 Ga0163163_130482571 119
1149 3300014326 Ga0157380_10453975 Ga0157380_104539753 119
1150 3300014326 Ga0157380_10625421 Ga0157380_106254211 119
1151 3300014326 Ga0157380_10653612 Ga0157380_106536122 119
1152 3300014326 Ga0157380_11774590 Ga0157380_117745902 119
1153 3300014497 Ga0182008_10034870 Ga0182008_100348703 119
1154 3300014497 Ga0182008_10329147 Ga0182008_103291472 119
1155 3300014745 Ga0157377_10016655 Ga0157377_100166552 119
1156 3300014745 Ga0157377_10385835 Ga0157377_103858352 119
1157 3300014968 Ga0157379_10144243 Ga0157379_101442434 119
1158 3300014968 Ga0157379_10295596 Ga0157379_102955963 119
1159 3300014968 Ga0157379_10818235 Ga0157379_108182351 119
1160 3300014968 Ga0157379_11244005 Ga0157379_112440052 119
1161 3300014969 Ga0157376_10088728 Ga0157376_100887283 119
1162 3300014969 Ga0157376_10100666 Ga0157376_101006664 119
1163 3300014969 Ga0157376_10684424 Ga0157376_106844243 119
1164 3300015261 Ga0182006_1058256 Ga0182006_10582563 119
1165 3300015261 Ga0182006_1159097 Ga0182006_11590972 119
1166 3300015262 Ga0182007_10003275 Ga0182007_100032755 119
1167 3300015262 Ga0182007_10023290 Ga0182007_100232902 119
1168 3300015262 Ga0182007_10059412 Ga0182007_100594123 119
1169 3300015265 Ga0182005_1036259 Ga0182005_10362593 119
1170 3300016635 Ga0183361_10014 Ga0183361_1001475 119
1171 3300017792 Ga0163161_10094436 Ga0163161_100944362 119
1172 3300019177 Ga0184592_124643 Ga0184592_1246431 119
1173 3300019181 Ga0184594_101816 Ga0184594_1018161 119
1174 3300019183 Ga0184601_124142 Ga0184601_1241423 119
1175 3300020069 Ga0197907_10080731 Ga0197907_100807313 119
1176 3300020069 Ga0197907_10209533 Ga0197907_102095332 119
1177 3300020069 Ga0197907_10543707 Ga0197907_105437071 119
1178 3300020070 Ga0206356_10678846 Ga0206356_106788461 119
1179 3300020070 Ga0206356_10734784 Ga0206356_107347844 119
1180 3300020070 Ga0206356_11584160 Ga0206356_115841603 119
1181 3300020075 Ga0206349_1026961 Ga0206349_10269611 119
1182 3300020075 Ga0206349_1316050 Ga0206349_13160501 119
1183 3300020076 Ga0206355_1231534 Ga0206355_12315343 119
1184 3300020076 Ga0206355_1501166 Ga0206355_15011662 119
1185 3300020076 Ga0206355_1664610 Ga0206355_16646102 119
1186 3300020077 Ga0206351_10152856 Ga0206351_101528561 119
1187 3300020078 Ga0206352_10517362 Ga0206352_105173621 119
1188 3300020080 Ga0206350_10412246 Ga0206350_104122461 119
1189 3300020080 Ga0206350_10601530 Ga0206350_106015301 119
1190 3300020080 Ga0206350_11401232 Ga0206350_114012322 119
1191 3300020081 Ga0206354_10131732 Ga0206354_101317321 119
1192 3300020082 Ga0206353_10095146 Ga0206353_100951462 119
1193 3300020610 Ga0154015_1131996 Ga0154015_11319962 119
1194 3300020610 Ga0154015_1183350 Ga0154015_11833501 119
1195 3300021361 Ga0213872_10042036 Ga0213872_100420362 119
1196 3300021384 Ga0213876_10578946 Ga0213876_105789461 119
1197 3300021441 Ga0213871_10232425 Ga0213871_102324251 119
1198 3300022467 Ga0224712_10001035 Ga0224712_100010357 119
1199 3300022467 Ga0224712_10122600 Ga0224712_101226003 119
1200 3300023552 Ga0247551_101084 Ga0247551_1010843 119
1201 3300023560 Ga0247514_113575 Ga0247514_1135752 119
1202 3300023564 Ga0247515_115509 Ga0247515_1155092 119
1203 3300025225 Ga0209566_101036 Ga0209566_1010368 119
1204 3300025226 Ga0209674_100013 Ga0209674_10001366 119
1205 3300025228 Ga0209672_100010 Ga0209672_100010102 119
1206 3300025228 Ga0209672_100037 Ga0209672_10003718 119
1207 3300025228 Ga0209672_100065 Ga0209672_1000656 119
1208 3300025228 Ga0209672_100132 Ga0209672_10013223 119
1209 3300025229 Ga0209147_100006 Ga0209147_100006102 119
1210 3300025229 Ga0209147_100023 Ga0209147_100023328 119
1211 3300025229 Ga0209147_100049 Ga0209147_1000493 119
1212 3300025229 Ga0209147_100180 Ga0209147_10018071 119
1213 3300025230 Ga0209563_102866 Ga0209563_1028661 119
1214 3300025231 Ga0207427_100913 Ga0207427_1009133 119
1215 3300025233 Ga0209437_100080 Ga0209437_100080142 119
1216 3300025242 Ga0209258_100010 Ga0209258_100010102 119
1217 3300025242 Ga0209258_100031 Ga0209258_1000316 119
1218 3300025242 Ga0209258_100066 Ga0209258_10006618 119
1219 3300025242 Ga0209258_100179 Ga0209258_10017921 119
1220 3300025246 Ga0209646_1000033 Ga0209646_1000033309 119
1221 3300025250 Ga0209026_1000996 Ga0209026_10009963 119
1222 3300025250 Ga0209026_1002578 Ga0209026_10025782 119
1223 3300025253 Ga0209677_123232 Ga0209677_1232321 119
1224 3300025254 Ga0209148_1000018 Ga0209148_1000018102 119
1225 3300025254 Ga0209148_1000027 Ga0209148_10000276 119
1226 3300025256 Ga0209759_1000088 Ga0209759_1000088151 119
1227 3300025261 Ga0209233_1000171 Ga0209233_1000171100 119
1228 3300025261 Ga0209233_1040156 Ga0209233_10401562 119
1229 3300025263 Ga0209565_1019698 Ga0209565_10196983 119
1230 3300025272 Ga0209455_1000015 Ga0209455_1000015102 119
1231 3300025272 Ga0209455_1000332 Ga0209455_100033238 119
1232 3300025272 Ga0209455_1002415 Ga0209455_10024155 119
1233 3300025273 Ga0209673_1000007 Ga0209673_1000007429 119
1234 3300025273 Ga0209673_1000184 Ga0209673_1000184117 119
1235 3300025273 Ga0209673_1124600 Ga0209673_11246001 119
1236 3300025284 Ga0209130_1000156 Ga0209130_100015668 119
1237 3300025284 Ga0209130_1011377 Ga0209130_10113773 119
1238 3300025291 Ga0209675_1000009 Ga0209675_100000989 119
1239 3300025291 Ga0209675_1014612 Ga0209675_10146123 119
1240 3300025291 Ga0209675_1033085 Ga0209675_10330852 119
1241 3300025295 Ga0209564_1000055 Ga0209564_100005524 119
1242 3300025295 Ga0209564_1004574 Ga0209564_10045745 119
1243 3300025295 Ga0209564_1013076 Ga0209564_10130761 119
1244 3300025299 Ga0209256_1000007 Ga0209256_1000007329 119
1245 3300025299 Ga0209256_1000849 Ga0209256_100084930 119
1246 3300025302 Ga0207426_1000297 Ga0207426_100029733 119
1247 3300025302 Ga0207426_1008780 Ga0207426_10087803 119
1248 3300025315 Ga0207697_10014823 Ga0207697_100148232 119
1249 3300025315 Ga0207697_10175129 Ga0207697_101751292 119
1250 3300025321 Ga0207656_10322539 Ga0207656_103225391 119
1251 3300025728 Ga0207655_1112530 Ga0207655_11125303 119
1252 3300025735 Ga0207713_1003101 Ga0207713_100310110 119
1253 3300025735 Ga0207713_1008130 Ga0207713_10081301 119
1254 3300025885 Ga0207653_10003424 Ga0207653_100034245 119
1255 3300025893 Ga0207682_10005952 Ga0207682_100059522 119
1256 3300025893 Ga0207682_10016551 Ga0207682_100165513 119
1257 3300025898 Ga0207692_10446936 Ga0207692_104469361 119
1258 3300025899 Ga0207642_10530925 Ga0207642_105309252 119
1259 3300025899 Ga0207642_10705879 Ga0207642_107058791 119
1260 3300025901 Ga0207688_10000707 Ga0207688_1000070716 119
1261 3300025901 Ga0207688_10199356 Ga0207688_101993563 119
1262 3300025901 Ga0207688_10320296 Ga0207688_103202963 119
1263 3300025903 Ga0207680_10937740 Ga0207680_109377401 119
1264 3300025903 Ga0207680_11235875 Ga0207680_112358751 119
1265 3300025904 Ga0207647_10001046 Ga0207647_1000104613 119
1266 3300025904 Ga0207647_10003244 Ga0207647_100032448 119
1267 3300025907 Ga0207645_10021102 Ga0207645_100211022 119
1268 3300025907 Ga0207645_10259049 Ga0207645_102590493 119
1269 3300025907 Ga0207645_10876245 Ga0207645_108762451 119
1270 3300025908 Ga0207643_10012369 Ga0207643_100123695 119
1271 3300025908 Ga0207643_10102399 Ga0207643_101023992 119
1272 3300025909 Ga0207705_10000674 Ga0207705_1000067419 119
1273 3300025910 Ga0207684_10099093 Ga0207684_100990934 119
1274 3300025910 Ga0207684_10109842 Ga0207684_101098424 119
1275 3300025911 Ga0207654_10019936 Ga0207654_100199361 119
1276 3300025911 Ga0207654_10055057 Ga0207654_100550574 119
1277 3300025911 Ga0207654_10989984 Ga0207654_109899841 119
1278 3300025912 Ga0207707_10009589 Ga0207707_100095899 119
1279 3300025912 Ga0207707_10022517 Ga0207707_100225173 119
1280 3300025912 Ga0207707_10205683 Ga0207707_102056833 119
1281 3300025913 Ga0207695_10003361 Ga0207695_1000336112 119
1282 3300025913 Ga0207695_10005318 Ga0207695_100053186 119
1283 3300025913 Ga0207695_10013836 Ga0207695_100138369 119
1284 3300025913 Ga0207695_10117849 Ga0207695_101178495 119
1285 3300025913 Ga0207695_10120471 Ga0207695_101204713 119
1286 3300025913 Ga0207695_10944002 Ga0207695_109440022 119
1287 3300025914 Ga0207671_10030332 Ga0207671_100303323 119
1288 3300025914 Ga0207671_10144880 Ga0207671_101448802 119
1289 3300025914 Ga0207671_10278057 Ga0207671_102780572 119
1290 3300025914 Ga0207671_10307847 Ga0207671_103078472 119
1291 3300025914 Ga0207671_10584467 Ga0207671_105844672 119
1292 3300025915 Ga0207693_10988049 Ga0207693_109880491 119
1293 3300025917 Ga0207660_10050114 Ga0207660_100501144 119
1294 3300025918 Ga0207662_10014245 Ga0207662_100142452 119
1295 3300025919 Ga0207657_10000078 Ga0207657_1000007869 119
1296 3300025919 Ga0207657_10001465 Ga0207657_1000146520 119
1297 3300025919 Ga0207657_10051381 Ga0207657_100513811 119
1298 3300025919 Ga0207657_10064053 Ga0207657_100640532 119
1299 3300025919 Ga0207657_10547435 Ga0207657_105474352 119
1300 3300025920 Ga0207649_10079727 Ga0207649_100797274 119
1301 3300025920 Ga0207649_10087929 Ga0207649_100879294 119
1302 3300025920 Ga0207649_10236056 Ga0207649_102360562 119
1303 3300025920 Ga0207649_10890825 Ga0207649_108908251 119
