F496435

General Info

Members Datasets Scaffolds Average Seq Length
2123 821 1833 296

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0052242|Ga0316574_0052242_865_1737
Length 290
Sequence MSILINSNTKVICQGFTGNQGTFHSQQALDYGTRMVGGVTPGKGGQSHLGLPVFDTVADAVAETGADASVIYVPPAFAADAILEAADAGVRVIVAITEGIPVQDMMTVKAVIQGKPGTWLIGPNCPGIITPGECKIGIMPGQIHSKGRVGVVSRSGTLTYEAVYQTTLAGLGQSTCIGIGGDPLQGTNFIDVLEEFQQDEETEGIIMVGEIGGSAEEDAAAFIAEHVTKPVVAYIAGVTAPPGKRMGHAGAIIAGGKGTAEAKFEALEAAGVTTVRSPADLGSAILKRLQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
7 2511231004 Pseudomonas sp. GM102 Isolate Nodule
8 2511231006 Pseudomonas sp. GM17 Isolate Nodule
9 2511231007 Pseudomonas sp. GM18 Isolate Nodule
10 2511231008 Pseudomonas sp. GM21 Isolate Nodule
11 2511231010 Pseudomonas sp. GM25 Isolate Nodule
12 2511231011 Pseudomonas sp. GM30 Isolate Nodule
13 2511231012 Pseudomonas sp. GM33 Isolate Nodule
14 2511231014 Pseudomonas sp. GM48 Isolate Nodule
15 2511231015 Pseudomonas sp. GM49 Isolate Nodule
16 2511231016 Pseudomonas sp. GM50 Isolate Nodule
17 2511231017 Pseudomonas sp. GM55 Isolate Nodule
18 2511231018 Pseudomonas sp. GM60 Isolate Nodule
19 2511231019 Pseudomonas sp. GM67 Isolate Nodule
20 2511231020 Pseudomonas sp. GM74 Isolate Nodule
21 2511231021 Pseudomonas sp. GM78 Isolate Nodule
22 2511231022 Pseudomonas sp. GM79 Isolate Nodule
23 2511231023 Pseudomonas sp. GM80 Isolate Nodule
24 2511231024 Pseudomonas sp. GM84 Isolate Nodule
25 2511231031 Pseudomonas sp. GM16 Isolate Nodule
26 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
27 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
28 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
29 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
30 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
31 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
32 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
33 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
34 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
35 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
36 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
37 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
38 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
39 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
40 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
41 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
42 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
43 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
44 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
45 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
46 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
47 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
48 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
49 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
50 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
51 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
52 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
53 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
54 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
55 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
56 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
57 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
58 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
59 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
60 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
61 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
62 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
63 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
64 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
65 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
66 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
67 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
68 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
69 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
70 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
71 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
72 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
73 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
74 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
75 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
76 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
77 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
78 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
79 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
80 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
81 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
82 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
83 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
84 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
85 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
86 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
87 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
88 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
89 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
90 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
91 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
92 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
93 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
94 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
95 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
96 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
97 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
98 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
99 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
100 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
101 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
102 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
103 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
104 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
105 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
106 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
107 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
108 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
109 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
110 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
111 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
112 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
113 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
114 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
115 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
116 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
117 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
118 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
119 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
120 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
121 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
122 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
123 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
124 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
125 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
126 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
127 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
128 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
129 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
130 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
131 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
132 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
133 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
134 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
135 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
136 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
137 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
138 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
139 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
140 2765235841 Pseudomonas putida AA7 Isolate Unclassified
141 2773857670 Pseudomonas sp. 478 Isolate Unclassified
142 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
143 2773857673 Pseudomonas sp. 443 Isolate Unclassified
144 2784132063 Pseudomonas sp. 424 Isolate Unclassified
145 2784132072 Pseudomonas sp. 460 Isolate Unclassified
146 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
147 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
148 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
149 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
150 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
151 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
152 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
153 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
154 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
155 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
156 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
157 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
158 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
159 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
160 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
161 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
162 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
163 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
164 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
165 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
166 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
167 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
168 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
169 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
170 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
