F496564

General Info

Members Datasets Scaffolds Average Seq Length
2224 709 2188 240

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0004067|Ga0395899_0004067_7021_7968
Length 292
Sequence VQAGGRQALDVLDARFGHFVQSLIVIPTFYWPFRLKFYLTPPQFQISFEDIMQGTTLQGKTALVTGSTSGIGLGIARKFAAQGANIVFNGFGDLKEIEALQADVKEEFKVQTAYHNADMSKPAEIEAMMHFAAERFGGVDVLVNNAGIQYVANIEDFPVEKWDAIIAINLSSTFHTTRLALPSMKAKNWGRIINIASVHGLVGSAQKSAYTCNAICPGWVLTPLVQKQVDARSAEQGISNEAAKKSLLSEKQPSGEFVTPEQLGELAVFLSSDAASQVRGVAWNMDGGWVAQ

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231023 Pseudomonas sp. GM80 Isolate Nodule
4 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
5 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
6 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
7 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221645 Massilia sp. Root351 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2643221684 Massilia sp. Root133 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2765235841 Pseudomonas putida AA7 Isolate Unclassified
18 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
19 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
20 2831864461 Roseateles noduli HZ7 Isolate Nodule
21 2842711865 Duganella sp. R-73148 Isolate Unclassified
22 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
23 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
24 2857553236 Duganella sp. R-74557 Isolate Unclassified
25 2857558681 Duganella sp. R-74565 Isolate Unclassified
26 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
27 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
28 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
29 2937967321 Serratia sp. YC16 Isolate Unclassified
30 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
31 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
32 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
33 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
34 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
35 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
36 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
39 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
40 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
41 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
42 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
58 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
59 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
60 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
61 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
62 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
63 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
64 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
79 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
82 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
83 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
91 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
92 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
93 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
94 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
95 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
96 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
97 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
98 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
103 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
104 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
105 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
106 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
107 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
108 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
109 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
110 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
111 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
112 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
113 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
114 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
115 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
116 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
117 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
118 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
119 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
120 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
121 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
122 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
123 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
126 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
127 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
128 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
129 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
130 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
134 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
147 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
148 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
155 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
156 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
160 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
161 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
162 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
163 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
164 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
165 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
166 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
167 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
168 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
169 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
171 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
176 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
179 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
180 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
182 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
183 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
186 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
198 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
202 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
203 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
204 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
205 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
206 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
207 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
208 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
209 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
210 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
211 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
212 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
213 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
214 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
215 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
216 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
217 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
218 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
219 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
220 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
221 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
222 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
225 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
226 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
227 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
228 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
229 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
230 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
231 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
237 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
239 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
240 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
241 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
244 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
245 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
246 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
253 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
255 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
326 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
332 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
336 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
340 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
341 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
342 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
343 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
344 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
345 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
346 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
347 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
348 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
349 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
350 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
351 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
352 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
353 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
354 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
355 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
356 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
357 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
358 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
359 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
360 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
361 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
362 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
363 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
364 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
365 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
366 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
367 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
368 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
369 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
370 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
371 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
372 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
373 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
374 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
375 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
376 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
377 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
378 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
379 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
380 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
381 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
382 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
383 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
384 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
385 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
386 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
387 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
388 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
389 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
390 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
391 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
392 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
393 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
394 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
395 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
396 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
397 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
398 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
399 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
400 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
401 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
402 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
403 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
404 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
405 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
406 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
407 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
408 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
409 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
410 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
411 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
412 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
413 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
414 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
415 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
416 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
419 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
420 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
421 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
422 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
423 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
424 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
425 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
426 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
427 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
428 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
429 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
430 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
431 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
432 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
433 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
434 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
435 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
436 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
437 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
438 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
439 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
440 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
441 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
442 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
443 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
444 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
445 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
446 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
447 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
448 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
449 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
450 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
451 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
452 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
453 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
454 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
455 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
456 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
457 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
458 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
459 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
460 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
461 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
462 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
463 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
464 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
465 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
466 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
467 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
468 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
469 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
470 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
471 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
472 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
473 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
474 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
475 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
476 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
477 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
478 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
479 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
480 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
481 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
482 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
483 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
484 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
485 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
486 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
487 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
488 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
489 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
490 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
491 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
492 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
493 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
494 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
495 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
496 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
497 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
498 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
499 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
500 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
501 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
502 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
503 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
504 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
505 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
506 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
507 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
508 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
509 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
510 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
511 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
512 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
513 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
514 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
515 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
516 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
517 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
518 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
519 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
520 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
521 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
522 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
523 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
524 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
525 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
526 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
527 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
528 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
529 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
530 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
531 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
532 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
533 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
534 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
535 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
536 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
537 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
538 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
539 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
540 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
541 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
542 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
543 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
544 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
545 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
546 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
547 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
548 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
549 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
550 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
551 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
552 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
553 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
554 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
555 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
556 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
557 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
558 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
559 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
560 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
561 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
562 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
563 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
564 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
565 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
566 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
567 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
568 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
569 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
570 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
571 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
572 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
573 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
574 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
575 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
576 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
577 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
578 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
579 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
580 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
581 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
582 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
583 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
584 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
585 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
586 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
587 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
588 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
589 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
590 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
591 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
592 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
593 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
594 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
595 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
596 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
597 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
598 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
599 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
600 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
601 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
602 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
603 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
605 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
608 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
609 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
610 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
611 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
612 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
613 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
617 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
618 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
619 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
620 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
621 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
622 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
623 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
624 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
625 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
626 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
627 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
628 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
629 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
630 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
631 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
632 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
633 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
634 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
635 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
636 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
637 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
638 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
640 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
641 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
642 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
643 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
644 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
645 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
646 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
647 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
648 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
649 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
650 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
651 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
652 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
653 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
654 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
655 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
656 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
657 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
658 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
659 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
660 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
661 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
662 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
663 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
664 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
665 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
666 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
667 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
668 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
669 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
670 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
671 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
672 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
673 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
674 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
675 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
676 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
677 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
678 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
679 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
680 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
681 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
682 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
683 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
684 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
685 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
703 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
704 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
705 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
706 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
707 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
708 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
709 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 1.48
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.98
Nodule 0.58
Rhizoplane 3.82
Rhizosphere 81.29
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800748 2209111006 Bacteria 11445
2 ARcpr5oldR_c000003 3300000041 Bacteria 66110
3 ARSoilYngRDRAFT_c00054 3300000042 Bacteria 18568
4 ARcpr5yngRDRAFT_c000010 3300000043 Bacteria 36497
5 JGI24741J21665_1000265 3300001915 Bacteria 15670
6 JGI24741J21665_1000994 3300001915 Bacteria 8515
7 JGI24740J21852_10003031 3300001979 Bacteria 7435
8 JGI24740J21852_10005716 3300001979 Bacteria 5231
9 JGI24033J26618_1014554 3300002155 Bacteria 964
10 JGI24742J22300_10000147 3300002244 Bacteria 10477
11 JGI25155J39150_1000081 3300002704 Bacteria 55520
12 JGI25156J39149_1000025 3300002705 Bacteria 136287
13 JGI25162J39368_1000013 3300002737 Bacteria 343384
14 JGI25154J39366_1000045 3300002738 Bacteria 136302
15 JGI25154J39366_1001938 3300002738 Bacteria 6168
16 JGI25157J39369_1000034 3300002741 Bacteria 136301
17 JGI25164J39214_1000005 3300002772 Bacteria 343384
18 JGI25152J39213_1001685 3300002773 Bacteria 9118
19 JGI25152J39213_1019759 3300002773 Bacteria 1218
20 JGI25150J39212_1006454 3300002774 Bacteria 2418
21 JGI25150J39212_1009891 3300002774 Bacteria 1796
22 JGI25150J39212_1020840 3300002774 Bacteria 1005
23 JGI25150J39212_1022009 3300002774 Bacteria 963
24 JGI25159J45721_1000455 3300002987 Bacteria 18924
25 JGI25159J45721_1001179 3300002987 Bacteria 11162
26 JGI25159J45721_1002024 3300002987 Bacteria 8022
27 Ga0006759J45824_1078836 3300003163 Bacteria 862
28 JGI25151J46595_10006470 3300003187 Bacteria 5889
29 JGI25151J46595_10006687 3300003187 Bacteria 5750
30 JGI25151J46595_10007991 3300003187 Bacteria 5129
31 JGI25151J46595_10008852 3300003187 Bacteria 4811
32 JGI25151J46595_10015587 3300003187 Bacteria 3344
33 JGI25406J46586_10019639 3300003203 Bacteria 2748
34 JGI25165J46597_1000340 3300003214 Bacteria 54174
35 JGI25153J46596_10001268 3300003215 Bacteria 15174
36 JGI25153J46596_10002290 3300003215 Bacteria 11152
37 rootH2_10121193 3300003320 Bacteria 6167
38 rootL2_10070738 3300003322 Bacteria 1590
39 JGI25160J50197_1000148 3300003354 Bacteria 61871
40 JGI25160J50197_1000822 3300003354 Bacteria 16614
41 JGI25161J50226_1000111 3300003374 Bacteria 63577
42 Ga0007417J51691_1054294 3300003544 Bacteria 1413
43 Ga0007409J51694_1014306 3300003575 Bacteria 954
44 Ga0007409J51694_1033908 3300003575 Bacteria 1602
45 Ga0007416J51690_1023694 3300003577 Bacteria 876
46 Ga0055538_1002773 3300003751 Bacteria 2426
47 Ga0055538_1002791 3300003751 Bacteria 2415
48 Ga0055539_1000061 3300003752 Bacteria 144457
49 Ga0055533_1004572 3300003756 Bacteria 2449
50 Ga0055533_1004642 3300003756 Bacteria 2410
51 Ga0055525_1000001 3300003759 Bacteria 1016948
52 Ga0055525_1000476 3300003759 Bacteria 21836
53 Ga0055529_1000032 3300003763 Bacteria 255895
54 Ga0055526_1001143 3300003771 Bacteria 19215
55 Ga0055526_1001576 3300003771 Bacteria 16041
56 Ga0055526_1002527 3300003771 Bacteria 12293
57 Ga0055526_1008734 3300003771 Bacteria 4997
58 Ga0055526_1009022 3300003771 Bacteria 4874
59 Ga0055526_1016432 3300003771 Bacteria 2897
60 Ga0055537_1000030 3300003773 Bacteria 100491
61 Ga0055537_1000298 3300003773 Bacteria 34638
62 Ga0055537_1012082 3300003773 Bacteria 1706
63 Ga0055524_1000075 3300003775 Bacteria 121897
64 Ga0055524_1000170 3300003775 Bacteria 74352
65 Ga0055534_1000435 3300003784 Bacteria 24764
66 Ga0055534_1000447 3300003784 Bacteria 24217
67 Ga0055534_1023163 3300003784 Bacteria 1020
68 Ga0055528_1000439 3300003790 Bacteria 33348
69 Ga0055528_1002608 3300003790 Bacteria 9545
70 Ga0055528_1004007 3300003790 Bacteria 7203
71 Ga0055528_1044311 3300003790 Bacteria 959
72 Ga0055530_10000002 3300003791 Bacteria 300466
73 Ga0055530_10000686 3300003791 Bacteria 28715
74 Ga0055530_10001733 3300003791 Bacteria 15314
75 Ga0055540_1000009 3300003792 Bacteria 300466
76 Ga0055540_1000033 3300003792 Bacteria 172048
77 Ga0055540_1000075 3300003792 Bacteria 115267
78 Ga0055540_1002443 3300003792 Bacteria 9800
79 Ga0055531_10002027 3300003794 Bacteria 14010
80 Ga0055531_10027976 3300003794 Bacteria 1958
81 Ga0055541_1004816 3300003841 Bacteria 2415
82 Ga0055541_1004829 3300003841 Bacteria 2411
83 JGI25405J52794_10020155 3300003911 Bacteria 1341
84 Ga0055543_1000302 3300004625 Bacteria 34707
85 Ga0055543_1000800 3300004625 Bacteria 15560
86 Ga0055543_1006492 3300004625 Bacteria 2819
87 Ga0065165_1000074 3300005262 Bacteria 164454
88 Ga0065165_1000353 3300005262 Bacteria 75343
89 Ga0065165_1001978 3300005262 Bacteria 19342
90 Ga0065165_1002157 3300005262 Bacteria 17805
91 Ga0065717_1002780 3300005276 Bacteria 1627
92 Ga0065716_1001725 3300005277 Bacteria 3793
93 Ga0065714_10005231 3300005288 Bacteria 4106
94 Ga0065714_10026580 3300005288 Bacteria 1652
95 Ga0065714_10066301 3300005288 Bacteria 7160
96 Ga0065704_10009900 3300005289 Bacteria 2858
97 Ga0065704_10070326 3300005289 Bacteria 32542
98 Ga0065704_10081449 3300005289 Bacteria 3760
99 Ga0065704_10121414 3300005289 Bacteria 1767
100 Ga0065704_10197466 3300005289 Bacteria 1161
101 Ga0065712_10003115 3300005290 Bacteria 4404
102 Ga0065715_10279258 3300005293 Bacteria 1091
103 Ga0065707_10202545 3300005295 Bacteria 1304
104 Ga0070658_10014794 3300005327 Bacteria 6253
105 Ga0070658_10047762 3300005327 Bacteria 3464
106 Ga0070658_10055268 3300005327 Bacteria 3225
107 Ga0070658_10186708 3300005327 Bacteria 1746
108 Ga0070676_10025909 3300005328 Bacteria 3318
109 Ga0070676_10042658 3300005328 Bacteria 2635
110 Ga0070676_10053861 3300005328 Bacteria 2370
111 Ga0070676_10054436 3300005328 Bacteria 2359
112 Ga0070683_100853465 3300005329 Bacteria 873
113 Ga0070690_100099721 3300005330 Bacteria 1924
114 Ga0070690_100176246 3300005330 Bacteria 1475
115 Ga0070690_100372565 3300005330 Bacteria 1042
116 Ga0070670_100044711 3300005331 Bacteria 3807
117 Ga0070670_100198719 3300005331 Bacteria 1742
118 Ga0070670_100280929 3300005331 Bacteria 1454
119 Ga0070677_10002393 3300005333 Bacteria 5985
120 Ga0070677_10034345 3300005333 Bacteria 1958
121 Ga0068869_100270250 3300005334 Bacteria 1364
122 Ga0068869_100368921 3300005334 Bacteria 1174
123 Ga0070666_10046516 3300005335 Bacteria 2911
124 Ga0070666_10155149 3300005335 Bacteria 1599
125 Ga0070680_100021745 3300005336 Bacteria 5101
126 Ga0070680_100030117 3300005336 Bacteria 4359
127 Ga0070680_100093912 3300005336 Bacteria 2486
128 Ga0070680_100331765 3300005336 Bacteria 1292
129 Ga0070682_100091191 3300005337 Bacteria 1994
130 Ga0070682_100106270 3300005337 Bacteria 1862
131 Ga0068868_100027651 3300005338 Bacteria 4327
132 Ga0068868_100038720 3300005338 Bacteria 3701
133 Ga0068868_100106367 3300005338 Bacteria 2276
134 Ga0068868_100214275 3300005338 Bacteria 1610
135 Ga0068868_100251098 3300005338 Bacteria 1489
136 Ga0070660_100001988 3300005339 Bacteria 14107
137 Ga0070660_100004866 3300005339 Bacteria 9279
138 Ga0070660_100139684 3300005339 Bacteria 1943
139 Ga0070660_100177797 3300005339 Bacteria 1721
140 Ga0070660_100275337 3300005339 Bacteria 1376
141 Ga0070660_100286637 3300005339 Bacteria 1348
142 Ga0070689_100003835 3300005340 Bacteria 10072
143 Ga0070689_100020557 3300005340 Bacteria 4900
144 Ga0070689_100026373 3300005340 Bacteria 4374
145 Ga0070689_100026579 3300005340 Bacteria 4358
146 Ga0070691_10017626 3300005341 Bacteria 3286
147 Ga0070661_100000624 3300005344 Bacteria 26327
148 Ga0070661_100005953 3300005344 Bacteria 8398
149 Ga0070661_100006933 3300005344 Bacteria 7821
150 Ga0070661_100107095 3300005344 Bacteria 2084
151 Ga0070661_100133693 3300005344 Bacteria 1865
152 Ga0070661_100178363 3300005344 Bacteria 1615
153 Ga0070692_10011086 3300005345 Bacteria 4128
154 Ga0070668_100056117 3300005347 Bacteria 3041
155 Ga0070668_100080141 3300005347 Bacteria 2557
156 Ga0070668_100461031 3300005347 Bacteria 1094
157 Ga0070669_100042039 3300005353 Bacteria 3325
158 Ga0070669_100077956 3300005353 Bacteria 2462
159 Ga0070669_100288109 3300005353 Bacteria 1318
160 Ga0070675_100013767 3300005354 Bacteria 6366
161 Ga0070675_100157979 3300005354 Bacteria 1948
162 Ga0070675_100246097 3300005354 Bacteria 1563
163 Ga0070675_100514329 3300005354 Bacteria 1080
164 Ga0070671_100008194 3300005355 Bacteria 8362
165 Ga0070671_100016365 3300005355 Bacteria 5997
166 Ga0070671_100100668 3300005355 Bacteria 2424
167 Ga0070674_100010285 3300005356 Bacteria 5648
168 Ga0070674_100048653 3300005356 Bacteria 2911
169 Ga0070674_100054368 3300005356 Bacteria 2769
170 Ga0070674_100055286 3300005356 Bacteria 2748
171 Ga0070673_100028843 3300005364 Bacteria 4132
172 Ga0070673_100164752 3300005364 Bacteria 1888
173 Ga0070673_100177013 3300005364 Bacteria 1824
174 Ga0070673_100252166 3300005364 Bacteria 1539
175 Ga0070688_100014520 3300005365 Bacteria 4464
176 Ga0070688_100068513 3300005365 Bacteria 2263
177 Ga0070659_100000423 3300005366 Bacteria 32124
178 Ga0070659_100000531 3300005366 Bacteria 27861
179 Ga0070659_100006995 3300005366 Bacteria 8167
180 Ga0070659_100141182 3300005366 Bacteria 1961
181 Ga0070659_100185913 3300005366 Bacteria 1706
182 Ga0070659_100288550 3300005366 Bacteria 1366
183 Ga0070667_100019267 3300005367 Bacteria 5660
184 Ga0070667_100030638 3300005367 Bacteria 4486
185 Ga0070667_100085711 3300005367 Bacteria 2702
186 Ga0070703_10060740 3300005406 Bacteria 1236
187 Ga0070709_10011796 3300005434 Bacteria 4880
188 Ga0070709_10028349 3300005434 Bacteria 3338
189 Ga0070714_100131593 3300005435 Bacteria 2236
190 Ga0070714_100170833 3300005435 Bacteria 1973
191 Ga0070713_100008297 3300005436 Bacteria 7366
192 Ga0070713_100116534 3300005436 Bacteria 2336
193 Ga0070713_100393114 3300005436 Bacteria 1294
194 Ga0070710_10010139 3300005437 Bacteria 4624
195 Ga0070710_10041036 3300005437 Bacteria 2552
196 Ga0070710_10070868 3300005437 Bacteria 2009
197 Ga0070711_100242260 3300005439 Bacteria 1410
198 Ga0070705_100009809 3300005440 Bacteria 4774
199 Ga0070700_100015139 3300005441 Bacteria 4367
200 Ga0070700_100028708 3300005441 Bacteria 3312
201 Ga0070700_100139615 3300005441 Bacteria 1645
202 Ga0070700_100417999 3300005441 Bacteria 1012
203 Ga0070694_100018727 3300005444 Bacteria 4398
204 Ga0070694_100397622 3300005444 Bacteria 1078
205 Ga0070708_100026294 3300005445 Bacteria 4980
206 Ga0070663_100000044 3300005455 Bacteria 57555
207 Ga0070663_100060571 3300005455 Bacteria 2723
208 Ga0070663_100102768 3300005455 Bacteria 2135
209 Ga0070678_100007922 3300005456 Bacteria 6326
210 Ga0070678_100010108 3300005456 Bacteria 5746
211 Ga0070678_100041159 3300005456 Bacteria 3274
212 Ga0070678_100050825 3300005456 Bacteria 3001
213 Ga0070678_100066274 3300005456 Bacteria 2684
214 Ga0070678_100310077 3300005456 Bacteria 1344
215 Ga0070678_100635698 3300005456 Bacteria 956
216 Ga0070662_100012131 3300005457 Bacteria 5704
217 Ga0070662_100052386 3300005457 Bacteria 2950
218 Ga0070662_100069143 3300005457 Bacteria 2598
219 Ga0070662_100102629 3300005457 Bacteria 2167
220 Ga0070662_100169704 3300005457 Bacteria 1713
221 Ga0070662_100249178 3300005457 Bacteria 1427
222 Ga0070662_100556416 3300005457 Bacteria 962
223 Ga0070681_10033541 3300005458 Bacteria 5153
224 Ga0070681_10052279 3300005458 Bacteria 4074
225 Ga0070681_10092649 3300005458 Bacteria 2970
226 Ga0068867_100018802 3300005459 Bacteria 4915
227 Ga0068867_100020084 3300005459 Bacteria 4760
228 Ga0068867_100065028 3300005459 Bacteria 2713
229 Ga0068867_100092166 3300005459 Bacteria 2301
230 Ga0068867_100119465 3300005459 Bacteria 2035
231 Ga0068867_100188902 3300005459 Bacteria 1643
232 Ga0068867_100213073 3300005459 Bacteria 1552
233 Ga0070685_10128376 3300005466 Bacteria 1583
234 Ga0070706_100022574 3300005467 Bacteria 5794
235 Ga0070706_100321936 3300005467 Bacteria 1442
236 Ga0074259_10615634 3300005507 Bacteria 1366
237 Ga0070679_100002865 3300005530 Bacteria 15676
238 Ga0070679_100040307 3300005530 Bacteria 4647
239 Ga0070679_100041628 3300005530 Bacteria 4572
240 Ga0070679_100078643 3300005530 Bacteria 3287
241 Ga0070679_100154367 3300005530 Bacteria 2271
242 Ga0070679_100530478 3300005530 Bacteria 1121
243 Ga0070684_100143246 3300005535 Bacteria 2162
244 Ga0070684_100165181 3300005535 Bacteria 2009
245 Ga0070684_100205387 3300005535 Bacteria 1795
246 Ga0070684_100358857 3300005535 Bacteria 1341
247 Ga0070697_100016119 3300005536 Bacteria 5876
248 Ga0068853_100008627 3300005539 Bacteria 8195
249 Ga0068853_100104022 3300005539 Bacteria 2513
250 Ga0068853_100555844 3300005539 Bacteria 1088
251 Ga0068853_100620630 3300005539 Bacteria 1028
252 Ga0070672_100006518 3300005543 Bacteria 7847
253 Ga0070672_100046560 3300005543 Bacteria 3361
254 Ga0070672_100127143 3300005543 Bacteria 2091
255 Ga0070672_100142571 3300005543 Bacteria 1977
256 Ga0070672_100165762 3300005543 Bacteria 1835
257 Ga0070672_100282153 3300005543 Bacteria 1404
258 Ga0070686_100019116 3300005544 Bacteria 4032
259 Ga0070686_100045240 3300005544 Bacteria 2772
260 Ga0070686_100264138 3300005544 Bacteria 1263
261 Ga0070693_100009520 3300005547 Bacteria 4832
262 Ga0070665_100041433 3300005548 Bacteria 4629
263 Ga0070665_100070398 3300005548 Bacteria 3505
264 Ga0070665_100221446 3300005548 Bacteria 1893
265 Ga0070665_100229135 3300005548 Bacteria 1858
266 Ga0070704_100041239 3300005549 Bacteria 3184
267 Ga0070704_100229625 3300005549 Bacteria 1513
268 Ga0068855_100175073 3300005563 Bacteria 2428
269 Ga0068855_100197021 3300005563 Bacteria 2269
270 Ga0068855_100365245 3300005563 Bacteria 1588
271 Ga0070664_100000092 3300005564 Bacteria 57555
272 Ga0070664_100008307 3300005564 Bacteria 8399
273 Ga0070664_100074450 3300005564 Bacteria 2915
274 Ga0070664_100088727 3300005564 Bacteria 2674
275 Ga0070664_100164025 3300005564 Bacteria 1968
276 Ga0070664_100184073 3300005564 Bacteria 1858
277 Ga0070664_100187150 3300005564 Bacteria 1843
278 Ga0068857_100278690 3300005577 Bacteria 1537
279 Ga0068857_100332729 3300005577 Bacteria 1404
280 Ga0068854_100238748 3300005578 Bacteria 1446
281 Ga0068854_100436918 3300005578 Bacteria 1090
282 Ga0068856_100000261 3300005614 Bacteria 57555
283 Ga0068856_100141992 3300005614 Bacteria 2409
284 Ga0068856_100188219 3300005614 Bacteria 2078
285 Ga0068856_100272944 3300005614 Bacteria 1707
286 Ga0068856_100417402 3300005614 Bacteria 1362
287 Ga0068856_100522621 3300005614 Bacteria 1208
288 Ga0068856_101116682 3300005614 Bacteria 806
289 Ga0070702_100020508 3300005615 Bacteria 3464
290 Ga0068852_100003198 3300005616 Bacteria 11433
291 Ga0068852_100003539 3300005616 Bacteria 10932
292 Ga0068852_100024103 3300005616 Bacteria 4912
293 Ga0068852_100113441 3300005616 Bacteria 2468
294 Ga0068859_100206986 3300005617 Bacteria 2047
295 Ga0068859_100395889 3300005617 Bacteria 1477
296 Ga0068859_100528320 3300005617 Bacteria 1274
297 Ga0068859_100628150 3300005617 Bacteria 1167
298 Ga0068864_100012176 3300005618 Bacteria 7110
299 Ga0068864_100558177 3300005618 Bacteria 1108
300 Ga0068861_100782196 3300005719 Bacteria 894
301 Ga0068851_10000276 3300005834 Bacteria 23755
302 Ga0068851_10159555 3300005834 Bacteria 1238
303 Ga0068851_10201091 3300005834 Bacteria 1112
304 Ga0068870_10232605 3300005840 Bacteria 1134
305 Ga0068863_100262875 3300005841 Bacteria 1669
306 Ga0068863_100276304 3300005841 Bacteria 1627
307 Ga0068858_100548543 3300005842 Bacteria 1119
308 Ga0068860_100024489 3300005843 Bacteria 5830
309 Ga0068860_100043622 3300005843 Bacteria 4277
310 Ga0068862_100010910 3300005844 Bacteria 7503
311 Ga0068862_100025429 3300005844 Bacteria 4971
312 Ga0068862_100043128 3300005844 Bacteria 3845
313 Ga0068862_100219319 3300005844 Bacteria 1721
314 Ga0081455_10000002 3300005937 Bacteria 460472
315 Ga0081455_10012343 3300005937 Bacteria 8525
316 Ga0081455_10015908 3300005937 Bacteria 7282
317 Ga0081455_10067938 3300005937 Bacteria 2968
318 Ga0081455_10253535 3300005937 Bacteria 1286
319 Ga0081538_10003299 3300005981 Bacteria 15312
320 Ga0081539_10000522 3300005985 Bacteria 79973
321 Ga0070717_10007418 3300006028 Bacteria 8144
322 Ga0070717_10041629 3300006028 Bacteria 3745
323 Ga0070717_10326816 3300006028 Bacteria 1367
324 Ga0075365_10098830 3300006038 Bacteria 1997
325 Ga0075365_10220884 3300006038 Bacteria 1329
326 Ga0075363_100061194 3300006048 Bacteria 2028
327 Ga0075363_100066233 3300006048 Bacteria 1954
328 Ga0075363_100076923 3300006048 Bacteria 1820
329 Ga0075363_100248562 3300006048 Bacteria 1024
330 Ga0075363_100332237 3300006048 Bacteria 885
331 Ga0075364_10012857 3300006051 Bacteria 5134
332 Ga0075364_10330467 3300006051 Bacteria 1038