1304 3300025920 Ga0207649_10963076 Ga0207649_109630762 119
1305 3300025921 Ga0207652_11206320 Ga0207652_112063202 119
1306 3300025922 Ga0207646_10044711 Ga0207646_100447113 119
1307 3300025922 Ga0207646_10322754 Ga0207646_103227542 119
1308 3300025924 Ga0207694_10007319 Ga0207694_100073194 119
1309 3300025924 Ga0207694_10223324 Ga0207694_102233241 119
1310 3300025924 Ga0207694_10227722 Ga0207694_102277222 119
1311 3300025925 Ga0207650_10109664 Ga0207650_101096642 119
1312 3300025925 Ga0207650_10168534 Ga0207650_101685342 119
1313 3300025925 Ga0207650_10482743 Ga0207650_104827432 119
1314 3300025926 Ga0207659_10028376 Ga0207659_100283761 119
1315 3300025926 Ga0207659_10190508 Ga0207659_101905082 119
1316 3300025926 Ga0207659_11811371 Ga0207659_118113712 119
1317 3300025927 Ga0207687_10310125 Ga0207687_103101252 119
1318 3300025928 Ga0207700_10388759 Ga0207700_103887592 119
1319 3300025929 Ga0207664_10716232 Ga0207664_107162321 119
1320 3300025931 Ga0207644_10016507 Ga0207644_100165074 119
1321 3300025931 Ga0207644_10125933 Ga0207644_101259333 119
1322 3300025931 Ga0207644_10237130 Ga0207644_102371302 119
1323 3300025932 Ga0207690_10000026 Ga0207690_1000002674 119
1324 3300025932 Ga0207690_10107523 Ga0207690_101075232 119
1325 3300025932 Ga0207690_10178599 Ga0207690_101785992 119
1326 3300025932 Ga0207690_10235205 Ga0207690_102352053 119
1327 3300025932 Ga0207690_10808449 Ga0207690_108084492 119
1328 3300025933 Ga0207706_10020307 Ga0207706_100203074 119
1329 3300025933 Ga0207706_10158542 Ga0207706_101585423 119
1330 3300025933 Ga0207706_10432267 Ga0207706_104322672 119
1331 3300025933 Ga0207706_10559215 Ga0207706_105592152 119
1332 3300025933 Ga0207706_10579916 Ga0207706_105799162 119
1333 3300025934 Ga0207686_10030277 Ga0207686_100302774 119
1334 3300025934 Ga0207686_10327941 Ga0207686_103279411 119
1335 3300025934 Ga0207686_11375263 Ga0207686_113752632 119
1336 3300025935 Ga0207709_10024616 Ga0207709_100246163 119
1337 3300025935 Ga0207709_10064773 Ga0207709_100647734 119
1338 3300025935 Ga0207709_11065202 Ga0207709_110652021 119
1339 3300025936 Ga0207670_11602456 Ga0207670_116024561 119
1340 3300025936 Ga0207670_11622401 Ga0207670_116224011 119
1341 3300025937 Ga0207669_10187720 Ga0207669_101877202 119
1342 3300025938 Ga0207704_10289380 Ga0207704_102893801 119
1343 3300025938 Ga0207704_11025819 Ga0207704_110258191 119
1344 3300025938 Ga0207704_11107573 Ga0207704_111075732 119
1345 3300025940 Ga0207691_10001213 Ga0207691_1000121315 119
1346 3300025940 Ga0207691_10057083 Ga0207691_100570831 119
1347 3300025941 Ga0207711_10064262 Ga0207711_100642622 119
1348 3300025941 Ga0207711_10159964 Ga0207711_101599643 119
1349 3300025941 Ga0207711_10295848 Ga0207711_102958483 119
1350 3300025941 Ga0207711_10939321 Ga0207711_109393213 119
1351 3300025942 Ga0207689_10030888 Ga0207689_100308885 119
1352 3300025942 Ga0207689_10035496 Ga0207689_100354964 119
1353 3300025942 Ga0207689_10075222 Ga0207689_100752221 119
1354 3300025944 Ga0207661_10353310 Ga0207661_103533102 119
1355 3300025944 Ga0207661_11863587 Ga0207661_118635871 119
1356 3300025945 Ga0207679_10523194 Ga0207679_105231942 119
1357 3300025945 Ga0207679_10767515 Ga0207679_107675152 119
1358 3300025949 Ga0207667_10000347 Ga0207667_1000034727 119
1359 3300025949 Ga0207667_10022263 Ga0207667_100222636 119
1360 3300025949 Ga0207667_10031203 Ga0207667_100312032 119
1361 3300025949 Ga0207667_10237831 Ga0207667_102378312 119
1362 3300025949 Ga0207667_11383325 Ga0207667_113833252 119
1363 3300025960 Ga0207651_10018049 Ga0207651_100180497 119
1364 3300025961 Ga0207712_10015247 Ga0207712_100152473 119
1365 3300025961 Ga0207712_10114120 Ga0207712_101141202 119
1366 3300025961 Ga0207712_10211786 Ga0207712_102117863 119
1367 3300025961 Ga0207712_11181979 Ga0207712_111819792 119
1368 3300025972 Ga0207668_10145804 Ga0207668_101458043 119
1369 3300025981 Ga0207640_10518395 Ga0207640_105183953 119
1370 3300026023 Ga0207677_10184171 Ga0207677_101841712 119
1371 3300026023 Ga0207677_10342658 Ga0207677_103426583 119
1372 3300026023 Ga0207677_10399991 Ga0207677_103999912 119
1373 3300026023 Ga0207677_11016517 Ga0207677_110165171 119
1374 3300026035 Ga0207703_10102763 Ga0207703_101027633 119
1375 3300026035 Ga0207703_10406946 Ga0207703_104069461 119
1376 3300026035 Ga0207703_11042132 Ga0207703_110421322 119
1377 3300026035 Ga0207703_11941142 Ga0207703_119411421 119
1378 3300026041 Ga0207639_10027098 Ga0207639_100270983 119
1379 3300026041 Ga0207639_10258017 Ga0207639_102580171 119
1380 3300026067 Ga0207678_10028033 Ga0207678_100280332 119
1381 3300026067 Ga0207678_10143588 Ga0207678_101435882 119
1382 3300026067 Ga0207678_10196797 Ga0207678_101967972 119
1383 3300026067 Ga0207678_10451462 Ga0207678_104514623 119
1384 3300026067 Ga0207678_10483209 Ga0207678_104832093 119
1385 3300026075 Ga0207708_10019211 Ga0207708_100192113 119
1386 3300026075 Ga0207708_10492314 Ga0207708_104923141 119
1387 3300026075 Ga0207708_12029599 Ga0207708_120295991 119
1388 3300026078 Ga0207702_10064528 Ga0207702_100645283 119
1389 3300026078 Ga0207702_10147310 Ga0207702_101473103 119
1390 3300026078 Ga0207702_10258165 Ga0207702_102581652 119
1391 3300026078 Ga0207702_10443278 Ga0207702_104432781 119
1392 3300026088 Ga0207641_10114456 Ga0207641_101144564 119
1393 3300026089 Ga0207648_10016708 Ga0207648_100167089 119
1394 3300026089 Ga0207648_10045516 Ga0207648_100455163 119
1395 3300026089 Ga0207648_10139876 Ga0207648_101398762 119
1396 3300026089 Ga0207648_11346495 Ga0207648_113464951 119
1397 3300026089 Ga0207648_11393178 Ga0207648_113931781 119
1398 3300026095 Ga0207676_10050850 Ga0207676_100508503 119
1399 3300026095 Ga0207676_10181284 Ga0207676_101812841 119
1400 3300026095 Ga0207676_10499766 Ga0207676_104997662 119
1401 3300026095 Ga0207676_12259996 Ga0207676_122599961 119
1402 3300026116 Ga0207674_10021274 Ga0207674_100212743 119
1403 3300026116 Ga0207674_10239990 Ga0207674_102399904 119
1404 3300026116 Ga0207674_10604124 Ga0207674_106041241 119
1405 3300026118 Ga0207675_100098256 Ga0207675_1000982562 119
1406 3300026118 Ga0207675_100378755 Ga0207675_1003787552 119
1407 3300026118 Ga0207675_100675888 Ga0207675_1006758882 119
1408 3300026121 Ga0207683_10000668 Ga0207683_1000066814 119
1409 3300026121 Ga0207683_10037871 Ga0207683_100378712 119
1410 3300026121 Ga0207683_10200411 Ga0207683_102004113 119
1411 3300026121 Ga0207683_10364513 Ga0207683_103645131 119
1412 3300026142 Ga0207698_10048002 Ga0207698_100480023 119
1413 3300026142 Ga0207698_10109583 Ga0207698_101095832 119
1414 3300026142 Ga0207698_10176949 Ga0207698_101769493 119
1415 3300026142 Ga0207698_10835692 Ga0207698_108356922 119
1416 3300026142 Ga0207698_11002755 Ga0207698_110027552 119
1417 3300026142 Ga0207698_12000202 Ga0207698_120002021 119
1418 3300027312 Ga0209371_1000506 Ga0209371_100050618 119
1419 3300027312 Ga0209371_1003800 Ga0209371_10038003 119
1420 3300027360 Ga0209969_1001507 Ga0209969_10015073 119
1421 3300027360 Ga0209969_1048354 Ga0209969_10483542 119
1422 3300027364 Ga0209967_1001595 Ga0209967_10015952 119
1423 3300027462 Ga0210000_1000234 Ga0210000_100023410 119
1424 3300027471 Ga0209995_1000807 Ga0209995_10008073 119
1425 3300027471 Ga0209995_1025502 Ga0209995_10255022 119
1426 3300027543 Ga0209999_1017154 Ga0209999_10171542 119
1427 3300027552 Ga0209982_1027778 Ga0209982_10277782 119
1428 3300027614 Ga0209970_1055800 Ga0209970_10558002 119
1429 3300027665 Ga0209983_1008174 Ga0209983_10081743 119
1430 3300027665 Ga0209983_1083997 Ga0209983_10839971 119
1431 3300027666 Ga0209282_1000001 Ga0209282_1000001670 119
1432 3300027682 Ga0209971_1004357 Ga0209971_10043573 119
1433 3300027682 Ga0209971_1018772 Ga0209971_10187723 119
1434 3300027876 Ga0209974_10011244 Ga0209974_100112441 119
1435 3300027876 Ga0209974_10315256 Ga0209974_103152562 119
1436 3300027907 Ga0207428_10001855 Ga0207428_100018556 119
1437 3300028379 Ga0268266_10082780 Ga0268266_100827804 119
1438 3300028379 Ga0268266_10226014 Ga0268266_102260142 119
1439 3300028379 Ga0268266_10336067 Ga0268266_103360672 119
1440 3300028380 Ga0268265_10000395 Ga0268265_1000039523 119
1441 3300028380 Ga0268265_10142621 Ga0268265_101426212 119
1442 3300028380 Ga0268265_10161153 Ga0268265_101611532 119
1443 3300028380 Ga0268265_10202145 Ga0268265_102021453 119
1444 3300028380 Ga0268265_10300919 Ga0268265_103009193 119
1445 3300028380 Ga0268265_11987846 Ga0268265_119878461 119
1446 3300028381 Ga0268264_10002277 Ga0268264_100022777 119
1447 3300028794 Ga0307515_10213388 Ga0307515_102133884 119
1448 3300028800 Ga0265338_10000692 Ga0265338_1000069245 119
1449 3300028800 Ga0265338_10001739 Ga0265338_1000173929 119
1450 3300030500 Ga0268256_1001284 Ga0268256_10012842 119
1451 3300030500 Ga0268256_1003682 Ga0268256_10036827 119
1452 3300030836 Ga0265767_102088 Ga0265767_1020883 119
1453 3300030836 Ga0265767_105420 Ga0265767_1054202 119
1454 3300030863 Ga0265766_1005155 Ga0265766_10051551 119
1455 3300030863 Ga0265766_1008702 Ga0265766_10087022 119
1456 3300030863 Ga0265766_1017675 Ga0265766_10176752 119