171 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
172 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
173 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
174 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
175 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
176 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
177 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
178 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
179 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
180 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
181 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
182 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
183 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
184 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
185 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
186 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
187 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
188 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
189 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
190 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
191 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
192 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
193 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
194 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
195 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
196 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
197 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
198 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
199 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
200 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
201 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
202 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
203 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
204 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
205 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
206 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
207 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
208 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
209 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
210 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
211 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
212 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
213 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
214 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
215 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
216 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
217 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
218 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
219 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
220 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
221 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
222 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
223 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
224 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
225 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
226 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
227 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
228 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
229 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
230 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
231 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
232 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
233 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
234 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
235 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
236 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
237 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
238 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
239 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
240 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
241 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
242 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
243 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
244 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
245 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
246 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
247 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
248 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
249 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
250 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
251 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
252 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
253 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
254 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
255 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
256 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
257 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
258 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
259 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
260 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
261 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
262 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
263 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
264 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
265 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
266 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
267 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
268 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
269 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
270 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
271 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
272 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
273 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
274 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
275 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
276 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
277 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
278 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
279 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
280 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
281 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
282 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
283 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
284 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
285 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
286 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
287 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
288 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
289 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
290 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
291 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
292 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
293 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
294 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
295 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
296 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
297 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
298 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
299 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
300 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
301 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
302 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
303 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
304 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
305 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
306 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
307 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
308 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
309 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
310 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
311 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
312 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
313 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
314 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
315 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
316 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
317 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
318 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
319 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
320 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
321 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
322 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
323 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
324 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
325 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
326 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
327 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
328 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
329 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
330 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
331 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
332 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
333 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
334 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
335 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
336 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
337 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
338 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
339 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
340 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