333 Ga0075432_10000446 3300006058 Bacteria 12162
334 Ga0075432_10001993 3300006058 Bacteria 6780
335 Ga0075432_10055704 3300006058 Bacteria 1401
336 Ga0070715_10007918 3300006163 Bacteria 3679
337 Ga0070715_10047114 3300006163 Bacteria 1836
338 Ga0070716_100029877 3300006173 Bacteria 2951
339 Ga0070716_100105929 3300006173 Bacteria 1733
340 Ga0070716_100356820 3300006173 Bacteria 1037
341 Ga0070712_100191062 3300006175 Bacteria 1602
342 Ga0075362_10014708 3300006177 Bacteria 3165
343 Ga0075362_10022454 3300006177 Bacteria 2659
344 Ga0075362_10032384 3300006177 Bacteria 2268
345 Ga0075362_10049624 3300006177 Bacteria 1875
346 Ga0075367_10022990 3300006178 Bacteria 3503
347 Ga0075367_10043958 3300006178 Bacteria 2617
348 Ga0075367_10137610 3300006178 Bacteria 1511
349 Ga0075369_10099080 3300006186 Bacteria 1306
350 Ga0075427_10000343 3300006194 Bacteria 5121
351 Ga0075366_10000110 3300006195 Bacteria 33557
352 Ga0075366_10007688 3300006195 Bacteria 5968
353 Ga0075366_10007707 3300006195 Bacteria 5963
354 Ga0075366_10009030 3300006195 Bacteria 5559
355 Ga0075366_10009936 3300006195 Bacteria 5327
356 Ga0075366_10021717 3300006195 Bacteria 3732
357 Ga0075366_10040401 3300006195 Bacteria 2759
358 Ga0075366_10084874 3300006195 Bacteria 1893
359 Ga0075366_10152756 3300006195 Bacteria 1398
360 Ga0075366_10278140 3300006195 Bacteria 1023
361 Ga0097621_100021189 3300006237 Bacteria 5022
362 Ga0097621_100065168 3300006237 Bacteria 2997
363 Ga0097621_100090559 3300006237 Bacteria 2560
364 Ga0075370_10001090 3300006353 Bacteria 11315
365 Ga0075370_10013814 3300006353 Bacteria 4296
366 Ga0075370_10110133 3300006353 Bacteria 1599
367 Ga0075370_10267458 3300006353 Bacteria 1014
368 Ga0068871_100016055 3300006358 Bacteria 5627
369 Ga0068871_100027763 3300006358 Bacteria 4430
370 Ga0068871_100037738 3300006358 Bacteria 3855
371 Ga0068871_100078521 3300006358 Bacteria 2729
372 Ga0068871_100259175 3300006358 Bacteria 1516
373 Ga0075428_100013017 3300006844 Bacteria 9247
374 Ga0075430_100001551 3300006846 Bacteria 18790
375 Ga0075430_100083272 3300006846 Bacteria 2680
376 Ga0075431_100003715 3300006847 Bacteria 14830
377 Ga0075431_100016231 3300006847 Bacteria 7555
378 Ga0075431_100086702 3300006847 Bacteria 3231
379 Ga0075431_100342722 3300006847 Bacteria 1504
380 Ga0075433_10000008 3300006852 Bacteria 75573
381 Ga0075433_10100116 3300006852 Bacteria 2566
382 Ga0075433_10351308 3300006852 Bacteria 1303
383 Ga0075434_100000229 3300006871 Bacteria 38516
384 Ga0075434_100018903 3300006871 Bacteria 6660
385 Ga0075434_100174769 3300006871 Bacteria 2167
386 Ga0075434_100261710 3300006871 Bacteria 1749
387 Ga0075429_100004392 3300006880 Bacteria 12110
388 Ga0068865_100003447 3300006881 Bacteria 9469
389 Ga0068865_100028103 3300006881 Bacteria 3722
390 Ga0068865_100090160 3300006881 Bacteria 2222
391 Ga0068865_100095703 3300006881 Bacteria 2164
392 Ga0068865_100097909 3300006881 Bacteria 2142
393 Ga0075436_100054223 3300006914 Bacteria 2767
394 Ga0075436_100057329 3300006914 Bacteria 2690
395 Ga0075436_100125520 3300006914 Bacteria 1798
396 Ga0075436_100457376 3300006914 Bacteria 930
397 Ga0097620_100206984 3300006931 Bacteria 2047
398 Ga0097620_100395884 3300006931 Bacteria 1477
399 Ga0097620_100528341 3300006931 Bacteria 1274
400 Ga0097620_100628117 3300006931 Bacteria 1167
401 Ga0079104_1000004 3300006946 Bacteria 444549
402 Ga0079104_1000071 3300006946 Bacteria 153790
403 Ga0079104_1000081 3300006946 Bacteria 140632
404 Ga0079104_1007679 3300006946 Bacteria 3866
405 Ga0075435_100013904 3300007076 Bacteria 6003
406 Ga0075435_100028161 3300007076 Bacteria 4404
407 Ga0075435_100048535 3300007076 Bacteria 3411
408 Ga0099795_10159171 3300007788 Bacteria 931
409 Ga0105251_10017691 3300009011 Bacteria 3811
410 Ga0105244_10031525 3300009036 Bacteria 2813
411 Ga0105244_10048089 3300009036 Bacteria 2184
412 Ga0105244_10162957 3300009036 Bacteria 1064
413 Ga0105250_10066258 3300009092 Bacteria 1456
414 Ga0105240_10007989 3300009093 Bacteria 15247
415 Ga0105240_10099553 3300009093 Bacteria 3538
416 Ga0105240_10128353 3300009093 Bacteria 3044
417 Ga0105240_10178653 3300009093 Bacteria 2507
418 Ga0111539_10000168 3300009094 Bacteria 75710
419 Ga0111539_10001645 3300009094 Bacteria 29839
420 Ga0111539_10024634 3300009094 Bacteria 7381
421 Ga0111539_10029199 3300009094 Bacteria 6722
422 Ga0111539_10121681 3300009094 Bacteria 3058
423 Ga0111539_10306870 3300009094 Bacteria 1847
424 Ga0111539_10364634 3300009094 Bacteria 1682
425 Ga0111539_10629137 3300009094 Bacteria 1250
426 Ga0105245_10032163 3300009098 Bacteria 4644
427 Ga0105245_10056186 3300009098 Bacteria 3537
428 Ga0105245_10425925 3300009098 Bacteria 1331
429 Ga0114129_10004941 3300009147 Bacteria 18800
430 Ga0114129_10042906 3300009147 Bacteria 6366
431 Ga0114129_10256201 3300009147 Bacteria 2347
432 Ga0114129_10359962 3300009147 Bacteria 1925
433 Ga0105243_10000261 3300009148 Bacteria 59514
434 Ga0105243_10017831 3300009148 Bacteria 5370
435 Ga0105243_10022908 3300009148 Bacteria 4748
436 Ga0105243_10052752 3300009148 Bacteria 3222
437 Ga0105243_10068459 3300009148 Bacteria 2861
438 Ga0105243_10134231 3300009148 Bacteria 2104
439 Ga0105243_10158739 3300009148 Bacteria 1948
440 Ga0105241_10030703 3300009174 Bacteria 4018
441 Ga0105241_10059379 3300009174 Bacteria 2940
442 Ga0105241_10068016 3300009174 Bacteria 2758
443 Ga0105241_10206588 3300009174 Bacteria 1643
444 Ga0105242_10065352 3300009176 Bacteria 3001
445 Ga0105242_10107654 3300009176 Bacteria 2371
446 Ga0105242_10211936 3300009176 Bacteria 1727
447 Ga0105242_10254947 3300009176 Bacteria 1582
448 Ga0105242_10455504 3300009176 Bacteria 1207
449 Ga0105248_10038008 3300009177 Bacteria 5385
450 Ga0105248_10208876 3300009177 Bacteria 2200
451 Ga0105248_10327954 3300009177 Bacteria 1724
452 Ga0105248_10555603 3300009177 Bacteria 1295
453 Ga0105248_10693831 3300009177 Bacteria 1149
454 Ga0105237_10015908 3300009545 Bacteria 7822
455 Ga0105237_10026592 3300009545 Bacteria 5914
456 Ga0105237_10217261 3300009545 Bacteria 1912
457 Ga0105237_10229392 3300009545 Bacteria 1858
458 Ga0105237_10582208 3300009545 Bacteria 1126
459 Ga0105238_10004063 3300009551 Bacteria 14505
460 Ga0105238_10214090 3300009551 Bacteria 1903
461 Ga0105238_10325051 3300009551 Bacteria 1524
462 Ga0105249_10037246 3300009553 Bacteria 4414
463 Ga0105249_10054631 3300009553 Bacteria 3653
464 Ga0105249_10658702 3300009553 Bacteria 1105
465 Ga0105249_10993488 3300009553 Bacteria 908
466 Ga0099796_10000538 3300010159 Bacteria 6477
467 Ga0105239_10202656 3300010375 Bacteria 2223
468 Ga0105239_10255787 3300010375 Bacteria 1967
469 Ga0105246_10002678 3300011119 Bacteria 10789
470 Ga0105246_10011476 3300011119 Bacteria 5498
471 Ga0105246_10013058 3300011119 Bacteria 5197
472 Ga0157337_1000655 3300012483 Bacteria 1638
473 Ga0157341_1000371 3300012494 Bacteria 2204
474 Ga0157319_1000299 3300012497 Bacteria 2364
475 Ga0157314_1002358 3300012500 Bacteria 1308
476 Ga0157316_1002259 3300012510 Bacteria 1294
477 Ga0157373_10019636 3300013100 Bacteria 4915
478 Ga0157373_10020180 3300013100 Bacteria 4847
479 Ga0157373_10308791 3300013100 Bacteria 1124
480 Ga0157371_10000040 3300013102 Bacteria 207451
481 Ga0157371_10000362 3300013102 Bacteria 57561
482 Ga0157371_10000495 3300013102 Bacteria 47755
483 Ga0157371_10089346 3300013102 Bacteria 2182
484 Ga0157370_10001784 3300013104 Bacteria 26531
485 Ga0157370_10481566 3300013104 Bacteria 1140
486 Ga0157370_10570271 3300013104 Bacteria 1037
487 Ga0157370_10586920 3300013104 Bacteria 1021
488 Ga0157369_10000568 3300013105 Bacteria 48608
489 Ga0157369_10354111 3300013105 Bacteria 1524
490 Ga0157369_10652353 3300013105 Bacteria 1085
491 Ga0157374_10069095 3300013296 Bacteria 3326
492 Ga0157378_10003059 3300013297 Bacteria 14866
493 Ga0157378_10088690 3300013297 Bacteria 2807
494 Ga0157378_10216994 3300013297 Bacteria 1817
495 Ga0157378_10280352 3300013297 Bacteria 1606
496 Ga0163162_10000210 3300013306 Bacteria 54200
497 Ga0163162_10006735 3300013306 Bacteria 11147
498 Ga0163162_10007432 3300013306 Bacteria 10655
499 Ga0163162_10053212 3300013306 Bacteria 4069
500 Ga0163162_10207483 3300013306 Bacteria 2089
501 Ga0163162_10382356 3300013306 Bacteria 1541
502 Ga0163162_10451823 3300013306 Bacteria 1417
503 Ga0163162_10567908 3300013306 Bacteria 1262
504 Ga0163162_10592214 3300013306 Bacteria 1235
505 Ga0157372_10004004 3300013307 Bacteria 15805
506 Ga0157372_10109057 3300013307 Bacteria 3169
507 Ga0157372_10426798 3300013307 Bacteria 1545
508 Ga0157372_10558946 3300013307 Bacteria 1334
509 Ga0157372_10754777 3300013307 Bacteria 1131
510 Ga0157372_10767146 3300013307 Bacteria 1121
511 Ga0157375_10026759 3300013308 Bacteria 5382
512 Ga0157375_10141485 3300013308 Bacteria 2533
513 Ga0157375_10188171 3300013308 Bacteria 2219
514 Ga0157375_10395803 3300013308 Bacteria 1548
515 Ga0157375_10426080 3300013308 Bacteria 1493
516 Ga0163163_10093329 3300014325 Bacteria 3026
517 Ga0163163_10300851 3300014325 Bacteria 1657
518 Ga0163163_10341301 3300014325 Bacteria 1553
519 Ga0163163_10347632 3300014325 Bacteria 1539
520 Ga0157380_10009422 3300014326 Bacteria 6996
521 Ga0182008_10000088 3300014497 Bacteria 70248
522 Ga0182008_10003596 3300014497 Bacteria 9279
523 Ga0182008_10007714 3300014497 Bacteria 5924
524 Ga0182008_10008368 3300014497 Bacteria 5649
525 Ga0182008_10012334 3300014497 Bacteria 4512
526 Ga0182008_10029707 3300014497 Bacteria 2760
527 Ga0182008_10037529 3300014497 Bacteria 2424
528 Ga0157377_10029803 3300014745 Bacteria 2951
529 Ga0157379_10066710 3300014968 Bacteria 3217
530 Ga0157379_10661589 3300014968 Bacteria 978
531 Ga0157376_10001401 3300014969 Bacteria 15849
532 Ga0157376_10023706 3300014969 Bacteria 4808
533 Ga0157376_10079062 3300014969 Bacteria 2818
534 Ga0157376_10121810 3300014969 Bacteria 2313
535 Ga0157376_10155005 3300014969 Bacteria 2070
536 Ga0182006_1000029 3300015261 Bacteria 247579
537 Ga0182006_1012873 3300015261 Bacteria 3650
538 Ga0182006_1014039 3300015261 Bacteria 3458
539 Ga0182006_1017346 3300015261 Bacteria 3061
540 Ga0182006_1025011 3300015261 Bacteria 2457
541 Ga0182007_10000179 3300015262 Bacteria 43076
542 Ga0182007_10004175 3300015262 Bacteria 6617
543 Ga0182007_10008986 3300015262 Bacteria 4068
544 Ga0182005_1000037 3300015265 Bacteria 166102
545 Ga0163161_10045040 3300017792 Bacteria 3180
546 Ga0163161_10088708 3300017792 Bacteria 2286
547 Ga0163161_10108581 3300017792 Bacteria 2072
548 Ga0163161_10204477 3300017792 Bacteria 1523
549 Ga0163161_10212365 3300017792 Bacteria 1495
550 Ga0163161_10419664 3300017792 Bacteria 1076
551 Ga0213872_10000001 3300021361 Bacteria 662532
552 Ga0213872_10000236 3300021361 Bacteria 48593
553 Ga0213872_10000589 3300021361 Bacteria 27939
554 Ga0213872_10001546 3300021361 Bacteria 14745
555 Ga0213872_10004213 3300021361 Bacteria 7718
556 Ga0213872_10007371 3300021361 Bacteria 5420
557 Ga0213872_10008073 3300021361 Bacteria 5115
558 Ga0213872_10009223 3300021361 Bacteria 4741
559 Ga0213872_10014229 3300021361 Bacteria 3716
560 Ga0213872_10072488 3300021361 Bacteria 1551
561 Ga0213872_10095122 3300021361 Bacteria 1330
562 Ga0213876_10047182 3300021384 Bacteria 2277
563 Ga0213876_10096698 3300021384 Bacteria 1564
564 Ga0213876_10152167 3300021384 Bacteria 1230
565 Ga0213875_10009266 3300021388 Bacteria 4995
566 Ga0213875_10017513 3300021388 Bacteria 3459
567 Ga0209435_100001 3300025206 Bacteria 1424171
568 Ga0209760_100007 3300025207 Bacteria 211381
569 Ga0209436_108521 3300025208 Bacteria 2034
570 Ga0209784_100003 3300025224 Bacteria 1379451
571 Ga0209784_101833 3300025224 Bacteria 2477
572 Ga0209566_100002 3300025225 Bacteria 2614868
573 Ga0209566_100911 3300025225 Bacteria 13870
574 Ga0209674_100094 3300025226 Bacteria 169506
575 Ga0209674_104056 3300025226 Bacteria 2476
576 Ga0209563_100004 3300025230 Bacteria 1814108
577 Ga0209563_100007 3300025230 Bacteria 1579402
578 Ga0207427_100018 3300025231 Bacteria 530735
579 Ga0209437_100031 3300025233 Bacteria 530871
580 Ga0209437_105638 3300025233 Bacteria 2123
581 Ga0209437_107815 3300025233 Bacteria 1725
582 Ga0209258_107712 3300025242 Bacteria 1576
583 Ga0207425_1000204 3300025245 Bacteria 47226
584 Ga0207425_1001057 3300025245 Bacteria 12726
585 Ga0207425_1002322 3300025245 Bacteria 6808
586 Ga0207425_1009663 3300025245 Bacteria 2388
587 Ga0209646_1000001 3300025246 Bacteria 3092932
588 Ga0209646_1000051 3300025246 Bacteria 296525
589 Ga0209026_1000003 3300025250 Bacteria 1060571
590 Ga0209026_1018123 3300025250 Bacteria 1117
591 Ga0209677_100071 3300025253 Bacteria 139425
592 Ga0209677_104388 3300025253 Bacteria 4095
593 Ga0209148_1001171 3300025254 Bacteria 15147
594 Ga0209759_1000001 3300025256 Bacteria 2799452
595 Ga0209759_1007815 3300025256 Bacteria 3395
596 Ga0209129_1000025 3300025258 Bacteria 413639
597 Ga0209129_1008428 3300025258 Bacteria 2868
598 Ga0209129_1009483 3300025258 Bacteria 2557
599 Ga0209233_1000012 3300025261 Bacteria 1019519
600 Ga0209565_1000004 3300025263 Bacteria 983150
601 Ga0209565_1000017 3300025263 Bacteria 462438
602 Ga0209565_1003317 3300025263 Bacteria 5274
603 Ga0209565_1006262 3300025263 Bacteria 3363
604 Ga0209565_1018144 3300025263 Bacteria 1528
605 Ga0209455_1000043 3300025272 Bacteria 413928
606 Ga0209455_1000196 3300025272 Bacteria 88682
607 Ga0209673_1000007 3300025273 Bacteria 634477
608 Ga0209673_1000275 3300025273 Bacteria 96728
609 Ga0209673_1021718 3300025273 Bacteria 2237
610 Ga0209673_1025737 3300025273 Bacteria 1950
611 Ga0209130_1000110 3300025284 Bacteria 133258
612 Ga0209130_1000156 3300025284 Bacteria 101929
613 Ga0209130_1000453 3300025284 Bacteria 43144
614 Ga0209675_1000009 3300025291 Bacteria 562872
615 Ga0209675_1000124 3300025291 Bacteria 106099
616 Ga0209675_1000614 3300025291 Bacteria 25547
617 Ga0209675_1035974 3300025291 Bacteria 1125
618 Ga0209676_1000029 3300025292 Bacteria 520536
619 Ga0209676_1002971 3300025292 Bacteria 11033
620 Ga0209025_1000435 3300025294 Bacteria 82663
621 Ga0209025_1001797 3300025294 Bacteria 25461
622 Ga0209025_1006101 3300025294 Bacteria 9514
623 Ga0209025_1006991 3300025294 Bacteria 8565
624 Ga0209025_1018110 3300025294 Bacteria 4020
625 Ga0209564_1000003 3300025295 Bacteria 1585848
626 Ga0209564_1000039 3300025295 Bacteria 413604
627 Ga0209564_1000055 3300025295 Bacteria 343782
628 Ga0209564_1000089 3300025295 Bacteria 249694
629 Ga0209564_1000605 3300025295 Bacteria 55905
630 Ga0209564_1001426 3300025295 Bacteria 24601
631 Ga0209564_1005436 3300025295 Bacteria 7280
632 Ga0209564_1007441 3300025295 Bacteria 5655
633 Ga0209758_1000163 3300025297 Bacteria 151988
634 Ga0209758_1000287 3300025297 Bacteria 99234
635 Ga0209758_1002668 3300025297 Bacteria 17623
636 Ga0209758_1007795 3300025297 Bacteria 7152
637 Ga0209050_1000003 3300025298 Bacteria 1609245
638 Ga0209050_1000009 3300025298 Bacteria 1047265
639 Ga0209050_1000956 3300025298 Bacteria 37488
640 Ga0209050_1006991 3300025298 Bacteria 6491
641 Ga0209256_1000001 3300025299 Bacteria 2166974
642 Ga0209256_1000051 3300025299 Bacteria 307241
643 Ga0209256_1000559 3300025299 Bacteria 53325
644 Ga0209256_1029657 3300025299 Bacteria 1521
645 Ga0209256_1031398 3300025299 Bacteria 1453
646 Ga0209256_1035187 3300025299 Bacteria 1326
647 Ga0207426_1000061 3300025302 Bacteria 362507
648 Ga0209051_1000003 3300025303 Bacteria 1609245
649 Ga0209051_1000008 3300025303 Bacteria 706935
650 Ga0209051_1000177 3300025303 Bacteria 115462
651 Ga0209051_1000363 3300025303 Bacteria 66432
652 Ga0209257_1000018 3300025304 Bacteria 836016
653 Ga0209257_1000322 3300025304 Bacteria 100390
654 Ga0207697_10002312 3300025315 Bacteria 9927
655 Ga0207697_10005006 3300025315 Bacteria 6233
656 Ga0207697_10098320 3300025315 Bacteria 1246
657 Ga0207656_10034849 3300025321 Bacteria 2104
658 Ga0207656_10165034 3300025321 Bacteria 1056
659 Ga0207682_10001145 3300025893 Bacteria 12280
660 Ga0207682_10003948 3300025893 Bacteria 6320
661 Ga0207692_10022143 3300025898 Bacteria 2920
662 Ga0207692_10022323 3300025898 Bacteria 2911
663 Ga0207642_10020946 3300025899 Bacteria 2564
664 Ga0207642_10029925 3300025899 Bacteria 2262
665 Ga0207642_10059358 3300025899 Bacteria 1769
666 Ga0207642_10078310 3300025899 Bacteria 1597
667 Ga0207642_10392742 3300025899 Bacteria 828
668 Ga0207710_10107210 3300025900 Bacteria 1323
669 Ga0207688_10045212 3300025901 Bacteria 2456
670 Ga0207688_10052391 3300025901 Bacteria 2286
671 Ga0207688_10075148 3300025901 Bacteria 1923
672 Ga0207680_10072303 3300025903 Bacteria 2141
673 Ga0207680_10113258 3300025903 Bacteria 1763
674 Ga0207685_10008123 3300025905 Bacteria 2969
675 Ga0207685_10012741 3300025905 Bacteria 2577
676 Ga0207699_10109555 3300025906 Bacteria 1767
677 Ga0207699_10150482 3300025906 Bacteria 1539
678 Ga0207645_10002901 3300025907 Bacteria 13246
679 Ga0207645_10026817 3300025907 Bacteria 3723
680 Ga0207645_10035735 3300025907 Bacteria 3190
681 Ga0207645_10043834 3300025907 Bacteria 2863
682 Ga0207645_10054049 3300025907 Bacteria 2565
683 Ga0207645_10078336 3300025907 Bacteria 2118
684 Ga0207643_10106987 3300025908 Bacteria 1644
685 Ga0207643_10227776 3300025908 Bacteria 1142
686 Ga0207705_10010149 3300025909 Bacteria 6854
687 Ga0207705_10055860 3300025909 Bacteria 2847
688 Ga0207705_10164989 3300025909 Bacteria 1665
689 Ga0207705_10334205 3300025909 Bacteria 1166
690 Ga0207705_10338446 3300025909 Bacteria 1158
691 Ga0207684_10138398 3300025910 Bacteria 2092
692 Ga0207684_10194692 3300025910 Bacteria 1749
693 Ga0207654_10016638 3300025911 Bacteria 3831
694 Ga0207654_10057690 3300025911 Bacteria 2257
695 Ga0207707_10085386 3300025912 Bacteria 2758
696 Ga0207707_10146364 3300025912 Bacteria 2065
697 Ga0207707_10281226 3300025912 Bacteria 1441
698 Ga0207707_10374758 3300025912 Bacteria 1224
699 Ga0207695_10191650 3300025913 Bacteria 1962
700 Ga0207695_10206204 3300025913 Bacteria 1878
701 Ga0207695_10342795 3300025913 Bacteria 1382
702 Ga0207671_10251198 3300025914 Bacteria 1390
703 Ga0207671_10260942 3300025914 Bacteria 1363
704 Ga0207671_10588743 3300025914 Bacteria 887
705 Ga0207693_10016831 3300025915 Bacteria 5835
706 Ga0207693_10044218 3300025915 Bacteria 3500
707 Ga0207693_10080258 3300025915 Bacteria 2554
708 Ga0207663_10006987 3300025916 Bacteria 5822
709 Ga0207660_10029178 3300025917 Bacteria 3780
710 Ga0207660_10121954 3300025917 Bacteria 1975
711 Ga0207662_10119838 3300025918 Bacteria 1649
712 Ga0207657_10004062 3300025919 Bacteria 15529
713 Ga0207657_10010003 3300025919 Bacteria 9490
714 Ga0207657_10037712 3300025919 Bacteria 4312
715 Ga0207657_10042193 3300025919 Bacteria 4027
716 Ga0207657_10082221 3300025919 Bacteria 2703
717 Ga0207657_10129537 3300025919 Bacteria 2069
718 Ga0207657_10344932 3300025919 Bacteria 1175
719 Ga0207649_10000082 3300025920 Bacteria 81508
720 Ga0207649_10008546 3300025920 Bacteria 5585
721 Ga0207649_10023354 3300025920 Bacteria 3581
722 Ga0207649_10206879 3300025920 Bacteria 1390
723 Ga0207649_10464725 3300025920 Bacteria 957
724 Ga0207652_10024538 3300025921 Bacteria 5003
725 Ga0207652_10094734 3300025921 Bacteria 2629
726 Ga0207652_10165621 3300025921 Bacteria 1982
727 Ga0207652_10542271 3300025921 Bacteria 1046
728 Ga0207681_10013076 3300025923 Bacteria 5132
729 Ga0207681_10048936 3300025923 Bacteria 2855
730 Ga0207681_10095492 3300025923 Bacteria 2132
731 Ga0207681_10228820 3300025923 Bacteria 1442
732 Ga0207681_10290614 3300025923 Bacteria 1290
733 Ga0207694_10039743 3300025924 Bacteria 3621
734 Ga0207694_10062231 3300025924 Bacteria 2906
735 Ga0207650_10010191 3300025925 Bacteria 6441
736 Ga0207650_10073687 3300025925 Bacteria 2572
737 Ga0207650_10108688 3300025925 Bacteria 2144
738 Ga0207650_10152516 3300025925 Bacteria 1824
739 Ga0207650_10176622 3300025925 Bacteria 1700
740 Ga0207650_10492704 3300025925 Bacteria 1023
741 Ga0207659_10006611 3300025926 Bacteria 7119
742 Ga0207659_10060424 3300025926 Bacteria 2728
743 Ga0207659_10087147 3300025926 Bacteria 2323
744 Ga0207659_10283705 3300025926 Bacteria 1355
745 Ga0207659_10610422 3300025926 Bacteria 930
746 Ga0207687_10118293 3300025927 Bacteria 1978
747 Ga0207687_10428713 3300025927 Bacteria 1093
748 Ga0207687_10482273 3300025927 Bacteria 1033
749 Ga0207700_10000499 3300025928 Bacteria 22988
750 Ga0207700_10013150 3300025928 Bacteria 5372
751 Ga0207664_10058881 3300025929 Bacteria 3058
752 Ga0207664_10410399 3300025929 Bacteria 1205
753 Ga0207644_10005044 3300025931 Bacteria 8616
754 Ga0207644_10154679 3300025931 Bacteria 1777
755 Ga0207644_10256803 3300025931 Bacteria 1396
756 Ga0207690_10000736 3300025932 Bacteria 21103
757 Ga0207690_10001054 3300025932 Bacteria 17655
758 Ga0207690_10004240 3300025932 Bacteria 8469
759 Ga0207690_10011606 3300025932 Bacteria 5265
760 Ga0207690_10103802 3300025932 Bacteria 2035
761 Ga0207706_10002510 3300025933 Bacteria 17890
762 Ga0207706_10008764 3300025933 Bacteria 9310
763 Ga0207706_10024273 3300025933 Bacteria 5435
764 Ga0207706_10078662 3300025933 Bacteria 2900
765 Ga0207706_10085165 3300025933 Bacteria 2779
766 Ga0207706_10101190 3300025933 Bacteria 2535
767 Ga0207686_10030267 3300025934 Bacteria 3203
768 Ga0207686_10040727 3300025934 Bacteria 2827
769 Ga0207686_10090161 3300025934 Bacteria 2022
770 Ga0207709_10000019 3300025935 Bacteria 402225
771 Ga0207709_10018224 3300025935 Bacteria 3928
772 Ga0207709_10026405 3300025935 Bacteria 3336
773 Ga0207709_10036408 3300025935 Bacteria 2916
774 Ga0207709_10273033 3300025935 Bacteria 1245
775 Ga0207670_10032494 3300025936 Bacteria 3356
776 Ga0207669_10015872 3300025937 Bacteria 3810
777 Ga0207669_10125677 3300025937 Bacteria 1751
778 Ga0207669_10163568 3300025937 Bacteria 1575
779 Ga0207669_10169893 3300025937 Bacteria 1551
780 Ga0207669_10234575 3300025937 Bacteria 1356
781 Ga0207704_10030902 3300025938 Bacteria 3010
782 Ga0207704_10083339 3300025938 Bacteria 2075
783 Ga0207704_10412137 3300025938 Bacteria 1069
784 Ga0207665_10000578 3300025939 Bacteria 24653
785 Ga0207665_10281827 3300025939 Bacteria 1237
786 Ga0207691_10011683 3300025940 Bacteria 8432
787 Ga0207691_10014808 3300025940 Bacteria 7431
788 Ga0207691_10049849 3300025940 Bacteria 3835
789 Ga0207691_10165059 3300025940 Bacteria 1941
790 Ga0207691_10223629 3300025940 Bacteria 1631
791 Ga0207691_10372286 3300025940 Bacteria 1220
792 Ga0207691_10421577 3300025940 Bacteria 1137
793 Ga0207711_10419920 3300025941 Bacteria 1244
794 Ga0207711_10579964 3300025941 Bacteria 1046
795 Ga0207689_10013235 3300025942 Bacteria 7038
796 Ga0207689_10248004 3300025942 Bacteria 1472
797 Ga0207689_10256317 3300025942 Bacteria 1447
798 Ga0207661_10182723 3300025944 Bacteria 1833
799 Ga0207661_10268432 3300025944 Bacteria 1522
800 Ga0207679_10000619 3300025945 Bacteria 23689
801 Ga0207679_10009383 3300025945 Bacteria 6268
802 Ga0207679_10024218 3300025945 Bacteria 4161
803 Ga0207679_10033978 3300025945 Bacteria 3594
804 Ga0207679_10038793 3300025945 Bacteria 3397
805 Ga0207679_10100533 3300025945 Bacteria 2260
806 Ga0207679_10136963 3300025945 Bacteria 1973
807 Ga0207667_10061742 3300025949 Bacteria 3920
808 Ga0207667_10062740 3300025949 Bacteria 3885
809 Ga0207667_10100662 3300025949 Bacteria 2981
810 Ga0207667_10169247 3300025949 Bacteria 2246
811 Ga0207651_10029172 3300025960 Bacteria 3492
812 Ga0207651_10066741 3300025960 Bacteria 2529
813 Ga0207651_10102413 3300025960 Bacteria 2128
814 Ga0207651_10814388 3300025960 Bacteria 828
815 Ga0207712_10020087 3300025961 Bacteria 4371
816 Ga0207712_10087231 3300025961 Bacteria 2288
817 Ga0207712_10504651 3300025961 Bacteria 1034
818 Ga0207668_10175086 3300025972 Bacteria 1687
819 Ga0207668_10543123 3300025972 Bacteria 1006
820 Ga0207640_10401149 3300025981 Bacteria 1117
821 Ga0207658_10054268 3300025986 Bacteria 2965
822 Ga0207658_10095835 3300025986 Bacteria 2313
823 Ga0207658_10166532 3300025986 Bacteria 1811
824 Ga0207677_10016042 3300026023 Bacteria 4425
825 Ga0207677_10019687 3300026023 Bacteria 4082
826 Ga0207703_10030478 3300026035 Bacteria 4264
827 Ga0207639_10013750 3300026041 Bacteria 5675
828 Ga0207639_10246179 3300026041 Bacteria 1557
829 Ga0207639_10335666 3300026041 Bacteria 1346
830 Ga0207639_10500640 3300026041 Bacteria 1110
831 Ga0207678_10000148 3300026067 Bacteria 57513
832 Ga0207678_10023671 3300026067 Bacteria 5371
833 Ga0207678_10033083 3300026067 Bacteria 4505
834 Ga0207678_10251511 3300026067 Bacteria 1513
835 Ga0207678_10270814 3300026067 Bacteria 1456
836 Ga0207708_10017801 3300026075 Bacteria 5347
837 Ga0207708_10038385 3300026075 Bacteria 3648
838 Ga0207708_10173205 3300026075 Bacteria 1710
839 Ga0207708_10195012 3300026075 Bacteria 1614
840 Ga0207702_10000296 3300026078 Bacteria 57562
841 Ga0207702_10033589 3300026078 Bacteria 4286
842 Ga0207702_10329890 3300026078 Bacteria 1455
843 Ga0207702_10473428 3300026078 Bacteria 1218
844 Ga0207641_10114868 3300026088 Bacteria 2393
845 Ga0207641_10443697 3300026088 Bacteria 1253
846 Ga0207641_10483379 3300026088 Bacteria 1200
847 Ga0207641_10885846 3300026088 Bacteria 886
848 Ga0207648_10000712 3300026089 Bacteria 37330
849 Ga0207648_10012297 3300026089 Bacteria 8015
850 Ga0207648_10013191 3300026089 Bacteria 7701
851 Ga0207648_10018499 3300026089 Bacteria 6306
852 Ga0207648_10034904 3300026089 Bacteria 4434
853 Ga0207648_10045144 3300026089 Bacteria 3865
854 Ga0207676_10040883 3300026095 Bacteria 3556
855 Ga0207676_10493483 3300026095 Bacteria 1161
856 Ga0207674_10042310 3300026116 Bacteria 4707
857 Ga0207674_10084893 3300026116 Bacteria 3163
858 Ga0207674_10384841 3300026116 Bacteria 1356
859 Ga0207675_100031971 3300026118 Bacteria 4903
860 Ga0207675_100215816 3300026118 Bacteria 1847
861 Ga0207675_100512989 3300026118 Bacteria 1194
862 Ga0207675_100571734 3300026118 Bacteria 1131
863 Ga0207683_10002721 3300026121 Bacteria 15437
864 Ga0207683_10004947 3300026121 Bacteria 11464
865 Ga0207683_10005185 3300026121 Bacteria 11189
866 Ga0207683_10007852 3300026121 Bacteria 9131
867 Ga0207683_10018313 3300026121 Bacteria 5975
868 Ga0207683_10018373 3300026121 Bacteria 5965
869 Ga0207683_10031010 3300026121 Bacteria 4638
870 Ga0207683_10047228 3300026121 Bacteria 3770
871 Ga0207683_10359071 3300026121 Bacteria 1338
872 Ga0207698_10001815 3300026142 Bacteria 12474
873 Ga0207698_10086246 3300026142 Bacteria 2552
874 Ga0207698_10517582 3300026142 Bacteria 1164
875 Ga0209281_1000005 3300027111 Bacteria 1242284
876 Ga0209281_1000098 3300027111 Bacteria 226641
877 Ga0209281_1000135 3300027111 Bacteria 183462
878 Ga0209281_1003634 3300027111 Bacteria 4981
879 Ga0209973_1006036 3300027252 Bacteria 1308
880 Ga0209371_1000385 3300027312 Bacteria 46739
881 Ga0209996_1000696 3300027395 Bacteria 4021
882 Ga0209968_1000637 3300027526 Bacteria 5403
883 Ga0209970_1000327 3300027614 Bacteria 7923
884 Ga0209282_1191421 3300027666 Bacteria 950
885 Ga0209966_1000358 3300027695 Bacteria 13967
886 Ga0209966_1002473 3300027695 Bacteria 3083
887 Ga0209966_1004838 3300027695 Bacteria 2296
888 Ga0209998_10001231 3300027717 Bacteria 6298
889 Ga0209998_10009266 3300027717 Bacteria 2043
890 Ga0209974_10002361 3300027876 Bacteria 6844
891 Ga0209974_10005168 3300027876 Bacteria 4607
892 Ga0209974_10007189 3300027876 Bacteria 3847
893 Ga0209974_10013827 3300027876 Bacteria 2689
894 Ga0209974_10015100 3300027876 Bacteria 2565
895 Ga0209974_10087574 3300027876 Bacteria 1077
896 Ga0207428_10000045 3300027907 Bacteria 194471
897 Ga0207428_10000233 3300027907 Bacteria 76679
898 Ga0207428_10000566 3300027907 Bacteria 43802
899 Ga0207428_10060645 3300027907 Bacteria 2997
900 Ga0207428_10109526 3300027907 Bacteria 2127
901 Ga0268266_10267865 3300028379 Bacteria 1585
902 Ga0268266_10283711 3300028379 Bacteria 1540
903 Ga0268266_10400189 3300028379 Bacteria 1298
904 Ga0268265_10013096 3300028380 Bacteria 5632
905 Ga0268265_10025627 3300028380 Bacteria 4189
906 Ga0268265_10027143 3300028380 Bacteria 4083
907 Ga0268265_10127557 3300028380 Bacteria 2108
908 Ga0268264_10001880 3300028381 Bacteria 19068
909 Ga0268264_10166463 3300028381 Bacteria 1990
910 Ga0268264_10781650 3300028381 Bacteria 953
911 Ga0265319_1040569 3300028563 Bacteria 1574
912 Ga0265319_1071253 3300028563 Bacteria 1114
913 Ga0265334_10006206 3300028573 Bacteria 5170
914 Ga0265334_10038795 3300028573 Bacteria 1872
915 Ga0265334_10084996 3300028573 Bacteria 1162
916 Ga0265318_10023086 3300028577 Bacteria 2483
917 Ga0265318_10038885 3300028577 Bacteria 1817
918 Ga0307515_10000022 3300028794 Bacteria 404064
919 Ga0307515_10052000 3300028794 Bacteria 6090
920 Ga0307515_10070676 3300028794 Bacteria 4746
921 Ga0265338_10036918 3300028800 Bacteria 4663
922 Ga0268256_1000394 3300030500 Bacteria 39863
923 Ga0316177_1104395 3300030731 Bacteria 2991
924 Ga0316176_1115808 3300030732 Bacteria 3834
925 Ga0316179_1114749 3300030734 Bacteria 5187
926 Ga0316178_1104248 3300030735 Bacteria 2055
927 Ga0316183_1048080 3300030742 Bacteria 2707
928 Ga0316183_1072259 3300030742 Bacteria 4765
929 Ga0316182_1239479 3300030745 Bacteria 3151
930 Ga0316182_1346278 3300030745 Bacteria 4430
931 Ga0265330_10000108 3300031235 Bacteria 69468
932 Ga0265330_10015365 3300031235 Bacteria 3543
933 Ga0265332_10000037 3300031238 Bacteria 134250
934 Ga0265332_10000072 3300031238 Bacteria 86029
935 Ga0265328_10006129 3300031239 Bacteria 5118
936 Ga0265320_10063785 3300031240 Bacteria 1752
937 Ga0265325_10039163 3300031241 Bacteria 2497
938 Ga0265329_10088549 3300031242 Bacteria 982
939 Ga0265340_10015804 3300031247 Bacteria 3917
940 Ga0265339_10002576 3300031249 Bacteria 12919
941 Ga0265339_10113229 3300031249 Bacteria 1401
942 Ga0265339_10185108 3300031249 Bacteria 1035
943 Ga0265331_10020416 3300031250 Bacteria 3401
944 Ga0265331_10021628 3300031250 Bacteria 3289
945 Ga0265331_10040113 3300031250 Bacteria 2279
946 Ga0265327_10000423 3300031251 Bacteria 77351
947 Ga0265327_10001312 3300031251 Bacteria 32428
948 Ga0265316_10000123 3300031344 Bacteria 84283
949 Ga0265316_10038287 3300031344 Bacteria 3865
950 Ga0265316_10127672 3300031344 Bacteria 1917
951 Ga0307513_10000006 3300031456 Bacteria 470848
952 Ga0307513_10000014 3300031456 Bacteria 303157
953 Ga0307509_10509715 3300031507 Bacteria 886
954 Ga0307408_100000203 3300031548 Bacteria 63723
955 Ga0307408_100005366 3300031548 Bacteria 8587
956 Ga0307408_100006774 3300031548 Bacteria 7594
957 Ga0307408_100031603 3300031548 Bacteria 3687
958 Ga0307408_100055614 3300031548 Bacteria 2866
959 Ga0307408_100253624 3300031548 Bacteria 1452
960 Ga0307408_100332526 3300031548 Bacteria 1283
961 Ga0307408_100438284 3300031548 Bacteria 1130
962 Ga0265313_10001715 3300031595 Bacteria 20184
963 Ga0265313_10007896 3300031595 Bacteria 7163
964 Ga0265313_10031201 3300031595 Bacteria 2734
965 Ga0265313_10063915 3300031595 Bacteria 1714
966 Ga0307514_10001061 3300031649 Bacteria 39297
967 Ga0307514_10122396 3300031649 Bacteria 1811
968 Ga0265314_10000516 3300031711 Bacteria 49905
969 Ga0265314_10011175 3300031711 Bacteria 7439
970 Ga0265314_10088080 3300031711 Bacteria 2028
971 Ga0265342_10023446 3300031712 Bacteria 3906
972 Ga0265342_10024120 3300031712 Bacteria 3842
973 Ga0307516_10248265 3300031730 Bacteria 1475
974 Ga0307405_10004167 3300031731 Bacteria 6802
975 Ga0307405_10035343 3300031731 Bacteria 2983
976 Ga0307405_10106713 3300031731 Bacteria 1889
977 Ga0307405_10549191 3300031731 Bacteria 934
978 Ga0307413_10026309 3300031824 Bacteria 3204
979 Ga0307413_10101129 3300031824 Bacteria 1905
980 Ga0307413_10170674 3300031824 Bacteria 1539
981 Ga0307410_10087757 3300031852 Bacteria 2201
982 Ga0307410_10346845 3300031852 Bacteria 1185
983 Ga0307406_10000704 3300031901 Bacteria 18898
984 Ga0307406_10012016 3300031901 Bacteria 4925
985 Ga0307406_10014173 3300031901 Bacteria 4581
986 Ga0307406_10047005 3300031901 Bacteria 2718
987 Ga0307406_10401401 3300031901 Bacteria 1087
988 Ga0307407_10061133 3300031903 Bacteria 2201
989 Ga0307412_10001704 3300031911 Bacteria 12153
990 Ga0307412_10011369 3300031911 Bacteria 5154
991 Ga0307412_10018358 3300031911 Bacteria 4207
992 Ga0307412_10036229 3300031911 Bacteria 3158
993 Ga0307412_10055275 3300031911 Bacteria 2639
994 Ga0307412_10137854 3300031911 Bacteria 1782
995 Ga0307412_10286325 3300031911 Bacteria 1296
996 Ga0307409_100335601 3300031995 Bacteria 1420
997 Ga0307416_100214875 3300032002 Bacteria 1838
998 Ga0307416_100355996 3300032002 Bacteria 1484
999 Ga0307416_100400117 3300032002 Bacteria 1410
1000 Ga0307416_100406528 3300032002 Bacteria 1401
1001 Ga0307416_100436616 3300032002 Bacteria 1358
1002 Ga0307414_10091887 3300032004 Bacteria 2257
1003 Ga0307414_10123016 3300032004 Bacteria 1998
1004 Ga0307414_10354468 3300032004 Bacteria 1260
1005 Ga0307411_10779855 3300032005 Bacteria 840
1006 Ga0307415_100693625 3300032126 Bacteria 918
1007 Ga0307510_10112237 3300033180 Bacteria 2463
1008 Ga0373930_0000145 3300034816 Bacteria 7997
1009 Ga0373948_0000020 3300034817 Bacteria 20635
1010 Ga0373948_0033530 3300034817 Bacteria 1046
1011 Ga0373948_0050102 3300034817 Bacteria 895
1012 Ga0373959_0000517 3300034820 Bacteria 6911
1013 Ga0373959_0036939 3300034820 Bacteria 1010
1014 Ga0373928_0000212 3300035084 Bacteria 11283
1015 Ga0373929_0000945 3300035085 Bacteria 5644
1016 Ga0373934_0057823 3300035086 Bacteria 1543
1017 Ga0373940_0000182 3300035088 Bacteria 8493
1018 Ga0373949_0000713 3300035090 Bacteria 10807
1019 Ga0373949_0013189 3300035090 Bacteria 1831
1020 Ga0373951_0001691 3300035091 Bacteria 5764
1021 Ga0373952_0000214 3300035092 Bacteria 9142
1022 Ga0373952_0003427 3300035092 Bacteria 2862
1023 Ga0373932_0000110 3300035112 Bacteria 22516
1024 Ga0373932_0031709 3300035112 Bacteria 1474
1025 Ga0373939_0000702 3300035114 Bacteria 8288
1026 Ga0373941_0000923 3300035115 Bacteria 6054
1027 Ga0373941_0007446 3300035115 Bacteria 2678
1028 Ga0373945_0010354 3300035116 Bacteria 3069
1029 Ga0373945_0016591 3300035116 Bacteria 2485
1030 Ga0373953_0048987 3300035117 Bacteria 1703
1031 Ga0373954_0017854 3300035118 Bacteria 3190
1032 Ga0373954_0048918 3300035118 Bacteria 1981
1033 Ga0373954_0135636 3300035118 Bacteria 1199
1034 Ga0373957_0002489 3300035120 Bacteria 5274
1035 Ga0373957_0015363 3300035120 Bacteria 2634
1036 Ga0373960_0001315 3300035121 Bacteria 5473
1037 Ga0373960_0002509 3300035121 Bacteria 4129
1038 Ga0373960_0110307 3300035121 Bacteria 902
1039 Ga0373943_0037348 3300035170 Bacteria 2331
1040 Ga0373943_0055660 3300035170 Bacteria 1960
1041 Ga0373943_0058784 3300035170 Bacteria 1915
1042 Ga0373943_0161286 3300035170 Bacteria 1221
1043 Ga0373946_0011148 3300035171 Bacteria 3346
1044 Ga0373955_0016295 3300035172 Bacteria 3655
1045 Ga0373955_0029912 3300035172 Bacteria 2838
1046 Ga0373955_0045700 3300035172 Bacteria 2364
1047 Ga0373955_0362558 3300035172 Bacteria 878
1048 Ga0373942_0001033 3300035207 Bacteria 7550
1049 Ga0373942_0007520 3300035207 Bacteria 2529
1050 Ga0373961_0000448 3300035241 Bacteria 16686
1051 Ga0373962_0000396 3300035242 Bacteria 9518
1052 Ga0373924_0073055 3300035410 Bacteria 1449
1053 Ga0373924_0076496 3300035410 Bacteria 1418
1054 Ga0373931_0002827 3300035691 Bacteria 7735
1055 Ga0373931_0226761 3300035691 Bacteria 1127
1056 Ga0373931_0351701 3300035691 Bacteria 922
1057 Ga0373935_0013334 3300035692 Bacteria 4959
1058 Ga0373935_0319039 3300035692 Bacteria 1102
1059 Ga0373927_0075645 3300035695 Bacteria 2180
1060 Ga0373933_0031872 3300035724 Bacteria 3060
1061 Ga0373947_0015048 3300035725 Bacteria 4441
1062 Ga0373947_0034526 3300035725 Bacteria 2991
1063 Ga0373947_0204478 3300035725 Bacteria 1293
1064 Ga0373947_0389832 3300035725 Bacteria 938
1065 Ga0373937_0003087 3300036401 Bacteria 13932
1066 Ga0373937_0009826 3300036401 Bacteria 8343
1067 Ga0373937_0014161 3300036401 Bacteria 7034
1068 Ga0373937_0016649 3300036401 Bacteria 6531
1069 Ga0373937_0084725 3300036401 Bacteria 2932
1070 Ga0373937_0236822 3300036401 Bacteria 1719
1071 Ga0373937_0360992 3300036401 Bacteria 1377
1072 Ga0373925_0012329 3300037068 Bacteria 6187
1073 Ga0373925_0013835 3300037068 Bacteria 5842
1074 Ga0373925_0040570 3300037068 Bacteria 3447
1075 Ga0373925_0227533 3300037068 Bacteria 1490
1076 Ga0395899_0001751 3300037312 Bacteria 18046
1077 Ga0395899_0002385 3300037312 Bacteria 15265
1078 Ga0395899_0002696 3300037312 Bacteria 14317
1079 Ga0395899_0004067 3300037312 Bacteria 11528
1080 Ga0395899_0004305 3300037312 Bacteria 11118
1081 Ga0395899_0018473 3300037312 Bacteria 5300
1082 Ga0395899_0029354 3300037312 Bacteria 4136
1083 Ga0395899_0062879 3300037312 Bacteria 2732
1084 Ga0395899_0076197 3300037312 Bacteria 2449
1085 Ga0395899_0118446 3300037312 Bacteria 1899
1086 Ga0395899_0187844 3300037312 Bacteria 1447
1087 Ga0395899_0255605 3300037312 Bacteria 1200
1088 Ga0395900_0000343 3300037418 Bacteria 68342
1089 Ga0395900_0000584 3300037418 Bacteria 50170
1090 Ga0395900_0005960 3300037418 Bacteria 12727
1091 Ga0395900_0006855 3300037418 Bacteria 11819
1092 Ga0395900_0008788 3300037418 Bacteria 10380
1093 Ga0395900_0027588 3300037418 Bacteria 5816
1094 Ga0395900_0043264 3300037418 Bacteria 4641
1095 Ga0395900_0055481 3300037418 Bacteria 4080
1096 Ga0395900_0105264 3300037418 Bacteria 2898
1097 Ga0395900_0168814 3300037418 Bacteria 2229
1098 Ga0395900_0174636 3300037418 Bacteria 2186
1099 Ga0395900_0187621 3300037418 Bacteria 2098
1100 Ga0395900_0652180 3300037418 Bacteria 989
1101 Ga0395900_0733393 3300037418 Bacteria 919
1102 Ga0395900_0906237 3300037418 Bacteria 805
1103 Ga0395898_0003262 3300037466 Bacteria 18232
1104 Ga0395898_0005468 3300037466 Bacteria 13723
1105 Ga0395898_0025689 3300037466 Bacteria 5931
1106 Ga0395898_0026751 3300037466 Bacteria 5798
1107 Ga0395898_0031807 3300037466 Bacteria 5270
1108 Ga0395898_0635874 3300037466 Bacteria 1009
1109 Ga0395905_0000126 3300037471 Bacteria 126035
1110 Ga0395905_0003638 3300037471 Bacteria 16382
1111 Ga0395905_0004104 3300037471 Bacteria 15258
1112 Ga0395905_0012988 3300037471 Bacteria 8004
1113 Ga0395905_0015533 3300037471 Bacteria 7236
1114 Ga0395905_0018706 3300037471 Bacteria 6571
1115 Ga0395905_0021636 3300037471 Bacteria 6082
1116 Ga0395905_0036837 3300037471 Bacteria 4594
1117 Ga0395905_0037442 3300037471 Bacteria 4554
1118 Ga0395905_0045702 3300037471 Bacteria 4107
1119 Ga0395905_0047811 3300037471 Bacteria 4008
1120 Ga0395905_0114523 3300037471 Bacteria 2533
1121 Ga0395905_0156473 3300037471 Bacteria 2143
1122 Ga0395905_0378128 3300037471 Bacteria 1310
1123 Ga0395905_0475121 3300037471 Bacteria 1149
1124 Ga0436364_0029269 3300037853 Bacteria 7612
1125 Ga0436364_0913607 3300037853 Bacteria 3018
1126 Ga0436364_1464285 3300037853 Bacteria 5828
1127 Ga0395901_0000122 3300038443 Bacteria 100003
1128 Ga0395901_0003716 3300038443 Bacteria 15380
1129 Ga0395901_0004044 3300038443 Bacteria 14769
1130 Ga0395901_0034845 3300038443 Bacteria 5199
1131 Ga0395901_0048978 3300038443 Bacteria 4388
1132 Ga0395901_0078482 3300038443 Bacteria 3447
1133 Ga0395901_0101158 3300038443 Bacteria 3025
1134 Ga0395901_0944109 3300038443 Bacteria 842
1135 Ga0436365_0529637 3300039437 Bacteria 32938
1136 Ga0436365_1478878 3300039437 Bacteria 2794
1137 Ga0436365_1750793 3300039437 Bacteria 2936
1138 Ga0436360_0690975 3300039438 Bacteria 2294
1139 Ga0436360_0785555 3300039438 Bacteria 821
1140 Ga0436361_0257449 3300039447 Bacteria 46569
1141 Ga0436361_0287651 3300039447 Bacteria 35780
1142 Ga0436361_0300526 3300039447 Bacteria 4740
1143 Ga0436361_0343816 3300039447 Bacteria 22925
1144 Ga0436361_0527985 3300039447 Bacteria 23505
1145 Ga0436361_0534065 3300039447 Bacteria 2873
1146 Ga0436361_0702679 3300039447 Bacteria 9433
1147 Ga0436361_0837681 3300039447 Bacteria 5330
1148 Ga0436361_0897086 3300039447 Bacteria 3728
1149 Ga0436361_0951023 3300039447 Bacteria 1734
1150 Ga0436361_1101359 3300039447 Bacteria 2914
1151 Ga0436362_0225961 3300039453 Bacteria 1280
1152 Ga0436362_0312145 3300039453 Unclassified 2284
1153 Ga0439436_0004304 3300041404 Bacteria 4357
1154 Ga0439438_031469 3300041405 Bacteria 1410
1155 Ga0439439_0008899 3300041406 Bacteria 2377
1156 Ga0439447_014261 3300041407 Bacteria 2234
1157 Ga0439453_0000966 3300041408 Bacteria 3479
1158 Ga0439466_0023680 3300041411 Bacteria 2158
1159 Ga0439465_0122419 3300041413 Bacteria 913
1160 Ga0451791_0434519 3300041451 Bacteria 1852
1161 Ga0451797_0622548 3300041453 Bacteria 939
1162 Ga0439431_0005706 3300041997 Bacteria 2745
1163 Ga0439442_009004 3300042002 Bacteria 2017
1164 Ga0439443_002542 3300042003 Bacteria 2193
1165 Ga0439448_0013746 3300042005 Bacteria 2436
1166 Ga0439432_006450 3300042006 Bacteria 4189
1167 Ga0439449_0001069 3300042007 Bacteria 10763
1168 Ga0439449_0002400 3300042007 Bacteria 7330
1169 Ga0439449_0017677 3300042007 Bacteria 2677
1170 Ga0439455_0013213 3300042012 Bacteria 1866
1171 Ga0439456_000092 3300042013 Bacteria 31313
1172 Ga0439456_019140 3300042013 Bacteria 1439
1173 Ga0439462_0000991 3300042015 Bacteria 6069
1174 Ga0439462_0044989 3300042015 Bacteria 1182
1175 Ga0450919_000767 3300042121 Bacteria 4096
1176 Ga0450920_006080 3300042122 Bacteria 2162
1177 Ga0450923_014350 3300042125 Bacteria 1469
1178 Ga0450896_009232 3300042133 Bacteria 1373
1179 Ga0450898_003997 3300042134 Bacteria 2154
1180 Ga0450898_021576 3300042134 Bacteria 1135
1181 Ga0450904_000303 3300042139 Bacteria 10497
1182 Ga0450906_007350 3300042145 Bacteria 2178
1183 Ga0439446_0067768 3300042156 Bacteria 1087
1184 Ga0439446_0096675 3300042156 Bacteria 930
1185 Ga0450908_007420 3300042184 Bacteria 2068
1186 Ga0439434_0007249 3300042435 Bacteria 3250
1187 Ga0439434_0024300 3300042435 Bacteria 1828
1188 Ga0439434_0059698 3300042435 Bacteria 1191
1189 Ga0439435_0017468 3300042436 Bacteria 1814
1190 Ga0439460_0001614 3300042461 Bacteria 5341
1191 Ga0450918_000103 3300042531 Bacteria 18200
1192 Ga0451577_0000257 3300042876 Bacteria 104746
1193 Ga0451577_0001824 3300042876 Bacteria 27205
1194 Ga0451577_0005400 3300042876 Bacteria 13114
1195 Ga0451577_0005415 3300042876 Bacteria 13090
1196 Ga0451577_0062080 3300042876 Bacteria 3332
1197 Ga0451577_0153376 3300042876 Bacteria 2073
1198 Ga0451577_0321023 3300042876 Bacteria 1404
1199 Ga0451577_0365212 3300042876 Bacteria 1309
1200 Ga0451577_0465095 3300042876 Bacteria 1148
1201 Ga0439440_0046688 3300042993 Bacteria 1071
1202 Ga0466969_0000140 3300044656 Bacteria 39075
1203 Ga0466969_0005820 3300044656 Bacteria 6553
1204 Ga0466969_0007165 3300044656 Bacteria 5931
1205 Ga0466969_0013031 3300044656 Bacteria 4379
1206 Ga0466969_0017664 3300044656 Bacteria 3722
1207 Ga0466969_0024405 3300044656 Bacteria 3110
1208 Ga0466969_0078999 3300044656 Bacteria 1573
1209 Ga0466972_0000118 3300044658 Bacteria 66725
1210 Ga0466972_0000970 3300044658 Bacteria 13813
1211 Ga0466972_0002883 3300044658 Bacteria 8509
1212 Ga0466972_0078929 3300044658 Bacteria 1567
1213 Ga0466965_0003238 3300044683 Bacteria 7119
1214 Ga0466965_0017043 3300044683 Bacteria 3467
1215 Ga0466965_0017080 3300044683 Bacteria 3463
1216 Ga0466965_0026724 3300044683 Bacteria 2798
1217 Ga0466965_0044809 3300044683 Bacteria 2187
1218 Ga0466965_0074602 3300044683 Bacteria 1709
1219 Ga0466965_0091322 3300044683 Bacteria 1549
1220 Ga0466965_0207662 3300044683 Bacteria 1040
1221 Ga0466966_0014879 3300044684 Bacteria 5147
1222 Ga0466966_0031802 3300044684 Bacteria 3422
1223 Ga0466966_0041162 3300044684 Bacteria 2969
1224 Ga0466966_0041901 3300044684 Bacteria 2941
1225 Ga0466966_0057554 3300044684 Bacteria 2457
1226 Ga0466966_0082289 3300044684 Bacteria 2003
1227 Ga0466961_0000078 3300044693 Bacteria 60385
1228 Ga0466961_0000186 3300044693 Bacteria 41739
1229 Ga0466961_0034566 3300044693 Bacteria 3245
1230 Ga0466961_0089275 3300044693 Bacteria 1946
1231 Ga0466963_0047900 3300044694 Bacteria 2822
1232 Ga0466963_0115646 3300044694 Bacteria 1843
1233 Ga0466964_0000101 3300044706 Bacteria 20945
1234 Ga0466964_0013830 3300044706 Bacteria 3063
1235 Ga0453684_0001024 3300044712 Bacteria 89721
1236 Ga0453684_0003977 3300044712 Bacteria 32287
1237 Ga0453684_0055056 3300044712 Bacteria 5174
1238 Ga0453684_0112257 3300044712 Bacteria 3309
1239 Ga0466971_0018640 3300044719 Bacteria 3076
1240 Ga0466971_0024636 3300044719 Bacteria 2685
1241 Ga0466971_0030881 3300044719 Bacteria 2398
1242 Ga0466971_0150674 3300044719 Bacteria 1086
1243 Ga0466968_0000268 3300044735 Bacteria 16636
1244 Ga0466970_0013469 3300044765 Bacteria 4192
1245 Ga0466970_0028177 3300044765 Bacteria 2950
1246 Ga0466970_0029479 3300044765 Bacteria 2889
1247 Ga0466970_0034333 3300044765 Bacteria 2685
1248 Ga0466957_0003539 3300044842 Bacteria 8598
1249 Ga0466957_0004850 3300044842 Bacteria 7526
1250 Ga0466957_0005295 3300044842 Bacteria 7230
1251 Ga0466957_0017205 3300044842 Bacteria 4232
1252 Ga0466957_0222227 3300044842 Bacteria 1247
1253 Ga0466960_0090513 3300044901 Bacteria 1559
1254 Ga0466960_0199098 3300044901 Bacteria 1093
1255 Ga0466959_0005356 3300045049 Bacteria 8781
1256 Ga0466959_0011392 3300045049 Bacteria 6388
1257 Ga0466959_0015134 3300045049 Bacteria 5618
1258 Ga0466959_0020945 3300045049 Bacteria 4820
1259 Ga0466959_0115064 3300045049 Bacteria 1916
1260 Ga0451576_0000914 3300045051 Bacteria 55935
1261 Ga0451576_0006191 3300045051 Bacteria 14738
1262 Ga0451576_0006768 3300045051 Bacteria 13946