1457 3300030879 Ga0265765_1014967 Ga0265765_10149672 119
1458 3300030880 Ga0265776_106120 Ga0265776_1061201 119
1459 3300030888 Ga0265769_116277 Ga0265769_1162771 119
1460 3300030888 Ga0265769_120167 Ga0265769_1201672 119
1461 3300030888 Ga0265769_120411 Ga0265769_1204112 119
1462 3300030942 Ga0247549_101077 Ga0247549_1010771 119
1463 3300031011 Ga0265774_100709 Ga0265774_1007091 119
1464 3300031018 Ga0265773_1022264 Ga0265773_10222641 119
1465 3300031235 Ga0265330_10069532 Ga0265330_100695322 119
1466 3300031238 Ga0265332_10016765 Ga0265332_100167654 119
1467 3300031239 Ga0265328_10013367 Ga0265328_100133672 119
1468 3300031239 Ga0265328_10367155 Ga0265328_103671552 119
1469 3300031240 Ga0265320_10049087 Ga0265320_100490873 119
1470 3300031242 Ga0265329_10012186 Ga0265329_100121863 119
1471 3300031247 Ga0265340_10008541 Ga0265340_100085413 119
1472 3300031249 Ga0265339_10149325 Ga0265339_101493252 119
1473 3300031250 Ga0265331_10005094 Ga0265331_100050942 119
1474 3300031250 Ga0265331_10097747 Ga0265331_100977473 119
1475 3300031250 Ga0265331_10460101 Ga0265331_104601011 119
1476 3300031251 Ga0265327_10096364 Ga0265327_100963641 119
1477 3300031344 Ga0265316_10034802 Ga0265316_100348024 119
1478 3300031456 Ga0307513_10033342 Ga0307513_100333424 119
1479 3300031548 Ga0307408_100160675 Ga0307408_1001606752 119
1480 3300031633 Ga0310108_119035 Ga0310108_1190351 119
1481 3300031636 Ga0310113_124117 Ga0310113_1241172 119
1482 3300031665 Ga0316575_10162475 Ga0316575_101624751 119
1483 3300031691 Ga0316579_10003056 Ga0316579_100030566 119
1484 3300031691 Ga0316579_10110036 Ga0316579_101100362 119
1485 3300031691 Ga0316579_10358743 Ga0316579_103587431 119
1486 3300031691 Ga0316579_10388212 Ga0316579_103882121 119
1487 3300031711 Ga0265314_10003603 Ga0265314_100036038 119
1488 3300031712 Ga0265342_10070815 Ga0265342_100708152 119
1489 3300031727 Ga0316576_10071550 Ga0316576_100715502 119
1490 3300031728 Ga0316578_10009997 Ga0316578_100099974 119
1491 3300031730 Ga0307516_10108622 Ga0307516_101086223 119
1492 3300031731 Ga0307405_10749345 Ga0307405_107493451 119
1493 3300031733 Ga0316577_10119384 Ga0316577_101193841 119
1494 3300031814 Ga0247548_102148 Ga0247548_1021481 119
1495 3300031824 Ga0307413_10054441 Ga0307413_100544413 119
1496 3300031824 Ga0307413_11185988 Ga0307413_111859881 119
1497 3300031838 Ga0307518_10081948 Ga0307518_100819484 119
1498 3300031852 Ga0307410_10156697 Ga0307410_101566972 119
1499 3300031901 Ga0307406_10343267 Ga0307406_103432672 119
1500 3300031901 Ga0307406_10649791 Ga0307406_106497911 119
1501 3300031901 Ga0307406_12012218 Ga0307406_120122181 119
1502 3300031911 Ga0307412_10000008 Ga0307412_10000008186 119
1503 3300031995 Ga0307409_102650556 Ga0307409_1026505561 119
1504 3300032002 Ga0307416_100146426 Ga0307416_1001464263 119
1505 3300032002 Ga0307416_100154826 Ga0307416_1001548262 119
1506 3300032002 Ga0307416_100272793 Ga0307416_1002727933 119
1507 3300032002 Ga0307416_103203079 Ga0307416_1032030791 119
1508 3300032004 Ga0307414_10200044 Ga0307414_102000441 119
1509 3300032005 Ga0307411_10089197 Ga0307411_100891973 119
1510 3300032005 Ga0307411_10600712 Ga0307411_106007121 119
1511 3300032005 Ga0307411_10614311 Ga0307411_106143112 119
1512 3300032005 Ga0307411_10679181 Ga0307411_106791812 119
1513 3300032120 Ga0316053_108651 Ga0316053_1086511 119
1514 3300032133 Ga0316583_10040682 Ga0316583_100406823 119
1515 3300032133 Ga0316583_10099769 Ga0316583_100997691 119
1516 3300032133 Ga0316583_10119472 Ga0316583_101194722 119
1517 3300032133 Ga0316583_10211499 Ga0316583_102114992 119
1518 3300032137 Ga0316585_10069217 Ga0316585_100692173 119
1519 3300032137 Ga0316585_10197000 Ga0316585_101970002 119
1520 3300032168 Ga0316593_10000361 Ga0316593_100003615 119
1521 3300032168 Ga0316593_10007195 Ga0316593_100071952 119
1522 3300032168 Ga0316593_10022315 Ga0316593_100223154 119
1523 3300032168 Ga0316593_10048682 Ga0316593_100486821 119
1524 3300032168 Ga0316593_10053230 Ga0316593_100532302 119
1525 3300032168 Ga0316593_10253313 Ga0316593_102533131 119
1526 3300032168 Ga0316593_10430795 Ga0316593_104307951 119
1527 3300033180 Ga0307510_10124828 Ga0307510_101248284 119
1528 3300033524 Ga0316592_1015277 Ga0316592_10152771 119
1529 3300033524 Ga0316592_1090047 Ga0316592_10900472 119
1530 3300033527 Ga0316586_1006608 Ga0316586_10066082 119
1531 3300033528 Ga0316588_1130265 Ga0316588_11302651 119
1532 3300033528 Ga0316588_1219715 Ga0316588_12197151 119
1533 3300033529 Ga0316587_1002789 Ga0316587_10027892 119
1534 3300033529 Ga0316587_1005542 Ga0316587_10055422 119
1535 3300033529 Ga0316587_1005922 Ga0316587_10059221 119
1536 3300033529 Ga0316587_1006744 Ga0316587_10067442 119
1537 3300033529 Ga0316587_1030581 Ga0316587_10305813 119
1538 3300033529 Ga0316587_1085927 Ga0316587_10859271 119
1539 3300033541 Ga0316596_1018273 Ga0316596_10182731 119
1540 3300033541 Ga0316596_1018300 Ga0316596_10183002 119
1541 3300033541 Ga0316596_1024541 Ga0316596_10245414 119
1542 3300033541 Ga0316596_1024641 Ga0316596_10246413 119
1543 3300033541 Ga0316596_1027601 Ga0316596_10276014 119
1544 3300033541 Ga0316596_1028569 Ga0316596_10285694 119
1545 3300033541 Ga0316596_1035767 Ga0316596_10357673 119
1546 3300033541 Ga0316596_1053987 Ga0316596_10539871 119
1547 3300033541 Ga0316596_1152039 Ga0316596_11520391 119
1548 3300034817 Ga0373948_0153039 Ga0373948_0153039_182_541 119
1549 3300034957 Ga0373938_0184962 Ga0373938_0184962_73_432 119
1550 3300035088 Ga0373940_0283470 Ga0373940_0283470_169_528 119
1551 3300035090 Ga0373949_0303260 Ga0373949_0303260_36_395 119
1552 3300035091 Ga0373951_0225601 Ga0373951_0225601_55_417 119
1553 3300035092 Ga0373952_0000792 Ga0373952_0000792_3813_4172 119
1554 3300035111 Ga0373923_0147708 Ga0373923_0147708_409_768 119
1555 3300035112 Ga0373932_0089968 Ga0373932_0089968_141_500 119
1556 3300035116 Ga0373945_0413339 Ga0373945_0413339_119_484 119
1557 3300035118 Ga0373954_0489304 Ga0373954_0489304_177_536 119
1558 3300035120 Ga0373957_0482369 Ga0373957_0482369_83_442 119
1559 3300035121 Ga0373960_0101288 Ga0373960_0101288_424_783 119
1560 3300035121 Ga0373960_0273068 Ga0373960_0273068_30_389 119
1561 3300035207 Ga0373942_0077279 Ga0373942_0077279_251_610 119
1562 3300035398 Ga0316574_0037143 Ga0316574_0037143_1360_1719 119
1563 3300035398 Ga0316574_0040060 Ga0316574_0040060_965_1324 119
1564 3300035398 Ga0316574_0068932 Ga0316574_0068932_829_1188 119
1565 3300035398 Ga0316574_0161833 Ga0316574_0161833_49_408 119
1566 3300035398 Ga0316574_0475537 Ga0316574_0475537_312_671 119
1567 3300035398 Ga0316574_0802057 Ga0316574_0802057_117_476 119
1568 3300035691 Ga0373931_0149538 Ga0373931_0149538_202_561 119
1569 3300035691 Ga0373931_0811266 Ga0373931_0811266_97_456 119
1570 3300035695 Ga0373927_0802008 Ga0373927_0802008_229_588 119
1571 3300035724 Ga0373933_1027120 Ga0373933_1027120_13_372 119
1572 3300036401 Ga0373937_0109075 Ga0373937_0109075_777_1136 119
1573 3300036401 Ga0373937_1737440 Ga0373937_1737440_104_463 119
1574 3300036458 Ga0310112_024546 Ga0310112_024546_80_439 119
1575 3300036534 Ga0310109_027908 Ga0310109_027908_26_385 119
1576 3300036535 Ga0310110_018599 Ga0310110_018599_103_462 119
1577 3300036647 Ga0316582_0016790 Ga0316582_0016790_425_784 119
1578 3300036647 Ga0316582_0028834 Ga0316582_0028834_383_748 119
1579 3300036647 Ga0316582_0030603 Ga0316582_0030603_1464_1823 119
1580 3300036647 Ga0316582_0035296 Ga0316582_0035296_1742_2101 119
1581 3300036647 Ga0316582_0274836 Ga0316582_0274836_572_934 119
1582 3300036647 Ga0316582_0279479 Ga0316582_0279479_256_615 119
1583 3300036647 Ga0316582_0369298 Ga0316582_0369298_552_911 119
1584 3300036712 Ga0316584_0002080 Ga0316584_0002080_9317_9676 119
1585 3300036712 Ga0316584_0048003 Ga0316584_0048003_388_747 119
1586 3300036712 Ga0316584_0064885 Ga0316584_0064885_167_532 119
1587 3300036712 Ga0316584_0365296 Ga0316584_0365296_351_710 119
1588 3300036712 Ga0316584_0632277 Ga0316584_0632277_56_415 119
1589 3300037068 Ga0373925_0465568 Ga0373925_0465568_527_892 119
1590 3300037312 Ga0395899_0000029 Ga0395899_0000029_161922_162281 119
1591 3300037312 Ga0395899_0037055 Ga0395899_0037055_3040_3399 119
1592 3300037312 Ga0395899_0187825 Ga0395899_0187825_1009_1368 119
1593 3300037312 Ga0395899_0278458 Ga0395899_0278458_351_710 119
1594 3300037418 Ga0395900_0000085 Ga0395900_0000085_167091_167450 119
1595 3300037418 Ga0395900_0004512 Ga0395900_0004512_14101_14460 119
1596 3300037418 Ga0395900_0041887 Ga0395900_0041887_3107_3466 119
1597 3300037418 Ga0395900_1137061 Ga0395900_1137061_260_619 119
1598 3300037466 Ga0395898_0000086 Ga0395898_0000086_167091_167450 119
1599 3300037466 Ga0395898_0151376 Ga0395898_0151376_150_509 119
1600 3300037466 Ga0395898_0277571 Ga0395898_0277571_118_477 119
1601 3300037471 Ga0395905_0000206 Ga0395905_0000206_188_547 119
1602 3300037471 Ga0395905_0009326 Ga0395905_0009326_5678_6037 119
1603 3300037471 Ga0395905_0024135 Ga0395905_0024135_3900_4259 119
1604 3300037471 Ga0395905_0069139 Ga0395905_0069139_2283_2642 119