341 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
342 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
343 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
344 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
345 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
346 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
347 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
348 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
349 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
350 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
351 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
352 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
353 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
354 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
355 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
356 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
357 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
358 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
359 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
360 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
361 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
362 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
363 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
364 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
365 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
366 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
367 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
368 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
369 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
370 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
371 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
372 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
373 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
374 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
375 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
376 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
377 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
378 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
379 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
380 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
381 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
382 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
383 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
384 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
385 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
386 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
387 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
388 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
389 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
390 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
391 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
392 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
393 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
394 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
395 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
396 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
397 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
398 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
399 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
400 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
401 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
402 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
403 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
404 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
405 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
406 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
407 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
408 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
409 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
410 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
411 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
412 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
413 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
414 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
415 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
416 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
417 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
418 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
419 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
420 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
421 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
422 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
423 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
424 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
425 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
426 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
427 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
428 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
429 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
432 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
433 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
435 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
436 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
438 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
439 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
440 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
441 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
442 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
443 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
444 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
445 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
499 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
501 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
505 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
506 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
512 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
513 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
514 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
515 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
516 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
517 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
518 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
519 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
520 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
521 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
522 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
523 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
527 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
528 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
529 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
530 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
531 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
532 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
533 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
534 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
535 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
536 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
537 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
538 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
539 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
540 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
541 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
542 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
543 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
544 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
545 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
546 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
547 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
548 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
549 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
550 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
551 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
552 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
553 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
554 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
555 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
556 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
557 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
558 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
559 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
560 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
561 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
562 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
563 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
564 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
565 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
566 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
567 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
568 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
569 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
570 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
571 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
572 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
573 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
574 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
575 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
577 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
579 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
581 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
582 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