1263 Ga0451576_0023061 3300045051 Bacteria 6745
1264 Ga0451576_0036843 3300045051 Bacteria 5183
1265 Ga0451576_0089170 3300045051 Bacteria 3207
1266 Ga0451576_0923350 3300045051 Bacteria 916
1267 Ga0451576_1163281 3300045051 Bacteria 806
1268 Ga0466958_0055526 3300045836 Bacteria 2403
1269 Ga0466958_0226808 3300045836 Bacteria 1192
1270 Ga0466967_0079324 3300045976 Bacteria 2959
1271 Ga0466967_0121686 3300045976 Bacteria 2412
1272 Ga0466967_0132364 3300045976 Bacteria 2316
1273 Ga0466967_0225574 3300045976 Bacteria 1782
1274 Ga0466967_0258201 3300045976 Bacteria 1666
1275 Ga0466967_0288572 3300045976 Bacteria 1576
1276 Ga0495617_000001 3300046452 Bacteria 877032
1277 Ga0495617_000136 3300046452 Bacteria 48660
1278 Ga0495617_004796 3300046452 Bacteria 4877
1279 Ga0495617_079606 3300046452 Bacteria 1074
1280 Ga0495627_000059 3300046453 Bacteria 142466
1281 Ga0495627_000652 3300046453 Bacteria 26760
1282 Ga0495627_016526 3300046453 Bacteria 2524
1283 Ga0495627_018979 3300046453 Bacteria 2311
1284 Ga0495592_0000595 3300046454 Bacteria 25585
1285 Ga0495592_0026218 3300046454 Bacteria 4420
1286 Ga0495592_0174190 3300046454 Bacteria 1471
1287 Ga0495603_0004236 3300046455 Bacteria 8542
1288 Ga0495603_0007396 3300046455 Bacteria 6603
1289 Ga0495603_0015152 3300046455 Bacteria 4664
1290 Ga0495603_0030739 3300046455 Bacteria 3234
1291 Ga0495603_0042012 3300046455 Bacteria 2734
1292 Ga0495590_0000013 3300046457 Bacteria 271977
1293 Ga0495590_0000190 3300046457 Bacteria 34691
1294 Ga0495590_0001612 3300046457 Bacteria 9652
1295 Ga0495590_0007581 3300046457 Bacteria 4175
1296 Ga0495590_0070432 3300046457 Bacteria 1226
1297 Ga0495590_0120095 3300046457 Bacteria 942
1298 Ga0495591_000093 3300046458 Bacteria 101289
1299 Ga0495591_002620 3300046458 Bacteria 9868
1300 Ga0495629_0003279 3300046459 Bacteria 12249
1301 Ga0495629_0143906 3300046459 Bacteria 1658
1302 Ga0495629_0244969 3300046459 Bacteria 1234
1303 Ga0495638_0000017 3300046460 Bacteria 391117
1304 Ga0495638_0011096 3300046460 Bacteria 6227
1305 Ga0495638_0016449 3300046460 Bacteria 4955
1306 Ga0495638_0047051 3300046460 Bacteria 2707
1307 Ga0495638_0096201 3300046460 Bacteria 1778
1308 Ga0495638_0114833 3300046460 Bacteria 1596
1309 Ga0495638_0117897 3300046460 Bacteria 1571
1310 Ga0495651_0045876 3300046462 Bacteria 3384
1311 Ga0495651_0053049 3300046462 Bacteria 3123
1312 Ga0495653_0054716 3300046463 Bacteria 3048
1313 Ga0495653_0093238 3300046463 Bacteria 2197
1314 Ga0495653_0193568 3300046463 Bacteria 1385
1315 Ga0495650_0000019 3300046471 Bacteria 533849
1316 Ga0495650_0000639 3300046471 Bacteria 46381
1317 Ga0495650_0000986 3300046471 Bacteria 32427
1318 Ga0495650_0001157 3300046471 Bacteria 28359
1319 Ga0495650_0005088 3300046471 Bacteria 8692
1320 Ga0495650_0006516 3300046471 Bacteria 7255
1321 Ga0495650_0015152 3300046471 Bacteria 3968
1322 Ga0495650_0019183 3300046471 Bacteria 3376
1323 Ga0495650_0059685 3300046471 Bacteria 1535
1324 Ga0495650_0140119 3300046471 Bacteria 875
1325 Ga0495580_0054114 3300046472 Bacteria 2832
1326 Ga0495582_0000544 3300046473 Bacteria 20822
1327 Ga0495582_0001041 3300046473 Bacteria 15554
1328 Ga0495605_0000028 3300046474 Bacteria 218471
1329 Ga0495605_0000035 3300046474 Bacteria 208069
1330 Ga0495605_0000076 3300046474 Bacteria 128699
1331 Ga0495605_0000237 3300046474 Bacteria 66607
1332 Ga0495605_0000980 3300046474 Bacteria 19420
1333 Ga0495605_0001282 3300046474 Bacteria 16650
1334 Ga0495605_0003493 3300046474 Bacteria 9346
1335 Ga0495605_0019919 3300046474 Bacteria 3572
1336 Ga0495605_0022662 3300046474 Bacteria 3313
1337 Ga0495605_0069122 3300046474 Bacteria 1673
1338 Ga0495605_0119821 3300046474 Bacteria 1193
1339 Ga0495639_0003081 3300046475 Bacteria 7253
1340 Ga0495639_0019455 3300046475 Bacteria 2964
1341 Ga0495639_0151845 3300046475 Bacteria 1118
1342 Ga0495639_0191586 3300046475 Bacteria 998
1343 Ga0495662_0011253 3300046476 Bacteria 4374
1344 Ga0495662_0057716 3300046476 Bacteria 1875
1345 Ga0495662_0119403 3300046476 Bacteria 1294
1346 Ga0495664_0057325 3300046477 Bacteria 2317
1347 Ga0495584_0000032 3300046491 Bacteria 99595
1348 Ga0495584_0000133 3300046491 Bacteria 51161
1349 Ga0495584_0003379 3300046491 Bacteria 8820
1350 Ga0495584_0006071 3300046491 Bacteria 6359
1351 Ga0495584_0011239 3300046491 Bacteria 4585
1352 Ga0495584_0015304 3300046491 Bacteria 3908
1353 Ga0495584_0022836 3300046491 Bacteria 3174
1354 Ga0495584_0041502 3300046491 Bacteria 2322
1355 Ga0495585_0000005 3300046492 Bacteria 328103
1356 Ga0495585_0000102 3300046492 Bacteria 91414
1357 Ga0495585_0000372 3300046492 Bacteria 43337
1358 Ga0495585_0001927 3300046492 Bacteria 15525
1359 Ga0495585_0002461 3300046492 Bacteria 13245
1360 Ga0495585_0002843 3300046492 Bacteria 12053
1361 Ga0495585_0008517 3300046492 Bacteria 6213
1362 Ga0495585_0015617 3300046492 Bacteria 4411
1363 Ga0495585_0016926 3300046492 Bacteria 4222
1364 Ga0495585_0025114 3300046492 Bacteria 3415
1365 Ga0495585_0045657 3300046492 Bacteria 2444
1366 Ga0495585_0049467 3300046492 Bacteria 2334
1367 Ga0495585_0092978 3300046492 Bacteria 1622
1368 Ga0495585_0112602 3300046492 Bacteria 1445
1369 Ga0495585_0120747 3300046492 Bacteria 1386
1370 Ga0495594_0000031 3300046499 Bacteria 65430
1371 Ga0495594_0003053 3300046499 Bacteria 8673
1372 Ga0495594_0028065 3300046499 Bacteria 3035
1373 Ga0495594_0224765 3300046499 Bacteria 1070
1374 Ga0495594_0302313 3300046499 Bacteria 911
1375 Ga0495596_0003968 3300046500 Bacteria 7315
1376 Ga0495596_0003996 3300046500 Bacteria 7275
1377 Ga0495596_0006165 3300046500 Bacteria 5562
1378 Ga0495596_0010741 3300046500 Bacteria 3975
1379 Ga0495607_0000036 3300046501 Bacteria 140259
1380 Ga0495607_0000552 3300046501 Bacteria 36630
1381 Ga0495607_0004505 3300046501 Bacteria 10222
1382 Ga0495607_0008021 3300046501 Bacteria 7251
1383 Ga0495607_0008847 3300046501 Bacteria 6855
1384 Ga0495607_0013919 3300046501 Bacteria 5254
1385 Ga0495607_0014645 3300046501 Bacteria 5098
1386 Ga0495607_0017867 3300046501 Bacteria 4538
1387 Ga0495607_0021124 3300046501 Bacteria 4099
1388 Ga0495607_0033574 3300046501 Bacteria 3121
1389 Ga0495607_0046391 3300046501 Bacteria 2552
1390 Ga0495607_0059816 3300046501 Bacteria 2171
1391 Ga0495607_0082447 3300046501 Bacteria 1764
1392 Ga0495607_0118756 3300046501 Bacteria 1391
1393 Ga0495607_0136064 3300046501 Bacteria 1272
1394 Ga0495583_0000060 3300046506 Bacteria 199091
1395 Ga0495583_0000089 3300046506 Bacteria 163349
1396 Ga0495583_0000189 3300046506 Bacteria 103518
1397 Ga0495583_0000556 3300046506 Bacteria 52180
1398 Ga0495583_0001050 3300046506 Bacteria 31085
1399 Ga0495583_0002653 3300046506 Bacteria 14907
1400 Ga0495583_0005548 3300046506 Bacteria 8526
1401 Ga0495583_0014895 3300046506 Bacteria 4258
1402 Ga0495583_0017140 3300046506 Bacteria 3859
1403 Ga0495583_0019376 3300046506 Bacteria 3554
1404 Ga0495583_0023425 3300046506 Bacteria 3124
1405 Ga0495583_0025343 3300046506 Bacteria 2964
1406 Ga0495583_0026086 3300046506 Bacteria 2905
1407 Ga0495583_0028153 3300046506 Bacteria 2766
1408 Ga0495606_0000439 3300046507 Bacteria 68784
1409 Ga0495606_0004300 3300046507 Bacteria 14339
1410 Ga0495606_0005719 3300046507 Bacteria 11764
1411 Ga0495606_0007813 3300046507 Bacteria 9454
1412 Ga0495606_0008822 3300046507 Bacteria 8647
1413 Ga0495606_0009227 3300046507 Bacteria 8379
1414 Ga0495606_0011054 3300046507 Bacteria 7406
1415 Ga0495606_0022813 3300046507 Bacteria 4549
1416 Ga0495606_0042594 3300046507 Bacteria 3034
1417 Ga0495606_0151774 3300046507 Bacteria 1359
1418 Ga0495606_0242403 3300046507 Bacteria 1004
1419 Ga0495608_0018088 3300046511 Bacteria 4869
1420 Ga0495608_0058873 3300046511 Bacteria 2532
1421 Ga0495608_0078126 3300046511 Bacteria 2154
1422 Ga0495610_0000827 3300046512 Bacteria 28920
1423 Ga0495610_0003263 3300046512 Bacteria 12798
1424 Ga0495610_0004841 3300046512 Bacteria 9804
1425 Ga0495610_0016000 3300046512 Bacteria 4337
1426 Ga0495610_0054955 3300046512 Bacteria 1921
1427 Ga0495616_0000184 3300046513 Bacteria 52694
1428 Ga0495616_0000470 3300046513 Bacteria 30663
1429 Ga0495616_0001773 3300046513 Bacteria 14679
1430 Ga0495616_0005259 3300046513 Bacteria 7989
1431 Ga0495616_0005376 3300046513 Bacteria 7898
1432 Ga0495616_0010626 3300046513 Bacteria 5319
1433 Ga0495616_0019927 3300046513 Bacteria 3654
1434 Ga0495616_0021888 3300046513 Bacteria 3456
1435 Ga0495616_0022669 3300046513 Bacteria 3388
1436 Ga0495616_0023795 3300046513 Bacteria 3292
1437 Ga0495616_0029015 3300046513 Bacteria 2924
1438 Ga0495616_0055306 3300046513 Bacteria 1965
1439 Ga0495616_0090386 3300046513 Bacteria 1450
1440 Ga0495618_0071799 3300046514 Bacteria 2202
1441 Ga0495618_0204161 3300046514 Bacteria 1250
1442 Ga0495618_0213574 3300046514 Bacteria 1219
1443 Ga0495628_0004979 3300046516 Bacteria 11671
1444 Ga0495628_0041101 3300046516 Bacteria 3691
1445 Ga0495630_0213321 3300046517 Bacteria 1473
1446 Ga0495630_0344858 3300046517 Bacteria 1140
1447 Ga0495630_0448450 3300046517 Bacteria 989
1448 Ga0495631_0000524 3300046518 Bacteria 25774
1449 Ga0495631_0002588 3300046518 Bacteria 10119
1450 Ga0495631_0006122 3300046518 Bacteria 6237
1451 Ga0495631_0047019 3300046518 Bacteria 1896
1452 Ga0495631_0059611 3300046518 Bacteria 1657
1453 Ga0495631_0061136 3300046518 Bacteria 1634
1454 Ga0495631_0065441 3300046518 Bacteria 1573
1455 Ga0495631_0100819 3300046518 Bacteria 1242
1456 Ga0495631_0123251 3300046518 Bacteria 1114
1457 Ga0495632_0000081 3300046519 Bacteria 99136
1458 Ga0495632_0000131 3300046519 Bacteria 76622
1459 Ga0495632_0000158 3300046519 Bacteria 70148
1460 Ga0495632_0000670 3300046519 Bacteria 31311
1461 Ga0495632_0001125 3300046519 Bacteria 22872
1462 Ga0495632_0004344 3300046519 Bacteria 9656
1463 Ga0495632_0019823 3300046519 Bacteria 3655
1464 Ga0495632_0116745 3300046519 Bacteria 1249
1465 Ga0495637_0000008 3300046520 Bacteria 404658
1466 Ga0495637_0002748 3300046520 Bacteria 9569
1467 Ga0495637_0004319 3300046520 Bacteria 7378
1468 Ga0495637_0025346 3300046520 Bacteria 2673
1469 Ga0495643_0000411 3300046522 Bacteria 56229
1470 Ga0495643_0000630 3300046522 Bacteria 41718
1471 Ga0495643_0000838 3300046522 Bacteria 33397
1472 Ga0495643_0002366 3300046522 Bacteria 15095
1473 Ga0495643_0006464 3300046522 Bacteria 7721
1474 Ga0495643_0006564 3300046522 Bacteria 7652
1475 Ga0495643_0007363 3300046522 Bacteria 7111
1476 Ga0495643_0017826 3300046522 Bacteria 4142
1477 Ga0495643_0023025 3300046522 Bacteria 3545
1478 Ga0495643_0032280 3300046522 Bacteria 2908
1479 Ga0495643_0085779 3300046522 Bacteria 1632
1480 Ga0495643_0162764 3300046522 Bacteria 1097
1481 Ga0495643_0171428 3300046522 Bacteria 1061
1482 Ga0495644_0000039 3300046523 Bacteria 62889
1483 Ga0495644_0003720 3300046523 Bacteria 6004
1484 Ga0495644_0022076 3300046523 Bacteria 2426
1485 Ga0495644_0055071 3300046523 Bacteria 1494
1486 Ga0495648_0000040 3300046524 Bacteria 184782
1487 Ga0495648_0000076 3300046524 Bacteria 129413
1488 Ga0495648_0000692 3300046524 Bacteria 35954
1489 Ga0495648_0000725 3300046524 Bacteria 35197
1490 Ga0495648_0010937 3300046524 Bacteria 6882
1491 Ga0495648_0016532 3300046524 Bacteria 5317
1492 Ga0495648_0055532 3300046524 Bacteria 2387
1493 Ga0495648_0058032 3300046524 Bacteria 2317
1494 Ga0495648_0070277 3300046524 Bacteria 2035
1495 Ga0495648_0071213 3300046524 Bacteria 2016
1496 Ga0495648_0151448 3300046524 Bacteria 1209
1497 Ga0495648_0164980 3300046524 Bacteria 1141
1498 Ga0495663_0009833 3300046525 Bacteria 2655
1499 Ga0495663_0026263 3300046525 Bacteria 1704
1500 Ga0495666_0002773 3300046526 Bacteria 8751
1501 Ga0495666_0022417 3300046526 Bacteria 3127
1502 Ga0495666_0031246 3300046526 Bacteria 2609
1503 Ga0495666_0062438 3300046526 Bacteria 1779
1504 Ga0495642_0000189 3300046528 Bacteria 36338
1505 Ga0495642_0000277 3300046528 Bacteria 29043
1506 Ga0495642_0000528 3300046528 Bacteria 19457
1507 Ga0495642_0000678 3300046528 Bacteria 16895
1508 Ga0495642_0001824 3300046528 Bacteria 9119
1509 Ga0495642_0002246 3300046528 Bacteria 7907
1510 Ga0495642_0002999 3300046528 Bacteria 6728
1511 Ga0495642_0012392 3300046528 Bacteria 3287
1512 Ga0495642_0017257 3300046528 Bacteria 2819
1513 Ga0495642_0029043 3300046528 Bacteria 2206
1514 Ga0495642_0034519 3300046528 Bacteria 2038
1515 Ga0495642_0039534 3300046528 Bacteria 1914
1516 Ga0495642_0067973 3300046528 Bacteria 1486
1517 Ga0495642_0154828 3300046528 Bacteria 992
1518 Ga0495652_0056744 3300046529 Bacteria 3324
1519 Ga0495652_0099344 3300046529 Bacteria 2363
1520 Ga0495654_0000015 3300046530 Bacteria 307873
1521 Ga0495654_0003919 3300046530 Bacteria 8985
1522 Ga0495654_0008909 3300046530 Bacteria 5514
1523 Ga0495654_0021731 3300046530 Bacteria 3336
1524 Ga0495654_0049306 3300046530 Bacteria 2063
1525 Ga0495654_0118559 3300046530 Bacteria 1200
1526 Ga0495665_0022066 3300046531 Bacteria 3423
1527 Ga0495640_0030349 3300046533 Bacteria 3871
1528 Ga0495640_0040738 3300046533 Bacteria 3251
1529 Ga0495640_0050764 3300046533 Bacteria 2855
1530 Ga0495640_0068269 3300046533 Bacteria 2393
1531 Ga0495586_0005815 3300046535 Bacteria 6593
1532 Ga0495587_0005285 3300046536 Bacteria 8442
1533 Ga0495587_0102537 3300046536 Bacteria 1647
1534 Ga0495598_0036875 3300046537 Bacteria 1407
1535 Ga0495609_0000027 3300046538 Bacteria 234661
1536 Ga0495609_0000039 3300046538 Bacteria 179384
1537 Ga0495609_0000474 3300046538 Bacteria 32477
1538 Ga0495609_0000835 3300046538 Bacteria 22876
1539 Ga0495609_0003324 3300046538 Bacteria 9273
1540 Ga0495609_0006187 3300046538 Bacteria 6154
1541 Ga0495609_0067748 3300046538 Bacteria 1571
1542 Ga0495609_0073102 3300046538 Bacteria 1504
1543 Ga0495609_0103483 3300046538 Bacteria 1232
1544 Ga0495609_0171723 3300046538 Bacteria 915
1545 Ga0495621_0003432 3300046539 Bacteria 4378
1546 Ga0495621_0023578 3300046539 Bacteria 2048
1547 Ga0495621_0101987 3300046539 Bacteria 1093
1548 Ga0495597_0000549 3300046542 Bacteria 31160
1549 Ga0495597_0001049 3300046542 Bacteria 21122
1550 Ga0495597_0001202 3300046542 Bacteria 19367
1551 Ga0495597_0001493 3300046542 Bacteria 16745
1552 Ga0495597_0001770 3300046542 Bacteria 14826
1553 Ga0495597_0002271 3300046542 Bacteria 12493
1554 Ga0495597_0006651 3300046542 Bacteria 5958
1555 Ga0495597_0015929 3300046542 Bacteria 3555
1556 Ga0495597_0044465 3300046542 Bacteria 1975
1557 Ga0495597_0049873 3300046542 Bacteria 1849
1558 Ga0495597_0068567 3300046542 Bacteria 1532
1559 Ga0495597_0076293 3300046542 Bacteria 1437
1560 Ga0495645_0019079 3300046543 Bacteria 4936
1561 Ga0495645_0046679 3300046543 Bacteria 3156
1562 Ga0495645_0135443 3300046543 Bacteria 1723
1563 Ga0495622_0000001 3300046557 Bacteria 365248
1564 Ga0495622_0000169 3300046557 Bacteria 53731
1565 Ga0495622_0000313 3300046557 Bacteria 35947
1566 Ga0495622_0001209 3300046557 Bacteria 13287
1567 Ga0495622_0001289 3300046557 Bacteria 12869
1568 Ga0495622_0007366 3300046557 Bacteria 5106
1569 Ga0495622_0062851 3300046557 Bacteria 1718
1570 Ga0495633_0000639 3300046558 Bacteria 32745
1571 Ga0495633_0000994 3300046558 Bacteria 23234
1572 Ga0495633_0003756 3300046558 Bacteria 9985
1573 Ga0495633_0005487 3300046558 Bacteria 7725
1574 Ga0495633_0005666 3300046558 Bacteria 7561
1575 Ga0495633_0006063 3300046558 Bacteria 7248
1576 Ga0495633_0018419 3300046558 Bacteria 3548
1577 Ga0495633_0027900 3300046558 Bacteria 2754
1578 Ga0495633_0029394 3300046558 Bacteria 2674
1579 Ga0495633_0036983 3300046558 Bacteria 2337
1580 Ga0495633_0041796 3300046558 Bacteria 2179
1581 Ga0495633_0161876 3300046558 Bacteria 1032
1582 Ga0495667_0029765 3300046559 Bacteria 3674
1583 Ga0495667_0038117 3300046559 Bacteria 3201
1584 Ga0495667_0070393 3300046559 Bacteria 2282
1585 Ga0495667_0171116 3300046559 Bacteria 1396
1586 Ga0495667_0268511 3300046559 Bacteria 1084
1587 Ga0495667_0460783 3300046559 Bacteria 798
1588 Ga0495656_0000088 3300046615 Bacteria 40432
1589 Ga0495656_0020272 3300046615 Bacteria 2577
1590 Ga0495656_0026925 3300046615 Bacteria 2293
1591 Ga0495656_0039481 3300046615 Bacteria 1961
1592 Ga0495668_0000285 3300046616 Bacteria 70023
1593 Ga0495668_0000372 3300046616 Bacteria 59316
1594 Ga0495668_0000824 3300046616 Bacteria 35498
1595 Ga0495668_0000846 3300046616 Bacteria 34719
1596 Ga0495668_0003555 3300046616 Bacteria 11582
1597 Ga0495668_0004674 3300046616 Bacteria 9610
1598 Ga0495668_0005109 3300046616 Bacteria 9023
1599 Ga0495668_0007709 3300046616 Bacteria 6841
1600 Ga0495668_0012991 3300046616 Bacteria 4928
1601 Ga0495668_0021804 3300046616 Bacteria 3667
1602 Ga0495668_0023900 3300046616 Bacteria 3479
1603 Ga0495668_0024412 3300046616 Bacteria 3438
1604 Ga0495668_0099887 3300046616 Bacteria 1587
1605 Ga0495668_0208411 3300046616 Bacteria 1070
1606 Ga0495634_0004556 3300046642 Bacteria 10832
1607 Ga0495634_0072068 3300046642 Bacteria 2273
1608 Ga0495634_0150602 3300046642 Bacteria 1471
1609 Ga0495634_0183337 3300046642 Bacteria 1309
1610 Ga0495611_0001061 3300046648 Bacteria 14518
1611 Ga0495611_0005501 3300046648 Bacteria 5413
1612 Ga0495611_0006168 3300046648 Bacteria 5115
1613 Ga0495611_0008403 3300046648 Bacteria 4372
1614 Ga0495611_0105816 3300046648 Bacteria 1308
1615 Ga0495625_0001158 3300046660 Bacteria 33991
1616 Ga0495625_0001223 3300046660 Bacteria 32564
1617 Ga0495625_0001275 3300046660 Bacteria 31649
1618 Ga0495625_0001807 3300046660 Bacteria 24546
1619 Ga0495625_0002327 3300046660 Bacteria 20779
1620 Ga0495625_0008880 3300046660 Bacteria 8503
1621 Ga0495625_0010557 3300046660 Bacteria 7628
1622 Ga0495625_0027204 3300046660 Bacteria 4310
1623 Ga0495625_0040824 3300046660 Bacteria 3381
1624 Ga0495625_0041790 3300046660 Bacteria 3335
1625 Ga0495625_0051755 3300046660 Bacteria 2943
1626 Ga0495625_0217019 3300046660 Bacteria 1255
1627 Ga0495635_0001591 3300046663 Bacteria 15279
1628 Ga0495635_0025030 3300046663 Bacteria 4159
1629 Ga0495635_0054041 3300046663 Bacteria 2766
1630 Ga0495635_0054994 3300046663 Bacteria 2742
1631 Ga0495635_0078916 3300046663 Bacteria 2253
1632 Ga0495635_0090456 3300046663 Bacteria 2093
1633 Ga0495635_0250817 3300046663 Bacteria 1193
1634 Ga0495659_0000703 3300046664 Bacteria 12064
1635 Ga0495659_0030057 3300046664 Bacteria 1888
1636 Ga0495661_0000670 3300046665 Bacteria 34283
1637 Ga0495661_0000934 3300046665 Bacteria 26601
1638 Ga0495661_0001453 3300046665 Bacteria 19833
1639 Ga0495661_0001840 3300046665 Bacteria 16963
1640 Ga0495661_0002287 3300046665 Bacteria 14803
1641 Ga0495661_0014195 3300046665 Bacteria 5337
1642 Ga0495661_0021727 3300046665 Bacteria 4179
1643 Ga0495661_0021839 3300046665 Bacteria 4166
1644 Ga0495661_0028906 3300046665 Bacteria 3543
1645 Ga0495661_0031334 3300046665 Bacteria 3377
1646 Ga0495661_0039473 3300046665 Bacteria 2933
1647 Ga0495661_0085074 3300046665 Bacteria 1813
1648 Ga0495661_0176146 3300046665 Bacteria 1136
1649 Ga0495661_0199593 3300046665 Bacteria 1048
1650 Ga0495661_0208561 3300046665 Bacteria 1019
1651 Ga0495588_0000110 3300046674 Bacteria 142825
1652 Ga0495588_0004725 3300046674 Bacteria 6020
1653 Ga0495588_0016215 3300046674 Bacteria 3598
1654 Ga0495588_0019440 3300046674 Bacteria 3326
1655 Ga0495588_0030329 3300046674 Bacteria 2717
1656 Ga0495588_0035811 3300046674 Bacteria 2516
1657 Ga0495588_0045308 3300046674 Bacteria 2254
1658 Ga0495588_0064287 3300046674 Bacteria 1903
1659 Ga0495657_0011094 3300046675 Bacteria 6755
1660 Ga0495657_0023793 3300046675 Bacteria 4373
1661 Ga0495599_0001552 3300046678 Bacteria 13225
1662 Ga0495599_0042760 3300046678 Bacteria 2843
1663 Ga0495623_0002996 3300046679 Bacteria 11107
1664 Ga0495623_0009356 3300046679 Bacteria 6364
1665 Ga0495623_0016449 3300046679 Bacteria 4778
1666 Ga0495623_0034314 3300046679 Bacteria 3254
1667 Ga0495646_0023632 3300046680 Bacteria 3869
1668 Ga0495646_0105430 3300046680 Bacteria 1611
1669 Ga0495646_0173561 3300046680 Bacteria 1186
1670 Ga0495646_0205214 3300046680 Bacteria 1072
1671 Ga0495646_0274667 3300046680 Bacteria 897
1672 Ga0495658_0012539 3300046683 Bacteria 4297
1673 Ga0495658_0027552 3300046683 Bacteria 3059
1674 Ga0495658_0119206 3300046683 Bacteria 1594
1675 Ga0495669_0000041 3300046684 Bacteria 88966
1676 Ga0495669_0000446 3300046684 Bacteria 19520
1677 Ga0495669_0001599 3300046684 Bacteria 9303
1678 Ga0495669_0003983 3300046684 Bacteria 6077
1679 Ga0495669_0008049 3300046684 Bacteria 4423
1680 Ga0495669_0039458 3300046684 Bacteria 2091
1681 Ga0495669_0066734 3300046684 Bacteria 1634
1682 Ga0495613_0051970 3300046689 Bacteria 3019
1683 Ga0495613_0364459 3300046689 Bacteria 990
1684 Ga0495624_0038663 3300046690 Bacteria 3064
1685 Ga0495624_0061255 3300046690 Bacteria 2358
1686 Ga0495624_0163457 3300046690 Bacteria 1359
1687 Ga0495670_0003286 3300046691 Bacteria 7962
1688 Ga0495670_0008893 3300046691 Bacteria 4940
1689 Ga0495670_0017924 3300046691 Bacteria 3487
1690 Ga0495670_0021655 3300046691 Bacteria 3171
1691 Ga0495670_0050522 3300046691 Bacteria 2081
1692 Ga0495671_0000098 3300046692 Bacteria 80588
1693 Ga0495671_0000099 3300046692 Bacteria 79624
1694 Ga0495671_0002109 3300046692 Bacteria 12710
1695 Ga0495671_0007220 3300046692 Bacteria 6352
1696 Ga0495671_0013285 3300046692 Bacteria 4467
1697 Ga0495649_0000459 3300046694 Bacteria 35147
1698 Ga0495649_0003578 3300046694 Bacteria 10419
1699 Ga0495649_0004396 3300046694 Bacteria 9216
1700 Ga0495649_0022106 3300046694 Bacteria 3561
1701 Ga0495649_0028804 3300046694 Bacteria 3078
1702 Ga0495649_0055790 3300046694 Bacteria 2134
1703 Ga0495649_0160316 3300046694 Bacteria 1179
1704 Ga0495589_0000019 3300046794 Bacteria 200814
1705 Ga0495589_0000265 3300046794 Bacteria 42827
1706 Ga0495589_0000706 3300046794 Bacteria 21736
1707 Ga0495589_0001969 3300046794 Bacteria 11630
1708 Ga0495589_0013381 3300046794 Bacteria 4234
1709 Ga0495600_0018280 3300046809 Bacteria 4464
1710 Ga0495600_0030602 3300046809 Bacteria 3486
1711 Ga0495600_0435544 3300046809 Bacteria 812
1712 Ga0495660_0000245 3300046810 Bacteria 53011
1713 Ga0495660_0000260 3300046810 Bacteria 50150
1714 Ga0495660_0002812 3300046810 Bacteria 10952
1715 Ga0495660_0004392 3300046810 Bacteria 8540
1716 Ga0495660_0005311 3300046810 Bacteria 7716
1717 Ga0495660_0007039 3300046810 Bacteria 6629
1718 Ga0495660_0017900 3300046810 Bacteria 4075
1719 Ga0495660_0018054 3300046810 Bacteria 4057
1720 Ga0495660_0024296 3300046810 Bacteria 3452
1721 Ga0495660_0029664 3300046810 Bacteria 3085
1722 Ga0495660_0073975 3300046810 Bacteria 1801
1723 Ga0495660_0160512 3300046810 Bacteria 1103
1724 Ga0495581_0003117 3300047315 Bacteria 9493
1725 Ga0495581_0011358 3300047315 Bacteria 5153
1726 Ga0495581_0074550 3300047315 Bacteria 1963
1727 Ga0495581_0117697 3300047315 Bacteria 1545
1728 Ga0495581_0129853 3300047315 Bacteria 1468
1729 Ga0495581_0175152 3300047315 Bacteria 1254
1730 Ga0495581_0178220 3300047315 Bacteria 1243
1731 Ga0495604_0009489 3300047317 Bacteria 7692
1732 Ga0495604_0019964 3300047317 Bacteria 5356
1733 Ga0495604_0034746 3300047317 Bacteria 3987
1734 Ga0495604_0038250 3300047317 Bacteria 3775
1735 Ga0495604_0061157 3300047317 Bacteria 2881
1736 Ga0495604_0194411 3300047317 Bacteria 1412
1737 Ga0495604_0355670 3300047317 Bacteria 972
1738 Ga0495636_0001337 3300047318 Bacteria 9361
1739 Ga0495636_0004929 3300047318 Bacteria 5233
1740 Ga0495636_0005764 3300047318 Bacteria 4853
1741 Ga0495674_0005253 3300047319 Bacteria 12425
1742 Ga0495674_0010902 3300047319 Bacteria 8592
1743 Ga0495674_0015343 3300047319 Bacteria 7166
1744 Ga0495674_0187831 3300047319 Bacteria 1719
1745 Ga0495674_0206086 3300047319 Bacteria 1630
1746 Ga0495674_0313585 3300047319 Bacteria 1279
1747 Ga0495672_0000021 3300047320 Bacteria 422795
1748 Ga0495672_0000033 3300047320 Bacteria 291992
1749 Ga0495672_0000121 3300047320 Bacteria 121680
1750 Ga0495672_0000683 3300047320 Bacteria 37856
1751 Ga0495672_0001337 3300047320 Bacteria 24480
1752 Ga0495672_0002894 3300047320 Bacteria 15185
1753 Ga0495672_0003756 3300047320 Bacteria 12789
1754 Ga0495672_0007060 3300047320 Bacteria 8524
1755 Ga0495676_0001982 3300047321 Bacteria 18000
1756 Ga0495676_0047857 3300047321 Bacteria 3453
1757 Ga0495676_0098815 3300047321 Bacteria 2164
1758 Ga0495676_0314941 3300047321 Bacteria 1052
1759 Ga0495680_0011708 3300047322 Bacteria 7749
1760 Ga0495680_0036730 3300047322 Bacteria 3930
1761 Ga0495680_0041707 3300047322 Bacteria 3647
1762 Ga0495680_0050236 3300047322 Bacteria 3262
1763 Ga0495683_0000024 3300047323 Bacteria 156554
1764 Ga0495683_0000533 3300047323 Bacteria 28850
1765 Ga0495683_0016509 3300047323 Bacteria 3833
1766 Ga0495683_0025469 3300047323 Bacteria 3032
1767 Ga0495683_0032599 3300047323 Bacteria 2653
1768 Ga0495687_000002 3300047443 Bacteria 1085770
1769 Ga0495687_000059 3300047443 Bacteria 179357
1770 Ga0495687_000189 3300047443 Bacteria 89686
1771 Ga0495687_001313 3300047443 Bacteria 23253
1772 Ga0495687_001331 3300047443 Bacteria 23029
1773 Ga0495687_001377 3300047443 Bacteria 22479
1774 Ga0495687_011487 3300047443 Bacteria 4755
1775 Ga0495687_013572 3300047443 Bacteria 4241
1776 Ga0495687_038813 3300047443 Bacteria 2110
1777 Ga0495675_0007286 3300047444 Bacteria 6814
1778 Ga0495675_0084713 3300047444 Bacteria 1994
1779 Ga0495675_0200044 3300047444 Bacteria 1216
1780 Ga0495677_0000006 3300047445 Bacteria 199230
1781 Ga0495677_0000931 3300047445 Bacteria 11799
1782 Ga0495677_0001290 3300047445 Bacteria 10013
1783 Ga0495677_0003707 3300047445 Bacteria 5916
1784 Ga0495677_0004084 3300047445 Bacteria 5636
1785 Ga0495677_0019670 3300047445 Bacteria 2448
1786 Ga0495677_0030002 3300047445 Bacteria 1978
1787 Ga0495677_0041345 3300047445 Bacteria 1686
1788 Ga0495677_0130890 3300047445 Bacteria 960
1789 Ga0495679_009620 3300047446 Bacteria 3854
1790 Ga0495679_022776 3300047446 Bacteria 2138
1791 Ga0495679_031590 3300047446 Bacteria 1707
1792 Ga0495679_035006 3300047446 Bacteria 1594
1793 Ga0495679_050089 3300047446 Bacteria 1257
1794 Ga0495685_001524 3300047447 Bacteria 7103
1795 Ga0495685_022177 3300047447 Bacteria 2185
1796 Ga0495685_045869 3300047447 Bacteria 1488
1797 Ga0495685_064586 3300047447 Bacteria 1231
1798 Ga0495673_0000003 3300047469 Bacteria 1491337
1799 Ga0495673_0000285 3300047469 Bacteria 68361
1800 Ga0495681_0000379 3300047470 Bacteria 34761
1801 Ga0495681_0000687 3300047470 Bacteria 25778
1802 Ga0495681_0005905 3300047470 Bacteria 8122
1803 Ga0495681_0006283 3300047470 Bacteria 7827
1804 Ga0495681_0006657 3300047470 Bacteria 7546
1805 Ga0495681_0010499 3300047470 Bacteria 5603
1806 Ga0495681_0019386 3300047470 Bacteria 3716
1807 Ga0495681_0035431 3300047470 Bacteria 2477
1808 Ga0495681_0048832 3300047470 Bacteria 2004
1809 Ga0495681_0069570 3300047470 Bacteria 1598
1810 Ga0495684_0088652 3300047471 Bacteria 2345
1811 Ga0495684_0163294 3300047471 Bacteria 1660
1812 Ga0495686_0000346 3300047472 Bacteria 76209
1813 Ga0495686_0001786 3300047472 Bacteria 21857
1814 Ga0495686_0007951 3300047472 Bacteria 7866
1815 Ga0495593_0001247 3300047673 Bacteria 14918
1816 Ga0495593_0006045 3300047673 Bacteria 7121
1817 Ga0495593_0009491 3300047673 Bacteria 5644
1818 Ga0495593_0049703 3300047673 Bacteria 2224
1819 Ga0495593_0192361 3300047673 Bacteria 1026
1820 Ga0495602_0005586 3300048088 Bacteria 13201
1821 Ga0495602_0028466 3300048088 Bacteria 5345
1822 Ga0495602_0132657 3300048088 Bacteria 1984
1823 Ga0495602_0231401 3300048088 Bacteria 1388
1824 Ga0495614_0003005 3300048089 Bacteria 7515
1825 Ga0495614_0003116 3300048089 Bacteria 7387
1826 Ga0495615_0007285 3300048090 Bacteria 2093
1827 Ga0495615_0013391 3300048090 Bacteria 1712
1828 Ga0495626_0000103 3300048091 Bacteria 110163
1829 Ga0495626_0000494 3300048091 Bacteria 39727
1830 Ga0495626_0000821 3300048091 Bacteria 27909
1831 Ga0495626_0000873 3300048091 Bacteria 26811
1832 Ga0495626_0005960 3300048091 Bacteria 7011
1833 Ga0495626_0006175 3300048091 Bacteria 6852
1834 Ga0495626_0017458 3300048091 Bacteria 3621
1835 Ga0495626_0029391 3300048091 Bacteria 2660
1836 Ga0495626_0042744 3300048091 Bacteria 2128
1837 Ga0495626_0045573 3300048091 Bacteria 2046
1838 Ga0495626_0058537 3300048091 Bacteria 1760
1839 Ga0495626_0193556 3300048091 Bacteria 837
1840 Ga0496100_0004874 3300048903 Bacteria 7171
1841 Ga0496100_0011282 3300048903 Bacteria 5083
1842 Ga0496100_0021043 3300048903 Bacteria 3922
1843 Ga0496100_0537468 3300048903 Bacteria 903
1844 Ga0496101_0000838 3300048904 Bacteria 18079
1845 Ga0496101_0009867 3300048904 Bacteria 6289
1846 Ga0496101_0135884 3300048904 Bacteria 1871
1847 Ga0496102_0000701 3300048905 Bacteria 33278
1848 Ga0496102_0022672 3300048905 Bacteria 5564
1849 Ga0496102_0047983 3300048905 Bacteria 3882
1850 Ga0496102_0049797 3300048905 Bacteria 3812
1851 Ga0496102_0070563 3300048905 Bacteria 3208
1852 Ga0496102_0115080 3300048905 Bacteria 2509
1853 Ga0496102_0146856 3300048905 Bacteria 2214
1854 Ga0496102_0317191 3300048905 Bacteria 1468
1855 Ga0496102_0352211 3300048905 Bacteria 1386
1856 Ga0496102_0369493 3300048905 Bacteria 1350
1857 Ga0496102_0464125 3300048905 Bacteria 1187
1858 Ga0496102_0601627 3300048905 Bacteria 1022
1859 Ga0496103_0005533 3300048906 Bacteria 7554
1860 Ga0496103_0040732 3300048906 Bacteria 2854
1861 Ga0496103_0044915 3300048906 Bacteria 2724
1862 Ga0496103_0139394 3300048906 Bacteria 1550
1863 Ga0496104_0000311 3300048907 Bacteria 43387
1864 Ga0496104_0014512 3300048907 Bacteria 7116
1865 Ga0496104_0021711 3300048907 Bacteria 5896
1866 Ga0496104_0104525 3300048907 Bacteria 2713
1867 Ga0496104_0133450 3300048907 Bacteria 2385
1868 Ga0496104_0155734 3300048907 Bacteria 2192
1869 Ga0496104_0303814 3300048907 Bacteria 1508
1870 Ga0496104_0311454 3300048907 Bacteria 1487
1871 Ga0496104_0342599 3300048907 Bacteria 1408
1872 Ga0496105_0001878 3300048908 Bacteria 15073
1873 Ga0496105_0038775 3300048908 Bacteria 3926
1874 Ga0496105_0046294 3300048908 Bacteria 3590
1875 Ga0496105_0048269 3300048908 Bacteria 3514
1876 Ga0496105_0253570 3300048908 Bacteria 1425
1877 Ga0496105_0362677 3300048908 Bacteria 1156
1878 Ga0496106_0016541 3300048909 Bacteria 5458
1879 Ga0496106_0023503 3300048909 Bacteria 4579
1880 Ga0496106_0051026 3300048909 Bacteria 3119
1881 Ga0496106_0058136 3300048909 Bacteria 2926
1882 Ga0496106_0070083 3300048909 Bacteria 2677
1883 Ga0496107_0011603 3300048910 Bacteria 6142
1884 Ga0496107_0034722 3300048910 Bacteria 3613
1885 Ga0496107_0037783 3300048910 Bacteria 3465
1886 Ga0496107_0146038 3300048910 Bacteria 1749
1887 Ga0496107_0333727 3300048910 Bacteria 1128
1888 Ga0496108_0019783 3300048911 Bacteria 5530
1889 Ga0496108_0105166 3300048911 Bacteria 2409
1890 Ga0496108_0460203 3300048911 Bacteria 1111
1891 Ga0496109_0025836 3300048912 Bacteria 5234
1892 Ga0496109_0045584 3300048912 Bacteria 3979
1893 Ga0496109_0083069 3300048912 Bacteria 2954
1894 Ga0496109_0185495 3300048912 Bacteria 1955
1895 Ga0496109_0251540 3300048912 Bacteria 1664
1896 Ga0496109_0419648 3300048912 Bacteria 1264
1897 Ga0496110_0002021 3300048913 Bacteria 15103
1898 Ga0496110_0010486 3300048913 Bacteria 7541
1899 Ga0496110_0013235 3300048913 Bacteria 6812
1900 Ga0496110_0032539 3300048913 Bacteria 4505
1901 Ga0496110_0075224 3300048913 Bacteria 3000
1902 Ga0496110_0425143 3300048913 Bacteria 1211
1903 Ga0496110_0553905 3300048913 Bacteria 1045
1904 Ga0496112_0079486 3300048915 Bacteria 3244
1905 Ga0496112_0320975 3300048915 Bacteria 1493
1906 Ga0496112_0620212 3300048915 Bacteria 1013
1907 Ga0496113_0003727 3300048916 Bacteria 9189
1908 Ga0496113_0042149 3300048916 Bacteria 3371
1909 Ga0496113_0112092 3300048916 Bacteria 2124
1910 Ga0496113_0196617 3300048916 Bacteria 1602
1911 Ga0496113_0291943 3300048916 Bacteria 1305
1912 Ga0496114_0012881 3300048917 Bacteria 6698
1913 Ga0496114_0042835 3300048917 Bacteria 3753
1914 Ga0496114_0061430 3300048917 Bacteria 3143
1915 Ga0496114_0075946 3300048917 Bacteria 2830
1916 Ga0496114_0095377 3300048917 Bacteria 2531
1917 Ga0496114_0097338 3300048917 Bacteria 2506
1918 Ga0496114_0322026 3300048917 Bacteria 1366
1919 Ga0496115_0020859 3300048918 Bacteria 5057
1920 Ga0496115_0081790 3300048918 Bacteria 2630
1921 Ga0496115_0093554 3300048918 Bacteria 2458
1922 Ga0496116_0157115 3300048919 Bacteria 1253
1923 Ga0496116_0212724 3300048919 Bacteria 1000
1924 Ga0496117_0008046 3300048920 Bacteria 10108
1925 Ga0496118_0001041 3300048921 Bacteria 43205
1926 Ga0496118_0032414 3300048921 Bacteria 4305
1927 Ga0496118_0102934 3300048921 Bacteria 1923
1928 Ga0496119_0001419 3300048922 Bacteria 29009
1929 Ga0496119_0071905 3300048922 Bacteria 2023
1930 Ga0496120_0001068 3300048923 Bacteria 36230
1931 Ga0496120_0008014 3300048923 Bacteria 7773
1932 Ga0496120_0109562 3300048923 Bacteria 1445
1933 Ga0496121_0003531 3300048924 Bacteria 22194
1934 Ga0496121_0152718 3300048924 Bacteria 1697
1935 Ga0496121_0159115 3300048924 Bacteria 1654
1936 Ga0496121_0203898 3300048924 Bacteria 1407
1937 Ga0496122_0000572 3300048925 Bacteria 75443
1938 Ga0496122_0005337 3300048925 Bacteria 15366
1939 Ga0496122_0029955 3300048925 Bacteria 4572
1940 Ga0496122_0040101 3300048925 Bacteria 3727
1941 Ga0496122_0060095 3300048925 Bacteria 2801
1942 Ga0496123_0001313 3300048926 Bacteria 35202
1943 Ga0496123_0005181 3300048926 Bacteria 13258
1944 Ga0496123_0022778 3300048926 Bacteria 4815
1945 Ga0496124_0004249 3300048927 Bacteria 16857
1946 Ga0496124_0007172 3300048927 Bacteria 11916
1947 Ga0496124_0009605 3300048927 Bacteria 9915
1948 Ga0496124_0024101 3300048927 Bacteria 5540
1949 Ga0496124_0027708 3300048927 Bacteria 5078
1950 Ga0496124_0055969 3300048927 Bacteria 3330
1951 Ga0496124_0093070 3300048927 Bacteria 2454
1952 Ga0496124_0163645 3300048927 Bacteria 1731
1953 Ga0496124_0260886 3300048927 Bacteria 1275
1954 Ga0496125_0001533 3300048928 Bacteria 33123
1955 Ga0496125_0001871 3300048928 Bacteria 28916
1956 Ga0496125_0006133 3300048928 Bacteria 13115
1957 Ga0496125_0133675 3300048928 Bacteria 1740
1958 Ga0496125_0318429 3300048928 Bacteria 944
1959 Ga0496125_0377771 3300048928 Bacteria 836
1960 Ga0496126_0024580 3300048929 Bacteria 5813
1961 Ga0496126_0130295 3300048929 Bacteria 2174
1962 Ga0495678_000030 3300049459 Bacteria 217986
1963 Ga0495678_000104 3300049459 Bacteria 103726
1964 Ga0495678_000282 3300049459 Bacteria 55944
1965 Ga0495678_003383 3300049459 Bacteria 9927
1966 Ga0495678_003719 3300049459 Bacteria 9227
1967 Ga0495678_004340 3300049459 Bacteria 8248
1968 Ga0495678_009153 3300049459 Bacteria 4930
1969 Ga0495678_085957 3300049459 Bacteria 1119
1970 Ga0495682_0000922 3300049460 Bacteria 17893
1971 Ga0495682_0001768 3300049460 Bacteria 10919
1972 Ga0495682_0002559 3300049460 Bacteria 8547
1973 Ga0501292_000890 3300049515 Bacteria 3629
1974 Ga0501298_040149 3300049521 Bacteria 947
1975 Ga0501303_005105 3300049526 Bacteria 1107
1976 Ga0501031_0151049 3300049568 Bacteria 1518
1977 Ga0501033_0334014 3300049570 Bacteria 1063
1978 Ga0501034_0001253 3300049571 Bacteria 34491
1979 Ga0501034_0043859 3300049571 Bacteria 4524
1980 Ga0501037_0040218 3300049573 Bacteria 3441
1981 Ga0501037_0260541 3300049573 Bacteria 1211
1982 Ga0501038_0060389 3300049574 Bacteria 3245
1983 Ga0501038_0414268 3300049574 Bacteria 1040
1984 Ga0501039_0052036 3300049575 Bacteria 3169
1985 Ga0501039_0107301 3300049575 Bacteria 2181
1986 Ga0501040_0044724 3300049576 Bacteria 3019
1987 Ga0501040_0067682 3300049576 Bacteria 2462
1988 Ga0501041_0124042 3300049577 Bacteria 1606
1989 Ga0501041_0156695 3300049577 Bacteria 1423
1990 Ga0501042_0340714 3300049578 Bacteria 1084
1991 Ga0501043_0121561 3300049579 Bacteria 2048
1992 Ga0501046_0061483 3300049580 Bacteria 2936
1993 Ga0501047_0105149 3300049581 Bacteria 2703
1994 Ga0501047_0186451 3300049581 Bacteria 1940
1995 Ga0501047_0329892 3300049581 Bacteria 1364
1996 Ga0501047_0405337 3300049581 Bacteria 1196
1997 Ga0501048_0050615 3300049582 Bacteria 2958
1998 Ga0501048_0088350 3300049582 Bacteria 2186
1999 Ga0501067_0074729 3300049583 Bacteria 1878
2000 Ga0501069_0033301 3300049585 Bacteria 2839
2001 Ga0501069_0033853 3300049585 Bacteria 2815
2002 Ga0501069_0175778 3300049585 Bacteria 1237
2003 Ga0501069_0215757 3300049585 Bacteria 1114
2004 Ga0501070_0005902 3300049586 Bacteria 10444
2005 Ga0501070_0010735 3300049586 Bacteria 7739
2006 Ga0501070_0275086 3300049586 Bacteria 1374
2007 Ga0501070_0443867 3300049586 Bacteria 1046
2008 Ga0501071_0019978 3300049587 Bacteria 4653
2009 Ga0501071_0185354 3300049587 Bacteria 1560
2010 Ga0501071_0366675 3300049587 Bacteria 1097
2011 Ga0501072_0007804 3300049588 Bacteria 8127
2012 Ga0501072_0043830 3300049588 Bacteria 3517
2013 Ga0501072_0304936 3300049588 Bacteria 1266
2014 Ga0501072_0332993 3300049588 Bacteria 1206
2015 Ga0501073_0321618 3300049589 Bacteria 1068
2016 Ga0501074_0050555 3300049590 Bacteria 3000
2017 Ga0501075_0010572 3300049591 Bacteria 6489
2018 Ga0501075_0026640 3300049591 Bacteria 4258
2019 Ga0501076_0010040 3300049592 Bacteria 7006
2020 Ga0501076_0012122 3300049592 Bacteria 6444
2021 Ga0501076_0297375 3300049592 Bacteria 1323
2022 Ga0501077_0007133 3300049593 Bacteria 6890
2023 Ga0501230_003820 3300049667 Bacteria 2029
2024 Ga0501249_013963 3300049679 Bacteria 1710
2025 Ga0501257_008825 3300049686 Bacteria 2270
2026 Ga0501079_0051671 3300049741 Bacteria 3174
2027 Ga0501079_0101856 3300049741 Bacteria 2227
2028 Ga0501080_0014736 3300049742 Bacteria 7200
2029 Ga0501080_0055070 3300049742 Bacteria 3704
2030 Ga0501080_0094026 3300049742 Bacteria 2784
2031 Ga0501080_0142171 3300049742 Bacteria 2218
2032 Ga0501080_0184593 3300049742 Bacteria 1918
2033 Ga0501081_0026219 3300049743 Bacteria 3928
2034 Ga0501083_0041090 3300049744 Bacteria 3137
2035 Ga0501083_0186576 3300049744 Bacteria 1354
2036 Ga0501083_0189574 3300049744 Bacteria 1342
2037 Ga0501262_000270 3300049759 Bacteria 6297
2038 Ga0501262_003369 3300049759 Bacteria 1830
2039 Ga0501265_000790 3300049762 Bacteria 3478
2040 Ga0501266_001612 3300049763 Bacteria 2876
2041 Ga0501269_000165 3300049766 Bacteria 20359
2042 Ga0501035_0005452 3300049822 Bacteria 12029
2043 Ga0501035_0055819 3300049822 Bacteria 3526
2044 Ga0501035_0077368 3300049822 Bacteria 2940
2045 Ga0501035_0091692 3300049822 Bacteria 2674
2046 Ga0501035_0482204 3300049822 Bacteria 1023
2047 Ga0501044_0007435 3300049823 Bacteria 12046
2048 Ga0501044_0038330 3300049823 Bacteria 5005
2049 Ga0501044_0120369 3300049823 Bacteria 2627
2050 Ga0501044_0243413 3300049823 Bacteria 1742
2051 Ga0501044_0465257 3300049823 Bacteria 1169
2052 Ga0501044_0545219 3300049823 Bacteria 1057
2053 Ga0501045_0061879 3300049824 Bacteria 2746
2054 Ga0501045_0127129 3300049824 Bacteria 1894
2055 Ga0501045_0179116 3300049824 Bacteria 1579
2056 Ga0501045_0422498 3300049824 Bacteria 992
2057 nmdc:mga03683_1076_c1 3300050489 Bacteria 7999
2058 nmdc:mga03683_25244_c1 3300050489 Bacteria 2332
2059 nmdc:mga03683_3421_c1 3300050489 Bacteria 5116
2060 nmdc:mga00v17_191301_c1 3300050491 Bacteria 1322
2061 nmdc:mga0yw44_2762_c1 3300050492 Bacteria 7596
2062 nmdc:mga0yw44_42587_c1 3300050492 Bacteria 2708
2063 nmdc:mga0k408_116947_c1 3300050493 Bacteria 1578
2064 nmdc:mga0k408_237833_c1 3300050493 Bacteria 1087
2065 nmdc:mga0k408_303675_c1 3300050493 Bacteria 952
2066 nmdc:mga0k408_30565_c1 3300050493 Bacteria 3072
2067 nmdc:mga0k408_34631_c1 3300050493 Bacteria 2892
2068 nmdc:mga0k408_4472_c2 3300050493 Bacteria 6121
2069 nmdc:mga0k408_5676_c1 3300050493 Bacteria 6633
2070 nmdc:mga0k408_67129_c1 3300050493 Bacteria 2090
2071 nmdc:mga0k408_6802_c1 3300050493 Bacteria 3395
2072 nmdc:mga0k408_7968_c2 3300050493 Bacteria 5163
2073 nmdc:mga0k408_86743_c1 3300050493 Bacteria 1837
2074 nmdc:mga06z11_91391_c1 3300050494 Bacteria 1653
2075 nmdc:mga07m45_180676_c1 3300050496 Bacteria 1227
2076 nmdc:mga07m45_1981_c1 3300050496 Bacteria 9484
2077 nmdc:mga07m45_201859_c1 3300050496 Bacteria 1157
2078 nmdc:mga07m45_25305_c1 3300050496 Bacteria 3255
2079 nmdc:mga05p37_376617_c1 3300050507 Bacteria 1664
2080 nmdc:mga05p37_4601_c1 3300050507 Bacteria 16127
2081 nmdc:mga09592_496147_c1 3300050508 Bacteria 1051
2082 nmdc:mga09592_808_c1 3300050508 Bacteria 24178
2083 nmdc:mga0qj67_1239_c1 3300050509 Bacteria 17826
2084 nmdc:mga0qj67_227585_c1 3300050509 Bacteria 1513
2085 nmdc:mga0qj67_332182_c1 3300050509 Bacteria 1230
2086 nmdc:mga06r32_17895_c1 3300050510 Bacteria 6478
2087 nmdc:mga06r32_548269_c1 3300050510 Bacteria 1130
2088 nmdc:mga06r32_71366_c1 3300050510 Bacteria 3360
2089 nmdc:mga06r32_76546_c1 3300050510 Bacteria 3249
2090 nmdc:mga08y16_49099_c1 3300050511 Bacteria 4417
2091 nmdc:mga08y16_76_c1 3300050511 Bacteria 82457
2092 nmdc:mga08y16_9603_c1 3300050511 Bacteria 10159
2093 nmdc:mga0n895_160395_c1 3300050512 Bacteria 2281
2094 nmdc:mga0n895_1829_c1 3300050512 Bacteria 16213
2095 nmdc:mga0n895_274451_c1 3300050512 Bacteria 1710
2096 nmdc:mga0n895_27759_c1 3300050512 Bacteria 5381
2097 nmdc:mga0rr50_12184_c1 3300050513 Bacteria 5543
2098 nmdc:mga0rr50_238821_c1 3300050513 Bacteria 1506
2099 nmdc:mga0rr50_27161_c1 3300050513 Bacteria 4003
2100 nmdc:mga0rr50_292322_c1 3300050513 Bacteria 1362
2101 nmdc:mga08x19_60469_c1 3300050514 Bacteria 2454
2102 nmdc:mga0a205_107318_c1 3300050515 Bacteria 2690
2103 nmdc:mga0a205_145070_c1 3300050515 Bacteria 2274
2104 nmdc:mga0a205_3529_c1 3300050515 Bacteria 13979
2105 nmdc:mga0a205_37363_c1 3300050515 Bacteria 4670
2106 nmdc:mga0sz30_42231_c1 3300050516 Bacteria 1918
2107 Ga0495601_0000851 3300053077 Bacteria 16593
2108 Ga0495601_0012340 3300053077 Bacteria 5124
2109 Ga0495601_0025815 3300053077 Bacteria 3624
2110 Ga0495601_0031609 3300053077 Bacteria 3290
2111 Ga0495601_0038333 3300053077 Bacteria 2997
2112 Ga0495612_0006247 3300053078 Bacteria 4908
2113 Ga0495612_0008243 3300053078 Bacteria 4232
2114 Ga0495612_0009724 3300053078 Bacteria 3895
2115 Ga0495612_0030924 3300053078 Bacteria 2157
2116 Ga0500610_0097431 3300053079 Bacteria 1524
2117 Ga0495595_0003528 3300053084 Bacteria 6208
2118 Ga0495595_0003759 3300053084 Bacteria 6038
2119 Ga0495595_0007642 3300053084 Bacteria 4428
2120 Ga0495595_0014092 3300053084 Bacteria 3386
2121 Ga0495619_0000063 3300053085 Bacteria 84834
2122 Ga0495619_0000520 3300053085 Bacteria 25508
2123 Ga0495619_0016954 3300053085 Bacteria 4614
2124 Ga0495619_0055986 3300053085 Bacteria 2613
2125 Ga0495619_0208057 3300053085 Bacteria 1355
2126 Ga0495619_0520258 3300053085 Bacteria 817
2127 Ga0500644_0004131 3300053088 Bacteria 3618
2128 Ga0500651_0226306 3300053093 Bacteria 1095
2129 Ga0500562_000202 3300053108 Bacteria 16162
2130 Ga0500572_017514 3300053111 Bacteria 1842
2131 Ga0500593_000880 3300053117 Bacteria 11156
2132 Ga0500593_004560 3300053117 Bacteria 5381
2133 Ga0500594_0005021 3300053118 Bacteria 2926
2134 Ga0500595_000001 3300053119 Bacteria 1088438
2135 Ga0500607_001481 3300053121 Bacteria 21145
2136 Ga0500618_000179 3300053125 Bacteria 52538
2137 Ga0500568_0007841 3300053139 Bacteria 5201
2138 Ga0500568_0037293 3300053139 Bacteria 1973
2139 Ga0500586_000479 3300053145 Bacteria 8024
2140 Ga0500604_0001716 3300053151 Bacteria 6138
2141 Ga0500616_0114340 3300053153 Bacteria 1298
2142 Ga0500616_0183094 3300053153 Bacteria 941
2143 Ga0500627_0001946 3300053158 Bacteria 5943
2144 Ga0500634_0020794 3300053161 Bacteria 3553
2145 Ga0500625_078454 3300053729 Bacteria 1448
2146 Ga0500645_000785 3300053730 Bacteria 19184
2147 Ga0501084_0076813 3300054114 Bacteria 2800
2148 Ga0501084_0110106 3300054114 Bacteria 2314
2149 Ga0501084_0112918 3300054114 Bacteria 2283
2150 Ga0500661_008623 3300055283 Bacteria 1875
2151 Ga0590075_019498 3300059424 Bacteria 1684
2152 Ga0587073_0025704 3300059492 Bacteria 1173
2153 Ga0587077_000088 3300059493 Bacteria 5014
2154 Ga0587080_011296 3300059503 Bacteria 1331
2155 Ga0587083_0007941 3300059505 Bacteria 1643
2156 Ga0587085_000896 3300059506 Bacteria 2503
2157 Ga0587086_007086 3300059507 Bacteria 1275
2158 Ga0587088_004393 3300059508 Bacteria 1782
2159 Ga0587090_000710 3300059510 Bacteria 2976
2160 Ga0587090_010045 3300059510 Bacteria 1304
2161 Ga0587090_031672 3300059510 Bacteria 888
2162 Ga0587092_002099 3300059512 Bacteria 2084
2163 Ga0587062_001158 3300059639 Bacteria 2177
2164 Ga0587062_001273 3300059639 Bacteria 2122
2165 Ga0587067_027520 3300059640 Bacteria 1026
2166 Ga0587068_005270 3300059641 Bacteria 1756
2167 Ga0587068_034578 3300059641 Bacteria 891
2168 Ga0587069_005950 3300059642 Bacteria 1445
2169 Ga0587072_004905 3300059643 Bacteria 1973
2170 Ga0587075_008318 3300059644 Bacteria 1324
2171 Ga0587076_015287 3300059645 Bacteria 1194
2172 Ga0587078_004112 3300059646 Bacteria 1509
2173 Ga0587079_014651 3300059647 Bacteria 1319
2174 Ga0587102_000353 3300059649 Bacteria 2488
2175 Ga0587071_011501 3300060344 Bacteria 1494
2176 Ga0587111_0000698 3300060346 Bacteria 3485
2177 Ga0587111_0002221 3300060346 Bacteria 2545
2178 Ga0587111_0004906 3300060346 Bacteria 2029
2179 Ga0587111_0021801 3300060346 Bacteria 1239
2180 Ga0501082_0052621 3300060353 Bacteria 3510
2181 Ga0501082_0063082 3300060353 Bacteria 3191
2182 Ga0501082_0076487 3300060353 Bacteria 2885
2183 Ga0501082_0291988 3300060353 Bacteria 1419
2184 Ga0501082_0397711 3300060353 Bacteria 1202
2185 Ga0466962_0006817 3300061719 Bacteria 5482
2186 Ga0466962_0025785 3300061719 Bacteria 2821
2187 Ga0466962_0131963 3300061719 Bacteria 1207
2188 Ga0530510_0007515 3300061734 Bacteria 7590