1605 3300037471 Ga0395905_0493851 Ga0395905_0493851_31_390 119
1606 3300037471 Ga0395905_0790199 Ga0395905_0790199_468_827 119
1607 3300037588 Ga0316581_0001335 Ga0316581_0001335_879_1238 119
1608 3300037588 Ga0316581_0120728 Ga0316581_0120728_189_554 119
1609 3300037853 Ga0436364_0870173 Ga0436364_0870173_128_487 119
1610 3300037853 Ga0436364_1034295 Ga0436364_1034295_174_539 119
1611 3300038443 Ga0395901_0000104 Ga0395901_0000104_11146_11505 119
1612 3300038443 Ga0395901_0000592 Ga0395901_0000592_36967_37326 119
1613 3300038443 Ga0395901_0003716 Ga0395901_0003716_3422_3781 119
1614 3300038443 Ga0395901_0006585 Ga0395901_0006585_5468_5827 119
1615 3300038443 Ga0395901_0109255 Ga0395901_0109255_978_1337 119
1616 3300038443 Ga0395901_0225134 Ga0395901_0225134_879_1238 119
1617 3300038443 Ga0395901_0260641 Ga0395901_0260641_1322_1681 119
1618 3300038443 Ga0395901_1831331 Ga0395901_1831331_37_396 119
1619 3300038726 Ga0400490_41985 Ga0400490_41985_456_815 119
1620 3300038742 Ga0400486_21858 Ga0400486_21858_203_565 119
1621 3300039062 Ga0400483_084617 Ga0400483_084617_283_645 119
1622 3300039437 Ga0436365_0475849 Ga0436365_0475849_54_413 119
1623 3300039438 Ga0436360_0483198 Ga0436360_0483198_562_921 119
1624 3300039438 Ga0436360_1217037 Ga0436360_1217037_178_537 119
1625 3300039447 Ga0436361_0186356 Ga0436361_0186356_1481_1840 119
1626 3300039447 Ga0436361_0602607 Ga0436361_0602607_217_576 119
1627 3300039447 Ga0436361_0841103 Ga0436361_0841103_1569_1928 119
1628 3300039447 Ga0436361_0949341 Ga0436361_0949341_108_467 119
1629 3300039450 Ga0436363_0085530 Ga0436363_0085530_272_631 119
1630 3300039453 Ga0436362_1253569 Ga0436362_1253569_433_792 119
1631 3300041458 Ga0451798_1012432 Ga0451798_1012432_32_415 119
1632 3300041460 Ga0451802_0139250 Ga0451802_0139250_56_415 119
1633 3300041460 Ga0451802_0142920 Ga0451802_0142920_84_443 119
1634 3300041460 Ga0451802_0771863 Ga0451802_0771863_54_419 119
1635 3300042001 Ga0439441_015651 Ga0439441_015651_824_1183 119
1636 3300042005 Ga0439448_0007343 Ga0439448_0007343_1974_2333 119
1637 3300042015 Ga0439462_0037132 Ga0439462_0037132_871_1230 119
1638 3300042122 Ga0450920_016025 Ga0450920_016025_216_575 119
1639 3300042125 Ga0450923_019390 Ga0450923_019390_870_1229 119
1640 3300042125 Ga0450923_102140 Ga0450923_102140_134_493 119
1641 3300042157 Ga0439458_0212365 Ga0439458_0212365_89_448 119
1642 3300042439 Ga0439464_0183230 Ga0439464_0183230_45_422 119
1643 3300042461 Ga0439460_0146061 Ga0439460_0146061_367_744 119
1644 3300042876 Ga0451577_0012652 Ga0451577_0012652_4959_5318 119
1645 3300042876 Ga0451577_0128687 Ga0451577_0128687_794_1153 119
1646 3300044656 Ga0466969_0007576 Ga0466969_0007576_691_1050 119
1647 3300044656 Ga0466969_0038644 Ga0466969_0038644_1237_1596 119
1648 3300044656 Ga0466969_0495268 Ga0466969_0495268_33_392 119
1649 3300044658 Ga0466972_0099947 Ga0466972_0099947_784_1143 119
1650 3300044658 Ga0466972_0133389 Ga0466972_0133389_561_920 119
1651 3300044659 Ga0466973_0345251 Ga0466973_0345251_258_617 119
1652 3300044666 Ga0466977_0059828 Ga0466977_0059828_1510_1869 119
1653 3300044668 Ga0466980_0103120 Ga0466980_0103120_127_486 119
1654 3300044673 Ga0453683_0024196 Ga0453683_0024196_1905_2264 119
1655 3300044673 Ga0453683_0032697 Ga0453683_0032697_1088_1447 119
1656 3300044673 Ga0453683_0108687 Ga0453683_0108687_336_695 119
1657 3300044683 Ga0466965_0001015 Ga0466965_0001015_1208_1567 119
1658 3300044683 Ga0466965_0107515 Ga0466965_0107515_329_688 119
1659 3300044683 Ga0466965_0651967 Ga0466965_0651967_165_524 119
1660 3300044684 Ga0466966_0000005 Ga0466966_0000005_53391_53750 119
1661 3300044684 Ga0466966_0007421 Ga0466966_0007421_1075_1434 119
1662 3300044684 Ga0466966_0038430 Ga0466966_0038430_1988_2347 119
1663 3300044684 Ga0466966_0181384 Ga0466966_0181384_287_646 119
1664 3300044693 Ga0466961_0005719 Ga0466961_0005719_1412_1771 119
1665 3300044693 Ga0466961_0029933 Ga0466961_0029933_1211_1570 119
1666 3300044693 Ga0466961_0175446 Ga0466961_0175446_550_909 119
1667 3300044693 Ga0466961_0205175 Ga0466961_0205175_679_1038 119
1668 3300044693 Ga0466961_0244110 Ga0466961_0244110_237_596 119
1669 3300044694 Ga0466963_0027515 Ga0466963_0027515_2161_2520 119
1670 3300044694 Ga0466963_0074012 Ga0466963_0074012_133_492 119
1671 3300044694 Ga0466963_0342758 Ga0466963_0342758_240_599 119
1672 3300044706 Ga0466964_0102205 Ga0466964_0102205_192_551 119
1673 3300044712 Ga0453684_0000195 Ga0453684_0000195_234756_235115 119
1674 3300044712 Ga0453684_0148264 Ga0453684_0148264_916_1275 119
1675 3300044712 Ga0453684_2076795 Ga0453684_2076795_121_480 119
1676 3300044712 Ga0453684_2346524 Ga0453684_2346524_121_480 119
1677 3300044719 Ga0466971_0000244 Ga0466971_0000244_754_1113 119
1678 3300044719 Ga0466971_0004178 Ga0466971_0004178_1477_1836 119
1679 3300044735 Ga0466968_0067503 Ga0466968_0067503_1143_1502 119
1680 3300044735 Ga0466968_0279752 Ga0466968_0279752_286_645 119
1681 3300044765 Ga0466970_0067366 Ga0466970_0067366_362_721 119
1682 3300044765 Ga0466970_0154903 Ga0466970_0154903_667_1026 119
1683 3300044765 Ga0466970_0170662 Ga0466970_0170662_298_657 119
1684 3300044765 Ga0466970_0893307 Ga0466970_0893307_68_427 119
1685 3300044842 Ga0466957_0060226 Ga0466957_0060226_1323_1682 119
1686 3300044842 Ga0466957_0125561 Ga0466957_0125561_463_822 119
1687 3300044842 Ga0466957_0135864 Ga0466957_0135864_191_550 119
1688 3300044842 Ga0466957_0141228 Ga0466957_0141228_1132_1491 119
1689 3300044842 Ga0466957_0316185 Ga0466957_0316185_465_824 119
1690 3300044842 Ga0466957_0417979 Ga0466957_0417979_211_570 119
1691 3300044842 Ga0466957_0510550 Ga0466957_0510550_427_786 119
1692 3300044842 Ga0466957_0973498 Ga0466957_0973498_235_594 119
1693 3300044901 Ga0466960_0072353 Ga0466960_0072353_1048_1407 119
1694 3300044901 Ga0466960_0078891 Ga0466960_0078891_690_1049 119
1695 3300045049 Ga0466959_0025614 Ga0466959_0025614_2866_3225 119
1696 3300045049 Ga0466959_0029242 Ga0466959_0029242_3059_3418 119
1697 3300045049 Ga0466959_0425135 Ga0466959_0425135_295_654 119
1698 3300045051 Ga0451576_0006371 Ga0451576_0006371_8801_9160 119
1699 3300045051 Ga0451576_0016776 Ga0451576_0016776_2020_2379 119
1700 3300045051 Ga0451576_0058227 Ga0451576_0058227_1138_1497 119
1701 3300045051 Ga0451576_0125653 Ga0451576_0125653_1195_1554 119
1702 3300045051 Ga0451576_0345693 Ga0451576_0345693_1065_1424 119
1703 3300045051 Ga0451576_0368977 Ga0451576_0368977_722_1081 119
1704 3300045051 Ga0451576_2158582 Ga0451576_2158582_87_446 119
1705 3300045836 Ga0466958_0014918 Ga0466958_0014918_3836_4195 119
1706 3300045836 Ga0466958_0111543 Ga0466958_0111543_328_687 119
1707 3300045836 Ga0466958_0209264 Ga0466958_0209264_317_676 119
1708 3300045836 Ga0466958_0334854 Ga0466958_0334854_322_681 119
1709 3300045836 Ga0466958_0705954 Ga0466958_0705954_167_526 119
1710 3300045976 Ga0466967_0489823 Ga0466967_0489823_465_824 119
1711 3300045976 Ga0466967_0676319 Ga0466967_0676319_89_448 119
1712 3300045976 Ga0466967_1355507 Ga0466967_1355507_222_581 119
1713 3300046455 Ga0495603_0003010 Ga0495603_0003010_5418_5777 119
1714 3300046455 Ga0495603_0029293 Ga0495603_0029293_1581_1940 119
1715 3300046457 Ga0495590_0006590 Ga0495590_0006590_2883_3242 119
1716 3300046457 Ga0495590_0122072 Ga0495590_0122072_44_403 119
1717 3300046458 Ga0495591_047806 Ga0495591_047806_429_788 119
1718 3300046459 Ga0495629_0003843 Ga0495629_0003843_10871_11230 119
1719 3300046459 Ga0495629_0031071 Ga0495629_0031071_996_1355 119
1720 3300046459 Ga0495629_0383377 Ga0495629_0383377_473_832 119
1721 3300046460 Ga0495638_0115055 Ga0495638_0115055_560_919 119
1722 3300046460 Ga0495638_0168290 Ga0495638_0168290_339_698 119
1723 3300046463 Ga0495653_0131466 Ga0495653_0131466_576_935 119
1724 3300046463 Ga0495653_0593494 Ga0495653_0593494_44_403 119
1725 3300046471 Ga0495650_0000224 Ga0495650_0000224_82523_82882 119
1726 3300046471 Ga0495650_0017045 Ga0495650_0017045_1703_2062 119
1727 3300046471 Ga0495650_0017850 Ga0495650_0017850_83_442 119
1728 3300046472 Ga0495580_0000102 Ga0495580_0000102_26056_26415 119
1729 3300046472 Ga0495580_0010696 Ga0495580_0010696_1928_2287 119
1730 3300046472 Ga0495580_0185159 Ga0495580_0185159_982_1341 119
1731 3300046472 Ga0495580_0465097 Ga0495580_0465097_264_623 119
1732 3300046473 Ga0495582_0361988 Ga0495582_0361988_230_589 119
1733 3300046474 Ga0495605_0032818 Ga0495605_0032818_2224_2583 119
1734 3300046474 Ga0495605_0051406 Ga0495605_0051406_72_431 119
1735 3300046474 Ga0495605_0152338 Ga0495605_0152338_634_993 119
1736 3300046476 Ga0495662_0099054 Ga0495662_0099054_621_980 119
1737 3300046476 Ga0495662_0158796 Ga0495662_0158796_78_437 119
1738 3300046476 Ga0495662_0271034 Ga0495662_0271034_92_451 119
1739 3300046477 Ga0495664_0075653 Ga0495664_0075653_1621_1980 119
1740 3300046477 Ga0495664_0446686 Ga0495664_0446686_313_672 119
1741 3300046491 Ga0495584_0017143 Ga0495584_0017143_2291_2650 119
1742 3300046491 Ga0495584_0393320 Ga0495584_0393320_98_457 119
1743 3300046492 Ga0495585_0048322 Ga0495585_0048322_1440_1799 119
1744 3300046499 Ga0495594_0612746 Ga0495594_0612746_151_510 119