583 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
584 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
585 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
586 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
587 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
588 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
589 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
590 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
591 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
592 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
593 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
594 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
595 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
596 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
597 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
598 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
599 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
600 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
601 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
602 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
603 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
604 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
605 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
606 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
607 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
608 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
609 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
610 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
611 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
612 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
613 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
614 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
615 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
616 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
617 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
618 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
619 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
620 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
621 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
622 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
623 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
624 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
625 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
626 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
627 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
628 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
629 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
630 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
631 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
632 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
633 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
634 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
635 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
636 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
637 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
638 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
639 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
640 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
641 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
642 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
643 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
644 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
645 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
646 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
647 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
648 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
649 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
650 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
651 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
652 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
653 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
654 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
655 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
656 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
657 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
658 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
659 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
660 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
661 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
662 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
663 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
664 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
665 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
666 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
667 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
668 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
669 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
670 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
671 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
672 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
673 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
674 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
675 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
676 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
677 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
678 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
679 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
680 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
681 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
682 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
683 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
684 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
685 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
686 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
687 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
688 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
689 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
690 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
691 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
692 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
693 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
694 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
695 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
696 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
697 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
698 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
699 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
700 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
701 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
702 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
703 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
704 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
705 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
706 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
707 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
708 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
709 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
710 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
711 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
712 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
713 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
714 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
715 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
716 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
717 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
719 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
721 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
722 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
723 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
724 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
727 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
728 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
729 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
730 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
731 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
732 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
733 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
734 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
735 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
736 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
737 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
738 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
739 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
740 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
741 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
742 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
743 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
744 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
745 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
746 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
747 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
748 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
749 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
750 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
751 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
752 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
753 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
754 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
755 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