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053111 Ga0500572_017514 Ga0500572_017514_1137_1814 195
2 3300032002 Ga0307416_100214875 Ga0307416_1002148753 201
3 3300039438 Ga0436360_0785555 Ga0436360_0785555_14_703 203
4 3300046514 Ga0495618_0071799 Ga0495618_0071799_1497_2186 203
5 3300047319 Ga0495674_0206086 Ga0495674_0206086_908_1597 203
6 3300047321 Ga0495676_0098815 Ga0495676_0098815_1459_2148 203
7 3300047444 Ga0495675_0200044 Ga0495675_0200044_511_1200 203
8 3300042013 Ga0439456_019140 Ga0439456_019140_699_1385 204
9 3300053085 Ga0495619_0520258 Ga0495619_0520258_96_785 205
10 3300035116 Ga0373945_0010354 Ga0373945_0010354_437_1111 207
11 3300042134 Ga0450898_021576 Ga0450898_021576_397_1110 210
12 3300046458 Ga0495591_002620 Ga0495591_002620_95_868 212
13 3300046471 Ga0495650_0001157 Ga0495650_0001157_6064_6867 212
14 3300046474 Ga0495605_0000076 Ga0495605_0000076_42207_43010 212
15 3300046492 Ga0495585_0000372 Ga0495585_0000372_10007_10780 212
16 3300046501 Ga0495607_0033574 Ga0495607_0033574_748_1551 212
17 3300046506 Ga0495583_0000089 Ga0495583_0000089_33146_33949 212
18 3300046506 Ga0495583_0000556 Ga0495583_0000556_9781_10584 212
19 3300046507 Ga0495606_0005719 Ga0495606_0005719_10135_10908 212
20 3300046512 Ga0495610_0000827 Ga0495610_0000827_10175_10948 212
21 3300046519 Ga0495632_0000158 Ga0495632_0000158_24233_25036 212
22 3300046530 Ga0495654_0021731 Ga0495654_0021731_2191_2964 212
23 3300046538 Ga0495609_0000027 Ga0495609_0000027_191410_192213 212
24 3300046616 Ga0495668_0003555 Ga0495668_0003555_803_1576 212
25 3300046665 Ga0495661_0000670 Ga0495661_0000670_6311_7114 212
26 3300046694 Ga0495649_0028804 Ga0495649_0028804_585_1358 212
27 3300048091 Ga0495626_0193556 Ga0495626_0193556_36_809 212
28 3300001979 JGI24740J21852_10003031 JGI24740J21852_100030315 214
29 3300046474 Ga0495605_0001282 Ga0495605_0001282_14019_14819 215
30 3300046501 Ga0495607_0000036 Ga0495607_0000036_128996_129796 215
31 3300048924 Ga0496121_0003531 Ga0496121_0003531_8066_8866 215
32 3300002737 JGI25162J39368_1000013 JGI25162J39368_100001333 217
33 3300002772 JGI25164J39214_1000005 JGI25164J39214_100000533 217
34 3300003214 JGI25165J46597_1000340 JGI25165J46597_100034018 217
35 3300003791 Ga0055530_10000002 Ga0055530_10000002189 217
36 3300003792 Ga0055540_1000009 Ga0055540_1000009189 217
37 3300005288 Ga0065714_10005231 Ga0065714_100052312 217
38 3300005288 Ga0065714_10026580 Ga0065714_100265801 217
39 3300005289 Ga0065704_10070326 Ga0065704_1007032612 217
40 3300006051 Ga0075364_10330467 Ga0075364_103304672 217
41 3300006058 Ga0075432_10001993 Ga0075432_100019934 217
42 3300006946 Ga0079104_1000081 Ga0079104_100008171 217
43 3300009036 Ga0105244_10048089 Ga0105244_100480892 217
44 3300011119 Ga0105246_10002678 Ga0105246_100026782 217
45 3300013104 Ga0157370_10570271 Ga0157370_105702712 217
46 3300013306 Ga0163162_10000210 Ga0163162_1000021047 217
47 3300014497 Ga0182008_10003596 Ga0182008_100035962 217
48 3300025207 Ga0209760_100007 Ga0209760_10000730 217
49 3300025231 Ga0207427_100018 Ga0207427_100018207 217
50 3300025233 Ga0209437_100031 Ga0209437_100031207 217
51 3300025256 Ga0209759_1007815 Ga0209759_10078153 217
52 3300025261 Ga0209233_1000012 Ga0209233_1000012205 217
53 3300025292 Ga0209676_1002971 Ga0209676_10029714 217
54 3300025298 Ga0209050_1000009 Ga0209050_1000009801 217
55 3300025303 Ga0209051_1000008 Ga0209051_1000008558 217
56 3300027907 Ga0207428_10109526 Ga0207428_101095262 217
57 3300031548 Ga0307408_100006774 Ga0307408_1000067742 217
58 3300031548 Ga0307408_100031603 Ga0307408_1000316033 217
59 3300031731 Ga0307405_10004167 Ga0307405_100041671 217
60 3300031731 Ga0307405_10035343 Ga0307405_100353432 217
61 3300031901 Ga0307406_10014173 Ga0307406_100141731 217
62 3300031911 Ga0307412_10001704 Ga0307412_100017048 217
63 3300031911 Ga0307412_10011369 Ga0307412_100113691 217
64 3300031911 Ga0307412_10036229 Ga0307412_100362293 217
65 3300046524 Ga0495648_0000725 Ga0495648_0000725_17715_18488 217
66 3300046642 Ga0495634_0004556 Ga0495634_0004556_993_1766 217
67 3300046680 Ga0495646_0173561 Ga0495646_0173561_343_1116 217
68 3300048928 Ga0496125_0377771 Ga0496125_0377771_13_786 217
69 3300015261 Ga0182006_1012873 Ga0182006_10128733 218
70 3300030742 Ga0316183_1048080 Ga0316183_10480801 218
71 3300032002 Ga0307416_100355996 Ga0307416_1003559962 218
72 3300039453 Ga0436362_0312145 Ga0436362_0312145_978_1769 218
73 3300042876 Ga0451577_0001824 Ga0451577_0001824_11054_11965 218
74 3300005458 Ga0070681_10052279 Ga0070681_100522794 219
75 3300046457 Ga0495590_0007581 Ga0495590_0007581_2581_3354 219
76 3300046474 Ga0495605_0000980 Ga0495605_0000980_12919_13692 219
77 3300046512 Ga0495610_0003263 Ga0495610_0003263_1086_1859 219
78 3300046528 Ga0495642_0000528 Ga0495642_0000528_1091_1864 219
79 3300046616 Ga0495668_0024412 Ga0495668_0024412_1981_2754 219
80 3300047320 Ga0495672_0001337 Ga0495672_0001337_10789_11562 219
81 3300050493 nmdc:mga0k408_34631_c1 nmdc:mga0k408_34631_c1_74_844 219
82 3300038443 Ga0395901_0944109 Ga0395901_0944109_27_812 220
83 3300046522 Ga0495643_0007363 Ga0495643_0007363_135_905 221
84 3300046694 Ga0495649_0055790 Ga0495649_0055790_252_1022 221
85 3300053085 Ga0495619_0208057 Ga0495619_0208057_350_1102 221
86 3300005356 Ga0070674_100054368 Ga0070674_1000543682 222
87 3300005456 Ga0070678_100635698 Ga0070678_1006356981 222
88 3300005459 Ga0068867_100119465 Ga0068867_1001194651 222
89 3300005844 Ga0068862_100043128 Ga0068862_1000431282 222
90 3300006353 Ga0075370_10267458 Ga0075370_102674582 222
91 3300009094 Ga0111539_10306870 Ga0111539_103068701 222
92 3300021361 Ga0213872_10000236 Ga0213872_100002362 222
93 3300025899 Ga0207642_10078310 Ga0207642_100783102 222
94 3300025923 Ga0207681_10290614 Ga0207681_102906142 222
95 3300026118 Ga0207675_100031971 Ga0207675_1000319713 222
96 3300028380 Ga0268265_10027143 Ga0268265_100271435 222
97 3300031548 Ga0307408_100438284 Ga0307408_1004382842 222
98 3300031824 Ga0307413_10101129 Ga0307413_101011292 222
99 3300031852 Ga0307410_10087757 Ga0307410_100877573 222
100 3300031901 Ga0307406_10401401 Ga0307406_104014012 222
101 3300031903 Ga0307407_10061133 Ga0307407_100611331 222
102 3300031995 Ga0307409_100335601 Ga0307409_1003356013 222
103 3300032002 Ga0307416_100436616 Ga0307416_1004366162 222
104 3300039447 Ga0436361_0343816 Ga0436361_0343816_14454_15224 222
105 3300045051 Ga0451576_0036843 Ga0451576_0036843_3692_4522 222
106 3300050508 nmdc:mga09592_496147_c1 nmdc:mga09592_496147_c1_85_867 222
107 3300050510 nmdc:mga06r32_548269_c1 nmdc:mga06r32_548269_c1_126_908 222
108 3300059424 Ga0590075_019498 Ga0590075_019498_623_1405 222
109 3300005614 Ga0068856_100417402 Ga0068856_1004174022 223
110 3300005844 Ga0068862_100010910 Ga0068862_1000109106 223
111 3300026078 Ga0207702_10329890 Ga0207702_103298902 223
112 3300028380 Ga0268265_10127557 Ga0268265_101275571 223
113 3300028794 Ga0307515_10000022 Ga0307515_10000022317 223
114 3300028794 Ga0307515_10052000 Ga0307515_100520007 223
115 3300031911 Ga0307412_10286325 Ga0307412_102863252 223
116 3300041997 Ga0439431_0005706 Ga0439431_0005706_502_1284 223
117 3300042156 Ga0439446_0067768 Ga0439446_0067768_272_1054 223
118 3300042435 Ga0439434_0059698 Ga0439434_0059698_27_809 223
119 3300050493 nmdc:mga0k408_237833_c1 nmdc:mga0k408_237833_c1_201_971 223
120 3300050509 nmdc:mga0qj67_332182_c1 nmdc:mga0qj67_332182_c1_324_1094 223
121 3300048088 Ga0495602_0231401 Ga0495602_0231401_146_931 224
122 3300045976 Ga0466967_0225574 Ga0466967_0225574_769_1551 225
123 3300046559 Ga0495667_0460783 Ga0495667_0460783_11_769 225
124 3300002773 JGI25152J39213_1019759 JGI25152J39213_10197591 226
125 3300002987 JGI25159J45721_1001179 JGI25159J45721_100117911 226
126 3300003187 JGI25151J46595_10006470 JGI25151J46595_100064707 226
127 3300003187 JGI25151J46595_10006687 JGI25151J46595_100066873 226
128 3300003790 Ga0055528_1044311 Ga0055528_10443112 226
129 3300003792 Ga0055540_1002443 Ga0055540_10024433 226
130 3300004625 Ga0055543_1006492 Ga0055543_10064922 226
131 3300005262 Ga0065165_1000353 Ga0065165_100035370 226
132 3300005288 Ga0065714_10066301 Ga0065714_100663017 226
133 3300005289 Ga0065704_10121414 Ga0065704_101214142 226
134 3300005459 Ga0068867_100065028 Ga0068867_1000650283 226
135 3300005539 Ga0068853_100620630 Ga0068853_1006206302 226
136 3300006038 Ga0075365_10220884 Ga0075365_102208842 226
137 3300006048 Ga0075363_100076923 Ga0075363_1000769233 226
138 3300006048 Ga0075363_100332237 Ga0075363_1003322371 226
139 3300006177 Ga0075362_10032384 Ga0075362_100323842 226
140 3300006178 Ga0075367_10022990 Ga0075367_100229902 226
141 3300006178 Ga0075367_10043958 Ga0075367_100439583 226
142 3300006195 Ga0075366_10009030 Ga0075366_100090303 226
143 3300006195 Ga0075366_10009936 Ga0075366_100099363 226
144 3300006353 Ga0075370_10001090 Ga0075370_100010905 226
145 3300006353 Ga0075370_10013814 Ga0075370_100138144 226
146 3300006847 Ga0075431_100342722 Ga0075431_1003427222 226
147 3300009148 Ga0105243_10052752 Ga0105243_100527523 226
148 3300011119 Ga0105246_10011476 Ga0105246_100114765 226
149 3300013100 Ga0157373_10020180 Ga0157373_100201804 226
150 3300014497 Ga0182008_10008368 Ga0182008_100083684 226
151 3300014497 Ga0182008_10037529 Ga0182008_100375294 226
152 3300025258 Ga0209129_1008428 Ga0209129_10084282 226
153 3300025273 Ga0209673_1021718 Ga0209673_10217181 226
154 3300025284 Ga0209130_1000156 Ga0209130_100015678 226
155 3300025294 Ga0209025_1000435 Ga0209025_100043523 226
156 3300025294 Ga0209025_1018110 Ga0209025_10181103 226
157 3300025303 Ga0209051_1000363 Ga0209051_10003634 226
158 3300025935 Ga0207709_10026405 Ga0207709_100264052 226
159 3300025940 Ga0207691_10421577 Ga0207691_104215772 226
160 3300026041 Ga0207639_10500640 Ga0207639_105006401 226
161 3300026088 Ga0207641_10885846 Ga0207641_108858461 226
162 3300027666 Ga0209282_1191421 Ga0209282_11914211 226
163 3300030731 Ga0316177_1104395 Ga0316177_11043952 226
164 3300030732 Ga0316176_1115808 Ga0316176_11158085 226
165 3300030734 Ga0316179_1114749 Ga0316179_11147493 226
166 3300030735 Ga0316178_1104248 Ga0316178_11042482 226
167 3300030742 Ga0316183_1072259 Ga0316183_10722593 226
168 3300030745 Ga0316182_1346278 Ga0316182_13462785 226
169 3300031548 Ga0307408_100332526 Ga0307408_1003325262 226
170 3300031649 Ga0307514_10122396 Ga0307514_101223962 226
171 3300031731 Ga0307405_10549191 Ga0307405_105491911 226
172 3300031852 Ga0307410_10346845 Ga0307410_103468451 226
173 3300031901 Ga0307406_10012016 Ga0307406_100120165 226
174 3300031911 Ga0307412_10018358 Ga0307412_100183584 226
175 3300031911 Ga0307412_10137854 Ga0307412_101378541 226
176 3300032002 Ga0307416_100400117 Ga0307416_1004001172 226
177 3300032004 Ga0307414_10091887 Ga0307414_100918872 226
178 3300032004 Ga0307414_10123016 Ga0307414_101230162 226
179 3300032004 Ga0307414_10354468 Ga0307414_103544681 226
180 3300041411 Ga0439466_0023680 Ga0439466_0023680_842_1612 226
181 3300041413 Ga0439465_0122419 Ga0439465_0122419_14_784 226
182 3300042002 Ga0439442_009004 Ga0439442_009004_893_1663 226
183 3300042122 Ga0450920_006080 Ga0450920_006080_128_898 226
184 3300042133 Ga0450896_009232 Ga0450896_009232_313_1083 226
185 3300042134 Ga0450898_003997 Ga0450898_003997_326_1096 226
186 3300042435 Ga0439434_0007249 Ga0439434_0007249_1452_2222 226
187 3300046453 Ga0495627_016526 Ga0495627_016526_813_1592 226
188 3300046520 Ga0495637_0002748 Ga0495637_0002748_5406_6176 226
189 3300046660 Ga0495625_0001807 Ga0495625_0001807_3412_4182 226
190 3300046674 Ga0495588_0030329 Ga0495588_0030329_468_1247 226
191 3300046692 Ga0495671_0007220 Ga0495671_0007220_691_1470 226
192 3300046810 Ga0495660_0073975 Ga0495660_0073975_352_1131 226
193 3300046810 Ga0495660_0160512 Ga0495660_0160512_302_1081 226
194 3300049679 Ga0501249_013963 Ga0501249_013963_862_1641 226
195 3300049759 Ga0501262_000270 Ga0501262_000270_326_1105 226
196 3300050489 nmdc:mga03683_25244_c1 nmdc:mga03683_25244_c1_218_988 226
197 3300050492 nmdc:mga0yw44_2762_c1 nmdc:mga0yw44_2762_c1_393_1163 226
198 3300050493 nmdc:mga0k408_5676_c1 nmdc:mga0k408_5676_c1_5121_5891 226
199 3300050496 nmdc:mga07m45_180676_c1 nmdc:mga07m45_180676_c1_140_910 226
200 3300050496 nmdc:mga07m45_1981_c1 nmdc:mga07m45_1981_c1_6471_7250 226
201 3300053079 Ga0500610_0097431 Ga0500610_0097431_702_1481 226
202 3300053117 Ga0500593_004560 Ga0500593_004560_1540_2319 226
203 3300053121 Ga0500607_001481 Ga0500607_001481_5272_6051 226
204 3300053158 Ga0500627_0001946 Ga0500627_0001946_2820_3599 226
205 3300053161 Ga0500634_0020794 Ga0500634_0020794_1086_1865 226
206 3300053729 Ga0500625_078454 Ga0500625_078454_72_842 226
207 3300005614 Ga0068856_100188219 Ga0068856_1001882193 227
208 3300006173 Ga0070716_100105929 Ga0070716_1001059292 227
209 3300006914 Ga0075436_100457376 Ga0075436_1004573762 227
210 3300009092 Ga0105250_10066258 Ga0105250_100662582 227
211 3300013100 Ga0157373_10019636 Ga0157373_100196363 227
212 3300013308 Ga0157375_10426080 Ga0157375_104260802 227
213 3300014497 Ga0182008_10000088 Ga0182008_1000008862 227
214 3300015261 Ga0182006_1014039 Ga0182006_10140393 227
215 3300017792 Ga0163161_10204477 Ga0163161_102044772 227
216 3300025299 Ga0209256_1029657 Ga0209256_10296572 227
217 3300025905 Ga0207685_10008123 Ga0207685_100081232 227
218 3300025939 Ga0207665_10281827 Ga0207665_102818272 227
219 3300025940 Ga0207691_10223629 Ga0207691_102236292 227
220 3300042007 Ga0439449_0002400 Ga0439449_0002400_5267_6046 227
221 3300042013 Ga0439456_000092 Ga0439456_000092_965_1735 227
222 3300046539 Ga0495621_0003432 Ga0495621_0003432_1221_1991 227
223 3300046615 Ga0495656_0000088 Ga0495656_0000088_12231_13001 227
224 3300048090 Ga0495615_0013391 Ga0495615_0013391_714_1484 227
225 3300048913 Ga0496110_0013235 Ga0496110_0013235_839_1609 227
226 3300048927 Ga0496124_0007172 Ga0496124_0007172_953_1723 227
227 3300048929 Ga0496126_0024580 Ga0496126_0024580_3953_4723 227
228 3300002773 JGI25152J39213_1001685 JGI25152J39213_10016858 228
229 3300002774 JGI25150J39212_1006454 JGI25150J39212_10064542 228
230 3300003215 JGI25153J46596_10001268 JGI25153J46596_100012687 228
231 3300003215 JGI25153J46596_10002290 JGI25153J46596_100022903 228
232 3300003771 Ga0055526_1002527 Ga0055526_100252714 228
233 3300006195 Ga0075366_10040401 Ga0075366_100404013 228
234 3300025245 Ga0207425_1000204 Ga0207425_100020417 228
235 3300025258 Ga0209129_1000025 Ga0209129_1000025304 228
236 3300025263 Ga0209565_1006262 Ga0209565_10062623 228
237 3300025295 Ga0209564_1000039 Ga0209564_1000039304 228
238 3300025297 Ga0209758_1000163 Ga0209758_100016364 228
239 3300025297 Ga0209758_1000287 Ga0209758_100028727 228
240 3300025299 Ga0209256_1031398 Ga0209256_10313982 228
241 3300027614 Ga0209970_1000327 Ga0209970_10003273 228
242 3300027876 Ga0209974_10015100 Ga0209974_100151002 228
243 3300037312 Ga0395899_0018473 Ga0395899_0018473_2156_2926 228
244 3300037418 Ga0395900_0105264 Ga0395900_0105264_1146_1916 228
245 3300037466 Ga0395898_0031807 Ga0395898_0031807_3298_4068 228
246 3300037471 Ga0395905_0378128 Ga0395905_0378128_10_780 228
247 3300049585 Ga0501069_0033301 Ga0501069_0033301_342_1109 228
248 3300002704 JGI25155J39150_1000081 JGI25155J39150_100008139 229
249 3300002705 JGI25156J39149_1000025 JGI25156J39149_100002541 229
250 3300002738 JGI25154J39366_1000045 JGI25154J39366_100004541 229
251 3300002741 JGI25157J39369_1000034 JGI25157J39369_100003441 229
252 3300002774 JGI25150J39212_1020840 JGI25150J39212_10208401 229
253 3300002774 JGI25150J39212_1022009 JGI25150J39212_10220092 229
254 3300002987 JGI25159J45721_1000455 JGI25159J45721_100045516 229
255 3300002987 JGI25159J45721_1002024 JGI25159J45721_10020249 229
256 3300003187 JGI25151J46595_10008852 JGI25151J46595_100088522 229
257 3300003187 JGI25151J46595_10015587 JGI25151J46595_100155874 229
258 3300003354 JGI25160J50197_1000148 JGI25160J50197_10001483 229
259 3300003354 JGI25160J50197_1000822 JGI25160J50197_100082213 229
260 3300003374 JGI25161J50226_1000111 JGI25161J50226_100011130 229
261 3300003771 Ga0055526_1008734 Ga0055526_10087344 229
262 3300003771 Ga0055526_1009022 Ga0055526_10090222 229
263 3300003773 Ga0055537_1000298 Ga0055537_100029824 229
264 3300003773 Ga0055537_1012082 Ga0055537_10120822 229
265 3300003775 Ga0055524_1000075 Ga0055524_100007597 229
266 3300003784 Ga0055534_1000435 Ga0055534_10004356 229
267 3300003790 Ga0055528_1002608 Ga0055528_10026083 229
268 3300003790 Ga0055528_1004007 Ga0055528_10040074 229
269 3300003791 Ga0055530_10000686 Ga0055530_1000068613 229
270 3300003792 Ga0055540_1000033 Ga0055540_100003330 229
271 3300004625 Ga0055543_1000302 Ga0055543_10003024 229
272 3300004625 Ga0055543_1000800 Ga0055543_100080013 229
273 3300005262 Ga0065165_1001978 Ga0065165_10019784 229
274 3300005354 Ga0070675_100514329 Ga0070675_1005143291 229
275 3300006177 Ga0075362_10022454 Ga0075362_100224541 229
276 3300006353 Ga0075370_10110133 Ga0075370_101101332 229
277 3300009036 Ga0105244_10162957 Ga0105244_101629572 229
278 3300013104 Ga0157370_10481566 Ga0157370_104815662 229
279 3300013306 Ga0163162_10207483 Ga0163162_102074832 229
280 3300014325 Ga0163163_10341301 Ga0163163_103413012 229
281 3300014497 Ga0182008_10012334 Ga0182008_100123342 229
282 3300015262 Ga0182007_10004175 Ga0182007_100041755 229
283 3300025206 Ga0209435_100001 Ga0209435_100001940 229
284 3300025208 Ga0209436_108521 Ga0209436_1085212 229
285 3300025245 Ga0207425_1002322 Ga0207425_10023221 229
286 3300025245 Ga0207425_1009663 Ga0207425_10096632 229
287 3300025246 Ga0209646_1000001 Ga0209646_10000011309 229
288 3300025250 Ga0209026_1000003 Ga0209026_1000003940 229
289 3300025256 Ga0209759_1000001 Ga0209759_1000001940 229
290 3300025258 Ga0209129_1009483 Ga0209129_10094833 229
291 3300025263 Ga0209565_1000004 Ga0209565_1000004850 229
292 3300025263 Ga0209565_1003317 Ga0209565_10033174 229
293 3300025273 Ga0209673_1000275 Ga0209673_100027570 229
294 3300025273 Ga0209673_1025737 Ga0209673_10257372 229
295 3300025284 Ga0209130_1000110 Ga0209130_100011041 229
296 3300025284 Ga0209130_1000453 Ga0209130_100045331 229
297 3300025291 Ga0209675_1000124 Ga0209675_100012445 229
298 3300025291 Ga0209675_1000614 Ga0209675_100061419 229
299 3300025292 Ga0209676_1000029 Ga0209676_100002954 229
300 3300025294 Ga0209025_1001797 Ga0209025_10017974 229
301 3300025294 Ga0209025_1006101 Ga0209025_10061012 229
302 3300025294 Ga0209025_1006991 Ga0209025_10069913 229
303 3300025295 Ga0209564_1000003 Ga0209564_1000003305 229
304 3300025295 Ga0209564_1000605 Ga0209564_100060512 229
305 3300025295 Ga0209564_1001426 Ga0209564_100142612 229
306 3300025295 Ga0209564_1007441 Ga0209564_10074416 229
307 3300025297 Ga0209758_1007795 Ga0209758_10077953 229
308 3300025298 Ga0209050_1000003 Ga0209050_1000003116 229
309 3300025298 Ga0209050_1006991 Ga0209050_10069915 229
310 3300025299 Ga0209256_1000001 Ga0209256_1000001118 229
311 3300025302 Ga0207426_1000061 Ga0207426_1000061281 229
312 3300025303 Ga0209051_1000003 Ga0209051_1000003116 229
313 3300025304 Ga0209257_1000018 Ga0209257_1000018116 229
314 3300026121 Ga0207683_10047228 Ga0207683_100472285 229
315 3300028381 Ga0268264_10781650 Ga0268264_107816501 229
316 3300031456 Ga0307513_10000014 Ga0307513_1000001411 229
317 3300031548 Ga0307408_100005366 Ga0307408_1000053667 229
318 3300031649 Ga0307514_10001061 Ga0307514_1000106115 229
319 3300031730 Ga0307516_10248265 Ga0307516_102482652 229
320 3300031901 Ga0307406_10047005 Ga0307406_100470053 229
321 3300041451 Ga0451791_0434519 Ga0451791_0434519_829_1611 229
322 3300042007 Ga0439449_0001069 Ga0439449_0001069_542_1312 229
323 3300042876 Ga0451577_0000257 Ga0451577_0000257_83973_84746 229
324 3300042876 Ga0451577_0321023 Ga0451577_0321023_124_921 229
325 3300044712 Ga0453684_0001024 Ga0453684_0001024_19981_20754 229
326 3300045051 Ga0451576_0006191 Ga0451576_0006191_7276_8076 229
327 3300045051 Ga0451576_0023061 Ga0451576_0023061_1117_1914 229
328 3300046459 Ga0495629_0244969 Ga0495629_0244969_331_1101 229
329 3300046475 Ga0495639_0003081 Ga0495639_0003081_4770_5540 229
330 3300046616 Ga0495668_0000285 Ga0495668_0000285_6493_7287 229
331 3300046674 Ga0495588_0045308 Ga0495588_0045308_953_1723 229
332 3300047472 Ga0495686_0007951 Ga0495686_0007951_2097_2891 229
333 3300048903 Ga0496100_0021043 Ga0496100_0021043_2896_3666 229
334 3300048904 Ga0496101_0000838 Ga0496101_0000838_13762_14532 229
335 3300048905 Ga0496102_0115080 Ga0496102_0115080_982_1752 229
336 3300048905 Ga0496102_0146856 Ga0496102_0146856_314_1108 229
337 3300048907 Ga0496104_0021711 Ga0496104_0021711_4333_5103 229
338 3300048908 Ga0496105_0001878 Ga0496105_0001878_6158_6928 229
339 3300048909 Ga0496106_0016541 Ga0496106_0016541_1812_2582 229
340 3300048910 Ga0496107_0146038 Ga0496107_0146038_958_1728 229
341 3300048913 Ga0496110_0075224 Ga0496110_0075224_847_1617 229
342 3300048915 Ga0496112_0620212 Ga0496112_0620212_177_947 229
343 3300048917 Ga0496114_0097338 Ga0496114_0097338_982_1752 229
344 3300053088 Ga0500644_0004131 Ga0500644_0004131_719_1501 229
345 3300053117 Ga0500593_000880 Ga0500593_000880_5808_6590 229
346 3300053730 Ga0500645_000785 Ga0500645_000785_12375_13157 229
347 3300055283 Ga0500661_008623 Ga0500661_008623_263_1045 229
348 iso_pu_bacteria 2554235132 2554815682 229
349 iso_pu_bacteria 2606217733 2608383985 229
350 iso_pu_bacteria 2643221644 2644248119 229
351 iso_pu_bacteria 2765235841 2765583893 229
352 iso_pu_bacteria 2772190666 2772437085 229
353 iso_pu_bacteria 2831864461 2831868097 229
354 iso_pu_bacteria 2886848708 2886851341 229
355 iso_pu_bacteria 2937967321 2937970868 229
356 iso_pu_bacteria 2939651529 2939651911 229
357 iso_pu_bacteria 3007252601 3007252864 229
358 iso_pu_bacteria 3007315729 3007318483 229
359 iso_pu_bacteria 8011350971 8011356970 229
360 iso_pu_bacteria 8015394850 8015396017 229
361 3300003187 JGI25151J46595_10007991 JGI25151J46595_100079918 230
362 3300003771 Ga0055526_1016432 Ga0055526_10164324 230
363 3300003794 Ga0055531_10002027 Ga0055531_100020272 230
364 3300005328 Ga0070676_10042658 Ga0070676_100426582 230
365 3300005334 Ga0068869_100270250 Ga0068869_1002702501 230
366 3300005356 Ga0070674_100048653 Ga0070674_1000486532 230
367 3300005456 Ga0070678_100310077 Ga0070678_1003100772 230
368 3300005467 Ga0070706_100022574 Ga0070706_1000225744 230
369 3300006048 Ga0075363_100066233 Ga0075363_1000662332 230
370 3300006195 Ga0075366_10007707 Ga0075366_100077073 230
371 3300025295 Ga0209564_1005436 Ga0209564_10054361 230
372 3300025299 Ga0209256_1035187 Ga0209256_10351872 230
373 3300025907 Ga0207645_10078336 Ga0207645_100783362 230
374 3300025910 Ga0207684_10138398 Ga0207684_101383982 230
375 3300025960 Ga0207651_10814388 Ga0207651_108143881 230
376 3300027395 Ga0209996_1000696 Ga0209996_10006963 230
377 3300027526 Ga0209968_1000637 Ga0209968_10006373 230
378 3300027695 Ga0209966_1000358 Ga0209966_10003589 230
379 3300028563 Ga0265319_1040569 Ga0265319_10405692 230
380 3300028573 Ga0265334_10006206 Ga0265334_100062065 230
381 3300031731 Ga0307405_10106713 Ga0307405_101067132 230
382 3300031824 Ga0307413_10026309 Ga0307413_100263094 230
383 3300031911 Ga0307412_10055275 Ga0307412_100552752 230
384 3300032005 Ga0307411_10779855 Ga0307411_107798551 230
385 3300041404 Ga0439436_0004304 Ga0439436_0004304_510_1280 230
386 3300041405 Ga0439438_031469 Ga0439438_031469_368_1138 230
387 3300041406 Ga0439439_0008899 Ga0439439_0008899_881_1651 230
388 3300041407 Ga0439447_014261 Ga0439447_014261_860_1630 230
389 3300042006 Ga0439432_006450 Ga0439432_006450_1140_1910 230
390 3300042007 Ga0439449_0017677 Ga0439449_0017677_1168_1938 230
391 3300042015 Ga0439462_0000991 Ga0439462_0000991_4062_4832 230
392 3300042145 Ga0450906_007350 Ga0450906_007350_757_1527 230
393 3300042184 Ga0450908_007420 Ga0450908_007420_929_1699 230
394 3300042435 Ga0439434_0024300 Ga0439434_0024300_390_1160 230
395 3300049571 Ga0501034_0043859 Ga0501034_0043859_128_898 230
396 3300050489 nmdc:mga03683_1076_c1 nmdc:mga03683_1076_c1_4656_5426 230
397 3300050493 nmdc:mga0k408_4472_c2 nmdc:mga0k408_4472_c2_2497_3267 230
398 3300050493 nmdc:mga0k408_67129_c1 nmdc:mga0k408_67129_c1_407_1186 230
399 3300050493 nmdc:mga0k408_6802_c1 nmdc:mga0k408_6802_c1_973_1752 230
400 3300050496 nmdc:mga07m45_25305_c1 nmdc:mga07m45_25305_c1_1138_1917 230
401 iso_pu_bacteria 2511231011 2511296134 230
402 iso_pu_bacteria 2511231023 2511368228 230
403 iso_pu_bacteria 2852657418 2852657680 230
404 3300001915 JGI24741J21665_1000265 JGI24741J21665_100026515 231
405 3300001915 JGI24741J21665_1000994 JGI24741J21665_10009948 231
406 3300001979 JGI24740J21852_10005716 JGI24740J21852_100057165 231
407 3300003751 Ga0055538_1002773 Ga0055538_10027733 231
408 3300003751 Ga0055538_1002791 Ga0055538_10027911 231
409 3300003752 Ga0055539_1000061 Ga0055539_1000061130 231
410 3300003756 Ga0055533_1004572 Ga0055533_10045723 231
411 3300003756 Ga0055533_1004642 Ga0055533_10046422 231
412 3300003759 Ga0055525_1000476 Ga0055525_100047611 231
413 3300003841 Ga0055541_1004816 Ga0055541_10048161 231
414 3300003841 Ga0055541_1004829 Ga0055541_10048291 231
415 3300005262 Ga0065165_1000074 Ga0065165_1000074118 231
416 3300005344 Ga0070661_100000624 Ga0070661_10000062411 231
417 3300005455 Ga0070663_100000044 Ga0070663_10000004419 231
418 3300005535 Ga0070684_100358857 Ga0070684_1003588572 231
419 3300005564 Ga0070664_100000092 Ga0070664_10000009221 231
420 3300005614 Ga0068856_100000261 Ga0068856_10000026121 231
421 3300013102 Ga0157371_10000362 Ga0157371_1000036221 231
422 3300013104 Ga0157370_10001784 Ga0157370_100017849 231
423 3300021361 Ga0213872_10004213 Ga0213872_100042136 231
424 3300025224 Ga0209784_100003 Ga0209784_1000031269 231
425 3300025224 Ga0209784_101833 Ga0209784_1018333 231
426 3300025225 Ga0209566_100002 Ga0209566_1000022223 231
427 3300025225 Ga0209566_100911 Ga0209566_10091110 231
428 3300025226 Ga0209674_100094 Ga0209674_10009440 231
429 3300025226 Ga0209674_104056 Ga0209674_1040563 231
430 3300025230 Ga0209563_100004 Ga0209563_1000041640 231
431 3300025250 Ga0209026_1018123 Ga0209026_10181231 231
432 3300025253 Ga0209677_100071 Ga0209677_10007110 231
433 3300025263 Ga0209565_1018144 Ga0209565_10181441 231
434 3300025920 Ga0207649_10000082 Ga0207649_1000008268 231
435 3300025945 Ga0207679_10000619 Ga0207679_100006199 231
436 3300026067 Ga0207678_10000148 Ga0207678_1000014849 231
437 3300026078 Ga0207702_10000296 Ga0207702_1000029621 231
438 3300026142 Ga0207698_10517582 Ga0207698_105175821 231
439 3300028563 Ga0265319_1071253 Ga0265319_10712532 231
440 3300031344 Ga0265316_10000123 Ga0265316_100001235 231
441 3300037312 Ga0395899_0118446 Ga0395899_0118446_1097_1876 231
442 3300037418 Ga0395900_0000584 Ga0395900_0000584_2636_3415 231
443 3300037466 Ga0395898_0005468 Ga0395898_0005468_10639_11418 231
444 3300044656 Ga0466969_0013031 Ga0466969_0013031_2260_3042 231
445 3300044658 Ga0466972_0078929 Ga0466972_0078929_128_907 231
446 3300044683 Ga0466965_0017043 Ga0466965_0017043_762_1544 231
447 3300044684 Ga0466966_0041162 Ga0466966_0041162_1662_2444 231
448 3300044693 Ga0466961_0000078 Ga0466961_0000078_6780_7559 231
449 3300044706 Ga0466964_0013830 Ga0466964_0013830_358_1140 231
450 3300044765 Ga0466970_0028177 Ga0466970_0028177_1850_2632 231
451 3300044842 Ga0466957_0017205 Ga0466957_0017205_2733_3515 231
452 3300045836 Ga0466958_0055526 Ga0466958_0055526_140_922 231
453 3300045976 Ga0466967_0079324 Ga0466967_0079324_2058_2837 231
454 3300045976 Ga0466967_0258201 Ga0466967_0258201_511_1293 231
455 3300046492 Ga0495585_0092978 Ga0495585_0092978_689_1483 231
456 3300046522 Ga0495643_0085779 Ga0495643_0085779_234_1043 231
457 3300046537 Ga0495598_0036875 Ga0495598_0036875_474_1256 231
458 3300049460 Ga0495682_0000922 Ga0495682_0000922_4073_4867 231
459 3300059640 Ga0587067_027520 Ga0587067_027520_107_886 231
460 3300061719 Ga0466962_0131963 Ga0466962_0131963_175_957 231
461 iso_pu_bacteria 2513237165 2514042789 231
462 iso_pu_bacteria 2842854478 2842855132 231
463 iso_pu_bacteria 8056143049 8056146853 231
464 3300005441 Ga0070700_100028708 Ga0070700_1000287083 232
465 3300005456 Ga0070678_100010108 Ga0070678_1000101083 232
466 3300005459 Ga0068867_100020084 Ga0068867_1000200842 232
467 3300005617 Ga0068859_100395889 Ga0068859_1003958892 232
468 3300005843 Ga0068860_100024489 Ga0068860_1000244894 232
469 3300005844 Ga0068862_100025429 Ga0068862_1000254293 232
470 3300006195 Ga0075366_10021717 Ga0075366_100217174 232
471 3300006195 Ga0075366_10152756 Ga0075366_101527562 232
472 3300006881 Ga0068865_100028103 Ga0068865_1000281032 232
473 3300006931 Ga0097620_100395884 Ga0097620_1003958842 232
474 3300009148 Ga0105243_10134231 Ga0105243_101342311 232
475 3300009553 Ga0105249_10054631 Ga0105249_100546313 232
476 3300013102 Ga0157371_10000495 Ga0157371_1000049535 232
477 3300013297 Ga0157378_10280352 Ga0157378_102803522 232
478 3300013306 Ga0163162_10007432 Ga0163162_100074323 232
479 3300013306 Ga0163162_10451823 Ga0163162_104518231 232
480 3300013308 Ga0157375_10141485 Ga0157375_101414853 232
481 3300014326 Ga0157380_10009422 Ga0157380_100094223 232
482 3300021361 Ga0213872_10014229 Ga0213872_100142292 232
483 3300021361 Ga0213872_10095122 Ga0213872_100951222 232
484 3300021384 Ga0213876_10047182 Ga0213876_100471821 232
485 3300025899 Ga0207642_10020946 Ga0207642_100209463 232
486 3300025923 Ga0207681_10095492 Ga0207681_100954922 232
487 3300025938 Ga0207704_10083339 Ga0207704_100833392 232
488 3300025942 Ga0207689_10256317 Ga0207689_102563172 232
489 3300025961 Ga0207712_10020087 Ga0207712_100200873 232
490 3300026041 Ga0207639_10246179 Ga0207639_102461792 232
491 3300026067 Ga0207678_10251511 Ga0207678_102515112 232
492 3300026075 Ga0207708_10038385 Ga0207708_100383853 232
493 3300026089 Ga0207648_10000712 Ga0207648_1000071220 232
494 3300026121 Ga0207683_10018373 Ga0207683_100183733 232
495 3300027252 Ga0209973_1006036 Ga0209973_10060361 232
496 3300027312 Ga0209371_1000385 Ga0209371_100038521 232
497 3300027876 Ga0209974_10002361 Ga0209974_100023614 232
498 3300027876 Ga0209974_10087574 Ga0209974_100875741 232
499 3300028380 Ga0268265_10025627 Ga0268265_100256273 232
500 3300028381 Ga0268264_10001880 Ga0268264_1000188013 232
501 3300030500 Ga0268256_1000394 Ga0268256_100039417 232
502 3300031548 Ga0307408_100055614 Ga0307408_1000556143 232
503 3300031548 Ga0307408_100253624 Ga0307408_1002536242 232
504 3300031711 Ga0265314_10088080 Ga0265314_100880802 232
505 3300039437 Ga0436365_1750793 Ga0436365_1750793_1848_2636 232
506 3300039447 Ga0436361_0534065 Ga0436361_0534065_119_910 232
507 3300039447 Ga0436361_0897086 Ga0436361_0897086_2530_3312 232
508 3300046471 Ga0495650_0019183 Ga0495650_0019183_1396_2166 232
509 3300046474 Ga0495605_0000028 Ga0495605_0000028_65319_66113 232
510 3300046491 Ga0495584_0041502 Ga0495584_0041502_1180_1974 232
511 3300046492 Ga0495585_0045657 Ga0495585_0045657_375_1169 232
512 3300046507 Ga0495606_0042594 Ga0495606_0042594_102_884 232
513 3300046518 Ga0495631_0059611 Ga0495631_0059611_568_1362 232
514 3300046525 Ga0495663_0009833 Ga0495663_0009833_774_1568 232
515 3300046528 Ga0495642_0001824 Ga0495642_0001824_522_1316 232
516 3300046530 Ga0495654_0049306 Ga0495654_0049306_965_1759 232
517 3300046538 Ga0495609_0171723 Ga0495609_0171723_35_829 232
518 3300046542 Ga0495597_0001770 Ga0495597_0001770_3938_4732 232
519 3300046542 Ga0495597_0076293 Ga0495597_0076293_208_1002 232
520 3300046615 Ga0495656_0020272 Ga0495656_0020272_131_925 232
521 3300046616 Ga0495668_0007709 Ga0495668_0007709_182_976 232
522 3300046648 Ga0495611_0008403 Ga0495611_0008403_154_948 232
523 3300046664 Ga0495659_0000703 Ga0495659_0000703_6301_7095 232
524 3300046691 Ga0495670_0050522 Ga0495670_0050522_30_824 232
525 3300046692 Ga0495671_0000099 Ga0495671_0000099_72702_73496 232
526 3300047320 Ga0495672_0000121 Ga0495672_0000121_17508_18302 232
527 3300047320 Ga0495672_0007060 Ga0495672_0007060_7144_7938 232
528 3300047446 Ga0495679_050089 Ga0495679_050089_216_986 232
529 3300048907 Ga0496104_0104525 Ga0496104_0104525_1696_2466 232
530 3300048912 Ga0496109_0025836 Ga0496109_0025836_1672_2454 232
531 3300048913 Ga0496110_0010486 Ga0496110_0010486_3300_4082 232
532 3300048920 Ga0496117_0008046 Ga0496117_0008046_6194_6964 232
533 3300048921 Ga0496118_0032414 Ga0496118_0032414_387_1157 232
534 3300048922 Ga0496119_0001419 Ga0496119_0001419_5546_6316 232
535 3300048923 Ga0496120_0001068 Ga0496120_0001068_22756_23526 232
536 3300049515 Ga0501292_000890 Ga0501292_000890_1313_2083 232
537 3300049521 Ga0501298_040149 Ga0501298_040149_165_935 232
538 3300049526 Ga0501303_005105 Ga0501303_005105_10_780 232
539 3300049574 Ga0501038_0060389 Ga0501038_0060389_327_1097 232
540 3300049686 Ga0501257_008825 Ga0501257_008825_1374_2144 232
541 3300049759 Ga0501262_003369 Ga0501262_003369_954_1724 232
542 3300049762 Ga0501265_000790 Ga0501265_000790_411_1181 232
543 3300049763 Ga0501266_001612 Ga0501266_001612_1495_2277 232
544 3300050493 nmdc:mga0k408_303675_c1 nmdc:mga0k408_303675_c1_163_933 232
545 3300050493 nmdc:mga0k408_86743_c1 nmdc:mga0k408_86743_c1_942_1712 232
546 3300002738 JGI25154J39366_1001938 JGI25154J39366_10019385 233
547 3300003203 JGI25406J46586_10019639 JGI25406J46586_100196393 233
548 3300003771 Ga0055526_1001143 Ga0055526_10011438 233
549 3300003773 Ga0055537_1000030 Ga0055537_100003087 233
550 3300003775 Ga0055524_1000170 Ga0055524_100017072 233
551 3300003784 Ga0055534_1000447 Ga0055534_100044715 233
552 3300003784 Ga0055534_1023163 Ga0055534_10231631 233
553 3300003790 Ga0055528_1000439 Ga0055528_10004394 233
554 3300003791 Ga0055530_10001733 Ga0055530_100017335 233
555 3300003792 Ga0055540_1000075 Ga0055540_100007577 233
556 3300003794 Ga0055531_10027976 Ga0055531_100279763 233
557 3300005289 Ga0065704_10009900 Ga0065704_100099003 233
558 3300005289 Ga0065704_10197466 Ga0065704_101974662 233
559 3300005295 Ga0065707_10202545 Ga0065707_102025452 233
560 3300005327 Ga0070658_10047762 Ga0070658_100477622 233
561 3300005327 Ga0070658_10055268 Ga0070658_100552683 233
562 3300005327 Ga0070658_10186708 Ga0070658_101867082 233
563 3300005334 Ga0068869_100368921 Ga0068869_1003689212 233
564 3300005336 Ga0070680_100021745 Ga0070680_1000217452 233
565 3300005336 Ga0070680_100093912 Ga0070680_1000939123 233
566 3300005338 Ga0068868_100038720 Ga0068868_1000387203 233
567 3300005338 Ga0068868_100214275 Ga0068868_1002142752 233
568 3300005339 Ga0070660_100004866 Ga0070660_1000048669 233
569 3300005339 Ga0070660_100139684 Ga0070660_1001396843 233
570 3300005339 Ga0070660_100286637 Ga0070660_1002866371 233
571 3300005340 Ga0070689_100026373 Ga0070689_1000263733 233
572 3300005344 Ga0070661_100005953 Ga0070661_1000059536 233
573 3300005344 Ga0070661_100178363 Ga0070661_1001783632 233