1745 3300046500 Ga0495596_0070852 Ga0495596_0070852_856_1215 119
1746 3300046501 Ga0495607_0003935 Ga0495607_0003935_5422_5781 119
1747 3300046501 Ga0495607_0304065 Ga0495607_0304065_349_708 119
1748 3300046506 Ga0495583_0005764 Ga0495583_0005764_1999_2358 119
1749 3300046506 Ga0495583_0009849 Ga0495583_0009849_2092_2451 119
1750 3300046506 Ga0495583_0033761 Ga0495583_0033761_1939_2298 119
1751 3300046506 Ga0495583_0121288 Ga0495583_0121288_230_589 119
1752 3300046507 Ga0495606_0000549 Ga0495606_0000549_6218_6577 119
1753 3300046507 Ga0495606_0032364 Ga0495606_0032364_1899_2258 119
1754 3300046507 Ga0495606_0101709 Ga0495606_0101709_824_1183 119
1755 3300046507 Ga0495606_0103958 Ga0495606_0103958_851_1210 119
1756 3300046511 Ga0495608_0044694 Ga0495608_0044694_2553_2912 119
1757 3300046512 Ga0495610_0077838 Ga0495610_0077838_495_854 119
1758 3300046513 Ga0495616_0038911 Ga0495616_0038911_1872_2231 119
1759 3300046513 Ga0495616_0064795 Ga0495616_0064795_535_894 119
1760 3300046514 Ga0495618_0005352 Ga0495618_0005352_1049_1408 119
1761 3300046515 Ga0495620_0013524 Ga0495620_0013524_2076_2435 119
1762 3300046515 Ga0495620_0108112 Ga0495620_0108112_93_452 119
1763 3300046516 Ga0495628_0232777 Ga0495628_0232777_875_1234 119
1764 3300046517 Ga0495630_0159190 Ga0495630_0159190_1222_1581 119
1765 3300046517 Ga0495630_0553436 Ga0495630_0553436_154_513 119
1766 3300046517 Ga0495630_0925325 Ga0495630_0925325_69_428 119
1767 3300046522 Ga0495643_0117075 Ga0495643_0117075_305_664 119
1768 3300046522 Ga0495643_0369535 Ga0495643_0369535_165_524 119
1769 3300046524 Ga0495648_0036697 Ga0495648_0036697_986_1345 119
1770 3300046524 Ga0495648_0064495 Ga0495648_0064495_604_963 119
1771 3300046526 Ga0495666_0006981 Ga0495666_0006981_5248_5607 119
1772 3300046526 Ga0495666_0331613 Ga0495666_0331613_40_399 119
1773 3300046528 Ga0495642_0021794 Ga0495642_0021794_1188_1547 119
1774 3300046528 Ga0495642_0079669 Ga0495642_0079669_537_896 119
1775 3300046528 Ga0495642_0324585 Ga0495642_0324585_268_627 119
1776 3300046528 Ga0495642_0368290 Ga0495642_0368290_219_578 119
1777 3300046529 Ga0495652_0018942 Ga0495652_0018942_3753_4112 119
1778 3300046529 Ga0495652_0342583 Ga0495652_0342583_262_621 119
1779 3300046530 Ga0495654_0019534 Ga0495654_0019534_1950_2309 119
1780 3300046530 Ga0495654_0060101 Ga0495654_0060101_801_1160 119
1781 3300046531 Ga0495665_0014430 Ga0495665_0014430_150_509 119
1782 3300046531 Ga0495665_0492809 Ga0495665_0492809_224_583 119
1783 3300046533 Ga0495640_0234002 Ga0495640_0234002_426_785 119
1784 3300046535 Ga0495586_0008387 Ga0495586_0008387_277_636 119
1785 3300046535 Ga0495586_0047317 Ga0495586_0047317_40_399 119
1786 3300046535 Ga0495586_0416697 Ga0495586_0416697_195_554 119
1787 3300046536 Ga0495587_0030449 Ga0495587_0030449_685_1044 119
1788 3300046537 Ga0495598_0031043 Ga0495598_0031043_40_399 119
1789 3300046538 Ga0495609_0000474 Ga0495609_0000474_20616_20975 119
1790 3300046538 Ga0495609_0058393 Ga0495609_0058393_300_659 119
1791 3300046539 Ga0495621_0029506 Ga0495621_0029506_976_1335 119
1792 3300046542 Ga0495597_0047779 Ga0495597_0047779_511_870 119
1793 3300046542 Ga0495597_0131855 Ga0495597_0131855_589_948 119
1794 3300046543 Ga0495645_0001442 Ga0495645_0001442_7646_8005 119
1795 3300046543 Ga0495645_0101673 Ga0495645_0101673_1342_1701 119
1796 3300046557 Ga0495622_0000206 Ga0495622_0000206_34978_35337 119
1797 3300046559 Ga0495667_0131309 Ga0495667_0131309_353_712 119
1798 3300046615 Ga0495656_0141036 Ga0495656_0141036_201_560 119
1799 3300046616 Ga0495668_0000028 Ga0495668_0000028_283079_283438 119
1800 3300046616 Ga0495668_0007007 Ga0495668_0007007_63_422 119
1801 3300046616 Ga0495668_0346822 Ga0495668_0346822_370_729 119
1802 3300046648 Ga0495611_0027706 Ga0495611_0027706_709_1068 119
1803 3300046648 Ga0495611_0270364 Ga0495611_0270364_135_494 119
1804 3300046663 Ga0495635_0097010 Ga0495635_0097010_905_1264 119
1805 3300046663 Ga0495635_0538547 Ga0495635_0538547_101_460 119
1806 3300046664 Ga0495659_0000736 Ga0495659_0000736_2221_2580 119
1807 3300046664 Ga0495659_0177530 Ga0495659_0177530_159_518 119
1808 3300046664 Ga0495659_0547058 Ga0495659_0547058_102_461 119
1809 3300046665 Ga0495661_0017640 Ga0495661_0017640_986_1345 119
1810 3300046665 Ga0495661_0023120 Ga0495661_0023120_842_1201 119
1811 3300046674 Ga0495588_0308809 Ga0495588_0308809_372_731 119
1812 3300046674 Ga0495588_0338299 Ga0495588_0338299_330_689 119
1813 3300046675 Ga0495657_0162428 Ga0495657_0162428_577_936 119
1814 3300046678 Ga0495599_0006192 Ga0495599_0006192_3867_4226 119
1815 3300046678 Ga0495599_0048822 Ga0495599_0048822_698_1057 119
1816 3300046679 Ga0495623_0001428 Ga0495623_0001428_14867_15226 119
1817 3300046679 Ga0495623_0045944 Ga0495623_0045944_1520_1879 119
1818 3300046680 Ga0495646_0007988 Ga0495646_0007988_2611_2970 119
1819 3300046680 Ga0495646_0164634 Ga0495646_0164634_719_1078 119
1820 3300046680 Ga0495646_0219294 Ga0495646_0219294_536_895 119
1821 3300046683 Ga0495658_0008882 Ga0495658_0008882_3847_4206 119
1822 3300046684 Ga0495669_0002022 Ga0495669_0002022_544_903 119
1823 3300046684 Ga0495669_0030511 Ga0495669_0030511_86_445 119
1824 3300046684 Ga0495669_0210139 Ga0495669_0210139_224_583 119
1825 3300046684 Ga0495669_0230982 Ga0495669_0230982_477_836 119
1826 3300046684 Ga0495669_0629965 Ga0495669_0629965_102_461 119
1827 3300046690 Ga0495624_0022277 Ga0495624_0022277_2614_2973 119
1828 3300046690 Ga0495624_0262928 Ga0495624_0262928_173_532 119
1829 3300046691 Ga0495670_0045783 Ga0495670_0045783_605_964 119
1830 3300046692 Ga0495671_0015472 Ga0495671_0015472_1999_2358 119
1831 3300046692 Ga0495671_0132470 Ga0495671_0132470_552_911 119
1832 3300046694 Ga0495649_0011346 Ga0495649_0011346_1828_2187 119
1833 3300046694 Ga0495649_0049978 Ga0495649_0049978_1573_1932 119
1834 3300046694 Ga0495649_0072687 Ga0495649_0072687_1101_1460 119
1835 3300046694 Ga0495649_0232797 Ga0495649_0232797_408_770 119
1836 3300046794 Ga0495589_0001053 Ga0495589_0001053_12131_12490 119
1837 3300046794 Ga0495589_0361350 Ga0495589_0361350_230_589 119
1838 3300046809 Ga0495600_0073258 Ga0495600_0073258_386_745 119
1839 3300046809 Ga0495600_0266881 Ga0495600_0266881_220_579 119
1840 3300046809 Ga0495600_0642873 Ga0495600_0642873_164_523 119
1841 3300046810 Ga0495660_0048313 Ga0495660_0048313_659_1018 119
1842 3300046810 Ga0495660_0155617 Ga0495660_0155617_309_668 119
1843 3300047317 Ga0495604_0060759 Ga0495604_0060759_1042_1401 119
1844 3300047318 Ga0495636_0032063 Ga0495636_0032063_640_999 119
1845 3300047318 Ga0495636_0379590 Ga0495636_0379590_118_477 119
1846 3300047319 Ga0495674_0024131 Ga0495674_0024131_1474_1833 119
1847 3300047319 Ga0495674_0211866 Ga0495674_0211866_1002_1361 119
1848 3300047319 Ga0495674_0506112 Ga0495674_0506112_330_689 119
1849 3300047320 Ga0495672_0000021 Ga0495672_0000021_152635_152994 119
1850 3300047320 Ga0495672_0025674 Ga0495672_0025674_1758_2117 119
1851 3300047320 Ga0495672_0031323 Ga0495672_0031323_888_1247 119
1852 3300047320 Ga0495672_0214821 Ga0495672_0214821_119_487 119
1853 3300047321 Ga0495676_0113135 Ga0495676_0113135_18_377 119
1854 3300047322 Ga0495680_0021527 Ga0495680_0021527_3974_4333 119
1855 3300047322 Ga0495680_0261658 Ga0495680_0261658_51_410 119
1856 3300047323 Ga0495683_0013523 Ga0495683_0013523_3416_3775 119
1857 3300047323 Ga0495683_0022267 Ga0495683_0022267_1705_2064 119
1858 3300047323 Ga0495683_0032118 Ga0495683_0032118_228_587 119
1859 3300047443 Ga0495687_000015 Ga0495687_000015_300934_301293 119
1860 3300047443 Ga0495687_027203 Ga0495687_027203_938_1297 119
1861 3300047444 Ga0495675_0005478 Ga0495675_0005478_4191_4550 119
1862 3300047445 Ga0495677_0007397 Ga0495677_0007397_2188_2547 119
1863 3300047445 Ga0495677_0183169 Ga0495677_0183169_318_677 119
1864 3300047445 Ga0495677_0290334 Ga0495677_0290334_192_551 119
1865 3300047446 Ga0495679_002832 Ga0495679_002832_7998_8357 119
1866 3300047446 Ga0495679_033687 Ga0495679_033687_279_638 119
1867 3300047446 Ga0495679_080529 Ga0495679_080529_369_728 119
1868 3300047447 Ga0495685_010565 Ga0495685_010565_1869_2228 119
1869 3300047447 Ga0495685_097742 Ga0495685_097742_202_561 119
1870 3300047469 Ga0495673_0009134 Ga0495673_0009134_1905_2264 119
1871 3300047469 Ga0495673_0020433 Ga0495673_0020433_1411_1770 119
1872 3300047470 Ga0495681_0010575 Ga0495681_0010575_863_1222 119
1873 3300047470 Ga0495681_0092125 Ga0495681_0092125_756_1115 119
1874 3300047470 Ga0495681_0164344 Ga0495681_0164344_214_573 119
1875 3300047471 Ga0495684_0213544 Ga0495684_0213544_45_404 119
1876 3300047472 Ga0495686_0000076 Ga0495686_0000076_111436_111795 119
1877 3300047472 Ga0495686_0008093 Ga0495686_0008093_3941_4300 119
1878 3300047472 Ga0495686_0141647 Ga0495686_0141647_1028_1387 119
1879 3300047673 Ga0495593_0013978 Ga0495593_0013978_2252_2611 119
1880 3300048088 Ga0495602_0076445 Ga0495602_0076445_986_1345 119
1881 3300048088 Ga0495602_0130396 Ga0495602_0130396_173_532 119
1882 3300048089 Ga0495614_0006763 Ga0495614_0006763_3733_4092 119
1883 3300048091 Ga0495626_0026600 Ga0495626_0026600_541_900 119