756 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
757 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
758 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
759 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
760 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
761 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
762 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
763 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
764 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
765 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
766 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
767 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
768 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
769 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
770 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
771 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
772 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
773 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
774 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
775 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
776 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
777 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
778 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
779 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
780 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
781 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
782 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
783 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
784 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
785 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
786 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
787 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
788 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
789 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
790 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
791 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
792 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
793 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
794 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
795 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
796 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
797 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
798 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
799 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
800 8052494512 Pseudomonas putida LD6 Isolate Unclassified
801 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
802 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
803 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
804 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
805 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
806 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
807 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
808 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
809 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
810 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
811 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
812 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
813 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
814 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
815 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
816 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
817 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
818 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
819 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
820 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
821 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.77
Metatranscriptomes 0.57
Isolates 13.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 4.19
Nodule 2.07
Rhizoplane 5.46
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5843 2010549000 Bacteria 2730
2 SwRhRL2b_contig_220770 2162886007 Bacteria 5485
3 SwRhRL2b_contig_2411953 2162886007 Bacteria 1295
4 SwRhRL2b_contig_330100 2162886007 Bacteria 2021
5 JGI25162J39368_1000003 3300002737 Bacteria 575218
6 JGI25162J39368_1000364 3300002737 Bacteria 38678
7 JGI25162J39368_1000384 3300002737 Bacteria 37541
8 JGI25154J39366_1002802 3300002738 Bacteria 4150
9 JGI25163J39215_1000007 3300002771 Bacteria 113612
10 JGI25164J39214_1000014 3300002772 Bacteria 219691
11 JGI25164J39214_1000268 3300002772 Bacteria 38678
12 JGI25164J39214_1000481 3300002772 Bacteria 19689
13 JGI25152J39213_1000329 3300002773 Bacteria 30338
14 JGI25406J46586_10020167 3300003203 Bacteria 2701
15 JGI25165J46597_1000483 3300003214 Bacteria 38678
16 JGI25165J46597_1000497 3300003214 Bacteria 37887
17 rootH2_10254950 3300003320 Bacteria 2398
18 rootH1_10031238 3300003323 Bacteria 14566
19 Ga0055538_1000005 3300003751 Bacteria 575218
20 Ga0055538_1000058 3300003751 Bacteria 112867
21 Ga0055539_1000007 3300003752 Bacteria 575218
22 Ga0055539_1000087 3300003752 Bacteria 114745
23 Ga0055533_1000009 3300003756 Bacteria 575218
24 Ga0055533_1000097 3300003756 Bacteria 112844
25 Ga0055532_1000156 3300003758 Bacteria 60124
26 Ga0055532_1000799 3300003758 Bacteria 10891
27 Ga0055525_1000010 3300003759 Bacteria 575218
28 Ga0055525_1000426 3300003759 Bacteria 25067
29 Ga0055535_1004882 3300003761 Bacteria 3107
30 Ga0055534_1003384 3300003784 Bacteria 5027
31 Ga0055531_10002458 3300003794 Bacteria 12384
32 Ga0055541_1000005 3300003841 Bacteria 575218
33 Ga0055541_1000060 3300003841 Bacteria 112630
34 Ga0058692_1000074 3300003856 Bacteria 75738
35 Ga0058692_1001225 3300003856 Bacteria 9827
36 Ga0058692_1003481 3300003856 Bacteria 4853
37 Ga0058692_1003490 3300003856 Bacteria 4847
38 Ga0058692_1005649 3300003856 Bacteria 3541
39 Ga0058692_1033575 3300003856 Bacteria 949
40 Ga0065714_10000071 3300005288 Bacteria 15580
41 Ga0065704_10000980 3300005289 Bacteria 21348
42 Ga0065704_10001655 3300005289 Bacteria 7308
43 Ga0065704_10092028 3300005289 Bacteria 2679
44 Ga0065704_10158697 3300005289 Bacteria 1352
45 Ga0065712_10000132 3300005290 Bacteria 73390
46 Ga0065712_10000707 3300005290 Bacteria 9696
47 Ga0065712_10009919 3300005290 Bacteria 3121
48 Ga0065712_10102479 3300005290 Bacteria 2008
49 Ga0065715_10001398 3300005293 Bacteria 12739
50 Ga0065715_10030977 3300005293 Bacteria 4169
51 Ga0065707_10082570 3300005295 Bacteria 13687
52 Ga0065707_10095160 3300005295 Bacteria 3410
53 Ga0065707_10098547 3300005295 Bacteria 3076
54 Ga0070676_10068134 3300005328 Bacteria 2130
55 Ga0070683_100002355 3300005329 Bacteria 15004
56 Ga0070690_100023708 3300005330 Bacteria 3767
57 Ga0070690_100051198 3300005330 Bacteria 2635
58 Ga0070670_100000018 3300005331 Bacteria 221691
59 Ga0070670_100001613 3300005331 Bacteria 18235
60 Ga0070670_100018813 3300005331 Bacteria 5922
61 Ga0070670_100055532 3300005331 Bacteria 3399
62 Ga0070677_10040300 3300005333 Bacteria 1837
63 Ga0068869_100090143 3300005334 Bacteria 2304
64 Ga0068869_100107006 3300005334 Bacteria 2123
65 Ga0068869_100197484 3300005334 Bacteria 1585
66 Ga0070666_10004092 3300005335 Bacteria 8856
67 Ga0070666_10006795 3300005335 Bacteria 7047
68 Ga0070666_10056938 3300005335 Bacteria 2641
69 Ga0070666_10104930 3300005335 Bacteria 1951
70 Ga0070680_100044281 3300005336 Bacteria 3616
71 Ga0070680_100119426 3300005336 Bacteria 2200
72 Ga0070680_100166346 3300005336 Bacteria 1854
73 Ga0070680_100207860 3300005336 Bacteria 1651
74 Ga0070680_100258712 3300005336 Bacteria 1472
75 Ga0070682_100024937 3300005337 Bacteria 3565
76 Ga0070682_100044555 3300005337 Bacteria 2747
77 Ga0070682_100106763 3300005337 Bacteria 1859
78 Ga0068868_100003500 3300005338 Bacteria 10932
79 Ga0068868_100005153 3300005338 Bacteria 9173
80 Ga0068868_100059471 3300005338 Bacteria 3022
81 Ga0068868_100118281 3300005338 Bacteria 2160
82 Ga0070660_100231370 3300005339 Bacteria 1504
83 Ga0070689_100011354 3300005340 Bacteria 6378
84 Ga0070689_100032368 3300005340 Bacteria 3976
85 Ga0070689_100064284 3300005340 Bacteria 2856
86 Ga0070689_100335404 3300005340 Bacteria 1266
87 Ga0070691_10030253 3300005341 Bacteria 2536
88 Ga0070691_10045594 3300005341 Bacteria 2081
89 Ga0070687_100058056 3300005343 Bacteria 2031
90 Ga0070661_100000029 3300005344 Bacteria 117682
91 Ga0070661_100005120 3300005344 Bacteria 9035
92 Ga0070692_10036729 3300005345 Bacteria 2487
93 Ga0070668_100001171 3300005347 Bacteria 18549
94 Ga0070668_100009230 3300005347 Bacteria 7314
95 Ga0070668_100196877 3300005347 Bacteria 1653
96 Ga0070668_100306398 3300005347 Bacteria 1333
97 Ga0070669_100156921 3300005353 Bacteria 1765
98 Ga0070669_100290882 3300005353 Bacteria 1311
99 Ga0070675_100001181 3300005354 Bacteria 18965
100 Ga0070675_100045618 3300005354 Bacteria 3587
101 Ga0070675_100114160 3300005354 Bacteria 2289
102 Ga0070675_100159693 3300005354 Bacteria 1938
103 Ga0070671_100000028 3300005355 Bacteria 113877
104 Ga0070671_100013664 3300005355 Bacteria 6548
105 Ga0070671_100031225 3300005355 Bacteria 4399
106 Ga0070671_100135833 3300005355 Bacteria 2073
107 Ga0070674_100018888 3300005356 Bacteria 4368
108 Ga0070673_100013049 3300005364 Bacteria 5732
109 Ga0070673_100025708 3300005364 Bacteria 4338
110 Ga0070688_100016981 3300005365 Bacteria 4171
111 Ga0070688_100040884 3300005365 Bacteria 2843
112 Ga0070688_100046810 3300005365 Bacteria 2680
113 Ga0070688_100077071 3300005365 Bacteria 2147
114 Ga0070688_100198668 3300005365 Bacteria 1402
115 Ga0070688_100343284 3300005365 Bacteria 1091
116 Ga0070659_100138960 3300005366 Bacteria 1977
117 Ga0070667_100000021 3300005367 Bacteria 205662
118 Ga0070667_100000665 3300005367 Bacteria 33336
119 Ga0070667_100005950 3300005367 Bacteria 10148
120 Ga0070667_100013421 3300005367 Bacteria 6771
121 Ga0070667_100054569 3300005367 Bacteria 3374