574 3300005347 Ga0070668_100461031 Ga0070668_1004610312 233
575 3300005353 Ga0070669_100042039 Ga0070669_1000420392 233
576 3300005364 Ga0070673_100164752 Ga0070673_1001647522 233
577 3300005366 Ga0070659_100000531 Ga0070659_10000053122 233
578 3300005366 Ga0070659_100141182 Ga0070659_1001411822 233
579 3300005434 Ga0070709_10011796 Ga0070709_100117964 233
580 3300005435 Ga0070714_100131593 Ga0070714_1001315932 233
581 3300005435 Ga0070714_100170833 Ga0070714_1001708332 233
582 3300005436 Ga0070713_100008297 Ga0070713_1000082977 233
583 3300005437 Ga0070710_10010139 Ga0070710_100101392 233
584 3300005437 Ga0070710_10041036 Ga0070710_100410362 233
585 3300005439 Ga0070711_100242260 Ga0070711_1002422602 233
586 3300005440 Ga0070705_100009809 Ga0070705_1000098092 233
587 3300005455 Ga0070663_100102768 Ga0070663_1001027682 233
588 3300005456 Ga0070678_100041159 Ga0070678_1000411593 233
589 3300005457 Ga0070662_100012131 Ga0070662_1000121313 233
590 3300005459 Ga0068867_100188902 Ga0068867_1001889022 233
591 3300005530 Ga0070679_100002865 Ga0070679_1000028652 233
592 3300005535 Ga0070684_100143246 Ga0070684_1001432462 233
593 3300005543 Ga0070672_100046560 Ga0070672_1000465603 233
594 3300005544 Ga0070686_100045240 Ga0070686_1000452402 233
595 3300005563 Ga0068855_100175073 Ga0068855_1001750733 233
596 3300005563 Ga0068855_100365245 Ga0068855_1003652452 233
597 3300005564 Ga0070664_100008307 Ga0070664_1000083076 233
598 3300005564 Ga0070664_100088727 Ga0070664_1000887272 233
599 3300005577 Ga0068857_100332729 Ga0068857_1003327292 233
600 3300005578 Ga0068854_100436918 Ga0068854_1004369182 233
601 3300005614 Ga0068856_100272944 Ga0068856_1002729441 233
602 3300005614 Ga0068856_101116682 Ga0068856_1011166821 233
603 3300005615 Ga0070702_100020508 Ga0070702_1000205084 233
604 3300005616 Ga0068852_100003198 Ga0068852_1000031987 233
605 3300005617 Ga0068859_100528320 Ga0068859_1005283201 233
606 3300005834 Ga0068851_10159555 Ga0068851_101595552 233
607 3300005937 Ga0081455_10012343 Ga0081455_100123437 233
608 3300005937 Ga0081455_10253535 Ga0081455_102535352 233
609 3300005985 Ga0081539_10000522 Ga0081539_100005225 233
610 3300006028 Ga0070717_10007418 Ga0070717_100074184 233
611 3300006028 Ga0070717_10041629 Ga0070717_100416295 233
612 3300006038 Ga0075365_10098830 Ga0075365_100988301 233
613 3300006058 Ga0075432_10000446 Ga0075432_100004462 233
614 3300006163 Ga0070715_10007918 Ga0070715_100079184 233
615 3300006173 Ga0070716_100029877 Ga0070716_1000298772 233
616 3300006194 Ga0075427_10000343 Ga0075427_100003434 233
617 3300006195 Ga0075366_10000110 Ga0075366_100001104 233
618 3300006195 Ga0075366_10007688 Ga0075366_100076883 233
619 3300006195 Ga0075366_10278140 Ga0075366_102781401 233
620 3300006237 Ga0097621_100090559 Ga0097621_1000905593 233
621 3300006844 Ga0075428_100013017 Ga0075428_1000130178 233
622 3300006846 Ga0075430_100001551 Ga0075430_10000155116 233
623 3300006847 Ga0075431_100003715 Ga0075431_1000037154 233
624 3300006852 Ga0075433_10000008 Ga0075433_1000000869 233
625 3300006852 Ga0075433_10100116 Ga0075433_101001164 233
626 3300006871 Ga0075434_100000229 Ga0075434_10000022934 233
627 3300006871 Ga0075434_100018903 Ga0075434_1000189036 233
628 3300006871 Ga0075434_100174769 Ga0075434_1001747693 233
629 3300006871 Ga0075434_100261710 Ga0075434_1002617101 233
630 3300006880 Ga0075429_100004392 Ga0075429_1000043924 233
631 3300006914 Ga0075436_100054223 Ga0075436_1000542233 233
632 3300006914 Ga0075436_100125520 Ga0075436_1001255202 233
633 3300006931 Ga0097620_100528341 Ga0097620_1005283411 233
634 3300006946 Ga0079104_1000004 Ga0079104_100000450 233
635 3300006946 Ga0079104_1000071 Ga0079104_10000719 233
636 3300007076 Ga0075435_100013904 Ga0075435_1000139043 233
637 3300007076 Ga0075435_100028161 Ga0075435_1000281612 233
638 3300007076 Ga0075435_100048535 Ga0075435_1000485352 233
639 3300009011 Ga0105251_10017691 Ga0105251_100176913 233
640 3300009093 Ga0105240_10128353 Ga0105240_101283532 233
641 3300009094 Ga0111539_10029199 Ga0111539_100291996 233
642 3300009094 Ga0111539_10629137 Ga0111539_106291372 233
643 3300009098 Ga0105245_10032163 Ga0105245_100321632 233
644 3300009098 Ga0105245_10425925 Ga0105245_104259251 233
645 3300009147 Ga0114129_10004941 Ga0114129_1000494118 233
646 3300009147 Ga0114129_10042906 Ga0114129_100429066 233
647 3300009148 Ga0105243_10000261 Ga0105243_1000026164 233
648 3300009148 Ga0105243_10158739 Ga0105243_101587392 233
649 3300009174 Ga0105241_10059379 Ga0105241_100593793 233
650 3300009174 Ga0105241_10068016 Ga0105241_100680164 233
651 3300009545 Ga0105237_10026592 Ga0105237_100265925 233
652 3300009545 Ga0105237_10582208 Ga0105237_105822081 233
653 3300009551 Ga0105238_10214090 Ga0105238_102140902 233
654 3300009553 Ga0105249_10993488 Ga0105249_109934881 233
655 3300012483 Ga0157337_1000655 Ga0157337_10006551 233
656 3300012494 Ga0157341_1000371 Ga0157341_10003713 233
657 3300012510 Ga0157316_1002259 Ga0157316_10022592 233
658 3300013102 Ga0157371_10089346 Ga0157371_100893462 233
659 3300013104 Ga0157370_10586920 Ga0157370_105869201 233
660 3300013306 Ga0163162_10592214 Ga0163162_105922142 233
661 3300013307 Ga0157372_10426798 Ga0157372_104267982 233
662 3300013307 Ga0157372_10558946 Ga0157372_105589462 233
663 3300014745 Ga0157377_10029803 Ga0157377_100298032 233
664 3300014968 Ga0157379_10661589 Ga0157379_106615891 233
665 3300014969 Ga0157376_10023706 Ga0157376_100237063 233
666 3300017792 Ga0163161_10108581 Ga0163161_101085812 233
667 3300021361 Ga0213872_10000589 Ga0213872_1000058915 233
668 3300021361 Ga0213872_10008073 Ga0213872_100080732 233
669 3300025246 Ga0209646_1000051 Ga0209646_1000051194 233
670 3300025263 Ga0209565_1000017 Ga0209565_100001719 233
671 3300025273 Ga0209673_1000007 Ga0209673_1000007410 233
672 3300025291 Ga0209675_1000009 Ga0209675_1000009108 233
673 3300025291 Ga0209675_1035974 Ga0209675_10359742 233
674 3300025295 Ga0209564_1000055 Ga0209564_100005543 233
675 3300025298 Ga0209050_1000956 Ga0209050_100095610 233
676 3300025299 Ga0209256_1000051 Ga0209256_1000051233 233
677 3300025299 Ga0209256_1000559 Ga0209256_100055937 233
678 3300025303 Ga0209051_1000177 Ga0209051_100017778 233
679 3300025304 Ga0209257_1000322 Ga0209257_100032220 233
680 3300025898 Ga0207692_10022143 Ga0207692_100221432 233
681 3300025900 Ga0207710_10107210 Ga0207710_101072102 233
682 3300025903 Ga0207680_10072303 Ga0207680_100723032 233
683 3300025905 Ga0207685_10012741 Ga0207685_100127414 233
684 3300025906 Ga0207699_10109555 Ga0207699_101095551 233
685 3300025907 Ga0207645_10054049 Ga0207645_100540492 233
686 3300025909 Ga0207705_10055860 Ga0207705_100558603 233
687 3300025909 Ga0207705_10334205 Ga0207705_103342052 233
688 3300025909 Ga0207705_10338446 Ga0207705_103384462 233
689 3300025911 Ga0207654_10057690 Ga0207654_100576902 233
690 3300025912 Ga0207707_10281226 Ga0207707_102812262 233
691 3300025913 Ga0207695_10342795 Ga0207695_103427952 233
692 3300025915 Ga0207693_10016831 Ga0207693_100168315 233
693 3300025915 Ga0207693_10080258 Ga0207693_100802582 233
694 3300025916 Ga0207663_10006987 Ga0207663_100069874 233
695 3300025917 Ga0207660_10121954 Ga0207660_101219542 233
696 3300025918 Ga0207662_10119838 Ga0207662_101198382 233
697 3300025919 Ga0207657_10042193 Ga0207657_100421935 233
698 3300025919 Ga0207657_10082221 Ga0207657_100822212 233
699 3300025920 Ga0207649_10008546 Ga0207649_100085466 233
700 3300025920 Ga0207649_10206879 Ga0207649_102068792 233
701 3300025921 Ga0207652_10094734 Ga0207652_100947342 233
702 3300025923 Ga0207681_10048936 Ga0207681_100489361 233
703 3300025924 Ga0207694_10039743 Ga0207694_100397435 233
704 3300025925 Ga0207650_10152516 Ga0207650_101525162 233
705 3300025925 Ga0207650_10176622 Ga0207650_101766222 233
706 3300025927 Ga0207687_10118293 Ga0207687_101182932 233
707 3300025928 Ga0207700_10000499 Ga0207700_100004997 233
708 3300025928 Ga0207700_10013150 Ga0207700_100131506 233
709 3300025929 Ga0207664_10410399 Ga0207664_104103991 233
710 3300025931 Ga0207644_10256803 Ga0207644_102568031 233
711 3300025932 Ga0207690_10000736 Ga0207690_1000073617 233
712 3300025933 Ga0207706_10008764 Ga0207706_100087643 233
713 3300025933 Ga0207706_10101190 Ga0207706_101011903 233
714 3300025935 Ga0207709_10000019 Ga0207709_10000019114 233
715 3300025937 Ga0207669_10169893 Ga0207669_101698931 233
716 3300025937 Ga0207669_10234575 Ga0207669_102345752 233
717 3300025940 Ga0207691_10049849 Ga0207691_100498493 233
718 3300025942 Ga0207689_10013235 Ga0207689_100132355 233
719 3300025945 Ga0207679_10024218 Ga0207679_100242184 233
720 3300025945 Ga0207679_10100533 Ga0207679_101005331 233
721 3300025949 Ga0207667_10100662 Ga0207667_101006621 233
722 3300025960 Ga0207651_10102413 Ga0207651_101024132 233
723 3300025972 Ga0207668_10175086 Ga0207668_101750862 233
724 3300025986 Ga0207658_10054268 Ga0207658_100542684 233
725 3300026023 Ga0207677_10016042 Ga0207677_100160423 233
726 3300026067 Ga0207678_10033083 Ga0207678_100330832 233
727 3300026078 Ga0207702_10033589 Ga0207702_100335891 233
728 3300026089 Ga0207648_10034904 Ga0207648_100349042 233
729 3300026116 Ga0207674_10084893 Ga0207674_100848932 233
730 3300026116 Ga0207674_10384841 Ga0207674_103848412 233
731 3300026121 Ga0207683_10004947 Ga0207683_100049472 233
732 3300026121 Ga0207683_10031010 Ga0207683_100310104 233
733 3300027111 Ga0209281_1000005 Ga0209281_1000005251 233
734 3300027111 Ga0209281_1000098 Ga0209281_1000098194 233
735 3300027111 Ga0209281_1000135 Ga0209281_100013529 233
736 3300027907 Ga0207428_10000233 Ga0207428_100002334 233
737 3300028379 Ga0268266_10283711 Ga0268266_102837112 233
738 3300028573 Ga0265334_10038795 Ga0265334_100387952 233
739 3300028794 Ga0307515_10070676 Ga0307515_100706763 233
740 3300028800 Ga0265338_10036918 Ga0265338_100369181 233
741 3300031235 Ga0265330_10015365 Ga0265330_100153654 233
742 3300031238 Ga0265332_10000037 Ga0265332_10000037105 233
743 3300031241 Ga0265325_10039163 Ga0265325_100391633 233
744 3300031249 Ga0265339_10113229 Ga0265339_101132292 233
745 3300031250 Ga0265331_10021628 Ga0265331_100216282 233
746 3300031250 Ga0265331_10040113 Ga0265331_100401132 233
747 3300031456 Ga0307513_10000006 Ga0307513_1000000681 233
748 3300031548 Ga0307408_100000203 Ga0307408_10000020313 233
749 3300031595 Ga0265313_10031201 Ga0265313_100312012 233
750 3300031711 Ga0265314_10011175 Ga0265314_100111754 233
751 3300031712 Ga0265342_10023446 Ga0265342_100234464 233
752 3300031712 Ga0265342_10024120 Ga0265342_100241203 233
753 3300031901 Ga0307406_10000704 Ga0307406_100007045 233
754 3300034817 Ga0373948_0050102 Ga0373948_0050102_73_855 233
755 3300034820 Ga0373959_0036939 Ga0373959_0036939_194_976 233
756 3300035091 Ga0373951_0001691 Ga0373951_0001691_2244_3026 233
757 3300035092 Ga0373952_0003427 Ga0373952_0003427_1679_2461 233
758 3300035112 Ga0373932_0031709 Ga0373932_0031709_107_889 233
759 3300035118 Ga0373954_0048918 Ga0373954_0048918_940_1722 233
760 3300035121 Ga0373960_0002509 Ga0373960_0002509_185_967 233
761 3300035691 Ga0373931_0002827 Ga0373931_0002827_6912_7694 233
762 3300035725 Ga0373947_0204478 Ga0373947_0204478_252_1034 233
763 3300036401 Ga0373937_0236822 Ga0373937_0236822_825_1607 233
764 3300037068 Ga0373925_0040570 Ga0373925_0040570_1874_2656 233
765 3300037312 Ga0395899_0002696 Ga0395899_0002696_11522_12295 233
766 3300037312 Ga0395899_0004305 Ga0395899_0004305_5927_6697 233
767 3300037312 Ga0395899_0076197 Ga0395899_0076197_543_1316 233
768 3300037418 Ga0395900_0006855 Ga0395900_0006855_7093_7863 233
769 3300037418 Ga0395900_0027588 Ga0395900_0027588_2318_3091 233
770 3300037466 Ga0395898_0003262 Ga0395898_0003262_13125_13895 233
771 3300037466 Ga0395898_0025689 Ga0395898_0025689_1901_2674 233
772 3300037471 Ga0395905_0000126 Ga0395905_0000126_23996_24766 233
773 3300037471 Ga0395905_0021636 Ga0395905_0021636_3976_4746 233
774 3300037471 Ga0395905_0036837 Ga0395905_0036837_2800_3570 233
775 3300037471 Ga0395905_0037442 Ga0395905_0037442_370_1140 233
776 3300037853 Ga0436364_0913607 Ga0436364_0913607_1405_2187 233
777 3300038443 Ga0395901_0000122 Ga0395901_0000122_1901_2674 233
778 3300038443 Ga0395901_0048978 Ga0395901_0048978_3376_4146 233
779 3300038443 Ga0395901_0101158 Ga0395901_0101158_2164_2934 233
780 3300039447 Ga0436361_0702679 Ga0436361_0702679_4300_5079 233
781 3300039447 Ga0436361_0837681 Ga0436361_0837681_568_1338 233
782 3300041453 Ga0451797_0622548 Ga0451797_0622548_18_797 233
783 3300042015 Ga0439462_0044989 Ga0439462_0044989_31_801 233
784 3300042121 Ga0450919_000767 Ga0450919_000767_2197_2967 233
785 3300042125 Ga0450923_014350 Ga0450923_014350_281_1051 233
786 3300042139 Ga0450904_000303 Ga0450904_000303_6627_7409 233
787 3300042156 Ga0439446_0096675 Ga0439446_0096675_21_791 233
788 3300042461 Ga0439460_0001614 Ga0439460_0001614_1278_2081 233
789 3300042531 Ga0450918_000103 Ga0450918_000103_2536_3306 233
790 3300042876 Ga0451577_0153376 Ga0451577_0153376_364_1146 233
791 3300042876 Ga0451577_0465095 Ga0451577_0465095_184_993 233
792 3300044656 Ga0466969_0000140 Ga0466969_0000140_31979_32749 233
793 3300044656 Ga0466969_0007165 Ga0466969_0007165_726_1496 233
794 3300044656 Ga0466969_0017664 Ga0466969_0017664_1291_2061 233
795 3300044656 Ga0466969_0024405 Ga0466969_0024405_1578_2354 233
796 3300044656 Ga0466969_0078999 Ga0466969_0078999_504_1280 233
797 3300044658 Ga0466972_0000970 Ga0466972_0000970_11655_12425 233
798 3300044683 Ga0466965_0026724 Ga0466965_0026724_453_1223 233
799 3300044683 Ga0466965_0044809 Ga0466965_0044809_1235_2005 233
800 3300044684 Ga0466966_0041901 Ga0466966_0041901_1421_2197 233
801 3300044684 Ga0466966_0057554 Ga0466966_0057554_1311_2081 233
802 3300044684 Ga0466966_0082289 Ga0466966_0082289_613_1383 233
803 3300044693 Ga0466961_0000186 Ga0466961_0000186_24396_25172 233
804 3300044693 Ga0466961_0034566 Ga0466961_0034566_2037_2807 233
805 3300044693 Ga0466961_0089275 Ga0466961_0089275_521_1291 233
806 3300044712 Ga0453684_0003977 Ga0453684_0003977_7362_8144 233
807 3300044719 Ga0466971_0024636 Ga0466971_0024636_1889_2659 233
808 3300044765 Ga0466970_0029479 Ga0466970_0029479_892_1662 233
809 3300044765 Ga0466970_0034333 Ga0466970_0034333_1016_1786 233
810 3300044842 Ga0466957_0004850 Ga0466957_0004850_1791_2573 233
811 3300045049 Ga0466959_0005356 Ga0466959_0005356_75_851 233
812 3300045049 Ga0466959_0011392 Ga0466959_0011392_4190_4960 233
813 3300045049 Ga0466959_0015134 Ga0466959_0015134_2761_3531 233
814 3300045051 Ga0451576_0089170 Ga0451576_0089170_325_1095 233
815 3300046455 Ga0495603_0015152 Ga0495603_0015152_1242_2063 233
816 3300046457 Ga0495590_0120095 Ga0495590_0120095_44_838 233
817 3300046460 Ga0495638_0011096 Ga0495638_0011096_2283_3077 233
818 3300046460 Ga0495638_0117897 Ga0495638_0117897_717_1499 233
819 3300046472 Ga0495580_0054114 Ga0495580_0054114_468_1262 233
820 3300046473 Ga0495582_0000544 Ga0495582_0000544_18477_19259 233
821 3300046473 Ga0495582_0001041 Ga0495582_0001041_8380_9174 233
822 3300046474 Ga0495605_0003493 Ga0495605_0003493_2814_3608 233
823 3300046491 Ga0495584_0011239 Ga0495584_0011239_970_1764 233
824 3300046492 Ga0495585_0016926 Ga0495585_0016926_2131_2925 233
825 3300046499 Ga0495594_0028065 Ga0495594_0028065_1717_2511 233
826 3300046501 Ga0495607_0013919 Ga0495607_0013919_3615_4409 233
827 3300046501 Ga0495607_0046391 Ga0495607_0046391_1449_2243 233
828 3300046501 Ga0495607_0082447 Ga0495607_0082447_278_1072 233
829 3300046507 Ga0495606_0022813 Ga0495606_0022813_3653_4447 233
830 3300046507 Ga0495606_0151774 Ga0495606_0151774_213_995 233
831 3300046511 Ga0495608_0058873 Ga0495608_0058873_42_824 233
832 3300046513 Ga0495616_0005376 Ga0495616_0005376_2121_2915 233
833 3300046513 Ga0495616_0021888 Ga0495616_0021888_2080_2874 233
834 3300046517 Ga0495630_0344858 Ga0495630_0344858_42_836 233
835 3300046518 Ga0495631_0123251 Ga0495631_0123251_88_882 233
836 3300046519 Ga0495632_0004344 Ga0495632_0004344_5065_5859 233
837 3300046522 Ga0495643_0162764 Ga0495643_0162764_106_876 233
838 3300046524 Ga0495648_0164980 Ga0495648_0164980_321_1115 233
839 3300046526 Ga0495666_0002773 Ga0495666_0002773_6069_6890 233
840 3300046526 Ga0495666_0022417 Ga0495666_0022417_1821_2615 233
841 3300046528 Ga0495642_0034519 Ga0495642_0034519_144_1157 233
842 3300046528 Ga0495642_0154828 Ga0495642_0154828_75_869 233
843 3300046531 Ga0495665_0022066 Ga0495665_0022066_946_1767 233
844 3300046538 Ga0495609_0006187 Ga0495609_0006187_3573_4367 233
845 3300046538 Ga0495609_0103483 Ga0495609_0103483_160_954 233
846 3300046542 Ga0495597_0001202 Ga0495597_0001202_8875_9657 233
847 3300046542 Ga0495597_0068567 Ga0495597_0068567_702_1496 233
848 3300046557 Ga0495622_0000313 Ga0495622_0000313_12703_13524 233
849 3300046557 Ga0495622_0001289 Ga0495622_0001289_3449_4243 233
850 3300046557 Ga0495622_0007366 Ga0495622_0007366_3262_4119 233
851 3300046558 Ga0495633_0161876 Ga0495633_0161876_86_880 233
852 3300046559 Ga0495667_0029765 Ga0495667_0029765_1663_2445 233
853 3300046559 Ga0495667_0171116 Ga0495667_0171116_114_971 233
854 3300046616 Ga0495668_0021804 Ga0495668_0021804_25_819 233
855 3300046616 Ga0495668_0023900 Ga0495668_0023900_2540_3334 233
856 3300046642 Ga0495634_0072068 Ga0495634_0072068_955_1737 233
857 3300046648 Ga0495611_0006168 Ga0495611_0006168_3661_4455 233
858 3300046660 Ga0495625_0001275 Ga0495625_0001275_13775_14569 233
859 3300046660 Ga0495625_0041790 Ga0495625_0041790_2254_3048 233
860 3300046660 Ga0495625_0051755 Ga0495625_0051755_1334_2128 233
861 3300046665 Ga0495661_0085074 Ga0495661_0085074_317_1111 233
862 3300046665 Ga0495661_0176146 Ga0495661_0176146_59_853 233
863 3300046674 Ga0495588_0016215 Ga0495588_0016215_1796_2590 233
864 3300046674 Ga0495588_0019440 Ga0495588_0019440_708_1502 233
865 3300046679 Ga0495623_0016449 Ga0495623_0016449_118_912 233
866 3300046680 Ga0495646_0274667 Ga0495646_0274667_70_852 233
867 3300046683 Ga0495658_0027552 Ga0495658_0027552_1113_1895 233
868 3300046684 Ga0495669_0001599 Ga0495669_0001599_357_1151 233
869 3300046690 Ga0495624_0038663 Ga0495624_0038663_1327_2148 233
870 3300046691 Ga0495670_0008893 Ga0495670_0008893_2057_2839 233
871 3300046694 Ga0495649_0003578 Ga0495649_0003578_2400_3194 233
872 3300046794 Ga0495589_0001969 Ga0495589_0001969_2119_2901 233
873 3300046794 Ga0495589_0013381 Ga0495589_0013381_3411_4205 233
874 3300047315 Ga0495581_0003117 Ga0495581_0003117_3399_4220 233
875 3300047315 Ga0495581_0011358 Ga0495581_0011358_1786_2580 233
876 3300047315 Ga0495581_0129853 Ga0495581_0129853_83_877 233
877 3300047315 Ga0495581_0178220 Ga0495581_0178220_257_1039 233
878 3300047317 Ga0495604_0009489 Ga0495604_0009489_1912_2706 233
879 3300047317 Ga0495604_0355670 Ga0495604_0355670_171_953 233
880 3300047319 Ga0495674_0313585 Ga0495674_0313585_208_990 233
881 3300047320 Ga0495672_0000683 Ga0495672_0000683_10476_11258 233
882 3300047321 Ga0495676_0001982 Ga0495676_0001982_12109_12903 233
883 3300047443 Ga0495687_001377 Ga0495687_001377_11985_12767 233
884 3300047445 Ga0495677_0001290 Ga0495677_0001290_1694_2488 233
885 3300047445 Ga0495677_0041345 Ga0495677_0041345_609_1403 233
886 3300047446 Ga0495679_031590 Ga0495679_031590_499_1293 233
887 3300047470 Ga0495681_0005905 Ga0495681_0005905_1804_2598 233
888 3300047470 Ga0495681_0019386 Ga0495681_0019386_1027_1821 233
889 3300047673 Ga0495593_0009491 Ga0495593_0009491_2935_3729 233
890 3300047673 Ga0495593_0192361 Ga0495593_0192361_38_820 233
891 3300048089 Ga0495614_0003116 Ga0495614_0003116_5094_5888 233
892 3300048091 Ga0495626_0058537 Ga0495626_0058537_937_1731 233
893 3300048903 Ga0496100_0004874 Ga0496100_0004874_4609_5391 233
894 3300048905 Ga0496102_0317191 Ga0496102_0317191_455_1237 233
895 3300048907 Ga0496104_0000311 Ga0496104_0000311_1236_2018 233
896 3300048907 Ga0496104_0155734 Ga0496104_0155734_561_1343 233
897 3300048908 Ga0496105_0038775 Ga0496105_0038775_2771_3553 233
898 3300048909 Ga0496106_0058136 Ga0496106_0058136_1584_2366 233
899 3300048910 Ga0496107_0037783 Ga0496107_0037783_496_1278 233
900 3300048912 Ga0496109_0045584 Ga0496109_0045584_2637_3419 233
901 3300048913 Ga0496110_0553905 Ga0496110_0553905_205_987 233
902 3300048916 Ga0496113_0112092 Ga0496113_0112092_782_1564 233
903 3300048917 Ga0496114_0012881 Ga0496114_0012881_3635_4405 233
904 3300048917 Ga0496114_0061430 Ga0496114_0061430_1605_2387 233
905 3300048917 Ga0496114_0075946 Ga0496114_0075946_850_1632 233
906 3300048918 Ga0496115_0093554 Ga0496115_0093554_481_1263 233
907 3300048925 Ga0496122_0060095 Ga0496122_0060095_875_1657 233
908 3300048926 Ga0496123_0022778 Ga0496123_0022778_2440_3225 233
909 3300048928 Ga0496125_0006133 Ga0496125_0006133_5764_6546 233
910 3300049459 Ga0495678_085957 Ga0495678_085957_282_1076 233
911 3300049575 Ga0501039_0052036 Ga0501039_0052036_800_1594 233
912 3300049576 Ga0501040_0044724 Ga0501040_0044724_1536_2330 233
913 3300049577 Ga0501041_0124042 Ga0501041_0124042_718_1512 233
914 3300049578 Ga0501042_0340714 Ga0501042_0340714_168_962 233
915 3300049580 Ga0501046_0061483 Ga0501046_0061483_1067_1861 233
916 3300049581 Ga0501047_0329892 Ga0501047_0329892_506_1276 233
917 3300049582 Ga0501048_0088350 Ga0501048_0088350_1150_1944 233
918 3300049587 Ga0501071_0019978 Ga0501071_0019978_2103_2897 233
919 3300049588 Ga0501072_0043830 Ga0501072_0043830_727_1521 233
920 3300049588 Ga0501072_0332993 Ga0501072_0332993_67_861 233
921 3300049591 Ga0501075_0010572 Ga0501075_0010572_3244_4038 233
922 3300049592 Ga0501076_0012122 Ga0501076_0012122_1084_1878 233
923 3300049593 Ga0501077_0007133 Ga0501077_0007133_6076_6870 233
924 3300049742 Ga0501080_0142171 Ga0501080_0142171_549_1343 233
925 3300049742 Ga0501080_0184593 Ga0501080_0184593_506_1276 233
926 3300049743 Ga0501081_0026219 Ga0501081_0026219_1581_2375 233
927 3300049822 Ga0501035_0091692 Ga0501035_0091692_380_1150 233
928 3300049823 Ga0501044_0038330 Ga0501044_0038330_1644_2414 233
929 3300049824 Ga0501045_0061879 Ga0501045_0061879_1453_2247 233
930 3300050492 nmdc:mga0yw44_42587_c1 nmdc:mga0yw44_42587_c1_1259_2029 233
931 3300050493 nmdc:mga0k408_116947_c1 nmdc:mga0k408_116947_c1_499_1281 233
932 3300050493 nmdc:mga0k408_7968_c2 nmdc:mga0k408_7968_c2_3409_4191 233
933 3300050507 nmdc:mga05p37_4601_c1 nmdc:mga05p37_4601_c1_7709_8491 233
934 3300050508 nmdc:mga09592_808_c1 nmdc:mga09592_808_c1_21543_22325 233
935 3300050509 nmdc:mga0qj67_1239_c1 nmdc:mga0qj67_1239_c1_1854_2636 233
936 3300050510 nmdc:mga06r32_17895_c1 nmdc:mga06r32_17895_c1_3843_4625 233
937 3300050511 nmdc:mga08y16_49099_c1 nmdc:mga08y16_49099_c1_1130_1912 233
938 3300050512 nmdc:mga0n895_1829_c1 nmdc:mga0n895_1829_c1_9348_10130 233
939 3300050512 nmdc:mga0n895_274451_c1 nmdc:mga0n895_274451_c1_93_875 233
940 3300050512 nmdc:mga0n895_27759_c1 nmdc:mga0n895_27759_c1_1854_2636 233
941 3300050513 nmdc:mga0rr50_238821_c1 nmdc:mga0rr50_238821_c1_711_1493 233
942 3300050513 nmdc:mga0rr50_27161_c1 nmdc:mga0rr50_27161_c1_1687_2469 233
943 3300050513 nmdc:mga0rr50_292322_c1 nmdc:mga0rr50_292322_c1_386_1174 233
944 3300050514 nmdc:mga08x19_60469_c1 nmdc:mga08x19_60469_c1_1058_1840 233
945 3300050515 nmdc:mga0a205_145070_c1 nmdc:mga0a205_145070_c1_94_882 233
946 3300050515 nmdc:mga0a205_3529_c1 nmdc:mga0a205_3529_c1_11344_12126 233
947 3300050515 nmdc:mga0a205_37363_c1 nmdc:mga0a205_37363_c1_1687_2469 233
948 3300053093 Ga0500651_0226306 Ga0500651_0226306_214_996 233
949 3300053139 Ga0500568_0007841 Ga0500568_0007841_1096_1866 233
950 3300054114 Ga0501084_0110106 Ga0501084_0110106_310_1104 233
951 3300060353 Ga0501082_0063082 Ga0501082_0063082_1570_2364 233
952 3300061719 Ga0466962_0025785 Ga0466962_0025785_700_1470 233
953 3300061734 Ga0530510_0007515 Ga0530510_0007515_1304_2098 233
954 iso_pu_bacteria 2932422444 2932423563 233
955 3300005290 Ga0065712_10003115 Ga0065712_100031155 234
956 3300005329 Ga0070683_100853465 Ga0070683_1008534651 234
957 3300005336 Ga0070680_100030117 Ga0070680_1000301175 234
958 3300005336 Ga0070680_100331765 Ga0070680_1003317651 234
959 3300005337 Ga0070682_100106270 Ga0070682_1001062703 234
960 3300005338 Ga0068868_100106367 Ga0068868_1001063672 234
961 3300005344 Ga0070661_100133693 Ga0070661_1001336932 234
962 3300005354 Ga0070675_100013767 Ga0070675_1000137674 234
963 3300005355 Ga0070671_100016365 Ga0070671_1000163652 234
964 3300005367 Ga0070667_100030638 Ga0070667_1000306385 234
965 3300005367 Ga0070667_100085711 Ga0070667_1000857112 234
966 3300005434 Ga0070709_10028349 Ga0070709_100283492 234
967 3300005436 Ga0070713_100116534 Ga0070713_1001165341 234
968 3300005436 Ga0070713_100393114 Ga0070713_1003931142 234
969 3300005437 Ga0070710_10070868 Ga0070710_100708682 234
970 3300005441 Ga0070700_100015139 Ga0070700_1000151391 234
971 3300005444 Ga0070694_100397622 Ga0070694_1003976221 234
972 3300005455 Ga0070663_100060571 Ga0070663_1000605713 234
973 3300005456 Ga0070678_100007922 Ga0070678_1000079225 234
974 3300005457 Ga0070662_100052386 Ga0070662_1000523863 234
975 3300005457 Ga0070662_100102629 Ga0070662_1001026291 234
976 3300005458 Ga0070681_10033541 Ga0070681_100335415 234
977 3300005458 Ga0070681_10092649 Ga0070681_100926492 234
978 3300005530 Ga0070679_100078643 Ga0070679_1000786434 234
979 3300005530 Ga0070679_100154367 Ga0070679_1001543673 234
980 3300005544 Ga0070686_100019116 Ga0070686_1000191164 234
981 3300005547 Ga0070693_100009520 Ga0070693_1000095204 234
982 3300005548 Ga0070665_100041433 Ga0070665_1000414333 234
983 3300005548 Ga0070665_100070398 Ga0070665_1000703982 234
984 3300005549 Ga0070704_100229625 Ga0070704_1002296251 234
985 3300005578 Ga0068854_100238748 Ga0068854_1002387482 234
986 3300005614 Ga0068856_100141992 Ga0068856_1001419923 234
987 3300005616 Ga0068852_100113441 Ga0068852_1001134412 234
988 3300006048 Ga0075363_100061194 Ga0075363_1000611942 234
989 3300006163 Ga0070715_10047114 Ga0070715_100471142 234
990 3300006175 Ga0070712_100191062 Ga0070712_1001910622 234
991 3300006177 Ga0075362_10049624 Ga0075362_100496242 234
992 3300006358 Ga0068871_100016055 Ga0068871_1000160555 234
993 3300006946 Ga0079104_1007679 Ga0079104_10076794 234
994 3300007788 Ga0099795_10159171 Ga0099795_101591712 234
995 3300009148 Ga0105243_10068459 Ga0105243_100684593 234
996 3300009174 Ga0105241_10030703 Ga0105241_100307034 234
997 3300009177 Ga0105248_10038008 Ga0105248_100380084 234
998 3300009553 Ga0105249_10037246 Ga0105249_100372462 234
999 3300010375 Ga0105239_10255787 Ga0105239_102557872 234
1000 3300013105 Ga0157369_10652353 Ga0157369_106523532 234
1001 3300013296 Ga0157374_10069095 Ga0157374_100690953 234
1002 3300013306 Ga0163162_10053212 Ga0163162_100532125 234
1003 3300013306 Ga0163162_10567908 Ga0163162_105679082 234
1004 3300013307 Ga0157372_10754777 Ga0157372_107547771 234
1005 3300013308 Ga0157375_10188171 Ga0157375_101881712 234
1006 3300014325 Ga0163163_10093329 Ga0163163_100933293 234
1007 3300014325 Ga0163163_10300851 Ga0163163_103008512 234
1008 3300014968 Ga0157379_10066710 Ga0157379_100667103 234
1009 3300014969 Ga0157376_10121810 Ga0157376_101218102 234
1010 3300014969 Ga0157376_10155005 Ga0157376_101550051 234
1011 3300025272 Ga0209455_1000196 Ga0209455_100019621 234
1012 3300025898 Ga0207692_10022323 Ga0207692_100223232 234
1013 3300025899 Ga0207642_10029925 Ga0207642_100299252 234
1014 3300025907 Ga0207645_10035735 Ga0207645_100357353 234
1015 3300025912 Ga0207707_10085386 Ga0207707_100853862 234
1016 3300025912 Ga0207707_10374758 Ga0207707_103747581 234
1017 3300025914 Ga0207671_10251198 Ga0207671_102511982 234
1018 3300025915 Ga0207693_10044218 Ga0207693_100442183 234
1019 3300025917 Ga0207660_10029178 Ga0207660_100291781 234
1020 3300025921 Ga0207652_10024538 Ga0207652_100245385 234
1021 3300025926 Ga0207659_10060424 Ga0207659_100604243 234
1022 3300025927 Ga0207687_10428713 Ga0207687_104287132 234
1023 3300025927 Ga0207687_10482273 Ga0207687_104822731 234
1024 3300025931 Ga0207644_10154679 Ga0207644_101546791 234
1025 3300025933 Ga0207706_10002510 Ga0207706_100025105 234
1026 3300025933 Ga0207706_10024273 Ga0207706_100242735 234
1027 3300025934 Ga0207686_10040727 Ga0207686_100407273 234
1028 3300025934 Ga0207686_10090161 Ga0207686_100901612 234
1029 3300025936 Ga0207670_10032494 Ga0207670_100324943 234
1030 3300025939 Ga0207665_10000578 Ga0207665_1000057815 234
1031 3300025944 Ga0207661_10268432 Ga0207661_102684321 234
1032 3300025961 Ga0207712_10087231 Ga0207712_100872312 234
1033 3300025981 Ga0207640_10401149 Ga0207640_104011492 234
1034 3300025986 Ga0207658_10095835 Ga0207658_100958352 234
1035 3300026035 Ga0207703_10030478 Ga0207703_100304785 234
1036 3300026067 Ga0207678_10023671 Ga0207678_100236714 234
1037 3300026075 Ga0207708_10017801 Ga0207708_100178012 234
1038 3300026116 Ga0207674_10042310 Ga0207674_100423102 234
1039 3300026121 Ga0207683_10018313 Ga0207683_100183135 234
1040 3300027111 Ga0209281_1003634 Ga0209281_10036343 234
1041 3300027695 Ga0209966_1004838 Ga0209966_10048382 234
1042 3300027717 Ga0209998_10001231 Ga0209998_100012314 234
1043 3300027876 Ga0209974_10007189 Ga0209974_100071893 234
1044 3300028379 Ga0268266_10267865 Ga0268266_102678652 234
1045 3300028381 Ga0268264_10166463 Ga0268264_101664632 234
1046 3300031249 Ga0265339_10002576 Ga0265339_100025769 234
1047 3300031344 Ga0265316_10038287 Ga0265316_100382874 234
1048 3300031344 Ga0265316_10127672 Ga0265316_101276722 234
1049 3300031595 Ga0265313_10001715 Ga0265313_1000171519 234
1050 3300031595 Ga0265313_10063915 Ga0265313_100639152 234
1051 3300034817 Ga0373948_0033530 Ga0373948_0033530_122_904 234
1052 3300035086 Ga0373934_0057823 Ga0373934_0057823_503_1285 234
1053 3300035088 Ga0373940_0000182 Ga0373940_0000182_6012_6827 234
1054 3300035090 Ga0373949_0013189 Ga0373949_0013189_703_1485 234
1055 3300035116 Ga0373945_0016591 Ga0373945_0016591_1538_2320 234
1056 3300035117 Ga0373953_0048987 Ga0373953_0048987_274_1056 234
1057 3300035118 Ga0373954_0017854 Ga0373954_0017854_931_1713 234
1058 3300035118 Ga0373954_0135636 Ga0373954_0135636_363_1145 234
1059 3300035120 Ga0373957_0002489 Ga0373957_0002489_3084_3866 234
1060 3300035120 Ga0373957_0015363 Ga0373957_0015363_1395_2177 234
1061 3300035121 Ga0373960_0110307 Ga0373960_0110307_10_792 234
1062 3300035170 Ga0373943_0037348 Ga0373943_0037348_1524_2306 234
1063 3300035170 Ga0373943_0055660 Ga0373943_0055660_684_1466 234
1064 3300035171 Ga0373946_0011148 Ga0373946_0011148_689_1471 234
1065 3300035172 Ga0373955_0016295 Ga0373955_0016295_2192_2974 234
1066 3300035172 Ga0373955_0029912 Ga0373955_0029912_1413_2195 234
1067 3300035172 Ga0373955_0045700 Ga0373955_0045700_1355_2137 234
1068 3300035172 Ga0373955_0362558 Ga0373955_0362558_51_833 234
1069 3300035410 Ga0373924_0073055 Ga0373924_0073055_167_949 234
1070 3300035410 Ga0373924_0076496 Ga0373924_0076496_179_961 234
1071 3300035691 Ga0373931_0351701 Ga0373931_0351701_21_803 234
1072 3300035692 Ga0373935_0013334 Ga0373935_0013334_2756_3538 234
1073 3300035692 Ga0373935_0319039 Ga0373935_0319039_294_1076 234
1074 3300035695 Ga0373927_0075645 Ga0373927_0075645_895_1677 234
1075 3300035724 Ga0373933_0031872 Ga0373933_0031872_1335_2117 234
1076 3300035725 Ga0373947_0015048 Ga0373947_0015048_3467_4252 234
1077 3300035725 Ga0373947_0034526 Ga0373947_0034526_1876_2658 234
1078 3300035725 Ga0373947_0389832 Ga0373947_0389832_29_811 234
1079 3300036401 Ga0373937_0003087 Ga0373937_0003087_10303_11085 234
1080 3300036401 Ga0373937_0009826 Ga0373937_0009826_4479_5261 234
1081 3300036401 Ga0373937_0014161 Ga0373937_0014161_4895_5677 234
1082 3300036401 Ga0373937_0016649 Ga0373937_0016649_3429_4214 234
1083 3300036401 Ga0373937_0084725 Ga0373937_0084725_1611_2393 234
1084 3300036401 Ga0373937_0360992 Ga0373937_0360992_307_1089 234
1085 3300037068 Ga0373925_0012329 Ga0373925_0012329_2177_2962 234
1086 3300037068 Ga0373925_0013835 Ga0373925_0013835_1846_2628 234
1087 3300037068 Ga0373925_0227533 Ga0373925_0227533_425_1210 234
1088 3300046454 Ga0495592_0000595 Ga0495592_0000595_17632_18414 234
1089 3300046454 Ga0495592_0026218 Ga0495592_0026218_787_1569 234
1090 3300046454 Ga0495592_0174190 Ga0495592_0174190_555_1337 234
1091 3300046455 Ga0495603_0030739 Ga0495603_0030739_1101_1883 234
1092 3300046459 Ga0495629_0143906 Ga0495629_0143906_179_961 234
1093 3300046462 Ga0495651_0045876 Ga0495651_0045876_1053_1835 234
1094 3300046462 Ga0495651_0053049 Ga0495651_0053049_403_1185 234
1095 3300046463 Ga0495653_0054716 Ga0495653_0054716_1147_1929 234
1096 3300046463 Ga0495653_0093238 Ga0495653_0093238_292_1074 234
1097 3300046471 Ga0495650_0059685 Ga0495650_0059685_610_1392 234
1098 3300046475 Ga0495639_0019455 Ga0495639_0019455_806_1588 234
1099 3300046476 Ga0495662_0011253 Ga0495662_0011253_2025_2807 234
1100 3300046476 Ga0495662_0119403 Ga0495662_0119403_159_941 234
1101 3300046477 Ga0495664_0057325 Ga0495664_0057325_511_1293 234
1102 3300046499 Ga0495594_0302313 Ga0495594_0302313_24_806 234
1103 3300046506 Ga0495583_0014895 Ga0495583_0014895_575_1369 234
1104 3300046511 Ga0495608_0018088 Ga0495608_0018088_668_1450 234
1105 3300046511 Ga0495608_0078126 Ga0495608_0078126_736_1518 234
1106 3300046514 Ga0495618_0204161 Ga0495618_0204161_335_1117 234
1107 3300046516 Ga0495628_0004979 Ga0495628_0004979_6076_6858 234
1108 3300046516 Ga0495628_0041101 Ga0495628_0041101_1164_1946 234
1109 3300046517 Ga0495630_0213321 Ga0495630_0213321_340_1122 234
1110 3300046517 Ga0495630_0448450 Ga0495630_0448450_152_934 234
1111 3300046526 Ga0495666_0062438 Ga0495666_0062438_914_1696 234
1112 3300046528 Ga0495642_0029043 Ga0495642_0029043_455_1243 234
1113 3300046529 Ga0495652_0056744 Ga0495652_0056744_2491_3273 234
1114 3300046529 Ga0495652_0099344 Ga0495652_0099344_789_1571 234
1115 3300046533 Ga0495640_0030349 Ga0495640_0030349_2937_3719 234
1116 3300046533 Ga0495640_0050764 Ga0495640_0050764_159_941 234
1117 3300046536 Ga0495587_0005285 Ga0495587_0005285_6774_7556 234
1118 3300046536 Ga0495587_0102537 Ga0495587_0102537_259_1041 234
1119 3300046538 Ga0495609_0000474 Ga0495609_0000474_29678_30472 234
1120 3300046542 Ga0495597_0015929 Ga0495597_0015929_2439_3233 234
1121 3300046543 Ga0495645_0019079 Ga0495645_0019079_1895_2677 234
1122 3300046543 Ga0495645_0046679 Ga0495645_0046679_2072_2854 234
1123 3300046543 Ga0495645_0135443 Ga0495645_0135443_139_921 234
1124 3300046558 Ga0495633_0041796 Ga0495633_0041796_517_1299 234
1125 3300046559 Ga0495667_0038117 Ga0495667_0038117_1671_2453 234
1126 3300046559 Ga0495667_0070393 Ga0495667_0070393_193_975 234
1127 3300046559 Ga0495667_0268511 Ga0495667_0268511_193_975 234
1128 3300046642 Ga0495634_0150602 Ga0495634_0150602_301_1083 234
1129 3300046642 Ga0495634_0183337 Ga0495634_0183337_251_1033 234
1130 3300046660 Ga0495625_0217019 Ga0495625_0217019_96_890 234
1131 3300046663 Ga0495635_0025030 Ga0495635_0025030_1776_2558 234
1132 3300046663 Ga0495635_0054041 Ga0495635_0054041_322_1104 234