1884 3300048903 Ga0496100_0005704 Ga0496100_0005704_6350_6709 119
1885 3300048903 Ga0496100_0044832 Ga0496100_0044832_1937_2296 119
1886 3300048903 Ga0496100_0089496 Ga0496100_0089496_712_1074 119
1887 3300048903 Ga0496100_0156284 Ga0496100_0156284_944_1303 119
1888 3300048903 Ga0496100_0163444 Ga0496100_0163444_720_1079 119
1889 3300048903 Ga0496100_0452627 Ga0496100_0452627_498_857 119
1890 3300048904 Ga0496101_0333797 Ga0496101_0333797_617_979 119
1891 3300048904 Ga0496101_0388397 Ga0496101_0388397_241_600 119
1892 3300048904 Ga0496101_0435084 Ga0496101_0435084_575_934 119
1893 3300048904 Ga0496101_0440060 Ga0496101_0440060_207_566 119
1894 3300048904 Ga0496101_0710969 Ga0496101_0710969_337_696 119
1895 3300048904 Ga0496101_0891521 Ga0496101_0891521_62_421 119
1896 3300048905 Ga0496102_0000728 Ga0496102_0000728_1498_1857 119
1897 3300048905 Ga0496102_0019771 Ga0496102_0019771_2658_3020 119
1898 3300048905 Ga0496102_0034126 Ga0496102_0034126_26_385 119
1899 3300048905 Ga0496102_0269146 Ga0496102_0269146_312_671 119
1900 3300048905 Ga0496102_0680551 Ga0496102_0680551_497_856 119
1901 3300048905 Ga0496102_0711240 Ga0496102_0711240_171_530 119
1902 3300048906 Ga0496103_0003258 Ga0496103_0003258_7288_7647 119
1903 3300048906 Ga0496103_0094623 Ga0496103_0094623_1239_1598 119
1904 3300048906 Ga0496103_0113851 Ga0496103_0113851_642_1004 119
1905 3300048907 Ga0496104_0070267 Ga0496104_0070267_1739_2098 119
1906 3300048907 Ga0496104_0115324 Ga0496104_0115324_1853_2212 119
1907 3300048907 Ga0496104_0173067 Ga0496104_0173067_1458_1817 119
1908 3300048907 Ga0496104_0189831 Ga0496104_0189831_815_1174 119
1909 3300048907 Ga0496104_0255372 Ga0496104_0255372_1087_1446 119
1910 3300048907 Ga0496104_0287439 Ga0496104_0287439_928_1287 119
1911 3300048907 Ga0496104_0908851 Ga0496104_0908851_160_522 119
1912 3300048908 Ga0496105_0300066 Ga0496105_0300066_173_532 119
1913 3300048908 Ga0496105_0321714 Ga0496105_0321714_336_695 119
1914 3300048908 Ga0496105_0378503 Ga0496105_0378503_442_804 119
1915 3300048908 Ga0496105_0401037 Ga0496105_0401037_228_587 119
1916 3300048908 Ga0496105_0426398 Ga0496105_0426398_165_524 119
1917 3300048908 Ga0496105_0961852 Ga0496105_0961852_91_450 119
1918 3300048908 Ga0496105_1136125 Ga0496105_1136125_38_397 119
1919 3300048908 Ga0496105_1231958 Ga0496105_1231958_26_385 119
1920 3300048909 Ga0496106_0000023 Ga0496106_0000023_11547_11906 119
1921 3300048909 Ga0496106_0003495 Ga0496106_0003495_2043_2402 119
1922 3300048909 Ga0496106_0007426 Ga0496106_0007426_4792_5154 119
1923 3300048909 Ga0496106_0596126 Ga0496106_0596126_81_440 119
1924 3300048910 Ga0496107_0053370 Ga0496107_0053370_2002_2361 119
1925 3300048910 Ga0496107_0232328 Ga0496107_0232328_780_1139 119
1926 3300048910 Ga0496107_0243300 Ga0496107_0243300_26_433 119
1927 3300048911 Ga0496108_0002023 Ga0496108_0002023_9717_10076 119
1928 3300048911 Ga0496108_0288774 Ga0496108_0288774_557_916 119
1929 3300048911 Ga0496108_0413577 Ga0496108_0413577_53_412 119
1930 3300048911 Ga0496108_0806921 Ga0496108_0806921_221_583 119
1931 3300048911 Ga0496108_0996643 Ga0496108_0996643_135_494 119
1932 3300048912 Ga0496109_0003005 Ga0496109_0003005_3706_4065 119
1933 3300048912 Ga0496109_0127039 Ga0496109_0127039_862_1224 119
1934 3300048912 Ga0496109_0129605 Ga0496109_0129605_1046_1405 119
1935 3300048912 Ga0496109_0161025 Ga0496109_0161025_1478_1837 119
1936 3300048912 Ga0496109_0333293 Ga0496109_0333293_483_842 119
1937 3300048913 Ga0496110_0008942 Ga0496110_0008942_406_765 119
1938 3300048913 Ga0496110_0009344 Ga0496110_0009344_7378_7737 119
1939 3300048913 Ga0496110_0166617 Ga0496110_0166617_162_521 119
1940 3300048913 Ga0496110_0450359 Ga0496110_0450359_235_594 119
1941 3300048913 Ga0496110_0596788 Ga0496110_0596788_107_466 119
1942 3300048913 Ga0496110_1411378 Ga0496110_1411378_12_371 119
1943 3300048914 Ga0496111_0009231 Ga0496111_0009231_682_1041 119
1944 3300048914 Ga0496111_0501220 Ga0496111_0501220_326_685 119
1945 3300048915 Ga0496112_0379519 Ga0496112_0379519_156_515 119
1946 3300048915 Ga0496112_0383309 Ga0496112_0383309_654_1013 119
1947 3300048915 Ga0496112_0544798 Ga0496112_0544798_223_582 119
1948 3300048915 Ga0496112_0551366 Ga0496112_0551366_504_863 119
1949 3300048916 Ga0496113_0017415 Ga0496113_0017415_2232_2591 119
1950 3300048916 Ga0496113_0045203 Ga0496113_0045203_717_1076 119
1951 3300048916 Ga0496113_0211136 Ga0496113_0211136_166_525 119
1952 3300048916 Ga0496113_0267767 Ga0496113_0267767_412_771 119
1953 3300048916 Ga0496113_0417348 Ga0496113_0417348_123_485 119
1954 3300048916 Ga0496113_0860781 Ga0496113_0860781_300_659 119
1955 3300048917 Ga0496114_0001789 Ga0496114_0001789_9515_9874 119
1956 3300048917 Ga0496114_0002868 Ga0496114_0002868_1839_2198 119
1957 3300048917 Ga0496114_0046362 Ga0496114_0046362_229_588 119
1958 3300048917 Ga0496114_0047933 Ga0496114_0047933_89_448 119
1959 3300048917 Ga0496114_0358364 Ga0496114_0358364_788_1147 119
1960 3300048917 Ga0496114_0968744 Ga0496114_0968744_201_560 119
1961 3300048918 Ga0496115_0038262 Ga0496115_0038262_1357_1716 119
1962 3300048918 Ga0496115_0181681 Ga0496115_0181681_1242_1601 119
1963 3300048918 Ga0496115_0188308 Ga0496115_0188308_960_1322 119
1964 3300048918 Ga0496115_0601289 Ga0496115_0601289_243_602 119
1965 3300048919 Ga0496116_0004799 Ga0496116_0004799_11119_11478 119
1966 3300048919 Ga0496116_0042050 Ga0496116_0042050_1808_2167 119
1967 3300048919 Ga0496116_0100985 Ga0496116_0100985_1130_1489 119
1968 3300048919 Ga0496116_0288017 Ga0496116_0288017_229_588 119
1969 3300048920 Ga0496117_0000800 Ga0496117_0000800_15974_16333 119
1970 3300048920 Ga0496117_0001551 Ga0496117_0001551_1477_1836 119
1971 3300048920 Ga0496117_0094414 Ga0496117_0094414_235_594 119
1972 3300048920 Ga0496117_0593296 Ga0496117_0593296_112_471 119
1973 3300048921 Ga0496118_0000916 Ga0496118_0000916_214_573 119
1974 3300048921 Ga0496118_0003442 Ga0496118_0003442_18441_18800 119
1975 3300048921 Ga0496118_0004447 Ga0496118_0004447_15620_15979 119
1976 3300048921 Ga0496118_0149258 Ga0496118_0149258_850_1209 119
1977 3300048921 Ga0496118_0159892 Ga0496118_0159892_658_1017 119
1978 3300048921 Ga0496118_0161558 Ga0496118_0161558_44_403 119
1979 3300048921 Ga0496118_0377067 Ga0496118_0377067_349_708 119
1980 3300048922 Ga0496119_0000916 Ga0496119_0000916_6101_6469 119
1981 3300048922 Ga0496119_0042497 Ga0496119_0042497_756_1115 119
1982 3300048922 Ga0496119_0296126 Ga0496119_0296126_66_425 119
1983 3300048923 Ga0496120_0215252 Ga0496120_0215252_199_558 119
1984 3300048924 Ga0496121_0003621 Ga0496121_0003621_13151_13510 119
1985 3300048924 Ga0496121_0028586 Ga0496121_0028586_2774_3133 119
1986 3300048924 Ga0496121_0116743 Ga0496121_0116743_236_595 119
1987 3300048924 Ga0496121_0128593 Ga0496121_0128593_686_1045 119
1988 3300048924 Ga0496121_0151960 Ga0496121_0151960_21_380 119
1989 3300048924 Ga0496121_0182234 Ga0496121_0182234_397_756 119
1990 3300048925 Ga0496122_0001793 Ga0496122_0001793_1965_2324 119
1991 3300048925 Ga0496122_0010409 Ga0496122_0010409_8392_8751 119
1992 3300048925 Ga0496122_0016789 Ga0496122_0016789_4700_5068 119
1993 3300048926 Ga0496123_0003792 Ga0496123_0003792_1844_2212 119
1994 3300048926 Ga0496123_0015690 Ga0496123_0015690_5001_5360 119
1995 3300048926 Ga0496123_0050885 Ga0496123_0050885_1725_2084 119
1996 3300048926 Ga0496123_0177662 Ga0496123_0177662_239_598 119
1997 3300048927 Ga0496124_0177879 Ga0496124_0177879_1113_1472 119
1998 3300048927 Ga0496124_0337987 Ga0496124_0337987_642_1001 119
1999 3300048927 Ga0496124_0423576 Ga0496124_0423576_121_483 119
2000 3300048927 Ga0496124_0559737 Ga0496124_0559737_77_457 119
2001 3300048928 Ga0496125_0001452 Ga0496125_0001452_32182_32541 119
2002 3300048928 Ga0496125_0001533 Ga0496125_0001533_25853_26212 119
2003 3300048928 Ga0496125_0003857 Ga0496125_0003857_7075_7434 119
2004 3300048928 Ga0496125_0208377 Ga0496125_0208377_823_1182 119
2005 3300048929 Ga0496126_0000230 Ga0496126_0000230_95428_95787 119
2006 3300048929 Ga0496126_0000628 Ga0496126_0000628_6240_6599 119
2007 3300048929 Ga0496126_0005369 Ga0496126_0005369_8532_8891 119
2008 3300048929 Ga0496126_0215964 Ga0496126_0215964_213_572 119
2009 3300048929 Ga0496126_1193648 Ga0496126_1193648_112_471 119
2010 3300048986 Ga0466983_0358327 Ga0466983_0358327_311_670 119
2011 3300049127 Ga0501306_018015 Ga0501306_018015_145_504 119
2012 3300049128 Ga0501308_070500 Ga0501308_070500_111_473 119
2013 3300049130 Ga0501310_009001 Ga0501310_009001_493_855 119
2014 3300049132 Ga0501343_008559 Ga0501343_008559_422_781 119
2015 3300049132 Ga0501343_011319 Ga0501343_011319_75_434 119
2016 3300049160 Ga0501304_011627 Ga0501304_011627_356_715 119
2017 3300049161 Ga0501305_023118 Ga0501305_023118_324_683 119
2018 3300049161 Ga0501305_031175 Ga0501305_031175_278_640 119
2019 3300049162 Ga0501307_018705 Ga0501307_018705_487_849 119
2020 3300049459 Ga0495678_004420 Ga0495678_004420_2135_2494 119
2021 3300049459 Ga0495678_087481 Ga0495678_087481_180_539 119
2022 3300049459 Ga0495678_219484 Ga0495678_219484_83_442 119