122 Ga0070667_100076374 3300005367 Bacteria 2860
123 Ga0070667_100094194 3300005367 Bacteria 2580
124 Ga0070667_100165272 3300005367 Bacteria 1951
125 Ga0070667_100235897 3300005367 Bacteria 1632
126 Ga0070667_100275829 3300005367 Bacteria 1509
127 Ga0070703_10025500 3300005406 Bacteria 1754
128 Ga0070709_10016413 3300005434 Bacteria 4227
129 Ga0070709_10301127 3300005434 Bacteria 1171
130 Ga0070714_100003443 3300005435 Bacteria 11790
131 Ga0070713_100007784 3300005436 Bacteria 7548
132 Ga0070713_100254573 3300005436 Bacteria 1603
133 Ga0070713_100455065 3300005436 Bacteria 1203
134 Ga0070701_10001019 3300005438 Bacteria 10211
135 Ga0070701_10004109 3300005438 Bacteria 5843
136 Ga0070701_10209222 3300005438 Bacteria 1157
137 Ga0070711_100004071 3300005439 Bacteria 8595
138 Ga0070711_100091851 3300005439 Bacteria 2189
139 Ga0070705_100038163 3300005440 Bacteria 2716
140 Ga0070700_100059584 3300005441 Bacteria 2404
141 Ga0070694_100036733 3300005444 Bacteria 3246
142 Ga0070694_100178536 3300005444 Bacteria 1569
143 Ga0070708_100006903 3300005445 Bacteria 9059
144 Ga0070708_100052434 3300005445 Bacteria 3617
145 Ga0070708_100142572 3300005445 Bacteria 2223
146 Ga0070663_100001828 3300005455 Bacteria 11851
147 Ga0070662_100003755 3300005457 Bacteria 9504
148 Ga0070662_100013156 3300005457 Bacteria 5499
149 Ga0070662_100026746 3300005457 Bacteria 3998
150 Ga0070662_100027185 3300005457 Bacteria 3969
151 Ga0070662_100052942 3300005457 Bacteria 2937
152 Ga0070662_100281095 3300005457 Bacteria 1347
153 Ga0070681_10004193 3300005458 Bacteria 13657
154 Ga0070681_10011595 3300005458 Bacteria 8725
155 Ga0070681_10018006 3300005458 Bacteria 7057
156 Ga0070681_10030666 3300005458 Bacteria 5396
157 Ga0070681_10050395 3300005458 Bacteria 4154
158 Ga0070681_10069003 3300005458 Bacteria 3502
159 Ga0070681_10098337 3300005458 Bacteria 2872
160 Ga0068867_100071748 3300005459 Bacteria 2591
161 Ga0068867_100094382 3300005459 Bacteria 2275
162 Ga0068867_100144024 3300005459 Bacteria 1865
163 Ga0070685_10000003 3300005466 Bacteria 283138
164 Ga0070685_10018111 3300005466 Bacteria 3783
165 Ga0070685_10061864 3300005466 Bacteria 2194
166 Ga0070685_10078226 3300005466 Bacteria 1977
167 Ga0070685_10163736 3300005466 Bacteria 1420
168 Ga0070706_100000750 3300005467 Bacteria 36395
169 Ga0070706_100241546 3300005467 Bacteria 1686
170 Ga0070707_100086913 3300005468 Bacteria 3024
171 Ga0070698_100008074 3300005471 Bacteria 11384
172 Ga0070698_100023722 3300005471 Bacteria 6409
173 Ga0070698_100042856 3300005471 Bacteria 4642
174 Ga0070698_100158917 3300005471 Unclassified 2205
175 Ga0070699_100040785 3300005518 Bacteria 4018
176 Ga0070699_100177203 3300005518 Bacteria 1891
177 Ga0070679_100007495 3300005530 Bacteria 10206
178 Ga0070679_100015491 3300005530 Bacteria 7327
179 Ga0070679_100026045 3300005530 Bacteria 5740
180 Ga0070679_100027585 3300005530 Bacteria 5590
181 Ga0070679_100033927 3300005530 Bacteria 5056
182 Ga0070679_100047565 3300005530 Bacteria 4274
183 Ga0070679_100081041 3300005530 Bacteria 3235
184 Ga0070684_100024689 3300005535 Bacteria 5044
185 Ga0070684_100051366 3300005535 Bacteria 3581
186 Ga0070684_100066313 3300005535 Bacteria 3169
187 Ga0070684_100328202 3300005535 Bacteria 1406
188 Ga0070697_100001347 3300005536 Bacteria 18591
189 Ga0070697_100078078 3300005536 Bacteria 2724
190 Ga0070697_100147712 3300005536 Bacteria 1980
191 Ga0068853_100227019 3300005539 Bacteria 1707
192 Ga0070672_100022380 3300005543 Bacteria 4642
193 Ga0070672_100056355 3300005543 Bacteria 3082
194 Ga0070672_100061103 3300005543 Bacteria 2969
195 Ga0070672_100093373 3300005543 Bacteria 2430
196 Ga0070672_100330483 3300005543 Bacteria 1297
197 Ga0070686_100055456 3300005544 Bacteria 2539
198 Ga0070695_100086657 3300005545 Bacteria 2081
199 Ga0070695_100133847 3300005545 Bacteria 1711
200 Ga0070695_100207421 3300005545 Bacteria 1404
201 Ga0070696_100007274 3300005546 Bacteria 7389
202 Ga0070696_100007748 3300005546 Bacteria 7164
203 Ga0070696_100031639 3300005546 Bacteria 3627
204 Ga0070696_100104534 3300005546 Bacteria 2033
205 Ga0070665_100000055 3300005548 Bacteria 242706
206 Ga0070665_100000199 3300005548 Bacteria 105924
207 Ga0070665_100003307 3300005548 Bacteria 17265
208 Ga0070665_100006847 3300005548 Bacteria 11590
209 Ga0070665_100007398 3300005548 Bacteria 11171
210 Ga0070665_100038480 3300005548 Bacteria 4808
211 Ga0070665_100064924 3300005548 Bacteria 3662
212 Ga0070665_100169888 3300005548 Bacteria 2182
213 Ga0070665_100424294 3300005548 Bacteria 1339
214 Ga0070704_100034947 3300005549 Bacteria 3413
215 Ga0070704_100074144 3300005549 Bacteria 2481
216 Ga0070704_100146967 3300005549 Bacteria 1848
217 Ga0070704_100179133 3300005549 Bacteria 1694
218 Ga0070704_100182003 3300005549 Bacteria 1682
219 Ga0070704_100309266 3300005549 Bacteria 1320
220 Ga0070704_100365522 3300005549 Bacteria 1222
221 Ga0068855_100001292 3300005563 Bacteria 31028
222 Ga0068855_100014602 3300005563 Bacteria 9459
223 Ga0068855_100024485 3300005563 Bacteria 7221
224 Ga0068855_100152849 3300005563 Bacteria 2624
225 Ga0070664_100001158 3300005564 Bacteria 20913
226 Ga0070664_100005346 3300005564 Bacteria 10304
227 Ga0070664_100014740 3300005564 Bacteria 6383
228 Ga0070664_100035715 3300005564 Bacteria 4173
229 Ga0070664_100116544 3300005564 Bacteria 2336
230 Ga0070664_100436508 3300005564 Bacteria 1201
231 Ga0068857_100013648 3300005577 Bacteria 7078
232 Ga0068854_100010579 3300005578 Bacteria 5987
233 Ga0068854_100030055 3300005578 Bacteria 3766
234 Ga0068856_100024860 3300005614 Bacteria 5834
235 Ga0068856_100124491 3300005614 Bacteria 2581
236 Ga0070702_100019415 3300005615 Bacteria 3545
237 Ga0070702_100118115 3300005615 Bacteria 1656
238 Ga0068852_100093903 3300005616 Bacteria 2690
239 Ga0068852_100506301 3300005616 Bacteria 1203
240 Ga0068859_100001116 3300005617 Bacteria 27403
241 Ga0068859_100006340 3300005617 Bacteria 11999
242 Ga0068859_100008989 3300005617 Bacteria 10091
243 Ga0068859_100015388 3300005617 Bacteria 7685
244 Ga0068859_100029889 3300005617 Bacteria 5466
245 Ga0068859_100075395 3300005617 Bacteria 3413
246 Ga0068859_100130601 3300005617 Bacteria 2583
247 Ga0068859_100167825 3300005617 Bacteria 2275
248 Ga0068864_100000002 3300005618 Bacteria 658857
249 Ga0068864_100008455 3300005618 Bacteria 8494
250 Ga0068864_100009661 3300005618 Bacteria 7958
251 Ga0068864_100041187 3300005618 Bacteria 3951
252 Ga0068864_100088533 3300005618 Bacteria 2727
253 Ga0068864_100134158 3300005618 Bacteria 2228
254 Ga0068864_100182202 3300005618 Bacteria 1921
255 Ga0068866_10073144 3300005718 Bacteria 1818
256 Ga0068866_10268261 3300005718 Bacteria 1052
257 Ga0068861_100013498 3300005719 Bacteria 5718
258 Ga0068861_100026888 3300005719 Bacteria 4187
259 Ga0068861_100035468 3300005719 Bacteria 3695
260 Ga0068861_100061160 3300005719 Bacteria 2889
261 Ga0068851_10000079 3300005834 Bacteria 54347
262 Ga0068870_10086934 3300005840 Bacteria 1740
263 Ga0068863_100007089 3300005841 Bacteria 10989
264 Ga0068863_100023075 3300005841 Bacteria 5945
265 Ga0068863_100024281 3300005841 Bacteria 5781
266 Ga0068863_100041896 3300005841 Bacteria 4352
267 Ga0068863_100072138 3300005841 Bacteria 3267
268 Ga0068863_100078989 3300005841 Bacteria 3116
269 Ga0068863_100086615 3300005841 Bacteria 2968
270 Ga0068863_100121459 3300005841 Bacteria 2491
271 Ga0068863_100133426 3300005841 Bacteria 2372
272 Ga0068863_100609045 3300005841 Bacteria 1081
273 Ga0068858_100006053 3300005842 Bacteria 11790
274 Ga0068858_100010397 3300005842 Bacteria 8818
275 Ga0068858_100022875 3300005842 Bacteria 5830
276 Ga0068858_100092045 3300005842 Bacteria 2822
277 Ga0068860_100000913 3300005843 Bacteria 32780
278 Ga0068860_100001060 3300005843 Bacteria 30341
279 Ga0068860_100001620 3300005843 Bacteria 24158
280 Ga0068860_100013404 3300005843 Bacteria 8039
281 Ga0068860_100025962 3300005843 Bacteria 5651
282 Ga0068860_100088967 3300005843 Bacteria 2939
283 Ga0068860_100344781 3300005843 Bacteria 1465
284 Ga0068862_100001883 3300005844 Bacteria 19024
285 Ga0068862_100001983 3300005844 Bacteria 18568
286 Ga0068862_100009858 3300005844 Bacteria 7889
287 Ga0068862_100012237 3300005844 Bacteria 7093
288 Ga0068862_100025109 3300005844 Bacteria 5003
289 Ga0068862_100027094 3300005844 Bacteria 4822
290 Ga0068862_100037749 3300005844 Bacteria 4095
291 Ga0081455_10001835 3300005937 Bacteria 25601
292 Ga0081455_10003741 3300005937 Bacteria 17388
293 Ga0081455_10010409 3300005937 Bacteria 9444
294 Ga0081538_10004527 3300005981 Bacteria 12800
295 Ga0081539_10000006 3300005985 Bacteria 534555
296 Ga0070717_10070788 3300006028 Bacteria 2907
297 Ga0075365_10116355 3300006038 Bacteria 1841
298 Ga0075364_10004581 3300006051 Bacteria 7960
299 Ga0075364_10008858 3300006051 Bacteria 6024
300 Ga0075364_10034264 3300006051 Bacteria 3274
301 Ga0075364_10034360 3300006051 Bacteria 3270
302 Ga0075364_10397360 3300006051 Bacteria 940
303 Ga0070715_10028423 3300006163 Bacteria 2243
304 Ga0070716_100037355 3300006173 Bacteria 2684
305 Ga0070716_100107674 3300006173 Bacteria 1721
306 Ga0070716_100204481 3300006173 Bacteria 1315
307 Ga0070712_100524001 3300006175 Bacteria 996
308 Ga0075362_10000010 3300006177 Bacteria 109823
309 Ga0075427_10002554 3300006194 Bacteria 2453
310 Ga0075366_10039108 3300006195 Bacteria 2803
311 Ga0097621_100033047 3300006237 Bacteria 4117
312 Ga0097621_100438876 3300006237 Bacteria 1174
313 Ga0068871_100014457 3300006358 Bacteria 5888
314 Ga0068871_100015759 3300006358 Bacteria 5670
315 Ga0068871_100053569 3300006358 Bacteria 3270
316 Ga0068871_100062819 3300006358 Bacteria 3036
317 Ga0068871_100158841 3300006358 Bacteria 1932
318 Ga0068871_100170513 3300006358 Bacteria 1865
319 Ga0075428_100007229 3300006844 Bacteria 12298
320 Ga0075428_100020542 3300006844 Bacteria 7312
321 Ga0075428_100024967 3300006844 Bacteria 6612
322 Ga0075428_100044435 3300006844 Bacteria 4882