1133 3300046663 Ga0495635_0078916 Ga0495635_0078916_853_1635 234
1134 3300046663 Ga0495635_0090456 Ga0495635_0090456_1294_2076 234
1135 3300046663 Ga0495635_0250817 Ga0495635_0250817_370_1152 234
1136 3300046665 Ga0495661_0028906 Ga0495661_0028906_79_861 234
1137 3300046675 Ga0495657_0011094 Ga0495657_0011094_3863_4645 234
1138 3300046675 Ga0495657_0023793 Ga0495657_0023793_172_954 234
1139 3300046678 Ga0495599_0001552 Ga0495599_0001552_2774_3556 234
1140 3300046678 Ga0495599_0042760 Ga0495599_0042760_316_1098 234
1141 3300046679 Ga0495623_0002996 Ga0495623_0002996_8798_9580 234
1142 3300046679 Ga0495623_0009356 Ga0495623_0009356_1271_2053 234
1143 3300046680 Ga0495646_0023632 Ga0495646_0023632_943_1725 234
1144 3300046683 Ga0495658_0119206 Ga0495658_0119206_788_1570 234
1145 3300046684 Ga0495669_0008049 Ga0495669_0008049_417_1205 234
1146 3300046689 Ga0495613_0364459 Ga0495613_0364459_163_945 234
1147 3300046690 Ga0495624_0061255 Ga0495624_0061255_1448_2230 234
1148 3300046690 Ga0495624_0163457 Ga0495624_0163457_437_1219 234
1149 3300046809 Ga0495600_0018280 Ga0495600_0018280_2538_3320 234
1150 3300046809 Ga0495600_0030602 Ga0495600_0030602_1946_2728 234
1151 3300046809 Ga0495600_0435544 Ga0495600_0435544_16_801 234
1152 3300046810 Ga0495660_0000260 Ga0495660_0000260_41332_42126 234
1153 3300047315 Ga0495581_0074550 Ga0495581_0074550_291_1073 234
1154 3300047317 Ga0495604_0019964 Ga0495604_0019964_2757_3539 234
1155 3300047317 Ga0495604_0034746 Ga0495604_0034746_1098_1880 234
1156 3300047317 Ga0495604_0061157 Ga0495604_0061157_52_834 234
1157 3300047317 Ga0495604_0194411 Ga0495604_0194411_188_970 234
1158 3300047318 Ga0495636_0004929 Ga0495636_0004929_4304_5098 234
1159 3300047319 Ga0495674_0005253 Ga0495674_0005253_9916_10698 234
1160 3300047319 Ga0495674_0015343 Ga0495674_0015343_3405_4187 234
1161 3300047319 Ga0495674_0187831 Ga0495674_0187831_905_1690 234
1162 3300047322 Ga0495680_0011708 Ga0495680_0011708_1294_2076 234
1163 3300047322 Ga0495680_0041707 Ga0495680_0041707_1176_1958 234
1164 3300047322 Ga0495680_0050236 Ga0495680_0050236_2048_2830 234
1165 3300047444 Ga0495675_0084713 Ga0495675_0084713_932_1714 234
1166 3300047470 Ga0495681_0006657 Ga0495681_0006657_6405_7199 234
1167 3300047470 Ga0495681_0048832 Ga0495681_0048832_943_1737 234
1168 3300047471 Ga0495684_0163294 Ga0495684_0163294_393_1175 234
1169 3300047673 Ga0495593_0049703 Ga0495593_0049703_942_1724 234
1170 3300048088 Ga0495602_0005586 Ga0495602_0005586_10711_11493 234
1171 3300048088 Ga0495602_0028466 Ga0495602_0028466_1593_2375 234
1172 3300048091 Ga0495626_0005960 Ga0495626_0005960_4771_5565 234
1173 3300048904 Ga0496101_0009867 Ga0496101_0009867_3085_3867 234
1174 3300048905 Ga0496102_0047983 Ga0496102_0047983_1246_2028 234
1175 3300048905 Ga0496102_0049797 Ga0496102_0049797_1673_2455 234
1176 3300048906 Ga0496103_0044915 Ga0496103_0044915_1409_2191 234
1177 3300048907 Ga0496104_0014512 Ga0496104_0014512_6033_6815 234
1178 3300048908 Ga0496105_0046294 Ga0496105_0046294_1358_2140 234
1179 3300048909 Ga0496106_0070083 Ga0496106_0070083_1748_2530 234
1180 3300048912 Ga0496109_0185495 Ga0496109_0185495_104_886 234
1181 3300048913 Ga0496110_0032539 Ga0496110_0032539_906_1688 234
1182 3300048916 Ga0496113_0291943 Ga0496113_0291943_150_932 234
1183 3300048917 Ga0496114_0095377 Ga0496114_0095377_632_1414 234
1184 3300048918 Ga0496115_0020859 Ga0496115_0020859_1761_2543 234
1185 3300048922 Ga0496119_0071905 Ga0496119_0071905_52_837 234
1186 3300048923 Ga0496120_0008014 Ga0496120_0008014_201_986 234
1187 3300048927 Ga0496124_0024101 Ga0496124_0024101_509_1303 234
1188 3300049459 Ga0495678_000030 Ga0495678_000030_116198_116992 234
1189 3300049568 Ga0501031_0151049 Ga0501031_0151049_512_1294 234
1190 3300049573 Ga0501037_0040218 Ga0501037_0040218_2154_2936 234
1191 3300049576 Ga0501040_0067682 Ga0501040_0067682_404_1231 234
1192 3300049577 Ga0501041_0156695 Ga0501041_0156695_53_880 234
1193 3300049587 Ga0501071_0185354 Ga0501071_0185354_371_1198 234
1194 3300049587 Ga0501071_0366675 Ga0501071_0366675_221_1003 234
1195 3300049588 Ga0501072_0304936 Ga0501072_0304936_324_1151 234
1196 3300049591 Ga0501075_0026640 Ga0501075_0026640_1848_2675 234
1197 3300049592 Ga0501076_0010040 Ga0501076_0010040_1528_2355 234
1198 3300049741 Ga0501079_0051671 Ga0501079_0051671_530_1357 234
1199 3300049744 Ga0501083_0186576 Ga0501083_0186576_216_1043 234
1200 3300049823 Ga0501044_0120369 Ga0501044_0120369_498_1280 234
1201 3300053077 Ga0495601_0000851 Ga0495601_0000851_23_805 234
1202 3300053077 Ga0495601_0012340 Ga0495601_0012340_946_1728 234
1203 3300053077 Ga0495601_0025815 Ga0495601_0025815_444_1226 234
1204 3300053077 Ga0495601_0031609 Ga0495601_0031609_1302_2084 234
1205 3300053077 Ga0495601_0038333 Ga0495601_0038333_735_1517 234
1206 3300053078 Ga0495612_0006247 Ga0495612_0006247_2258_3040 234
1207 3300053078 Ga0495612_0008243 Ga0495612_0008243_485_1267 234
1208 3300053078 Ga0495612_0009724 Ga0495612_0009724_2570_3352 234
1209 3300053078 Ga0495612_0030924 Ga0495612_0030924_851_1633 234
1210 3300053084 Ga0495595_0003528 Ga0495595_0003528_4205_4987 234
1211 3300053084 Ga0495595_0003759 Ga0495595_0003759_1160_1942 234
1212 3300053084 Ga0495595_0007642 Ga0495595_0007642_1644_2426 234
1213 3300053084 Ga0495595_0014092 Ga0495595_0014092_408_1190 234
1214 3300053085 Ga0495619_0000063 Ga0495619_0000063_29133_29915 234
1215 3300053085 Ga0495619_0000520 Ga0495619_0000520_1295_2077 234
1216 3300053085 Ga0495619_0016954 Ga0495619_0016954_2580_3362 234
1217 3300053085 Ga0495619_0055986 Ga0495619_0055986_1194_1976 234
1218 3300053119 Ga0500595_000001 Ga0500595_000001_1065711_1066493 234
1219 3300054114 Ga0501084_0076813 Ga0501084_0076813_1003_1830 234
1220 3300060353 Ga0501082_0076487 Ga0501082_0076487_17_799 234
1221 3300003911 JGI25405J52794_10020155 JGI25405J52794_100201551 235
1222 3300005366 Ga0070659_100000423 Ga0070659_1000004232 235
1223 3300005530 Ga0070679_100040307 Ga0070679_1000403075 235
1224 3300005530 Ga0070679_100530478 Ga0070679_1005304782 235
1225 3300005535 Ga0070684_100205387 Ga0070684_1002053872 235
1226 3300005616 Ga0068852_100003539 Ga0068852_1000035394 235
1227 3300005617 Ga0068859_100206986 Ga0068859_1002069864 235
1228 3300005937 Ga0081455_10000002 Ga0081455_1000000251 235
1229 3300006847 Ga0075431_100086702 Ga0075431_1000867023 235
1230 3300006931 Ga0097620_100206984 Ga0097620_1002069844 235
1231 3300009093 Ga0105240_10099553 Ga0105240_100995534 235
1232 3300009551 Ga0105238_10004063 Ga0105238_100040635 235
1233 3300013105 Ga0157369_10000568 Ga0157369_100005688 235
1234 3300013307 Ga0157372_10004004 Ga0157372_1000400414 235
1235 3300014497 Ga0182008_10007714 Ga0182008_100077146 235
1236 3300015262 Ga0182007_10008986 Ga0182007_100089863 235
1237 3300021361 Ga0213872_10009223 Ga0213872_100092232 235
1238 3300021384 Ga0213876_10096698 Ga0213876_100966981 235
1239 3300025913 Ga0207695_10191650 Ga0207695_101916502 235
1240 3300025919 Ga0207657_10344932 Ga0207657_103449322 235
1241 3300025921 Ga0207652_10165621 Ga0207652_101656213 235
1242 3300025924 Ga0207694_10062231 Ga0207694_100622314 235
1243 3300025932 Ga0207690_10001054 Ga0207690_1000105411 235
1244 3300025944 Ga0207661_10182723 Ga0207661_101827232 235
1245 3300025949 Ga0207667_10062740 Ga0207667_100627402 235
1246 3300026142 Ga0207698_10001815 Ga0207698_1000181510 235
1247 3300039437 Ga0436365_0529637 Ga0436365_0529637_4849_5631 235
1248 3300039447 Ga0436361_0257449 Ga0436361_0257449_22955_23737 235
1249 3300039447 Ga0436361_0527985 Ga0436361_0527985_18921_19703 235
1250 3300039447 Ga0436361_1101359 Ga0436361_1101359_684_1466 235
1251 3300042876 Ga0451577_0005400 Ga0451577_0005400_6124_6903 235
1252 3300044712 Ga0453684_0055056 Ga0453684_0055056_840_1619 235
1253 3300046460 Ga0495638_0000017 Ga0495638_0000017_384122_384916 235
1254 3300046471 Ga0495650_0005088 Ga0495650_0005088_1932_2726 235
1255 3300046501 Ga0495607_0021124 Ga0495607_0021124_2396_3190 235
1256 3300046506 Ga0495583_0001050 Ga0495583_0001050_6125_6919 235
1257 3300046507 Ga0495606_0011054 Ga0495606_0011054_6336_7130 235
1258 3300046514 Ga0495618_0213574 Ga0495618_0213574_280_1065 235
1259 3300046522 Ga0495643_0017826 Ga0495643_0017826_389_1171 235
1260 3300046524 Ga0495648_0000040 Ga0495648_0000040_6295_7089 235
1261 3300046524 Ga0495648_0071213 Ga0495648_0071213_944_1738 235
1262 3300046533 Ga0495640_0068269 Ga0495640_0068269_1339_2124 235
1263 3300046538 Ga0495609_0073102 Ga0495609_0073102_680_1474 235
1264 3300046542 Ga0495597_0044465 Ga0495597_0044465_544_1326 235
1265 3300046557 Ga0495622_0000169 Ga0495622_0000169_27615_28409 235
1266 3300046558 Ga0495633_0000994 Ga0495633_0000994_16433_17227 235
1267 3300046616 Ga0495668_0208411 Ga0495668_0208411_224_1006 235
1268 3300046660 Ga0495625_0001223 Ga0495625_0001223_25521_26315 235
1269 3300046665 Ga0495661_0021727 Ga0495661_0021727_596_1378 235
1270 3300046665 Ga0495661_0208561 Ga0495661_0208561_126_920 235
1271 3300047443 Ga0495687_038813 Ga0495687_038813_816_1598 235
1272 3300047471 Ga0495684_0088652 Ga0495684_0088652_459_1244 235
1273 3300048919 Ga0496116_0212724 Ga0496116_0212724_93_884 235
1274 3300048921 Ga0496118_0102934 Ga0496118_0102934_144_935 235
1275 3300049459 Ga0495678_000282 Ga0495678_000282_45478_46272 235
1276 3300049459 Ga0495678_003383 Ga0495678_003383_1043_1837 235
1277 3300049581 Ga0501047_0186451 Ga0501047_0186451_264_1049 235
1278 3300049823 Ga0501044_0243413 Ga0501044_0243413_917_1702 235
1279 3300050510 nmdc:mga06r32_76546_c1 nmdc:mga06r32_76546_c1_1629_2411 235
1280 3300050512 nmdc:mga0n895_160395_c1 nmdc:mga0n895_160395_c1_75_863 235
1281 3300053108 Ga0500562_000202 Ga0500562_000202_4420_5205 235
1282 3300003163 Ga0006759J45824_1078836 Ga0006759J45824_10788361 236
1283 3300003320 rootH2_10121193 rootH2_101211935 236
1284 3300003544 Ga0007417J51691_1054294 Ga0007417J51691_10542941 236
1285 3300003575 Ga0007409J51694_1033908 Ga0007409J51694_10339081 236
1286 3300003577 Ga0007416J51690_1023694 Ga0007416J51690_10236941 236
1287 3300005330 Ga0070690_100372565 Ga0070690_1003725651 236
1288 3300005331 Ga0070670_100280929 Ga0070670_1002809292 236
1289 3300005338 Ga0068868_100027651 Ga0068868_1000276516 236
1290 3300005339 Ga0070660_100001988 Ga0070660_10000198814 236
1291 3300005340 Ga0070689_100003835 Ga0070689_1000038356 236
1292 3300005340 Ga0070689_100020557 Ga0070689_1000205574 236
1293 3300005344 Ga0070661_100006933 Ga0070661_1000069336 236
1294 3300005353 Ga0070669_100288109 Ga0070669_1002881091 236
1295 3300005366 Ga0070659_100006995 Ga0070659_1000069957 236
1296 3300005459 Ga0068867_100213073 Ga0068867_1002130731 236
1297 3300005466 Ga0070685_10128376 Ga0070685_101283762 236
1298 3300005535 Ga0070684_100165181 Ga0070684_1001651812 236
1299 3300005544 Ga0070686_100264138 Ga0070686_1002641382 236
1300 3300005564 Ga0070664_100187150 Ga0070664_1001871501 236
1301 3300005616 Ga0068852_100024103 Ga0068852_1000241036 236
1302 3300005618 Ga0068864_100012176 Ga0068864_1000121761 236
1303 3300005834 Ga0068851_10000276 Ga0068851_1000027627 236
1304 3300005840 Ga0068870_10232605 Ga0068870_102326052 236
1305 3300005937 Ga0081455_10067938 Ga0081455_100679383 236
1306 3300006048 Ga0075363_100248562 Ga0075363_1002485621 236
1307 3300006051 Ga0075364_10012857 Ga0075364_100128572 236
1308 3300006173 Ga0070716_100356820 Ga0070716_1003568202 236
1309 3300006177 Ga0075362_10014708 Ga0075362_100147082 236
1310 3300006178 Ga0075367_10137610 Ga0075367_101376102 236
1311 3300006186 Ga0075369_10099080 Ga0075369_100990801 236
1312 3300006195 Ga0075366_10084874 Ga0075366_100848741 236
1313 3300006237 Ga0097621_100065168 Ga0097621_1000651682 236
1314 3300006358 Ga0068871_100037738 Ga0068871_1000377383 236
1315 3300006881 Ga0068865_100003447 Ga0068865_10000344710 236
1316 3300009094 Ga0111539_10024634 Ga0111539_100246348 236
1317 3300009094 Ga0111539_10121681 Ga0111539_101216812 236
1318 3300009176 Ga0105242_10107654 Ga0105242_101076541 236
1319 3300009177 Ga0105248_10208876 Ga0105248_102088762 236
1320 3300009177 Ga0105248_10327954 Ga0105248_103279542 236
1321 3300010159 Ga0099796_10000538 Ga0099796_100005383 236
1322 3300013297 Ga0157378_10088690 Ga0157378_100886904 236
1323 3300013306 Ga0163162_10382356 Ga0163162_103823561 236
1324 3300014497 Ga0182008_10029707 Ga0182008_100297072 236
1325 3300015261 Ga0182006_1000029 Ga0182006_100002949 236
1326 3300015261 Ga0182006_1025011 Ga0182006_10250112 236
1327 3300015262 Ga0182007_10000179 Ga0182007_100001792 236
1328 3300015265 Ga0182005_1000037 Ga0182005_10000377 236
1329 3300017792 Ga0163161_10045040 Ga0163161_100450404 236
1330 3300017792 Ga0163161_10419664 Ga0163161_104196642 236
1331 3300021361 Ga0213872_10072488 Ga0213872_100724882 236
1332 3300025321 Ga0207656_10034849 Ga0207656_100348492 236
1333 3300025907 Ga0207645_10002901 Ga0207645_1000290110 236
1334 3300025908 Ga0207643_10227776 Ga0207643_102277762 236
1335 3300025919 Ga0207657_10010003 Ga0207657_100100032 236
1336 3300025920 Ga0207649_10023354 Ga0207649_100233542 236
1337 3300025926 Ga0207659_10610422 Ga0207659_106104221 236
1338 3300025929 Ga0207664_10058881 Ga0207664_100588813 236
1339 3300025932 Ga0207690_10004240 Ga0207690_100042407 236
1340 3300025940 Ga0207691_10165059 Ga0207691_101650592 236
1341 3300025942 Ga0207689_10248004 Ga0207689_102480042 236
1342 3300025945 Ga0207679_10009383 Ga0207679_100093831 236
1343 3300026023 Ga0207677_10019687 Ga0207677_100196872 236
1344 3300026089 Ga0207648_10012297 Ga0207648_100122978 236
1345 3300026118 Ga0207675_100215816 Ga0207675_1002158163 236
1346 3300026118 Ga0207675_100512989 Ga0207675_1005129891 236
1347 3300027876 Ga0209974_10013827 Ga0209974_100138272 236
1348 3300037418 Ga0395900_0174636 Ga0395900_0174636_1026_1808 236
1349 3300037471 Ga0395905_0004104 Ga0395905_0004104_6474_7256 236
1350 3300037471 Ga0395905_0012988 Ga0395905_0012988_5582_6364 236
1351 3300037471 Ga0395905_0047811 Ga0395905_0047811_1058_1852 236
1352 3300037471 Ga0395905_0475121 Ga0395905_0475121_109_891 236
1353 3300039438 Ga0436360_0690975 Ga0436360_0690975_1194_1979 236
1354 3300039447 Ga0436361_0951023 Ga0436361_0951023_701_1495 236
1355 3300042876 Ga0451577_0365212 Ga0451577_0365212_134_931 236
1356 3300044656 Ga0466969_0005820 Ga0466969_0005820_3045_3827 236
1357 3300044683 Ga0466965_0091322 Ga0466965_0091322_391_1173 236
1358 3300044683 Ga0466965_0207662 Ga0466965_0207662_42_824 236
1359 3300044684 Ga0466966_0031802 Ga0466966_0031802_1427_2209 236
1360 3300044694 Ga0466963_0115646 Ga0466963_0115646_819_1601 236
1361 3300044719 Ga0466971_0018640 Ga0466971_0018640_1723_2505 236
1362 3300044719 Ga0466971_0150674 Ga0466971_0150674_148_930 236
1363 3300044842 Ga0466957_0222227 Ga0466957_0222227_238_1020 236
1364 3300044901 Ga0466960_0199098 Ga0466960_0199098_43_825 236
1365 3300045976 Ga0466967_0121686 Ga0466967_0121686_825_1619 236
1366 3300045976 Ga0466967_0288572 Ga0466967_0288572_199_981 236
1367 3300046457 Ga0495590_0001612 Ga0495590_0001612_8725_9519 236
1368 3300046460 Ga0495638_0047051 Ga0495638_0047051_987_1781 236
1369 3300046474 Ga0495605_0119821 Ga0495605_0119821_266_1060 236
1370 3300046501 Ga0495607_0000552 Ga0495607_0000552_6174_6968 236
1371 3300046501 Ga0495607_0014645 Ga0495607_0014645_3466_4248 236
1372 3300046506 Ga0495583_0017140 Ga0495583_0017140_2950_3732 236
1373 3300046506 Ga0495583_0025343 Ga0495583_0025343_150_944 236
1374 3300046507 Ga0495606_0004300 Ga0495606_0004300_5147_5941 236
1375 3300046513 Ga0495616_0029015 Ga0495616_0029015_753_1547 236
1376 3300046513 Ga0495616_0090386 Ga0495616_0090386_601_1395 236
1377 3300046518 Ga0495631_0000524 Ga0495631_0000524_11723_12517 236
1378 3300046519 Ga0495632_0000131 Ga0495632_0000131_64517_65299 236
1379 3300046519 Ga0495632_0001125 Ga0495632_0001125_19497_20291 236
1380 3300046522 Ga0495643_0000411 Ga0495643_0000411_12449_13243 236
1381 3300046522 Ga0495643_0023025 Ga0495643_0023025_1862_2644 236
1382 3300046524 Ga0495648_0151448 Ga0495648_0151448_69_863 236
1383 3300046530 Ga0495654_0003919 Ga0495654_0003919_5683_6477 236
1384 3300046539 Ga0495621_0023578 Ga0495621_0023578_316_1110 236
1385 3300046542 Ga0495597_0006651 Ga0495597_0006651_1175_1969 236
1386 3300046616 Ga0495668_0000824 Ga0495668_0000824_10599_11405 236
1387 3300046616 Ga0495668_0005109 Ga0495668_0005109_4217_5011 236
1388 3300046660 Ga0495625_0002327 Ga0495625_0002327_4526_5320 236
1389 3300046665 Ga0495661_0001840 Ga0495661_0001840_14605_15399 236
1390 3300046692 Ga0495671_0013285 Ga0495671_0013285_2022_2816 236
1391 3300046810 Ga0495660_0017900 Ga0495660_0017900_3063_3857 236
1392 3300047443 Ga0495687_000002 Ga0495687_000002_618955_619737 236
1393 3300047445 Ga0495677_0019670 Ga0495677_0019670_978_1772 236
1394 3300047445 Ga0495677_0130890 Ga0495677_0130890_28_810 236
1395 3300047446 Ga0495679_022776 Ga0495679_022776_1114_1908 236
1396 3300047447 Ga0495685_022177 Ga0495685_022177_269_1063 236
1397 3300047447 Ga0495685_045869 Ga0495685_045869_388_1182 236
1398 3300048091 Ga0495626_0017458 Ga0495626_0017458_836_1618 236
1399 3300048905 Ga0496102_0352211 Ga0496102_0352211_321_1103 236
1400 3300048907 Ga0496104_0311454 Ga0496104_0311454_403_1188 236
1401 3300048908 Ga0496105_0253570 Ga0496105_0253570_204_989 236
1402 3300048921 Ga0496118_0001041 Ga0496118_0001041_41725_42507 236
1403 3300048928 Ga0496125_0001533 Ga0496125_0001533_18129_18923 236
1404 3300049459 Ga0495678_009153 Ga0495678_009153_1996_2778 236
1405 3300049570 Ga0501033_0334014 Ga0501033_0334014_21_806 236
1406 3300049585 Ga0501069_0215757 Ga0501069_0215757_81_863 236
1407 3300049586 Ga0501070_0005902 Ga0501070_0005902_2269_3051 236
1408 3300049586 Ga0501070_0275086 Ga0501070_0275086_498_1280 236
1409 3300049588 Ga0501072_0007804 Ga0501072_0007804_2803_3585 236
1410 3300049589 Ga0501073_0321618 Ga0501073_0321618_73_855 236
1411 3300049592 Ga0501076_0297375 Ga0501076_0297375_77_856 236
1412 3300049741 Ga0501079_0101856 Ga0501079_0101856_1277_2056 236
1413 3300049742 Ga0501080_0094026 Ga0501080_0094026_1165_1947 236
1414 3300049744 Ga0501083_0041090 Ga0501083_0041090_925_1707 236
1415 3300049822 Ga0501035_0482204 Ga0501035_0482204_169_951 236
1416 3300049824 Ga0501045_0127129 Ga0501045_0127129_570_1349 236
1417 3300049824 Ga0501045_0179116 Ga0501045_0179116_625_1404 236
1418 3300050489 nmdc:mga03683_3421_c1 nmdc:mga03683_3421_c1_974_1756 236
1419 3300050491 nmdc:mga00v17_191301_c1 nmdc:mga00v17_191301_c1_263_1045 236
1420 3300050493 nmdc:mga0k408_30565_c1 nmdc:mga0k408_30565_c1_62_844 236
1421 3300050494 nmdc:mga06z11_91391_c1 nmdc:mga06z11_91391_c1_771_1553 236
1422 3300050496 nmdc:mga07m45_201859_c1 nmdc:mga07m45_201859_c1_264_1046 236
1423 3300053153 Ga0500616_0114340 Ga0500616_0114340_384_1166 236
1424 3300053153 Ga0500616_0183094 Ga0500616_0183094_27_809 236
1425 3300054114 Ga0501084_0112918 Ga0501084_0112918_112_894 236
1426 3300061719 Ga0466962_0006817 Ga0466962_0006817_3735_4517 236
1427 3300002155 JGI24033J26618_1014554 JGI24033J26618_10145541 237
1428 3300002244 JGI24742J22300_10000147 JGI24742J22300_100001472 237
1429 3300003575 Ga0007409J51694_1014306 Ga0007409J51694_10143061 237
1430 3300003759 Ga0055525_1000001 Ga0055525_1000001763 237
1431 3300005328 Ga0070676_10025909 Ga0070676_100259094 237
1432 3300005330 Ga0070690_100099721 Ga0070690_1000997211 237
1433 3300005330 Ga0070690_100176246 Ga0070690_1001762462 237
1434 3300005331 Ga0070670_100044711 Ga0070670_1000447112 237
1435 3300005333 Ga0070677_10002393 Ga0070677_100023936 237
1436 3300005333 Ga0070677_10034345 Ga0070677_100343453 237
1437 3300005335 Ga0070666_10155149 Ga0070666_101551492 237
1438 3300005339 Ga0070660_100275337 Ga0070660_1002753371 237
1439 3300005344 Ga0070661_100107095 Ga0070661_1001070953 237
1440 3300005347 Ga0070668_100056117 Ga0070668_1000561173 237
1441 3300005353 Ga0070669_100077956 Ga0070669_1000779562 237
1442 3300005354 Ga0070675_100246097 Ga0070675_1002460972 237
1443 3300005355 Ga0070671_100008194 Ga0070671_1000081946 237
1444 3300005356 Ga0070674_100010285 Ga0070674_1000102855 237
1445 3300005364 Ga0070673_100028843 Ga0070673_1000288434 237
1446 3300005364 Ga0070673_100177013 Ga0070673_1001770132 237
1447 3300005365 Ga0070688_100068513 Ga0070688_1000685132 237
1448 3300005367 Ga0070667_100019267 Ga0070667_1000192674 237
1449 3300005441 Ga0070700_100139615 Ga0070700_1001396151 237
1450 3300005441 Ga0070700_100417999 Ga0070700_1004179991 237
1451 3300005456 Ga0070678_100050825 Ga0070678_1000508254 237
1452 3300005456 Ga0070678_100066274 Ga0070678_1000662742 237
1453 3300005457 Ga0070662_100069143 Ga0070662_1000691432 237
1454 3300005457 Ga0070662_100169704 Ga0070662_1001697042 237
1455 3300005457 Ga0070662_100249178 Ga0070662_1002491782 237
1456 3300005457 Ga0070662_100556416 Ga0070662_1005564162 237
1457 3300005459 Ga0068867_100018802 Ga0068867_1000188022 237
1458 3300005543 Ga0070672_100006518 Ga0070672_1000065184 237
1459 3300005543 Ga0070672_100127143 Ga0070672_1001271433 237
1460 3300005548 Ga0070665_100221446 Ga0070665_1002214462 237
1461 3300005548 Ga0070665_100229135 Ga0070665_1002291352 237
1462 3300005564 Ga0070664_100074450 Ga0070664_1000744503 237
1463 3300005564 Ga0070664_100164025 Ga0070664_1001640252 237
1464 3300005719 Ga0068861_100782196 Ga0068861_1007821961 237
1465 3300005834 Ga0068851_10201091 Ga0068851_102010912 237
1466 3300005841 Ga0068863_100262875 Ga0068863_1002628752 237
1467 3300006028 Ga0070717_10326816 Ga0070717_103268162 237
1468 3300006237 Ga0097621_100021189 Ga0097621_1000211892 237
1469 3300006358 Ga0068871_100078521 Ga0068871_1000785213 237
1470 3300006847 Ga0075431_100016231 Ga0075431_1000162318 237
1471 3300006881 Ga0068865_100090160 Ga0068865_1000901602 237
1472 3300006881 Ga0068865_100095703 Ga0068865_1000957032 237
1473 3300006914 Ga0075436_100057329 Ga0075436_1000573294 237
1474 3300009093 Ga0105240_10178653 Ga0105240_101786533 237
1475 3300009098 Ga0105245_10056186 Ga0105245_100561862 237
1476 3300009147 Ga0114129_10359962 Ga0114129_103599623 237
1477 3300009148 Ga0105243_10022908 Ga0105243_100229084 237
1478 3300009174 Ga0105241_10206588 Ga0105241_102065882 237
1479 3300009176 Ga0105242_10065352 Ga0105242_100653522 237
1480 3300009176 Ga0105242_10211936 Ga0105242_102119362 237
1481 3300009551 Ga0105238_10325051 Ga0105238_103250511 237
1482 3300010375 Ga0105239_10202656 Ga0105239_102026562 237
1483 3300013100 Ga0157373_10308791 Ga0157373_103087912 237
1484 3300013102 Ga0157371_10000040 Ga0157371_10000040167 237
1485 3300013297 Ga0157378_10216994 Ga0157378_102169941 237
1486 3300013307 Ga0157372_10109057 Ga0157372_101090571 237
1487 3300013307 Ga0157372_10767146 Ga0157372_107671462 237
1488 3300014325 Ga0163163_10347632 Ga0163163_103476321 237
1489 3300014969 Ga0157376_10001401 Ga0157376_100014012 237
1490 3300015261 Ga0182006_1017346 Ga0182006_10173462 237
1491 3300017792 Ga0163161_10212365 Ga0163161_102123652 237
1492 3300021361 Ga0213872_10000001 Ga0213872_10000001353 237
1493 3300021361 Ga0213872_10001546 Ga0213872_100015466 237
1494 3300021361 Ga0213872_10007371 Ga0213872_100073713 237
1495 3300021384 Ga0213876_10152167 Ga0213876_101521672 237
1496 3300021388 Ga0213875_10017513 Ga0213875_100175132 237
1497 3300025230 Ga0209563_100007 Ga0209563_100007335 237
1498 3300025242 Ga0209258_107712 Ga0209258_1077122 237
1499 3300025253 Ga0209677_104388 Ga0209677_1043883 237
1500 3300025254 Ga0209148_1001171 Ga0209148_10011719 237
1501 3300025315 Ga0207697_10005006 Ga0207697_100050063 237
1502 3300025893 Ga0207682_10001145 Ga0207682_100011456 237
1503 3300025893 Ga0207682_10003948 Ga0207682_100039486 237
1504 3300025899 Ga0207642_10059358 Ga0207642_100593582 237
1505 3300025899 Ga0207642_10392742 Ga0207642_103927421 237
1506 3300025901 Ga0207688_10045212 Ga0207688_100452121 237
1507 3300025901 Ga0207688_10075148 Ga0207688_100751482 237
1508 3300025903 Ga0207680_10113258 Ga0207680_101132582 237
1509 3300025906 Ga0207699_10150482 Ga0207699_101504823 237
1510 3300025907 Ga0207645_10043834 Ga0207645_100438343 237
1511 3300025909 Ga0207705_10010149 Ga0207705_100101495 237
1512 3300025909 Ga0207705_10164989 Ga0207705_101649892 237
1513 3300025911 Ga0207654_10016638 Ga0207654_100166384 237
1514 3300025919 Ga0207657_10037712 Ga0207657_100377123 237
1515 3300025919 Ga0207657_10129537 Ga0207657_101295373 237
1516 3300025920 Ga0207649_10464725 Ga0207649_104647252 237
1517 3300025923 Ga0207681_10013076 Ga0207681_100130763 237
1518 3300025923 Ga0207681_10228820 Ga0207681_102288202 237
1519 3300025925 Ga0207650_10010191 Ga0207650_100101913 237
1520 3300025925 Ga0207650_10108688 Ga0207650_101086882 237
1521 3300025926 Ga0207659_10006611 Ga0207659_100066113 237
1522 3300025926 Ga0207659_10087147 Ga0207659_100871473 237
1523 3300025931 Ga0207644_10005044 Ga0207644_100050445 237
1524 3300025932 Ga0207690_10103802 Ga0207690_101038023 237
1525 3300025933 Ga0207706_10078662 Ga0207706_100786622 237
1526 3300025933 Ga0207706_10085165 Ga0207706_100851654 237
1527 3300025934 Ga0207686_10030267 Ga0207686_100302674 237
1528 3300025935 Ga0207709_10036408 Ga0207709_100364082 237
1529 3300025935 Ga0207709_10273033 Ga0207709_102730332 237
1530 3300025937 Ga0207669_10015872 Ga0207669_100158722 237
1531 3300025937 Ga0207669_10125677 Ga0207669_101256772 237
1532 3300025938 Ga0207704_10030902 Ga0207704_100309022 237
1533 3300025940 Ga0207691_10011683 Ga0207691_100116834 237
1534 3300025940 Ga0207691_10014808 Ga0207691_100148084 237
1535 3300025941 Ga0207711_10579964 Ga0207711_105799641 237
1536 3300025945 Ga0207679_10038793 Ga0207679_100387934 237
1537 3300025945 Ga0207679_10136963 Ga0207679_101369632 237
1538 3300025949 Ga0207667_10061742 Ga0207667_100617422 237
1539 3300025949 Ga0207667_10169247 Ga0207667_101692472 237
1540 3300025960 Ga0207651_10029172 Ga0207651_100291722 237
1541 3300025960 Ga0207651_10066741 Ga0207651_100667413 237
1542 3300025972 Ga0207668_10543123 Ga0207668_105431231 237
1543 3300026067 Ga0207678_10270814 Ga0207678_102708142 237
1544 3300026075 Ga0207708_10173205 Ga0207708_101732052 237
1545 3300026075 Ga0207708_10195012 Ga0207708_101950123 237
1546 3300026088 Ga0207641_10114868 Ga0207641_101148682 237
1547 3300026088 Ga0207641_10443697 Ga0207641_104436972 237
1548 3300026089 Ga0207648_10013191 Ga0207648_100131914 237
1549 3300026089 Ga0207648_10018499 Ga0207648_100184995 237
1550 3300026095 Ga0207676_10040883 Ga0207676_100408833 237
1551 3300026121 Ga0207683_10002721 Ga0207683_1000272110 237
1552 3300026121 Ga0207683_10005185 Ga0207683_100051855 237
1553 3300026121 Ga0207683_10007852 Ga0207683_100078527 237
1554 3300028379 Ga0268266_10400189 Ga0268266_104001892 237
1555 3300028573 Ga0265334_10084996 Ga0265334_100849962 237
1556 3300028577 Ga0265318_10023086 Ga0265318_100230863 237
1557 3300028577 Ga0265318_10038885 Ga0265318_100388852 237
1558 3300030745 Ga0316182_1239479 Ga0316182_12394792 237
1559 3300031235 Ga0265330_10000108 Ga0265330_1000010857 237
1560 3300031238 Ga0265332_10000072 Ga0265332_1000007260 237
1561 3300031239 Ga0265328_10006129 Ga0265328_100061292 237
1562 3300031240 Ga0265320_10063785 Ga0265320_100637851 237
1563 3300031242 Ga0265329_10088549 Ga0265329_100885491 237
1564 3300031247 Ga0265340_10015804 Ga0265340_100158042 237
1565 3300031249 Ga0265339_10185108 Ga0265339_101851081 237
1566 3300031250 Ga0265331_10020416 Ga0265331_100204164 237
1567 3300031251 Ga0265327_10000423 Ga0265327_1000042340 237
1568 3300031507 Ga0307509_10509715 Ga0307509_105097151 237
1569 3300031595 Ga0265313_10007896 Ga0265313_100078963 237
1570 3300031711 Ga0265314_10000516 Ga0265314_1000051635 237
1571 3300031824 Ga0307413_10170674 Ga0307413_101706743 237
1572 3300032002 Ga0307416_100406528 Ga0307416_1004065282 237
1573 3300032126 Ga0307415_100693625 Ga0307415_1006936251 237
1574 3300033180 Ga0307510_10112237 Ga0307510_101122371 237
1575 3300035115 Ga0373941_0007446 Ga0373941_0007446_1629_2411 237
1576 3300035170 Ga0373943_0161286 Ga0373943_0161286_38_823 237
1577 3300035691 Ga0373931_0226761 Ga0373931_0226761_77_862 237
1578 3300037312 Ga0395899_0001751 Ga0395899_0001751_9225_10007 237
1579 3300037312 Ga0395899_0002385 Ga0395899_0002385_8815_9609 237
1580 3300037312 Ga0395899_0004067 Ga0395899_0004067_7021_7968 237
1581 3300037312 Ga0395899_0062879 Ga0395899_0062879_370_1164 237
1582 3300037312 Ga0395899_0255605 Ga0395899_0255605_162_956 237
1583 3300037418 Ga0395900_0000343 Ga0395900_0000343_65041_65835 237
1584 3300037418 Ga0395900_0005960 Ga0395900_0005960_2770_3564 237
1585 3300037418 Ga0395900_0008788 Ga0395900_0008788_7324_8106 237
1586 3300037418 Ga0395900_0043264 Ga0395900_0043264_3303_4250 237
1587 3300037418 Ga0395900_0187621 Ga0395900_0187621_488_1282 237
1588 3300037418 Ga0395900_0652180 Ga0395900_0652180_172_978 237
1589 3300037418 Ga0395900_0733393 Ga0395900_0733393_62_856 237
1590 3300037418 Ga0395900_0906237 Ga0395900_0906237_10_792 237
1591 3300037466 Ga0395898_0026751 Ga0395898_0026751_2654_3601 237
1592 3300037471 Ga0395905_0003638 Ga0395905_0003638_4337_5161 237
1593 3300037471 Ga0395905_0015533 Ga0395905_0015533_1559_2341 237
1594 3300037471 Ga0395905_0018706 Ga0395905_0018706_3448_4230 237
1595 3300037853 Ga0436364_0029269 Ga0436364_0029269_1446_2231 237
1596 3300038443 Ga0395901_0003716 Ga0395901_0003716_11562_12467 237
1597 3300038443 Ga0395901_0004044 Ga0395901_0004044_5960_6907 237
1598 3300038443 Ga0395901_0034845 Ga0395901_0034845_2046_2840 237
1599 3300038443 Ga0395901_0078482 Ga0395901_0078482_1332_2126 237
1600 3300039437 Ga0436365_1478878 Ga0436365_1478878_47_829 237
1601 3300039447 Ga0436361_0287651 Ga0436361_0287651_29589_30383 237
1602 3300039447 Ga0436361_0300526 Ga0436361_0300526_1369_2163 237
1603 3300039453 Ga0436362_0225961 Ga0436362_0225961_412_1194 237
1604 3300041408 Ga0439453_0000966 Ga0439453_0000966_1062_1844 237
1605 3300042003 Ga0439443_002542 Ga0439443_002542_287_1069 237
1606 3300042005 Ga0439448_0013746 Ga0439448_0013746_1066_1848 237
1607 3300042436 Ga0439435_0017468 Ga0439435_0017468_846_1628 237
1608 3300042876 Ga0451577_0062080 Ga0451577_0062080_1643_2425 237
1609 3300042993 Ga0439440_0046688 Ga0439440_0046688_139_921 237
1610 3300044683 Ga0466965_0003238 Ga0466965_0003238_946_1728 237
1611 3300044684 Ga0466966_0014879 Ga0466966_0014879_1698_2492 237
1612 3300044694 Ga0466963_0047900 Ga0466963_0047900_1727_2521 237
1613 3300044719 Ga0466971_0030881 Ga0466971_0030881_1580_2362 237
1614 3300044765 Ga0466970_0013469 Ga0466970_0013469_2269_3063 237
1615 3300044842 Ga0466957_0003539 Ga0466957_0003539_3381_4163 237
1616 3300044842 Ga0466957_0005295 Ga0466957_0005295_2280_3074 237
1617 3300045049 Ga0466959_0020945 Ga0466959_0020945_3513_4307 237
1618 3300045049 Ga0466959_0115064 Ga0466959_0115064_1085_1867 237
1619 3300045051 Ga0451576_0000914 Ga0451576_0000914_9291_10073 237
1620 3300045051 Ga0451576_0923350 Ga0451576_0923350_86_868 237
1621 3300045836 Ga0466958_0226808 Ga0466958_0226808_386_1180 237
1622 3300045976 Ga0466967_0132364 Ga0466967_0132364_1469_2251 237
1623 3300046452 Ga0495617_000136 Ga0495617_000136_2256_3038 237
1624 3300046453 Ga0495627_000059 Ga0495627_000059_14_808 237
1625 3300046457 Ga0495590_0070432 Ga0495590_0070432_320_1114 237
1626 3300046460 Ga0495638_0114833 Ga0495638_0114833_37_831 237
1627 3300046474 Ga0495605_0000237 Ga0495605_0000237_13836_14630 237
1628 3300046474 Ga0495605_0019919 Ga0495605_0019919_1745_2527 237
1629 3300046474 Ga0495605_0022662 Ga0495605_0022662_1827_2621 237
1630 3300046474 Ga0495605_0069122 Ga0495605_0069122_68_850 237
1631 3300046475 Ga0495639_0151845 Ga0495639_0151845_115_909 237
1632 3300046491 Ga0495584_0000133 Ga0495584_0000133_12914_13708 237
1633 3300046491 Ga0495584_0003379 Ga0495584_0003379_2010_2804 237
1634 3300046491 Ga0495584_0006071 Ga0495584_0006071_2829_3623 237
1635 3300046492 Ga0495585_0000005 Ga0495585_0000005_35035_35817 237
1636 3300046492 Ga0495585_0000102 Ga0495585_0000102_13235_14029 237
1637 3300046492 Ga0495585_0002843 Ga0495585_0002843_782_1576 237
1638 3300046492 Ga0495585_0008517 Ga0495585_0008517_4360_5154 237
1639 3300046500 Ga0495596_0010741 Ga0495596_0010741_2755_3549 237
1640 3300046501 Ga0495607_0008021 Ga0495607_0008021_2186_2980 237
1641 3300046501 Ga0495607_0017867 Ga0495607_0017867_786_1580 237
1642 3300046501 Ga0495607_0136064 Ga0495607_0136064_297_1091 237
1643 3300046506 Ga0495583_0000189 Ga0495583_0000189_10741_11535 237
1644 3300046506 Ga0495583_0005548 Ga0495583_0005548_5124_5906 237
1645 3300046506 Ga0495583_0023425 Ga0495583_0023425_881_1663 237
1646 3300046507 Ga0495606_0000439 Ga0495606_0000439_63951_64745 237
1647 3300046507 Ga0495606_0008822 Ga0495606_0008822_2998_3792 237
1648 3300046513 Ga0495616_0000184 Ga0495616_0000184_17738_18520 237
1649 3300046513 Ga0495616_0005259 Ga0495616_0005259_1131_1913 237
1650 3300046513 Ga0495616_0010626 Ga0495616_0010626_2106_2900 237
1651 3300046513 Ga0495616_0023795 Ga0495616_0023795_992_1786 237
1652 3300046518 Ga0495631_0047019 Ga0495631_0047019_451_1245 237
1653 3300046522 Ga0495643_0000630 Ga0495643_0000630_23281_24063 237
1654 3300046522 Ga0495643_0006464 Ga0495643_0006464_2755_3579 237
1655 3300046522 Ga0495643_0006564 Ga0495643_0006564_5126_5920 237
1656 3300046522 Ga0495643_0171428 Ga0495643_0171428_37_819 237
1657 3300046523 Ga0495644_0055071 Ga0495644_0055071_465_1247 237
1658 3300046524 Ga0495648_0000076 Ga0495648_0000076_93620_94402 237
1659 3300046524 Ga0495648_0010937 Ga0495648_0010937_5793_6587 237
1660 3300046524 Ga0495648_0055532 Ga0495648_0055532_319_1113 237
1661 3300046525 Ga0495663_0026263 Ga0495663_0026263_808_1602 237
1662 3300046526 Ga0495666_0031246 Ga0495666_0031246_558_1340 237
1663 3300046528 Ga0495642_0000678 Ga0495642_0000678_2022_2816 237
1664 3300046528 Ga0495642_0002246 Ga0495642_0002246_3128_3922 237
1665 3300046528 Ga0495642_0002999 Ga0495642_0002999_3841_4665 237
1666 3300046528 Ga0495642_0012392 Ga0495642_0012392_1745_2539 237
1667 3300046528 Ga0495642_0039534 Ga0495642_0039534_20_814 237
1668 3300046530 Ga0495654_0118559 Ga0495654_0118559_374_1168 237
1669 3300046538 Ga0495609_0000039 Ga0495609_0000039_109859_110653 237
1670 3300046538 Ga0495609_0000835 Ga0495609_0000835_19170_19964 237
1671 3300046542 Ga0495597_0049873 Ga0495597_0049873_587_1411 237
1672 3300046558 Ga0495633_0005487 Ga0495633_0005487_6578_7372 237
1673 3300046558 Ga0495633_0006063 Ga0495633_0006063_4697_5491 237
1674 3300046558 Ga0495633_0036983 Ga0495633_0036983_1061_1843 237
1675 3300046615 Ga0495656_0026925 Ga0495656_0026925_1403_2185 237
1676 3300046615 Ga0495656_0039481 Ga0495656_0039481_564_1358 237
1677 3300046616 Ga0495668_0012991 Ga0495668_0012991_1269_2063 237
1678 3300046664 Ga0495659_0030057 Ga0495659_0030057_108_890 237
1679 3300046665 Ga0495661_0001453 Ga0495661_0001453_16265_17059 237
1680 3300046665 Ga0495661_0021839 Ga0495661_0021839_974_1798 237