2023 3300049528 Ga0501312_090381 Ga0501312_090381_168_527 119
2024 3300049530 Ga0501314_010688 Ga0501314_010688_355_714 119
2025 3300049530 Ga0501314_011384 Ga0501314_011384_345_704 119
2026 3300049530 Ga0501314_012099 Ga0501314_012099_413_772 119
2027 3300049531 Ga0501315_079864 Ga0501315_079864_119_478 119
2028 3300049533 Ga0501317_051650 Ga0501317_051650_146_505 119
2029 3300049536 Ga0501320_004911 Ga0501320_004911_707_1069 119
2030 3300049536 Ga0501320_011097 Ga0501320_011097_89_448 119
2031 3300049536 Ga0501320_029684 Ga0501320_029684_171_530 119
2032 3300049538 Ga0501322_010438 Ga0501322_010438_11_370 119
2033 3300049538 Ga0501322_013562 Ga0501322_013562_171_530 119
2034 3300049539 Ga0501323_056717 Ga0501323_056717_193_552 119
2035 3300049540 Ga0501324_010567 Ga0501324_010567_36_398 119
2036 3300049540 Ga0501324_012657 Ga0501324_012657_388_750 119
2037 3300049540 Ga0501324_032305 Ga0501324_032305_43_405 119
2038 3300049541 Ga0501325_012586 Ga0501325_012586_405_767 119
2039 3300049541 Ga0501325_021852 Ga0501325_021852_287_649 119
2040 3300049541 Ga0501325_034563 Ga0501325_034563_138_497 119
2041 3300049542 Ga0501326_09967 Ga0501326_09967_26_385 119
2042 3300049543 Ga0501327_04138 Ga0501327_04138_21_383 119
2043 3300049551 Ga0501335_021095 Ga0501335_021095_238_597 119
2044 3300049552 Ga0501336_002530 Ga0501336_002530_606_965 119
2045 3300049552 Ga0501336_013390 Ga0501336_013390_75_434 119
2046 3300049556 Ga0501340_009988 Ga0501340_009988_46_405 119
2047 3300049568 Ga0501031_0622669 Ga0501031_0622669_182_541 119
2048 3300049569 Ga0501032_0000167 Ga0501032_0000167_35197_35556 119
2049 3300049569 Ga0501032_0003957 Ga0501032_0003957_9001_9360 119
2050 3300049569 Ga0501032_0047999 Ga0501032_0047999_1965_2324 119
2051 3300049569 Ga0501032_0121771 Ga0501032_0121771_506_865 119
2052 3300049569 Ga0501032_0164262 Ga0501032_0164262_967_1326 119
2053 3300049570 Ga0501033_0002160 Ga0501033_0002160_3661_4020 119
2054 3300049570 Ga0501033_0002995 Ga0501033_0002995_11743_12102 119
2055 3300049570 Ga0501033_1005627 Ga0501033_1005627_127_489 119
2056 3300049571 Ga0501034_0005615 Ga0501034_0005615_9643_10002 119
2057 3300049571 Ga0501034_0014914 Ga0501034_0014914_4398_4757 119
2058 3300049571 Ga0501034_0128617 Ga0501034_0128617_729_1088 119
2059 3300049571 Ga0501034_1269077 Ga0501034_1269077_138_497 119
2060 3300049572 Ga0501036_0000725 Ga0501036_0000725_9379_9738 119
2061 3300049572 Ga0501036_0006699 Ga0501036_0006699_8430_8789 119
2062 3300049572 Ga0501036_0140269 Ga0501036_0140269_1330_1689 119
2063 3300049572 Ga0501036_0321791 Ga0501036_0321791_431_790 119
2064 3300049572 Ga0501036_0464622 Ga0501036_0464622_16_375 119
2065 3300049572 Ga0501036_0750995 Ga0501036_0750995_297_656 119
2066 3300049573 Ga0501037_0000255 Ga0501037_0000255_18522_18881 119
2067 3300049573 Ga0501037_0014295 Ga0501037_0014295_1201_1560 119
2068 3300049573 Ga0501037_0045350 Ga0501037_0045350_1427_1786 119
2069 3300049573 Ga0501037_0112980 Ga0501037_0112980_834_1193 119
2070 3300049573 Ga0501037_0138840 Ga0501037_0138840_979_1338 119
2071 3300049573 Ga0501037_0141510 Ga0501037_0141510_455_814 119
2072 3300049573 Ga0501037_0205648 Ga0501037_0205648_435_794 119
2073 3300049573 Ga0501037_0275971 Ga0501037_0275971_497_859 119
2074 3300049574 Ga0501038_0000229 Ga0501038_0000229_11997_12356 119
2075 3300049574 Ga0501038_0009184 Ga0501038_0009184_1534_1893 119
2076 3300049574 Ga0501038_0024813 Ga0501038_0024813_1396_1755 119
2077 3300049574 Ga0501038_0171918 Ga0501038_0171918_1148_1507 119
2078 3300049574 Ga0501038_0180846 Ga0501038_0180846_1038_1397 119
2079 3300049574 Ga0501038_0264815 Ga0501038_0264815_565_927 119
2080 3300049574 Ga0501038_0357125 Ga0501038_0357125_767_1126 119
2081 3300049574 Ga0501038_0611207 Ga0501038_0611207_424_783 119
2082 3300049574 Ga0501038_0784180 Ga0501038_0784180_23_382 119
2083 3300049575 Ga0501039_0001409 Ga0501039_0001409_5954_6313 119
2084 3300049575 Ga0501039_0002294 Ga0501039_0002294_10563_10922 119
2085 3300049575 Ga0501039_0037204 Ga0501039_0037204_2955_3314 119
2086 3300049575 Ga0501039_0488744 Ga0501039_0488744_90_449 119
2087 3300049575 Ga0501039_0575309 Ga0501039_0575309_440_799 119
2088 3300049576 Ga0501040_0000182 Ga0501040_0000182_22324_22683 119
2089 3300049576 Ga0501040_0007883 Ga0501040_0007883_4652_5011 119
2090 3300049576 Ga0501040_0845819 Ga0501040_0845819_95_454 119
2091 3300049577 Ga0501041_0001065 Ga0501041_0001065_6534_6893 119
2092 3300049577 Ga0501041_0290883 Ga0501041_0290883_575_937 119
2093 3300049577 Ga0501041_0584325 Ga0501041_0584325_158_517 119
2094 3300049578 Ga0501042_0000708 Ga0501042_0000708_11887_12246 119
2095 3300049578 Ga0501042_0027122 Ga0501042_0027122_2059_2418 119
2096 3300049578 Ga0501042_0661315 Ga0501042_0661315_339_701 119
2097 3300049578 Ga0501042_0852029 Ga0501042_0852029_98_457 119
2098 3300049579 Ga0501043_0002561 Ga0501043_0002561_11333_11692 119
2099 3300049579 Ga0501043_0015028 Ga0501043_0015028_3867_4226 119
2100 3300049579 Ga0501043_0750322 Ga0501043_0750322_68_427 119
2101 3300049580 Ga0501046_0000422 Ga0501046_0000422_6722_7081 119
2102 3300049580 Ga0501046_0011518 Ga0501046_0011518_1364_1723 119
2103 3300049580 Ga0501046_0045566 Ga0501046_0045566_621_983 119
2104 3300049580 Ga0501046_0076436 Ga0501046_0076436_1675_2034 119
2105 3300049580 Ga0501046_0688276 Ga0501046_0688276_91_453 119
2106 3300049581 Ga0501047_0002269 Ga0501047_0002269_5839_6198 119
2107 3300049581 Ga0501047_0283885 Ga0501047_0283885_506_865 119
2108 3300049581 Ga0501047_0642751 Ga0501047_0642751_26_385 119
2109 3300049581 Ga0501047_0744766 Ga0501047_0744766_232_591 119
2110 3300049582 Ga0501048_0001780 Ga0501048_0001780_3641_4000 119
2111 3300049582 Ga0501048_0069158 Ga0501048_0069158_780_1139 119
2112 3300049582 Ga0501048_0561437 Ga0501048_0561437_90_452 119
2113 3300049583 Ga0501067_0134259 Ga0501067_0134259_693_1055 119
2114 3300049584 Ga0501068_0000334 Ga0501068_0000334_14536_14895 119
2115 3300049584 Ga0501068_0013973 Ga0501068_0013973_3448_3807 119
2116 3300049585 Ga0501069_0051494 Ga0501069_0051494_571_930 119
2117 3300049586 Ga0501070_0016320 Ga0501070_0016320_237_596 119
2118 3300049586 Ga0501070_0021676 Ga0501070_0021676_2124_2483 119
2119 3300049586 Ga0501070_0186240 Ga0501070_0186240_140_499 119
2120 3300049587 Ga0501071_0040118 Ga0501071_0040118_517_876 119
2121 3300049588 Ga0501072_0011283 Ga0501072_0011283_2046_2405 119
2122 3300049589 Ga0501073_0100989 Ga0501073_0100989_148_507 119
2123 3300049589 Ga0501073_0281194 Ga0501073_0281194_776_1135 119
2124 3300049589 Ga0501073_0746213 Ga0501073_0746213_21_389 119
2125 3300049590 Ga0501074_0000764 Ga0501074_0000764_4824_5183 119
2126 3300049590 Ga0501074_0403524 Ga0501074_0403524_188_550 119
2127 3300049590 Ga0501074_0435151 Ga0501074_0435151_209_568 119
2128 3300049591 Ga0501075_0007076 Ga0501075_0007076_3638_3997 119
2129 3300049591 Ga0501075_0352453 Ga0501075_0352453_197_556 119
2130 3300049591 Ga0501075_0680076 Ga0501075_0680076_341_703 119
2131 3300049592 Ga0501076_1071707 Ga0501076_1071707_195_554 119
2132 3300049592 Ga0501076_1707610 Ga0501076_1707610_12_374 119
2133 3300049593 Ga0501077_0119890 Ga0501077_0119890_875_1234 119
2134 3300049593 Ga0501077_0941655 Ga0501077_0941655_24_383 119
2135 3300049671 Ga0501238_012775 Ga0501238_012775_447_806 119
2136 3300049741 Ga0501079_0010995 Ga0501079_0010995_6391_6750 119
2137 3300049741 Ga0501079_0016502 Ga0501079_0016502_3999_4361 119
2138 3300049741 Ga0501079_0032753 Ga0501079_0032753_2293_2652 119
2139 3300049741 Ga0501079_0037809 Ga0501079_0037809_3229_3591 119
2140 3300049741 Ga0501079_1300996 Ga0501079_1300996_74_436 119
2141 3300049742 Ga0501080_0137960 Ga0501080_0137960_1127_1486 119
2142 3300049743 Ga0501081_0005996 Ga0501081_0005996_1912_2271 119
2143 3300049743 Ga0501081_0095340 Ga0501081_0095340_419_781 119
2144 3300049744 Ga0501083_0060966 Ga0501083_0060966_768_1127 119
2145 3300049744 Ga0501083_0501850 Ga0501083_0501850_416_775 119
2146 3300049744 Ga0501083_0568702 Ga0501083_0568702_71_433 119
2147 3300049744 Ga0501083_0720437 Ga0501083_0720437_150_509 119
2148 3300049822 Ga0501035_0008885 Ga0501035_0008885_225_584 119
2149 3300049822 Ga0501035_0087436 Ga0501035_0087436_666_1025 119
2150 3300049822 Ga0501035_0162363 Ga0501035_0162363_1272_1631 119
2151 3300049822 Ga0501035_0264870 Ga0501035_0264870_640_999 119
2152 3300049823 Ga0501044_0000323 Ga0501044_0000323_34894_35253 119
2153 3300049823 Ga0501044_0000514 Ga0501044_0000514_42591_42950 119
2154 3300049823 Ga0501044_0047371 Ga0501044_0047371_2364_2723 119
2155 3300049823 Ga0501044_0065798 Ga0501044_0065798_3290_3649 119
2156 3300049823 Ga0501044_0215280 Ga0501044_0215280_1259_1618 119
2157 3300049823 Ga0501044_1129712 Ga0501044_1129712_66_425 119
2158 3300049824 Ga0501045_0001098 Ga0501045_0001098_3270_3629 119
2159 3300049824 Ga0501045_0079987 Ga0501045_0079987_607_969 119
2160 3300049824 Ga0501045_0087702 Ga0501045_0087702_92_451 119
2161 3300050489 nmdc:mga03683_126396_c1 nmdc:mga03683_126396_c1_411_770 119
2162 3300050493 nmdc:mga0k408_1091_c1 nmdc:mga0k408_1091_c1_739_1098 119