323 Ga0075428_100058386 3300006844 Bacteria 4224
324 Ga0075428_100075140 3300006844 Bacteria 3691
325 Ga0075428_100077608 3300006844 Bacteria 3626
326 Ga0075430_100001101 3300006846 Bacteria 21485
327 Ga0075430_100114221 3300006846 Bacteria 2250
328 Ga0075430_100161882 3300006846 Bacteria 1863
329 Ga0075430_100335149 3300006846 Bacteria 1250
330 Ga0075430_100420585 3300006846 Bacteria 1103
331 Ga0075431_100000101 3300006847 Bacteria 53683
332 Ga0075431_100018092 3300006847 Bacteria 7167
333 Ga0075431_100099330 3300006847 Bacteria 3004
334 Ga0075431_100211379 3300006847 Bacteria 1981
335 Ga0075433_10042202 3300006852 Bacteria 3957
336 Ga0075433_10080481 3300006852 Bacteria 2872
337 Ga0075433_10087637 3300006852 Bacteria 2749
338 Ga0075433_10116553 3300006852 Bacteria 2370
339 Ga0075433_10474794 3300006852 Bacteria 1102
340 Ga0075434_100003072 3300006871 Bacteria 14862
341 Ga0075434_100063615 3300006871 Bacteria 3672
342 Ga0075434_100217930 3300006871 Bacteria 1928
343 Ga0075429_100005444 3300006880 Bacteria 10966
344 Ga0075429_100005700 3300006880 Bacteria 10743
345 Ga0075429_100019349 3300006880 Bacteria 5897
346 Ga0075429_100287461 3300006880 Bacteria 1439
347 Ga0068865_100047460 3300006881 Bacteria 2951
348 Ga0068865_100299255 3300006881 Bacteria 1287
349 Ga0097620_100001116 3300006931 Bacteria 27403
350 Ga0097620_100006340 3300006931 Bacteria 11999
351 Ga0097620_100008989 3300006931 Bacteria 10091
352 Ga0097620_100015387 3300006931 Bacteria 7685
353 Ga0097620_100029889 3300006931 Bacteria 5466
354 Ga0097620_100075396 3300006931 Bacteria 3413
355 Ga0097620_100130609 3300006931 Bacteria 2583
356 Ga0097620_100167828 3300006931 Bacteria 2275
357 Ga0079104_1000197 3300006946 Bacteria 84824
358 Ga0079104_1000514 3300006946 Bacteria 41464
359 Ga0079104_1001292 3300006946 Bacteria 17270
360 Ga0079104_1002448 3300006946 Bacteria 10011
361 Ga0079104_1002512 3300006946 Bacteria 9750
362 Ga0079104_1003341 3300006946 Bacteria 7567
363 Ga0079104_1003369 3300006946 Bacteria 7496
364 Ga0079104_1003437 3300006946 Bacteria 7372
365 Ga0079104_1006151 3300006946 Bacteria 4618
366 Ga0079104_1025987 3300006946 Bacteria 1519
367 Ga0099826_10035887 3300006948 Bacteria 3517
368 Ga0075435_100018350 3300007076 Bacteria 5318
369 Ga0099794_10148695 3300007265 Bacteria 1189
370 Ga0099795_10000006 3300007788 Bacteria 107533
371 Ga0099795_10104419 3300007788 Bacteria 1115
372 Ga0105251_10000018 3300009011 Bacteria 142493
373 Ga0105251_10001518 3300009011 Bacteria 19945
374 Ga0105251_10002086 3300009011 Bacteria 16151
375 Ga0105251_10005905 3300009011 Bacteria 7915
376 Ga0105251_10007115 3300009011 Bacteria 6966
377 Ga0105251_10007555 3300009011 Bacteria 6674
378 Ga0105251_10009232 3300009011 Bacteria 5846
379 Ga0105251_10011339 3300009011 Bacteria 5097
380 Ga0105251_10020583 3300009011 Bacteria 3463
381 Ga0105251_10024146 3300009011 Bacteria 3125
382 Ga0105251_10032773 3300009011 Bacteria 2586
383 Ga0105251_10045138 3300009011 Bacteria 2125
384 Ga0105251_10075660 3300009011 Bacteria 1563
385 Ga0105251_10195880 3300009011 Bacteria 910
386 Ga0105244_10000006 3300009036 Bacteria 357997
387 Ga0105244_10000130 3300009036 Bacteria 76817
388 Ga0105244_10000194 3300009036 Bacteria 61396
389 Ga0105244_10003732 3300009036 Bacteria 10747
390 Ga0105244_10004174 3300009036 Bacteria 10051
391 Ga0105244_10005825 3300009036 Bacteria 8098
392 Ga0105244_10009715 3300009036 Bacteria 5885
393 Ga0105244_10012013 3300009036 Bacteria 5149
394 Ga0105244_10016547 3300009036 Bacteria 4198
395 Ga0105244_10151854 3300009036 Bacteria 1109
396 Ga0105250_10000008 3300009092 Bacteria 343965
397 Ga0105250_10000463 3300009092 Bacteria 29167
398 Ga0105250_10000861 3300009092 Bacteria 17902
399 Ga0105250_10000873 3300009092 Bacteria 17814
400 Ga0105250_10004078 3300009092 Bacteria 6791
401 Ga0105250_10004971 3300009092 Bacteria 6030
402 Ga0105250_10092131 3300009092 Bacteria 1233
403 Ga0105240_10004177 3300009093 Bacteria 22131
404 Ga0105240_10010688 3300009093 Bacteria 12882
405 Ga0105240_10017463 3300009093 Bacteria 9668
406 Ga0105240_10019484 3300009093 Bacteria 9063
407 Ga0105240_10053987 3300009093 Bacteria 5039
408 Ga0105240_10066598 3300009093 Bacteria 4467
409 Ga0105240_10119421 3300009093 Bacteria 3175
410 Ga0105240_10130436 3300009093 Bacteria 3016
411 Ga0105240_10161453 3300009093 Bacteria 2661
412 Ga0105240_10168372 3300009093 Bacteria 2597
413 Ga0105240_10177955 3300009093 Bacteria 2513
414 Ga0111539_10000873 3300009094 Bacteria 39350
415 Ga0111539_10015223 3300009094 Bacteria 9584
416 Ga0111539_10026865 3300009094 Bacteria 7032
417 Ga0111539_10034721 3300009094 Bacteria 6110
418 Ga0111539_10063563 3300009094 Bacteria 4367
419 Ga0111539_10122122 3300009094 Bacteria 3052
420 Ga0111539_10231371 3300009094 Bacteria 2152
421 Ga0111539_10621530 3300009094 Bacteria 1258
422 Ga0105245_10003825 3300009098 Bacteria 13384
423 Ga0105245_10017371 3300009098 Bacteria 6276
424 Ga0105245_10033089 3300009098 Bacteria 4579
425 Ga0105245_10067489 3300009098 Bacteria 3239
426 Ga0105247_10000018 3300009101 Bacteria 259335
427 Ga0105247_10001317 3300009101 Bacteria 18139
428 Ga0105247_10010208 3300009101 Bacteria 5685
429 Ga0105247_10049766 3300009101 Bacteria 2577
430 Ga0105247_10107282 3300009101 Bacteria 1793
431 Ga0114129_10000264 3300009147 Bacteria 59324
432 Ga0114129_10012623 3300009147 Bacteria 12026
433 Ga0114129_10035673 3300009147 Bacteria 7025
434 Ga0114129_10038877 3300009147 Bacteria 6707
435 Ga0114129_10044436 3300009147 Bacteria 6250
436 Ga0114129_10067976 3300009147 Bacteria 4969
437 Ga0114129_10069188 3300009147 Bacteria 4921
438 Ga0114129_10094564 3300009147 Bacteria 4139
439 Ga0114129_10227152 3300009147 Bacteria 2515
440 Ga0114129_10431843 3300009147 Bacteria 1730
441 Ga0114129_10566196 3300009147 Bacteria 1476
442 Ga0114129_10705837 3300009147 Bacteria 1296
443 Ga0114129_11098414 3300009147 Bacteria 996
444 Ga0105243_10006636 3300009148 Bacteria 8936
445 Ga0105243_10080145 3300009148 Bacteria 2662
446 Ga0105243_10110667 3300009148 Bacteria 2297
447 Ga0105243_10174972 3300009148 Bacteria 1862
448 Ga0105243_10204350 3300009148 Bacteria 1735
449 Ga0105243_10333609 3300009148 Bacteria 1386
450 Ga0105241_10000004 3300009174 Bacteria 803007
451 Ga0105241_10046552 3300009174 Bacteria 3294
452 Ga0105242_10024883 3300009176 Bacteria 4731
453 Ga0105242_10033306 3300009176 Bacteria 4125
454 Ga0105242_10099479 3300009176 Bacteria 2462
455 Ga0105248_10011363 3300009177 Bacteria 9813
456 Ga0105248_10021417 3300009177 Bacteria 7161
457 Ga0105248_10043085 3300009177 Bacteria 5062
458 Ga0105248_10048231 3300009177 Bacteria 4777
459 Ga0105248_10104555 3300009177 Bacteria 3192
460 Ga0105248_10361166 3300009177 Bacteria 1635
461 Ga0105237_10001936 3300009545 Bacteria 26387
462 Ga0105237_10028178 3300009545 Bacteria 5724
463 Ga0105237_10035084 3300009545 Bacteria 5077
464 Ga0105237_10119866 3300009545 Bacteria 2625
465 Ga0105237_10176792 3300009545 Bacteria 2135
466 Ga0105238_10014263 3300009551 Bacteria 8033
467 Ga0105238_10016722 3300009551 Bacteria 7433
468 Ga0105238_10163540 3300009551 Bacteria 2201
469 Ga0105238_10244892 3300009551 Bacteria 1770
470 Ga0105249_10014320 3300009553 Bacteria 7013
471 Ga0105249_10022843 3300009553 Bacteria 5606
472 Ga0105249_10044777 3300009553 Bacteria 4024
473 Ga0105249_10061511 3300009553 Bacteria 3446
474 Ga0105249_10740934 3300009553 Bacteria 1044
475 Ga0099796_10000002 3300010159 Bacteria 105502
476 Ga0099796_10013635 3300010159 Bacteria 2326
477 Ga0105239_10065885 3300010375 Bacteria 3979
478 Ga0105239_10147879 3300010375 Bacteria 2621
479 Ga0105239_10155959 3300010375 Bacteria 2549
480 Ga0105239_10237857 3300010375 Bacteria 2044
481 Ga0105239_10363334 3300010375 Bacteria 1635
482 Ga0105246_10002336 3300011119 Bacteria 11452
483 Ga0105246_10007027 3300011119 Bacteria 6890
484 Ga0105246_10008602 3300011119 Bacteria 6277
485 Ga0105246_10023926 3300011119 Bacteria 3959
486 Ga0105246_10168602 3300011119 Bacteria 1675
487 Ga0157373_10000220 3300013100 Bacteria 46833
488 Ga0157373_10002523 3300013100 Bacteria 13935
489 Ga0157373_10016116 3300013100 Bacteria 5455
490 Ga0157373_10041256 3300013100 Bacteria 3301
491 Ga0157373_10109652 3300013100 Bacteria 1940
492 Ga0157373_10422161 3300013100 Bacteria 957
493 Ga0157371_10000167 3300013102 Bacteria 95585
494 Ga0157371_10001411 3300013102 Bacteria 25041
495 Ga0157371_10001794 3300013102 Bacteria 21713
496 Ga0157371_10002311 3300013102 Bacteria 18345
497 Ga0157371_10004005 3300013102 Bacteria 13051
498 Ga0157371_10011396 3300013102 Bacteria 6856
499 Ga0157371_10015658 3300013102 Bacteria 5680
500 Ga0157371_10028031 3300013102 Bacteria 4081
501 Ga0157371_10219708 3300013102 Bacteria 1365
502 Ga0157370_10000093 3300013104 Bacteria 101308
503 Ga0157370_10002533 3300013104 Bacteria 21964
504 Ga0157370_10003123 3300013104 Bacteria 19615
505 Ga0157370_10008772 3300013104 Bacteria 10869
506 Ga0157369_10001855 3300013105 Bacteria 25533
507 Ga0157369_10119966 3300013105 Bacteria 2790
508 Ga0157369_10342715 3300013105 Bacteria 1552
509 Ga0157374_10004065 3300013296 Bacteria 12286
510 Ga0157378_10018446 3300013297 Bacteria 6129
511 Ga0157378_10021740 3300013297 Bacteria 5641
512 Ga0157378_10043056 3300013297 Bacteria 4008
513 Ga0157378_10100999 3300013297 Bacteria 2634
514 Ga0157378_10133325 3300013297 Bacteria 2301
515 Ga0157378_10183549 3300013297 Bacteria 1969
516 Ga0163162_10003861 3300013306 Bacteria 14379
517 Ga0163162_10029073 3300013306 Bacteria 5469
518 Ga0163162_10036341 3300013306 Bacteria 4909
519 Ga0163162_10064722 3300013306 Bacteria 3701
520 Ga0163162_10097983 3300013306 Bacteria 3021
521 Ga0163162_10272443 3300013306 Bacteria 1824
522 Ga0163162_10574967 3300013306 Bacteria 1254
523 Ga0157372_10006015 3300013307 Bacteria 12885
524 Ga0157372_10008044 3300013307 Bacteria 11213
525 Ga0157372_10028753 3300013307 Bacteria 6067
526 Ga0157372_10030083 3300013307 Bacteria 5937