1681 3300046665 Ga0495661_0039473 Ga0495661_0039473_333_1127 237
1682 3300046674 Ga0495588_0000110 Ga0495588_0000110_44701_45495 237
1683 3300046674 Ga0495588_0035811 Ga0495588_0035811_1652_2446 237
1684 3300046679 Ga0495623_0034314 Ga0495623_0034314_512_1306 237
1685 3300046680 Ga0495646_0105430 Ga0495646_0105430_242_1036 237
1686 3300046691 Ga0495670_0003286 Ga0495670_0003286_5299_6093 237
1687 3300046691 Ga0495670_0021655 Ga0495670_0021655_2233_3015 237
1688 3300046694 Ga0495649_0022106 Ga0495649_0022106_2238_3032 237
1689 3300046794 Ga0495589_0000019 Ga0495589_0000019_111630_112424 237
1690 3300046794 Ga0495589_0000265 Ga0495589_0000265_7450_8244 237
1691 3300046810 Ga0495660_0000245 Ga0495660_0000245_1443_2237 237
1692 3300046810 Ga0495660_0004392 Ga0495660_0004392_7513_8307 237
1693 3300046810 Ga0495660_0024296 Ga0495660_0024296_1104_1898 237
1694 3300046810 Ga0495660_0029664 Ga0495660_0029664_1396_2190 237
1695 3300047319 Ga0495674_0010902 Ga0495674_0010902_4574_5368 237
1696 3300047320 Ga0495672_0003756 Ga0495672_0003756_4725_5519 237
1697 3300047321 Ga0495676_0047857 Ga0495676_0047857_2567_3361 237
1698 3300047323 Ga0495683_0000533 Ga0495683_0000533_16017_16811 237
1699 3300047323 Ga0495683_0016509 Ga0495683_0016509_2869_3651 237
1700 3300047323 Ga0495683_0025469 Ga0495683_0025469_30_824 237
1701 3300047443 Ga0495687_000059 Ga0495687_000059_109859_110653 237
1702 3300047443 Ga0495687_000189 Ga0495687_000189_71805_72599 237
1703 3300047443 Ga0495687_001313 Ga0495687_001313_13684_14478 237
1704 3300047443 Ga0495687_011487 Ga0495687_011487_2687_3511 237
1705 3300047445 Ga0495677_0000006 Ga0495677_0000006_88578_89372 237
1706 3300047445 Ga0495677_0004084 Ga0495677_0004084_2670_3464 237
1707 3300047447 Ga0495685_064586 Ga0495685_064586_378_1160 237
1708 3300047470 Ga0495681_0000687 Ga0495681_0000687_13767_14549 237
1709 3300047470 Ga0495681_0069570 Ga0495681_0069570_304_1098 237
1710 3300048088 Ga0495602_0132657 Ga0495602_0132657_751_1533 237
1711 3300048090 Ga0495615_0007285 Ga0495615_0007285_103_885 237
1712 3300048091 Ga0495626_0000103 Ga0495626_0000103_38699_39493 237
1713 3300048091 Ga0495626_0000494 Ga0495626_0000494_13280_14074 237
1714 3300048091 Ga0495626_0000821 Ga0495626_0000821_18201_18995 237
1715 3300048091 Ga0495626_0000873 Ga0495626_0000873_17083_17889 237
1716 3300048091 Ga0495626_0006175 Ga0495626_0006175_5840_6634 237
1717 3300048091 Ga0495626_0042744 Ga0495626_0042744_896_1690 237
1718 3300048903 Ga0496100_0537468 Ga0496100_0537468_99_893 237
1719 3300048905 Ga0496102_0022672 Ga0496102_0022672_2961_3755 237
1720 3300048905 Ga0496102_0070563 Ga0496102_0070563_198_992 237
1721 3300048905 Ga0496102_0601627 Ga0496102_0601627_70_873 237
1722 3300048906 Ga0496103_0040732 Ga0496103_0040732_320_1114 237
1723 3300048906 Ga0496103_0139394 Ga0496103_0139394_527_1330 237
1724 3300048907 Ga0496104_0303814 Ga0496104_0303814_604_1398 237
1725 3300048908 Ga0496105_0048269 Ga0496105_0048269_82_876 237
1726 3300048908 Ga0496105_0362677 Ga0496105_0362677_256_1050 237
1727 3300048910 Ga0496107_0333727 Ga0496107_0333727_200_994 237
1728 3300048911 Ga0496108_0460203 Ga0496108_0460203_242_1036 237
1729 3300048912 Ga0496109_0251540 Ga0496109_0251540_513_1325 237
1730 3300048912 Ga0496109_0419648 Ga0496109_0419648_149_931 237
1731 3300048913 Ga0496110_0425143 Ga0496110_0425143_244_1026 237
1732 3300048915 Ga0496112_0079486 Ga0496112_0079486_1704_2498 237
1733 3300048915 Ga0496112_0320975 Ga0496112_0320975_250_1032 237
1734 3300048916 Ga0496113_0003727 Ga0496113_0003727_6199_6993 237
1735 3300048916 Ga0496113_0196617 Ga0496113_0196617_756_1550 237
1736 3300048917 Ga0496114_0042835 Ga0496114_0042835_2190_2984 237
1737 3300048919 Ga0496116_0157115 Ga0496116_0157115_239_1033 237
1738 3300048924 Ga0496121_0159115 Ga0496121_0159115_535_1317 237
1739 3300048925 Ga0496122_0005337 Ga0496122_0005337_2091_2885 237
1740 3300048925 Ga0496122_0029955 Ga0496122_0029955_1651_2433 237
1741 3300048926 Ga0496123_0005181 Ga0496123_0005181_10884_11666 237
1742 3300048927 Ga0496124_0004249 Ga0496124_0004249_13495_14289 237
1743 3300048927 Ga0496124_0009605 Ga0496124_0009605_4469_5263 237
1744 3300048927 Ga0496124_0027708 Ga0496124_0027708_3472_4266 237
1745 3300048927 Ga0496124_0055969 Ga0496124_0055969_1888_2670 237
1746 3300048927 Ga0496124_0093070 Ga0496124_0093070_1106_1888 237
1747 3300048928 Ga0496125_0133675 Ga0496125_0133675_643_1437 237
1748 3300048928 Ga0496125_0318429 Ga0496125_0318429_34_828 237
1749 3300048929 Ga0496126_0130295 Ga0496126_0130295_569_1363 237
1750 3300049573 Ga0501037_0260541 Ga0501037_0260541_150_974 237
1751 3300049574 Ga0501038_0414268 Ga0501038_0414268_47_871 237
1752 3300049575 Ga0501039_0107301 Ga0501039_0107301_1374_2156 237
1753 3300049579 Ga0501043_0121561 Ga0501043_0121561_940_1764 237
1754 3300049581 Ga0501047_0105149 Ga0501047_0105149_1413_2195 237
1755 3300049581 Ga0501047_0405337 Ga0501047_0405337_167_949 237
1756 3300049582 Ga0501048_0050615 Ga0501048_0050615_1598_2380 237
1757 3300049583 Ga0501067_0074729 Ga0501067_0074729_1084_1866 237
1758 3300049585 Ga0501069_0033853 Ga0501069_0033853_1874_2656 237
1759 3300049585 Ga0501069_0175778 Ga0501069_0175778_432_1214 237
1760 3300049586 Ga0501070_0010735 Ga0501070_0010735_5713_6495 237
1761 3300049586 Ga0501070_0443867 Ga0501070_0443867_153_977 237
1762 3300049590 Ga0501074_0050555 Ga0501074_0050555_34_858 237
1763 3300049742 Ga0501080_0014736 Ga0501080_0014736_5422_6204 237
1764 3300049742 Ga0501080_0055070 Ga0501080_0055070_159_983 237
1765 3300049822 Ga0501035_0005452 Ga0501035_0005452_1506_2288 237
1766 3300049822 Ga0501035_0055819 Ga0501035_0055819_762_1586 237
1767 3300049822 Ga0501035_0077368 Ga0501035_0077368_2075_2857 237
1768 3300049823 Ga0501044_0007435 Ga0501044_0007435_3868_4650 237
1769 3300049823 Ga0501044_0465257 Ga0501044_0465257_207_989 237
1770 3300049823 Ga0501044_0545219 Ga0501044_0545219_152_946 237
1771 3300049824 Ga0501045_0422498 Ga0501045_0422498_129_953 237
1772 3300050507 nmdc:mga05p37_376617_c1 nmdc:mga05p37_376617_c1_808_1593 237
1773 3300050510 nmdc:mga06r32_71366_c1 nmdc:mga06r32_71366_c1_1113_1895 237
1774 3300050513 nmdc:mga0rr50_12184_c1 nmdc:mga0rr50_12184_c1_4151_4933 237
1775 3300059492 Ga0587073_0025704 Ga0587073_0025704_158_952 237
1776 3300059493 Ga0587077_000088 Ga0587077_000088_695_1489 237
1777 3300059503 Ga0587080_011296 Ga0587080_011296_318_1112 237
1778 3300059505 Ga0587083_0007941 Ga0587083_0007941_276_1070 237
1779 3300059506 Ga0587085_000896 Ga0587085_000896_529_1323 237
1780 3300059507 Ga0587086_007086 Ga0587086_007086_264_1058 237
1781 3300059508 Ga0587088_004393 Ga0587088_004393_332_1126 237
1782 3300059510 Ga0587090_000710 Ga0587090_000710_2103_2897 237
1783 3300059510 Ga0587090_010045 Ga0587090_010045_289_1083 237
1784 3300059510 Ga0587090_031672 Ga0587090_031672_15_809 237
1785 3300059512 Ga0587092_002099 Ga0587092_002099_629_1423 237
1786 3300059639 Ga0587062_001158 Ga0587062_001158_850_1644 237
1787 3300059639 Ga0587062_001273 Ga0587062_001273_559_1353 237
1788 3300059641 Ga0587068_005270 Ga0587068_005270_126_920 237
1789 3300059641 Ga0587068_034578 Ga0587068_034578_47_841 237
1790 3300059642 Ga0587069_005950 Ga0587069_005950_35_829 237
1791 3300059643 Ga0587072_004905 Ga0587072_004905_653_1447 237
1792 3300059644 Ga0587075_008318 Ga0587075_008318_338_1132 237
1793 3300059645 Ga0587076_015287 Ga0587076_015287_183_977 237
1794 3300059646 Ga0587078_004112 Ga0587078_004112_332_1126 237
1795 3300059647 Ga0587079_014651 Ga0587079_014651_248_1042 237
1796 3300059649 Ga0587102_000353 Ga0587102_000353_508_1302 237
1797 3300060344 Ga0587071_011501 Ga0587071_011501_439_1233 237
1798 3300060346 Ga0587111_0002221 Ga0587111_0002221_1485_2279 237
1799 3300060346 Ga0587111_0004906 Ga0587111_0004906_45_839 237
1800 3300060346 Ga0587111_0021801 Ga0587111_0021801_339_1133 237
1801 3300060353 Ga0501082_0052621 Ga0501082_0052621_206_988 237
1802 3300060353 Ga0501082_0291988 Ga0501082_0291988_336_1118 237
1803 3300005293 Ga0065715_10279258 Ga0065715_102792581 238
1804 3300037312 Ga0395899_0029354 Ga0395899_0029354_2539_3333 238
1805 3300037466 Ga0395898_0635874 Ga0395898_0635874_107_901 238
1806 3300037471 Ga0395905_0156473 Ga0395905_0156473_226_1020 238
1807 3300044658 Ga0466972_0002883 Ga0466972_0002883_2633_3427 238
1808 3300044683 Ga0466965_0017080 Ga0466965_0017080_2654_3448 238
1809 3300044706 Ga0466964_0000101 Ga0466964_0000101_2005_2799 238
1810 3300044735 Ga0466968_0000268 Ga0466968_0000268_6802_7596 238
1811 3300046471 Ga0495650_0000019 Ga0495650_0000019_278579_279373 238
1812 3300046492 Ga0495585_0025114 Ga0495585_0025114_2474_3268 238
1813 3300046501 Ga0495607_0059816 Ga0495607_0059816_114_1091 238
1814 3300046506 Ga0495583_0026086 Ga0495583_0026086_19_801 238
1815 3300046507 Ga0495606_0007813 Ga0495606_0007813_3363_4157 238
1816 3300046520 Ga0495637_0025346 Ga0495637_0025346_13_792 238
1817 3300046539 Ga0495621_0101987 Ga0495621_0101987_43_825 238
1818 3300046557 Ga0495622_0000001 Ga0495622_0000001_5475_6269 238
1819 3300046810 Ga0495660_0005311 Ga0495660_0005311_6675_7469 238
1820 3300047318 Ga0495636_0005764 Ga0495636_0005764_727_1509 238
1821 3300047320 Ga0495672_0000021 Ga0495672_0000021_143010_143804 238
1822 3300047321 Ga0495676_0314941 Ga0495676_0314941_91_885 238
1823 3300047472 Ga0495686_0000346 Ga0495686_0000346_16757_17551 238
1824 3300048927 Ga0496124_0163645 Ga0496124_0163645_339_1121 238
1825 3300003771 Ga0055526_1001576 Ga0055526_100157611 239
1826 3300005262 Ga0065165_1002157 Ga0065165_10021575 239
1827 3300005614 Ga0068856_100522621 Ga0068856_1005226211 239
1828 3300005937 Ga0081455_10015908 Ga0081455_100159082 239
1829 3300009093 Ga0105240_10007989 Ga0105240_1000798911 239
1830 3300025233 Ga0209437_107815 Ga0209437_1078152 239
1831 3300025295 Ga0209564_1000089 Ga0209564_1000089125 239
1832 3300025913 Ga0207695_10206204 Ga0207695_102062042 239
1833 3300026078 Ga0207702_10473428 Ga0207702_104734281 239
1834 3300037312 Ga0395899_0187844 Ga0395899_0187844_482_1276 239
1835 3300037471 Ga0395905_0114523 Ga0395905_0114523_343_1137 239
1836 3300042012 Ga0439455_0013213 Ga0439455_0013213_213_995 239
1837 3300046452 Ga0495617_000001 Ga0495617_000001_825487_826269 239
1838 3300046452 Ga0495617_004796 Ga0495617_004796_4016_4810 239
1839 3300046453 Ga0495627_000652 Ga0495627_000652_13165_13947 239
1840 3300046453 Ga0495627_018979 Ga0495627_018979_753_1547 239
1841 3300046455 Ga0495603_0007396 Ga0495603_0007396_1571_2353 239
1842 3300046457 Ga0495590_0000013 Ga0495590_0000013_15880_16686 239
1843 3300046458 Ga0495591_000093 Ga0495591_000093_83937_84743 239
1844 3300046459 Ga0495629_0003279 Ga0495629_0003279_7467_8261 239
1845 3300046460 Ga0495638_0016449 Ga0495638_0016449_1378_2172 239
1846 3300046460 Ga0495638_0096201 Ga0495638_0096201_467_1273 239
1847 3300046471 Ga0495650_0000639 Ga0495650_0000639_10791_11585 239
1848 3300046471 Ga0495650_0000986 Ga0495650_0000986_30963_31772 239
1849 3300046471 Ga0495650_0015152 Ga0495650_0015152_878_1660 239
1850 3300046471 Ga0495650_0140119 Ga0495650_0140119_20_814 239
1851 3300046474 Ga0495605_0000035 Ga0495605_0000035_17838_18620 239
1852 3300046491 Ga0495584_0000032 Ga0495584_0000032_19879_20685 239
1853 3300046492 Ga0495585_0001927 Ga0495585_0001927_12822_13616 239
1854 3300046492 Ga0495585_0002461 Ga0495585_0002461_3313_4107 239
1855 3300046492 Ga0495585_0120747 Ga0495585_0120747_263_1045 239
1856 3300046500 Ga0495596_0003968 Ga0495596_0003968_3593_4387 239
1857 3300046500 Ga0495596_0003996 Ga0495596_0003996_4798_5592 239
1858 3300046500 Ga0495596_0006165 Ga0495596_0006165_1384_2166 239
1859 3300046501 Ga0495607_0004505 Ga0495607_0004505_342_1124 239
1860 3300046501 Ga0495607_0008847 Ga0495607_0008847_5531_6337 239
1861 3300046501 Ga0495607_0118756 Ga0495607_0118756_197_979 239
1862 3300046506 Ga0495583_0002653 Ga0495583_0002653_6879_7685 239
1863 3300046506 Ga0495583_0028153 Ga0495583_0028153_1754_2536 239
1864 3300046507 Ga0495606_0009227 Ga0495606_0009227_1758_2552 239
1865 3300046507 Ga0495606_0242403 Ga0495606_0242403_166_948 239
1866 3300046513 Ga0495616_0000470 Ga0495616_0000470_10146_10928 239
1867 3300046513 Ga0495616_0001773 Ga0495616_0001773_1027_1809 239
1868 3300046513 Ga0495616_0019927 Ga0495616_0019927_2708_3490 239
1869 3300046513 Ga0495616_0055306 Ga0495616_0055306_455_1249 239
1870 3300046518 Ga0495631_0002588 Ga0495631_0002588_1185_1967 239
1871 3300046518 Ga0495631_0006122 Ga0495631_0006122_3802_4608 239
1872 3300046519 Ga0495632_0000081 Ga0495632_0000081_59188_59970 239
1873 3300046519 Ga0495632_0000670 Ga0495632_0000670_11060_11842 239
1874 3300046519 Ga0495632_0116745 Ga0495632_0116745_366_1172 239
1875 3300046520 Ga0495637_0000008 Ga0495637_0000008_256084_256890 239
1876 3300046522 Ga0495643_0032280 Ga0495643_0032280_2031_2813 239
1877 3300046523 Ga0495644_0022076 Ga0495644_0022076_78_884 239
1878 3300046524 Ga0495648_0000692 Ga0495648_0000692_17883_18665 239
1879 3300046524 Ga0495648_0016532 Ga0495648_0016532_1765_2571 239
1880 3300046524 Ga0495648_0070277 Ga0495648_0070277_98_880 239
1881 3300046528 Ga0495642_0000189 Ga0495642_0000189_16208_16990 239
1882 3300046528 Ga0495642_0000277 Ga0495642_0000277_9881_10663 239
1883 3300046528 Ga0495642_0017257 Ga0495642_0017257_1826_2632 239
1884 3300046528 Ga0495642_0067973 Ga0495642_0067973_383_1177 239
1885 3300046530 Ga0495654_0008909 Ga0495654_0008909_2431_3213 239
1886 3300046533 Ga0495640_0040738 Ga0495640_0040738_2212_2994 239
1887 3300046538 Ga0495609_0003324 Ga0495609_0003324_5272_6054 239
1888 3300046538 Ga0495609_0067748 Ga0495609_0067748_574_1356 239
1889 3300046542 Ga0495597_0000549 Ga0495597_0000549_16766_17572 239
1890 3300046542 Ga0495597_0001049 Ga0495597_0001049_17001_17783 239
1891 3300046558 Ga0495633_0003756 Ga0495633_0003756_7238_8020 239
1892 3300046558 Ga0495633_0005666 Ga0495633_0005666_1982_2776 239
1893 3300046558 Ga0495633_0029394 Ga0495633_0029394_513_1307 239
1894 3300046616 Ga0495668_0000846 Ga0495668_0000846_15991_16773 239
1895 3300046616 Ga0495668_0004674 Ga0495668_0004674_294_1088 239
1896 3300046616 Ga0495668_0099887 Ga0495668_0099887_341_1123 239
1897 3300046648 Ga0495611_0001061 Ga0495611_0001061_9256_10062 239
1898 3300046648 Ga0495611_0005501 Ga0495611_0005501_1326_2120 239
1899 3300046660 Ga0495625_0001158 Ga0495625_0001158_1983_2777 239
1900 3300046665 Ga0495661_0000934 Ga0495661_0000934_16115_16897 239
1901 3300046665 Ga0495661_0002287 Ga0495661_0002287_3533_4327 239
1902 3300046665 Ga0495661_0014195 Ga0495661_0014195_738_1520 239
1903 3300046665 Ga0495661_0031334 Ga0495661_0031334_1451_2233 239
1904 3300046674 Ga0495588_0004725 Ga0495588_0004725_708_1490 239
1905 3300046674 Ga0495588_0064287 Ga0495588_0064287_1076_1858 239
1906 3300046680 Ga0495646_0205214 Ga0495646_0205214_38_820 239
1907 3300046684 Ga0495669_0000041 Ga0495669_0000041_9731_10525 239
1908 3300046684 Ga0495669_0000446 Ga0495669_0000446_4268_5050 239
1909 3300046684 Ga0495669_0003983 Ga0495669_0003983_4542_5336 239
1910 3300046684 Ga0495669_0039458 Ga0495669_0039458_894_1700 239
1911 3300046684 Ga0495669_0066734 Ga0495669_0066734_137_919 239
1912 3300046691 Ga0495670_0017924 Ga0495670_0017924_451_1233 239
1913 3300046692 Ga0495671_0000098 Ga0495671_0000098_15096_15878 239
1914 3300046692 Ga0495671_0002109 Ga0495671_0002109_41_823 239
1915 3300046694 Ga0495649_0000459 Ga0495649_0000459_18305_19111 239
1916 3300046694 Ga0495649_0004396 Ga0495649_0004396_5224_6018 239
1917 3300046694 Ga0495649_0160316 Ga0495649_0160316_118_912 239
1918 3300046794 Ga0495589_0000706 Ga0495589_0000706_14905_15687 239
1919 3300046810 Ga0495660_0007039 Ga0495660_0007039_4194_5000 239
1920 3300047315 Ga0495581_0117697 Ga0495581_0117697_376_1170 239
1921 3300047315 Ga0495581_0175152 Ga0495581_0175152_436_1218 239
1922 3300047320 Ga0495672_0000033 Ga0495672_0000033_11191_11997 239
1923 3300047323 Ga0495683_0000024 Ga0495683_0000024_16078_16884 239
1924 3300047323 Ga0495683_0032599 Ga0495683_0032599_271_1053 239
1925 3300047443 Ga0495687_001331 Ga0495687_001331_14290_15072 239
1926 3300047445 Ga0495677_0000931 Ga0495677_0000931_3575_4381 239
1927 3300047445 Ga0495677_0003707 Ga0495677_0003707_3231_4025 239
1928 3300047445 Ga0495677_0030002 Ga0495677_0030002_394_1176 239
1929 3300047446 Ga0495679_009620 Ga0495679_009620_310_1104 239
1930 3300047447 Ga0495685_001524 Ga0495685_001524_231_1013 239
1931 3300047469 Ga0495673_0000285 Ga0495673_0000285_30970_31764 239
1932 3300047470 Ga0495681_0000379 Ga0495681_0000379_23958_24752 239
1933 3300047470 Ga0495681_0010499 Ga0495681_0010499_2685_3479 239
1934 3300047470 Ga0495681_0035431 Ga0495681_0035431_1413_2195 239
1935 3300047472 Ga0495686_0001786 Ga0495686_0001786_5592_6488 239
1936 3300047673 Ga0495593_0006045 Ga0495593_0006045_3739_4533 239
1937 3300048091 Ga0495626_0029391 Ga0495626_0029391_296_1090 239
1938 3300048091 Ga0495626_0045573 Ga0495626_0045573_540_1334 239
1939 3300048903 Ga0496100_0011282 Ga0496100_0011282_2790_3572 239
1940 3300048905 Ga0496102_0000701 Ga0496102_0000701_19868_20650 239
1941 3300048909 Ga0496106_0051026 Ga0496106_0051026_1620_2429 239
1942 3300048910 Ga0496107_0034722 Ga0496107_0034722_1006_1815 239
1943 3300048911 Ga0496108_0105166 Ga0496108_0105166_917_1699 239
1944 3300048913 Ga0496110_0002021 Ga0496110_0002021_8703_9485 239
1945 3300048918 Ga0496115_0081790 Ga0496115_0081790_1618_2400 239
1946 3300048923 Ga0496120_0109562 Ga0496120_0109562_464_1258 239
1947 3300048925 Ga0496122_0000572 Ga0496122_0000572_64810_65604 239
1948 3300048926 Ga0496123_0001313 Ga0496123_0001313_24852_25646 239
1949 3300048928 Ga0496125_0001871 Ga0496125_0001871_18536_19330 239
1950 3300049459 Ga0495678_000104 Ga0495678_000104_33901_34707 239
1951 3300049459 Ga0495678_004340 Ga0495678_004340_2017_2799 239
1952 3300049460 Ga0495682_0001768 Ga0495682_0001768_914_1696 239
1953 3300049460 Ga0495682_0002559 Ga0495682_0002559_5462_6358 239
1954 3300049571 Ga0501034_0001253 Ga0501034_0001253_8046_8828 239
1955 3300049744 Ga0501083_0189574 Ga0501083_0189574_339_1121 239
1956 3300060353 Ga0501082_0397711 Ga0501082_0397711_242_1024 239
1957 iso_pu_bacteria 2511231221 2512037816 239
1958 iso_pu_bacteria 2897803580 2897809567 239
1959 iso_pu_bacteria 8054002106 8054007035 239
1960 3300002774 JGI25150J39212_1009891 JGI25150J39212_10098912 240
1961 3300005327 Ga0070658_10014794 Ga0070658_100147948 240
1962 3300005366 Ga0070659_100288550 Ga0070659_1002885502 240
1963 3300005530 Ga0070679_100041628 Ga0070679_1000416283 240
1964 3300006846 Ga0075430_100083272 Ga0075430_1000832722 240
1965 3300009036 Ga0105244_10031525 Ga0105244_100315254 240
1966 3300009147 Ga0114129_10256201 Ga0114129_102562013 240
1967 3300009545 Ga0105237_10217261 Ga0105237_102172612 240
1968 3300013105 Ga0157369_10354111 Ga0157369_103541112 240
1969 3300025245 Ga0207425_1001057 Ga0207425_10010576 240
1970 3300025297 Ga0209758_1002668 Ga0209758_10026687 240
1971 3300025910 Ga0207684_10194692 Ga0207684_101946922 240
1972 3300025914 Ga0207671_10260942 Ga0207671_102609422 240
1973 3300025921 Ga0207652_10542271 Ga0207652_105422712 240
1974 3300025986 Ga0207658_10166532 Ga0207658_101665323 240
1975 3300027695 Ga0209966_1002473 Ga0209966_10024733 240
1976 3300027717 Ga0209998_10009266 Ga0209998_100092663 240
1977 3300027876 Ga0209974_10005168 Ga0209974_100051684 240
1978 3300035170 Ga0373943_0058784 Ga0373943_0058784_677_1471 240
1979 3300037418 Ga0395900_0055481 Ga0395900_0055481_1982_2761 240
1980 3300037471 Ga0395905_0045702 Ga0395905_0045702_517_1332 240
1981 3300044658 Ga0466972_0000118 Ga0466972_0000118_32652_33440 240
1982 3300044901 Ga0466960_0090513 Ga0466960_0090513_688_1476 240
1983 3300046452 Ga0495617_079606 Ga0495617_079606_239_1024 240
1984 3300046455 Ga0495603_0004236 Ga0495603_0004236_6539_7324 240
1985 3300046463 Ga0495653_0193568 Ga0495653_0193568_117_911 240
1986 3300046491 Ga0495584_0015304 Ga0495584_0015304_2012_2794 240
1987 3300046492 Ga0495585_0112602 Ga0495585_0112602_20_802 240
1988 3300046499 Ga0495594_0000031 Ga0495594_0000031_30889_31674 240
1989 3300046499 Ga0495594_0003053 Ga0495594_0003053_6701_7495 240
1990 3300046506 Ga0495583_0000060 Ga0495583_0000060_185373_186167 240
1991 3300046506 Ga0495583_0019376 Ga0495583_0019376_1497_2282 240
1992 3300046512 Ga0495610_0054955 Ga0495610_0054955_67_861 240
1993 3300046513 Ga0495616_0022669 Ga0495616_0022669_2256_3038 240
1994 3300046518 Ga0495631_0065441 Ga0495631_0065441_456_1238 240
1995 3300046518 Ga0495631_0100819 Ga0495631_0100819_129_914 240
1996 3300046519 Ga0495632_0019823 Ga0495632_0019823_586_1368 240
1997 3300046523 Ga0495644_0000039 Ga0495644_0000039_27770_28555 240
1998 3300046523 Ga0495644_0003720 Ga0495644_0003720_1623_2405 240
1999 3300046524 Ga0495648_0058032 Ga0495648_0058032_526_1308 240
2000 3300046535 Ga0495586_0005815 Ga0495586_0005815_4138_4920 240
2001 3300046557 Ga0495622_0062851 Ga0495622_0062851_608_1402 240
2002 3300046558 Ga0495633_0027900 Ga0495633_0027900_1256_2041 240
2003 3300046660 Ga0495625_0008880 Ga0495625_0008880_5734_6528 240
2004 3300046660 Ga0495625_0010557 Ga0495625_0010557_128_913 240
2005 3300046663 Ga0495635_0001591 Ga0495635_0001591_816_1610 240
2006 3300046665 Ga0495661_0199593 Ga0495661_0199593_237_1019 240
2007 3300046689 Ga0495613_0051970 Ga0495613_0051970_1736_2530 240
2008 3300046810 Ga0495660_0002812 Ga0495660_0002812_4503_5285 240
2009 3300047317 Ga0495604_0038250 Ga0495604_0038250_1994_2788 240
2010 3300047322 Ga0495680_0036730 Ga0495680_0036730_1602_2396 240
2011 3300047444 Ga0495675_0007286 Ga0495675_0007286_3872_4666 240
2012 3300047446 Ga0495679_035006 Ga0495679_035006_772_1554 240
2013 3300047469 Ga0495673_0000003 Ga0495673_0000003_766692_767486 240
2014 3300047470 Ga0495681_0006283 Ga0495681_0006283_771_1553 240
2015 3300047673 Ga0495593_0001247 Ga0495593_0001247_659_1453 240
2016 3300048089 Ga0495614_0003005 Ga0495614_0003005_724_1518 240
2017 3300048924 Ga0496121_0152718 Ga0496121_0152718_544_1338 240
2018 3300049766 Ga0501269_000165 Ga0501269_000165_8663_9457 240
2019 3300050509 nmdc:mga0qj67_227585_c1 nmdc:mga0qj67_227585_c1_326_1123 240
2020 3300050516 nmdc:mga0sz30_42231_c1 nmdc:mga0sz30_42231_c1_70_849 240
2021 3300053139 Ga0500568_0037293 Ga0500568_0037293_455_1234 240
2022 3300053151 Ga0500604_0001716 Ga0500604_0001716_1543_2322 240
2023 iso_pu_bacteria 2808606418 2809146755 240
2024 2209111006 2214800748 2213829947 241
2025 3300000041 ARcpr5oldR_c000003 ARcpr5oldR_00000330 241
2026 3300000042 ARSoilYngRDRAFT_c00054 ARSoilYngRDRAFT_0005412 241
2027 3300000043 ARcpr5yngRDRAFT_c000010 ARcpr5yngRDRAFT_00001012 241
2028 3300003322 rootL2_10070738 rootL2_100707381 241
2029 3300003763 Ga0055529_1000032 Ga0055529_100003232 241
2030 3300005276 Ga0065717_1002780 Ga0065717_10027802 241
2031 3300005277 Ga0065716_1001725 Ga0065716_10017252 241
2032 3300005289 Ga0065704_10081449 Ga0065704_100814494 241
2033 3300005328 Ga0070676_10053861 Ga0070676_100538613 241
2034 3300005328 Ga0070676_10054436 Ga0070676_100544362 241
2035 3300005331 Ga0070670_100198719 Ga0070670_1001987192 241
2036 3300005335 Ga0070666_10046516 Ga0070666_100465164 241
2037 3300005337 Ga0070682_100091191 Ga0070682_1000911912 241
2038 3300005338 Ga0068868_100251098 Ga0068868_1002510982 241
2039 3300005339 Ga0070660_100177797 Ga0070660_1001777973 241
2040 3300005340 Ga0070689_100026579 Ga0070689_1000265791 241
2041 3300005341 Ga0070691_10017626 Ga0070691_100176262 241
2042 3300005345 Ga0070692_10011086 Ga0070692_100110865 241
2043 3300005347 Ga0070668_100080141 Ga0070668_1000801413 241
2044 3300005354 Ga0070675_100157979 Ga0070675_1001579792 241
2045 3300005355 Ga0070671_100100668 Ga0070671_1001006682 241
2046 3300005356 Ga0070674_100055286 Ga0070674_1000552864 241
2047 3300005364 Ga0070673_100252166 Ga0070673_1002521662 241
2048 3300005365 Ga0070688_100014520 Ga0070688_1000145202 241
2049 3300005366 Ga0070659_100185913 Ga0070659_1001859131 241
2050 3300005406 Ga0070703_10060740 Ga0070703_100607401 241
2051 3300005444 Ga0070694_100018727 Ga0070694_1000187275 241
2052 3300005445 Ga0070708_100026294 Ga0070708_1000262943 241
2053 3300005459 Ga0068867_100092166 Ga0068867_1000921662 241
2054 3300005467 Ga0070706_100321936 Ga0070706_1003219361 241
2055 3300005507 Ga0074259_10615634 Ga0074259_106156342 241
2056 3300005536 Ga0070697_100016119 Ga0070697_1000161193 241
2057 3300005539 Ga0068853_100008627 Ga0068853_1000086274 241
2058 3300005539 Ga0068853_100104022 Ga0068853_1001040223 241
2059 3300005539 Ga0068853_100555844 Ga0068853_1005558441 241
2060 3300005543 Ga0070672_100142571 Ga0070672_1001425712 241
2061 3300005543 Ga0070672_100165762 Ga0070672_1001657622 241
2062 3300005543 Ga0070672_100282153 Ga0070672_1002821532 241
2063 3300005549 Ga0070704_100041239 Ga0070704_1000412394 241
2064 3300005563 Ga0068855_100197021 Ga0068855_1001970212 241
2065 3300005564 Ga0070664_100184073 Ga0070664_1001840732 241
2066 3300005577 Ga0068857_100278690 Ga0068857_1002786901 241
2067 3300005617 Ga0068859_100628150 Ga0068859_1006281501 241
2068 3300005618 Ga0068864_100558177 Ga0068864_1005581771 241
2069 3300005841 Ga0068863_100276304 Ga0068863_1002763042 241
2070 3300005842 Ga0068858_100548543 Ga0068858_1005485432 241
2071 3300005843 Ga0068860_100043622 Ga0068860_1000436225 241
2072 3300005844 Ga0068862_100219319 Ga0068862_1002193193 241
2073 3300005981 Ga0081538_10003299 Ga0081538_1000329911 241
2074 3300006058 Ga0075432_10055704 Ga0075432_100557042 241
2075 3300006358 Ga0068871_100027763 Ga0068871_1000277633 241
2076 3300006358 Ga0068871_100259175 Ga0068871_1002591752 241
2077 3300006852 Ga0075433_10351308 Ga0075433_103513081 241
2078 3300006881 Ga0068865_100097909 Ga0068865_1000979092 241
2079 3300006931 Ga0097620_100628117 Ga0097620_1006281172 241
2080 3300009094 Ga0111539_10000168 Ga0111539_1000016864 241
2081 3300009094 Ga0111539_10001645 Ga0111539_1000164514 241
2082 3300009094 Ga0111539_10364634 Ga0111539_103646341 241
2083 3300009148 Ga0105243_10017831 Ga0105243_100178313 241
2084 3300009176 Ga0105242_10254947 Ga0105242_102549472 241
2085 3300009176 Ga0105242_10455504 Ga0105242_104555042 241
2086 3300009177 Ga0105248_10555603 Ga0105248_105556032 241
2087 3300009177 Ga0105248_10693831 Ga0105248_106938312 241
2088 3300009545 Ga0105237_10015908 Ga0105237_100159086 241
2089 3300009545 Ga0105237_10229392 Ga0105237_102293921 241
2090 3300009553 Ga0105249_10658702 Ga0105249_106587022 241
2091 3300011119 Ga0105246_10013058 Ga0105246_100130582 241
2092 3300012497 Ga0157319_1000299 Ga0157319_10002993 241
2093 3300012500 Ga0157314_1002358 Ga0157314_10023582 241
2094 3300013297 Ga0157378_10003059 Ga0157378_100030594 241
2095 3300013306 Ga0163162_10006735 Ga0163162_100067356 241
2096 3300013308 Ga0157375_10026759 Ga0157375_100267595 241
2097 3300013308 Ga0157375_10395803 Ga0157375_103958032 241
2098 3300014969 Ga0157376_10079062 Ga0157376_100790622 241
2099 3300017792 Ga0163161_10088708 Ga0163161_100887081 241
2100 3300021388 Ga0213875_10009266 Ga0213875_100092663 241
2101 3300025233 Ga0209437_105638 Ga0209437_1056382 241
2102 3300025272 Ga0209455_1000043 Ga0209455_1000043126 241
2103 3300025315 Ga0207697_10002312 Ga0207697_100023127 241
2104 3300025315 Ga0207697_10098320 Ga0207697_100983202 241
2105 3300025321 Ga0207656_10165034 Ga0207656_101650342 241
2106 3300025901 Ga0207688_10052391 Ga0207688_100523913 241
2107 3300025907 Ga0207645_10026817 Ga0207645_100268174 241
2108 3300025908 Ga0207643_10106987 Ga0207643_101069872 241
2109 3300025912 Ga0207707_10146364 Ga0207707_101463643 241
2110 3300025914 Ga0207671_10588743 Ga0207671_105887431 241
2111 3300025919 Ga0207657_10004062 Ga0207657_1000406214 241
2112 3300025925 Ga0207650_10073687 Ga0207650_100736874 241
2113 3300025925 Ga0207650_10492704 Ga0207650_104927041 241
2114 3300025926 Ga0207659_10283705 Ga0207659_102837052 241
2115 3300025932 Ga0207690_10011606 Ga0207690_100116065 241
2116 3300025935 Ga0207709_10018224 Ga0207709_100182244 241
2117 3300025937 Ga0207669_10163568 Ga0207669_101635682 241
2118 3300025938 Ga0207704_10412137 Ga0207704_104121372 241
2119 3300025940 Ga0207691_10372286 Ga0207691_103722861 241
2120 3300025941 Ga0207711_10419920 Ga0207711_104199202 241
2121 3300025945 Ga0207679_10033978 Ga0207679_100339783 241
2122 3300025961 Ga0207712_10504651 Ga0207712_105046512 241
2123 3300026041 Ga0207639_10013750 Ga0207639_100137503 241
2124 3300026041 Ga0207639_10335666 Ga0207639_103356662 241
2125 3300026088 Ga0207641_10483379 Ga0207641_104833792 241
2126 3300026089 Ga0207648_10045144 Ga0207648_100451442 241
2127 3300026095 Ga0207676_10493483 Ga0207676_104934832 241
2128 3300026118 Ga0207675_100571734 Ga0207675_1005717342 241
2129 3300026121 Ga0207683_10359071 Ga0207683_103590712 241
2130 3300026142 Ga0207698_10086246 Ga0207698_100862462 241
2131 3300027907 Ga0207428_10000045 Ga0207428_1000004555 241
2132 3300027907 Ga0207428_10000566 Ga0207428_1000056631 241
2133 3300027907 Ga0207428_10060645 Ga0207428_100606452 241
2134 3300028380 Ga0268265_10013096 Ga0268265_100130965 241
2135 3300031251 Ga0265327_10001312 Ga0265327_1000131211 241
2136 3300034816 Ga0373930_0000145 Ga0373930_0000145_4713_5528 241
2137 3300034817 Ga0373948_0000020 Ga0373948_0000020_514_1329 241
2138 3300034820 Ga0373959_0000517 Ga0373959_0000517_1369_2184 241
2139 3300035084 Ga0373928_0000212 Ga0373928_0000212_3334_4149 241
2140 3300035085 Ga0373929_0000945 Ga0373929_0000945_1860_2675 241
2141 3300035090 Ga0373949_0000713 Ga0373949_0000713_1568_2383 241
2142 3300035092 Ga0373952_0000214 Ga0373952_0000214_2214_3029 241
2143 3300035112 Ga0373932_0000110 Ga0373932_0000110_18889_19704 241
2144 3300035114 Ga0373939_0000702 Ga0373939_0000702_129_944 241
2145 3300035115 Ga0373941_0000923 Ga0373941_0000923_3994_4809 241
2146 3300035121 Ga0373960_0001315 Ga0373960_0001315_1232_2047 241
2147 3300035207 Ga0373942_0001033 Ga0373942_0001033_4346_5161 241
2148 3300035207 Ga0373942_0007520 Ga0373942_0007520_471_1268 241
2149 3300035241 Ga0373961_0000448 Ga0373961_0000448_7247_8062 241
2150 3300035242 Ga0373962_0000396 Ga0373962_0000396_1568_2383 241
2151 3300037418 Ga0395900_0168814 Ga0395900_0168814_323_1105 241
2152 3300037853 Ga0436364_1464285 Ga0436364_1464285_2266_3048 241
2153 3300042876 Ga0451577_0005415 Ga0451577_0005415_4570_5352 241
2154 3300044683 Ga0466965_0074602 Ga0466965_0074602_72_854 241
2155 3300044712 Ga0453684_0112257 Ga0453684_0112257_1235_2065 241
2156 3300045051 Ga0451576_0006768 Ga0451576_0006768_2969_3751 241
2157 3300045051 Ga0451576_1163281 Ga0451576_1163281_10_792 241
2158 3300046455 Ga0495603_0042012 Ga0495603_0042012_1727_2521 241
2159 3300046457 Ga0495590_0000190 Ga0495590_0000190_27260_28054 241
2160 3300046471 Ga0495650_0006516 Ga0495650_0006516_27_821 241
2161 3300046475 Ga0495639_0191586 Ga0495639_0191586_77_859 241
2162 3300046476 Ga0495662_0057716 Ga0495662_0057716_137_919 241
2163 3300046491 Ga0495584_0022836 Ga0495584_0022836_1638_2432 241
2164 3300046492 Ga0495585_0015617 Ga0495585_0015617_2136_2930 241
2165 3300046492 Ga0495585_0049467 Ga0495585_0049467_186_980 241
2166 3300046499 Ga0495594_0224765 Ga0495594_0224765_175_969 241
2167 3300046512 Ga0495610_0004841 Ga0495610_0004841_5454_6248 241
2168 3300046512 Ga0495610_0016000 Ga0495610_0016000_2333_3127 241
2169 3300046518 Ga0495631_0061136 Ga0495631_0061136_445_1239 241
2170 3300046520 Ga0495637_0004319 Ga0495637_0004319_55_849 241
2171 3300046522 Ga0495643_0000838 Ga0495643_0000838_7455_8249 241
2172 3300046522 Ga0495643_0002366 Ga0495643_0002366_8123_8917 241
2173 3300046530 Ga0495654_0000015 Ga0495654_0000015_61506_62300 241
2174 3300046542 Ga0495597_0001493 Ga0495597_0001493_8188_8982 241
2175 3300046542 Ga0495597_0002271 Ga0495597_0002271_7405_8199 241
2176 3300046557 Ga0495622_0001209 Ga0495622_0001209_11675_12490 241
2177 3300046558 Ga0495633_0000639 Ga0495633_0000639_23585_24379 241
2178 3300046558 Ga0495633_0018419 Ga0495633_0018419_1970_2764 241
2179 3300046616 Ga0495668_0000372 Ga0495668_0000372_6529_7323 241
2180 3300046648 Ga0495611_0105816 Ga0495611_0105816_438_1232 241
2181 3300046660 Ga0495625_0027204 Ga0495625_0027204_2575_3369 241
2182 3300046660 Ga0495625_0040824 Ga0495625_0040824_2020_2814 241
2183 3300046663 Ga0495635_0054994 Ga0495635_0054994_92_874 241
2184 3300046683 Ga0495658_0012539 Ga0495658_0012539_746_1528 241
2185 3300046810 Ga0495660_0018054 Ga0495660_0018054_803_1597 241
2186 3300047318 Ga0495636_0001337 Ga0495636_0001337_968_1762 241
2187 3300047320 Ga0495672_0002894 Ga0495672_0002894_6453_7247 241
2188 3300047443 Ga0495687_013572 Ga0495687_013572_1350_2144 241
2189 3300048904 Ga0496101_0135884 Ga0496101_0135884_1068_1856 241
2190 3300048905 Ga0496102_0369493 Ga0496102_0369493_91_873 241
2191 3300048905 Ga0496102_0464125 Ga0496102_0464125_12_794 241
2192 3300048906 Ga0496103_0005533 Ga0496103_0005533_156_950 241
2193 3300048907 Ga0496104_0133450 Ga0496104_0133450_1511_2293 241
2194 3300048907 Ga0496104_0342599 Ga0496104_0342599_411_1199 241
2195 3300048909 Ga0496106_0023503 Ga0496106_0023503_3596_4411 241
2196 3300048910 Ga0496107_0011603 Ga0496107_0011603_3954_4769 241
2197 3300048911 Ga0496108_0019783 Ga0496108_0019783_3403_4185 241
2198 3300048912 Ga0496109_0083069 Ga0496109_0083069_1630_2412 241
2199 3300048916 Ga0496113_0042149 Ga0496113_0042149_959_1741 241
2200 3300048917 Ga0496114_0322026 Ga0496114_0322026_492_1280 241
2201 3300048924 Ga0496121_0203898 Ga0496121_0203898_560_1342 241
2202 3300048925 Ga0496122_0040101 Ga0496122_0040101_803_1591 241
2203 3300048927 Ga0496124_0260886 Ga0496124_0260886_455_1249 241
2204 3300049459 Ga0495678_003719 Ga0495678_003719_6418_7212 241
2205 3300049667 Ga0501230_003820 Ga0501230_003820_1008_1790 241
2206 3300050511 nmdc:mga08y16_76_c1 nmdc:mga08y16_76_c1_37982_38764 241
2207 3300050511 nmdc:mga08y16_9603_c1 nmdc:mga08y16_9603_c1_3710_4525 241
2208 3300050515 nmdc:mga0a205_107318_c1 nmdc:mga0a205_107318_c1_153_968 241
2209 3300053118 Ga0500594_0005021 Ga0500594_0005021_2086_2880 241
2210 3300053125 Ga0500618_000179 Ga0500618_000179_48055_48849 241
2211 3300053145 Ga0500586_000479 Ga0500586_000479_5187_5981 241
2212 3300060346 Ga0587111_0000698 Ga0587111_0000698_898_1686 241
2213 iso_pu_bacteria 2643221556 2643799903 241
2214 iso_pu_bacteria 2643221645 2644253382 241
2215 iso_pu_bacteria 2643221664 2644355571 241
2216 iso_pu_bacteria 2643221684 2644474903 241
2217 iso_pu_bacteria 2738541280 2738737308 241
2218 iso_pu_bacteria 2738541300 2738841529 241
2219 iso_pu_bacteria 2738543018 2739272400 241
2220 iso_pu_bacteria 2738543030 2739341444 241
2221 iso_pu_bacteria 2842711865 2842712713 241
2222 iso_pu_bacteria 2857553236 2857557714 241
2223 iso_pu_bacteria 2857558681 2857563986 241
2224 iso_pu_bacteria 8047673197 8047673300 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