2163 3300050493 nmdc:mga0k408_828043_c1 nmdc:mga0k408_828043_c1_11_376 119
2164 3300050496 nmdc:mga07m45_755414_c1 nmdc:mga07m45_755414_c1_94_453 119
2165 3300050507 nmdc:mga05p37_2276100_c1 nmdc:mga05p37_2276100_c1_61_426 119
2166 3300050508 nmdc:mga09592_16545_c1 nmdc:mga09592_16545_c1_4644_5003 119
2167 3300050509 nmdc:mga0qj67_1096223_c1 nmdc:mga0qj67_1096223_c1_64_423 119
2168 3300050510 nmdc:mga06r32_1296341_c1 nmdc:mga06r32_1296341_c1_207_566 119
2169 3300050510 nmdc:mga06r32_1364421_c1 nmdc:mga06r32_1364421_c1_118_477 119
2170 3300050510 nmdc:mga06r32_1697797_c1 nmdc:mga06r32_1697797_c1_149_511 119
2171 3300050510 nmdc:mga06r32_40012_c1 nmdc:mga06r32_40012_c1_3755_4120 119
2172 3300050510 nmdc:mga06r32_904031_c1 nmdc:mga06r32_904031_c1_241_600 119
2173 3300050510 nmdc:mga06r32_962346_c1 nmdc:mga06r32_962346_c1_396_755 119
2174 3300050511 nmdc:mga08y16_139558_c1 nmdc:mga08y16_139558_c1_89_448 119
2175 3300050511 nmdc:mga08y16_1586545_c1 nmdc:mga08y16_1586545_c1_195_554 119
2176 3300050511 nmdc:mga08y16_17296_c1 nmdc:mga08y16_17296_c1_6887_7246 119
2177 3300050512 nmdc:mga0n895_127011_c1 nmdc:mga0n895_127011_c1_311_670 119
2178 3300050512 nmdc:mga0n895_400856_c1 nmdc:mga0n895_400856_c1_340_699 119
2179 3300050512 nmdc:mga0n895_623117_c1 nmdc:mga0n895_623117_c1_99_458 119
2180 3300050512 nmdc:mga0n895_972364_c1 nmdc:mga0n895_972364_c1_230_589 119
2181 3300053093 Ga0500651_0214096 Ga0500651_0214096_371_733 119
2182 3300053103 Ga0500555_045556 Ga0500555_045556_465_827 119
2183 3300053104 Ga0500556_0000033 Ga0500556_0000033_122434_122802 119
2184 3300053108 Ga0500562_167312 Ga0500562_167312_169_531 119
2185 3300053121 Ga0500607_005038 Ga0500607_005038_7897_8256 119
2186 3300053131 Ga0500652_240855 Ga0500652_240855_123_491 119
2187 3300053136 Ga0500559_0011735 Ga0500559_0011735_1847_2206 119
2188 3300053153 Ga0500616_0152870 Ga0500616_0152870_391_774 119
2189 3300053156 Ga0500622_0158207 Ga0500622_0158207_34_393 119
2190 3300053157 Ga0500624_016588 Ga0500624_016588_314_673 119
2191 3300053158 Ga0500627_0150628 Ga0500627_0150628_205_567 119
2192 3300053177 Ga0500636_0000049 Ga0500636_0000049_21940_22299 119
2193 3300053178 Ga0500637_0004248 Ga0500637_0004248_608_967 119
2194 3300053729 Ga0500625_153787 Ga0500625_153787_70_429 119
2195 3300053730 Ga0500645_066676 Ga0500645_066676_216_584 119
2196 3300054114 Ga0501084_0165198 Ga0501084_0165198_1167_1526 119
2197 3300054114 Ga0501084_0849633 Ga0501084_0849633_389_748 119
2198 3300054114 Ga0501084_1627020 Ga0501084_1627020_99_458 119
2199 3300054114 Ga0501084_1871409 Ga0501084_1871409_109_468 119
2200 3300059424 Ga0590075_211524 Ga0590075_211524_130_489 119
2201 3300059490 Ga0587066_103968 Ga0587066_103968_169_528 119
2202 3300059492 Ga0587073_0158320 Ga0587073_0158320_81_440 119
2203 3300059492 Ga0587073_0176197 Ga0587073_0176197_248_607 119
2204 3300059493 Ga0587077_149422 Ga0587077_149422_78_437 119
2205 3300059493 Ga0587077_212075 Ga0587077_212075_130_489 119
2206 3300059503 Ga0587080_031821 Ga0587080_031821_72_431 119
2207 3300059503 Ga0587080_108543 Ga0587080_108543_23_382 119
2208 3300059504 Ga0587082_003080 Ga0587082_003080_116_478 119
2209 3300059505 Ga0587083_0041675 Ga0587083_0041675_484_843 119
2210 3300059506 Ga0587085_120796 Ga0587085_120796_124_483 119
2211 3300059507 Ga0587086_029667 Ga0587086_029667_161_520 119
2212 3300059508 Ga0587088_055242 Ga0587088_055242_144_503 119
2213 3300059508 Ga0587088_111688 Ga0587088_111688_241_600 119
2214 3300059508 Ga0587088_128192 Ga0587088_128192_120_479 119
2215 3300059509 Ga0587089_002312 Ga0587089_002312_1460_1819 119
2216 3300059509 Ga0587089_034908 Ga0587089_034908_249_608 119
2217 3300059510 Ga0587090_003256 Ga0587090_003256_1250_1609 119
2218 3300059510 Ga0587090_006629 Ga0587090_006629_147_506 119
2219 3300059511 Ga0587091_094627 Ga0587091_094627_72_431 119
2220 3300059511 Ga0587091_110383 Ga0587091_110383_274_633 119
2221 3300059512 Ga0587092_106009 Ga0587092_106009_24_383 119
2222 3300059513 Ga0587094_037558 Ga0587094_037558_132_491 119
2223 3300059514 Ga0587095_013877 Ga0587095_013877_330_689 119
2224 3300059603 Ga0587097_03736 Ga0587097_03736_281_640 119
2225 3300059604 Ga0587098_011791 Ga0587098_011791_503_862 119
2226 3300059604 Ga0587098_020772 Ga0587098_020772_266_625 119
2227 3300059605 Ga0587106_072914 Ga0587106_072914_271_630 119
2228 3300059605 Ga0587106_098454 Ga0587106_098454_34_393 119
2229 3300059605 Ga0587106_110743 Ga0587106_110743_83_442 119
2230 3300059608 Ga0587129_000781 Ga0587129_000781_1172_1531 119
2231 3300059622 Ga0587099_022221 Ga0587099_022221_164_523 119
2232 3300059623 Ga0587101_017996 Ga0587101_017996_360_719 119
2233 3300059624 Ga0587109_089662 Ga0587109_089662_63_422 119
2234 3300059625 Ga0587113_005054 Ga0587113_005054_72_431 119
2235 3300059626 Ga0587115_123254 Ga0587115_123254_112_471 119
2236 3300059628 Ga0587122_016602 Ga0587122_016602_380_739 119
2237 3300059630 Ga0587128_054106 Ga0587128_054106_273_632 119
2238 3300059630 Ga0587128_072527 Ga0587128_072527_288_647 119
2239 3300059631 Ga0587130_021766 Ga0587130_021766_60_419 119
2240 3300059639 Ga0587062_076961 Ga0587062_076961_204_563 119
2241 3300059640 Ga0587067_008104 Ga0587067_008104_1096_1455 119
2242 3300059640 Ga0587067_047685 Ga0587067_047685_75_434 119
2243 3300059640 Ga0587067_080796 Ga0587067_080796_157_516 119
2244 3300059641 Ga0587068_042973 Ga0587068_042973_430_789 119
2245 3300059641 Ga0587068_092645 Ga0587068_092645_172_531 119
2246 3300059641 Ga0587068_121371 Ga0587068_121371_41_400 119
2247 3300059641 Ga0587068_145449 Ga0587068_145449_159_518 119
2248 3300059641 Ga0587068_153351 Ga0587068_153351_129_488 119
2249 3300059642 Ga0587069_050126 Ga0587069_050126_101_460 119
2250 3300059642 Ga0587069_153938 Ga0587069_153938_14_373 119
2251 3300059643 Ga0587072_048028 Ga0587072_048028_253_612 119
2252 3300059643 Ga0587072_094549 Ga0587072_094549_52_411 119
2253 3300059644 Ga0587075_003940 Ga0587075_003940_223_582 119
2254 3300059644 Ga0587075_020008 Ga0587075_020008_604_963 119
2255 3300059644 Ga0587075_032987 Ga0587075_032987_72_431 119
2256 3300059646 Ga0587078_003684 Ga0587078_003684_1181_1540 119
2257 3300059647 Ga0587079_043767 Ga0587079_043767_271_630 119
2258 3300059648 Ga0587100_018779 Ga0587100_018779_271_630 119
2259 3300059648 Ga0587100_041239 Ga0587100_041239_18_377 119
2260 3300059649 Ga0587102_002930 Ga0587102_002930_66_425 119
2261 3300059649 Ga0587102_015472 Ga0587102_015472_281_640 119
2262 3300059650 Ga0587104_007994 Ga0587104_007994_208_567 119
2263 3300059652 Ga0587107_021137 Ga0587107_021137_477_836 119
2264 3300059652 Ga0587107_096566 Ga0587107_096566_68_427 119
2265 3300059653 Ga0587108_007298 Ga0587108_007298_486_845 119
2266 3300059653 Ga0587108_008497 Ga0587108_008497_21_380 119
2267 3300059656 Ga0587116_03086 Ga0587116_03086_41_400 119
2268 3300059657 Ga0587118_04248 Ga0587118_04248_601_960 119
2269 3300059658 Ga0587119_049573 Ga0587119_049573_176_535 119
2270 3300059659 Ga0587120_020883 Ga0587120_020883_229_588 119
2271 3300059660 Ga0587124_020728 Ga0587124_020728_271_630 119
2272 3300060346 Ga0587111_0021366 Ga0587111_0021366_38_397 119
2273 3300060346 Ga0587111_0081390 Ga0587111_0081390_351_710 119
2274 3300060353 Ga0501082_0011534 Ga0501082_0011534_130_489 119
2275 3300060353 Ga0501082_0100692 Ga0501082_0100692_2094_2456 119
2276 3300060353 Ga0501082_0140665 Ga0501082_0140665_703_1062 119
2277 3300060353 Ga0501082_0148439 Ga0501082_0148439_157_519 119
2278 3300060353 Ga0501082_0509872 Ga0501082_0509872_617_979 119
2279 3300060353 Ga0501082_1203942 Ga0501082_1203942_22_381 119
2280 3300061719 Ga0466962_0002750 Ga0466962_0002750_4819_5178 119
2281 3300061719 Ga0466962_0019452 Ga0466962_0019452_1124_1483 119
2282 3300061734 Ga0530510_0336416 Ga0530510_0336416_625_987 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.903 61 117
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.8936 14 118
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.8846 14 114
7of7-assembly1.cif.gz_R structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1). 0.8841 5 117
6xyw-assembly1.cif.gz_Aq structure of the plant mitochondrial ribosome 0.8839 13 116
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9589 53 119 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9185 53 119 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.916 58 118 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.903 61 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8492 61 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A2D8YKH1-F1-model_v4 deleted 1.008 58 118
AF-A0A2N8FNS0-F1-model_v4 deleted 1.005 55 116
AF-A0A432PU90-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.001 56 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6EM08-F1-model_v4 deleted 0.9967 57 119
AF-A0A7G2DR74-F1-model_v4 Large ribosomal subunit protein bL20c (50S ribosomal protein L20, chloroplastic) 0.9917 58 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
85.37 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map