60

213

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

66

212

0.9

PF08659

KR

KR domain

60

241

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

205

290

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wmb-assembly1.cif.gz_A crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase 0.9452 1 241
1wmb-assembly1.cif.gz_A crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase 0.9414 1 241
2ztv-assembly1.cif.gz_C the binary complex of d-3-hydroxybutyrate dehydrogenase with nad+ 0.9249 1 241
2ztv-assembly1.cif.gz_C the binary complex of d-3-hydroxybutyrate dehydrogenase with nad+ 0.9211 1 241
5b4t-assembly1.cif.gz_A crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with nad+ and a substrate d-3-hydroxybutyrate 0.9153 1 241
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9224 2 140 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9092 2 82 3.40.50.720
af_Q4CR34_41_280_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8892 5 140 3.40.50.720
af_A0A0P0WVK1_53_257_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8886 7 143 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8876 1 146 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2X3E2L3-F1-model_v4 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) 0.9607 2 139 GO:0003858
GO:0008667
GO:0019290
AF-A0A0B7J3D6-F1-model_v4 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) 0.9546 3 119 GO:0003858
AF-A0A7Y1ZER1-F1-model_v4 SDR family oxidoreductase 0.9471 2 137 GO:0008667
GO:0019290
AF-A0A382PX81-F1-model_v4 SDR family oxidoreductase 0.9422 2 140 GO:0016616
AF-A0A3D4A6D1-F1-model_v4 Ketoacyl reductase 0.9393 2 140 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
88.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map