527 Ga0157372_10063042 3300013307 Bacteria 4155
528 Ga0157372_10074215 3300013307 Bacteria 3835
529 Ga0157372_10097892 3300013307 Bacteria 3346
530 Ga0157372_10158650 3300013307 Bacteria 2613
531 Ga0157372_10194389 3300013307 Bacteria 2350
532 Ga0157372_10264176 3300013307 Bacteria 1999
533 Ga0157375_10001953 3300013308 Bacteria 17778
534 Ga0157375_10009639 3300013308 Bacteria 8486
535 Ga0157375_10034765 3300013308 Bacteria 4804
536 Ga0163163_10000634 3300014325 Bacteria 30253
537 Ga0163163_10001921 3300014325 Bacteria 17599
538 Ga0163163_10008122 3300014325 Bacteria 9302
539 Ga0163163_10015222 3300014325 Bacteria 7105
540 Ga0163163_10034625 3300014325 Bacteria 4893
541 Ga0163163_10055836 3300014325 Bacteria 3903
542 Ga0163163_10098860 3300014325 Bacteria 2939
543 Ga0163163_10112282 3300014325 Bacteria 2754
544 Ga0163163_10131218 3300014325 Bacteria 2546
545 Ga0163163_10133406 3300014325 Bacteria 2524
546 Ga0157380_10001671 3300014326 Bacteria 14638
547 Ga0157380_10005298 3300014326 Bacteria 9013
548 Ga0157380_10115098 3300014326 Bacteria 2267
549 Ga0157380_10172300 3300014326 Bacteria 1892
550 Ga0157380_10514951 3300014326 Bacteria 1165
551 Ga0182008_10001742 3300014497 Bacteria 14296
552 Ga0157377_10065877 3300014745 Bacteria 2082
553 Ga0157379_10001546 3300014968 Bacteria 18913
554 Ga0157379_10008892 3300014968 Bacteria 8756
555 Ga0157379_10010746 3300014968 Bacteria 7979
556 Ga0157379_10040546 3300014968 Bacteria 4156
557 Ga0157379_10070740 3300014968 Bacteria 3122
558 Ga0157379_10106495 3300014968 Bacteria 2517
559 Ga0157379_10107019 3300014968 Bacteria 2510
560 Ga0157379_10154070 3300014968 Bacteria 2073
561 Ga0157376_10004164 3300014969 Bacteria 10027
562 Ga0157376_10436604 3300014969 Bacteria 1274
563 Ga0182006_1000063 3300015261 Bacteria 154042
564 Ga0182006_1035088 3300015261 Bacteria 2002
565 Ga0182007_10010048 3300015262 Bacteria 3765
566 Ga0183366_1001 3300015679 Bacteria 2743932
567 Ga0183370_1001 3300015680 Bacteria 2743932
568 Ga0183369_1001 3300015685 Bacteria 2743932
569 Ga0183368_1001 3300015687 Bacteria 2743932
570 Ga0163161_10000690 3300017792 Bacteria 27001
571 Ga0163161_10038164 3300017792 Bacteria 3444
572 Ga0163161_10092573 3300017792 Bacteria 2238
573 Ga0163161_10116703 3300017792 Bacteria 2001
574 Ga0163161_10375620 3300017792 Bacteria 1135
575 Ga0213874_10016012 3300021377 Bacteria 1988
576 Ga0213876_10000095 3300021384 Bacteria 99902
577 Ga0213876_10089454 3300021384 Bacteria 1631
578 Ga0213876_10168274 3300021384 Bacteria 1166
579 Ga0213875_10003220 3300021388 Bacteria 9371
580 Ga0209435_100577 3300025206 Bacteria 6872
581 Ga0209760_100001 3300025207 Bacteria 348781
582 Ga0209760_100011 3300025207 Bacteria 197221
583 Ga0209784_100001 3300025224 Bacteria 3600592
584 Ga0209784_100040 3300025224 Bacteria 231812
585 Ga0209566_100001 3300025225 Bacteria 3600765
586 Ga0209566_100051 3300025225 Bacteria 231920
587 Ga0209674_100002 3300025226 Bacteria 3600592
588 Ga0209674_100072 3300025226 Bacteria 231812
589 Ga0209147_100053 3300025229 Bacteria 267615
590 Ga0209147_100067 3300025229 Bacteria 231812
591 Ga0209563_100008 3300025230 Bacteria 1554545
592 Ga0209563_100073 3300025230 Bacteria 231920
593 Ga0207427_100001 3300025231 Bacteria 1410763
594 Ga0207427_100002 3300025231 Bacteria 1355321
595 Ga0207427_100008 3300025231 Bacteria 740731
596 Ga0209437_100003 3300025233 Bacteria 1517827
597 Ga0209437_100007 3300025233 Bacteria 938377
598 Ga0209437_100014 3300025233 Bacteria 740714
599 Ga0209437_100185 3300025233 Bacteria 126819
600 Ga0209258_100548 3300025242 Bacteria 33898
601 Ga0209646_1000537 3300025246 Bacteria 16480
602 Ga0209677_100004 3300025253 Bacteria 1554545
603 Ga0209677_100063 3300025253 Bacteria 151440
604 Ga0209129_1000015 3300025258 Bacteria 487967
605 Ga0209233_1000007 3300025261 Bacteria 1411234
606 Ga0209233_1000008 3300025261 Bacteria 1356712
607 Ga0209233_1006000 3300025261 Bacteria 3962
608 Ga0209675_1000639 3300025291 Bacteria 24900
609 Ga0209676_1000016 3300025292 Bacteria 655561
610 Ga0209676_1000021 3300025292 Bacteria 609534
611 Ga0209676_1000033 3300025292 Bacteria 463236
612 Ga0209676_1000474 3300025292 Bacteria 66391
613 Ga0209050_1000235 3300025298 Bacteria 121420
614 Ga0209050_1000477 3300025298 Bacteria 70798
615 Ga0209050_1002491 3300025298 Bacteria 15570
616 Ga0209051_1000043 3300025303 Bacteria 305473
617 Ga0209051_1000123 3300025303 Bacteria 144298
618 Ga0207656_10000210 3300025321 Bacteria 20825
619 Ga0207656_10111542 3300025321 Bacteria 1264
620 Ga0207696_1000001 3300025711 Bacteria 2579611
621 Ga0207696_1000003 3300025711 Bacteria 860639
622 Ga0207696_1000081 3300025711 Bacteria 198887
623 Ga0207696_1000152 3300025711 Bacteria 119512
624 Ga0207696_1000328 3300025711 Bacteria 50336
625 Ga0207696_1000445 3300025711 Bacteria 36874
626 Ga0207696_1000489 3300025711 Bacteria 33338
627 Ga0207696_1000546 3300025711 Bacteria 30331
628 Ga0207696_1000746 3300025711 Bacteria 21687
629 Ga0207696_1004779 3300025711 Bacteria 5758
630 Ga0207696_1005024 3300025711 Bacteria 5569
631 Ga0207696_1024054 3300025711 Bacteria 1914
632 Ga0207655_1000001 3300025728 Bacteria 1866413
633 Ga0207655_1000005 3300025728 Bacteria 917277
634 Ga0207655_1000011 3300025728 Bacteria 643321
635 Ga0207655_1000023 3300025728 Bacteria 467070
636 Ga0207655_1000032 3300025728 Bacteria 391253
637 Ga0207655_1000040 3300025728 Bacteria 335311
638 Ga0207655_1000105 3300025728 Bacteria 182927
639 Ga0207655_1000157 3300025728 Bacteria 124885
640 Ga0207655_1001462 3300025728 Bacteria 21825
641 Ga0207655_1001726 3300025728 Bacteria 19205
642 Ga0207655_1002699 3300025728 Bacteria 13913
643 Ga0207655_1003248 3300025728 Bacteria 12205
644 Ga0207655_1005181 3300025728 Bacteria 8966
645 Ga0207655_1006427 3300025728 Bacteria 7791
646 Ga0207655_1011015 3300025728 Bacteria 5426
647 Ga0207655_1012418 3300025728 Bacteria 4978
648 Ga0207655_1014455 3300025728 Bacteria 4459
649 Ga0207655_1017196 3300025728 Bacteria 3910
650 Ga0207655_1018887 3300025728 Bacteria 3633
651 Ga0207655_1021513 3300025728 Bacteria 3271
652 Ga0207713_1000001 3300025735 Bacteria 2295391
653 Ga0207713_1000006 3300025735 Bacteria 586163
654 Ga0207713_1000009 3300025735 Bacteria 551314
655 Ga0207713_1000021 3300025735 Bacteria 353108
656 Ga0207713_1000093 3300025735 Bacteria 146199
657 Ga0207713_1000205 3300025735 Bacteria 80817
658 Ga0207713_1000519 3300025735 Bacteria 38934
659 Ga0207713_1001549 3300025735 Bacteria 18078
660 Ga0207713_1006726 3300025735 Bacteria 6947
661 Ga0207713_1010050 3300025735 Bacteria 5274
662 Ga0207713_1013428 3300025735 Bacteria 4316
663 Ga0207713_1023403 3300025735 Bacteria 2907
664 Ga0207713_1025529 3300025735 Bacteria 2726
665 Ga0207713_1030955 3300025735 Bacteria 2375
666 Ga0207713_1035599 3300025735 Bacteria 2147
667 Ga0207653_10000893 3300025885 Bacteria 9908
668 Ga0207682_10067177 3300025893 Bacteria 1512
669 Ga0207692_10084768 3300025898 Bacteria 1703
670 Ga0207710_10000049 3300025900 Bacteria 186492
671 Ga0207710_10021222 3300025900 Bacteria 2781
672 Ga0207710_10028353 3300025900 Bacteria 2431
673 Ga0207710_10044932 3300025900 Bacteria 1969
674 Ga0207688_10012708 3300025901 Bacteria 4580
675 Ga0207680_10061234 3300025903 Bacteria 2295
676 Ga0207680_10145625 3300025903 Bacteria 1574
677 Ga0207680_10172452 3300025903 Bacteria 1458
678 Ga0207680_10225484 3300025903 Bacteria 1286
679 Ga0207699_10007127 3300025906 Bacteria 5452
680 Ga0207699_10267587 3300025906 Bacteria 1183
681 Ga0207645_10000798 3300025907 Bacteria 26403
682 Ga0207645_10188236 3300025907 Bacteria 1356
683 Ga0207643_10034973 3300025908 Bacteria 2816
684 Ga0207705_10216673 3300025909 Bacteria 1453
685 Ga0207684_10000041 3300025910 Bacteria 262530
686 Ga0207684_10021678 3300025910 Bacteria 5485
687 Ga0207654_10000006 3300025911 Bacteria 815027
688 Ga0207654_10193486 3300025911 Bacteria 1335
689 Ga0207707_10002135 3300025912 Bacteria 17906
690 Ga0207707_10002487 3300025912 Bacteria 16585
691 Ga0207707_10020681 3300025912 Bacteria 5748
692 Ga0207707_10021273 3300025912 Bacteria 5670
693 Ga0207707_10205016 3300025912 Bacteria 1718
694 Ga0207707_10286700 3300025912 Bacteria 1425
695 Ga0207707_10538294 3300025912 Bacteria 993
696 Ga0207695_10007590 3300025913 Bacteria 13750
697 Ga0207695_10023781 3300025913 Bacteria 6915
698 Ga0207695_10034289 3300025913 Bacteria 5523
699 Ga0207695_10082994 3300025913 Bacteria 3238
700 Ga0207695_10131969 3300025913 Bacteria 2454
701 Ga0207695_10152934 3300025913 Bacteria 2245
702 Ga0207695_10185695 3300025913 Bacteria 1998
703 Ga0207671_10000287 3300025914 Bacteria 74587
704 Ga0207671_10109594 3300025914 Bacteria 2099
705 Ga0207693_10008931 3300025915 Bacteria 8180
706 Ga0207693_10012365 3300025915 Bacteria 6894
707 Ga0207663_10004681 3300025916 Bacteria 6829
708 Ga0207663_10014720 3300025916 Bacteria 4294
709 Ga0207663_10317806 3300025916 Bacteria 1169
710 Ga0207660_10035893 3300025917 Bacteria 3444
711 Ga0207660_10069924 3300025917 Bacteria 2550
712 Ga0207660_10086767 3300025917 Bacteria 2311
713 Ga0207660_10100382 3300025917 Bacteria 2161
714 Ga0207660_10106088 3300025917 Bacteria 2106
715 Ga0207660_10153241 3300025917 Bacteria 1772
716 Ga0207660_10210005 3300025917 Bacteria 1524
717 Ga0207662_10005511 3300025918 Bacteria 6757
718 Ga0207662_10173442 3300025918 Bacteria 1384
719 Ga0207662_10415513 3300025918 Bacteria 914
720 Ga0207657_10007983 3300025919 Bacteria 10790
721 Ga0207657_10124817 3300025919 Bacteria 2115
722 Ga0207657_10169365 3300025919 Bacteria 1770
723 Ga0207649_10000068 3300025920 Bacteria 91623
724 Ga0207649_10067324 3300025920 Bacteria 2273
725 Ga0207652_10011454 3300025921 Bacteria 7150
726 Ga0207652_10027558 3300025921 Bacteria 4735
727 Ga0207652_10118304 3300025921 Bacteria 2355
728 Ga0207652_10154454 3300025921 Bacteria 2056
729 Ga0207652_10252647 3300025921 Bacteria 1590
730 Ga0207652_10382849 3300025921 Bacteria 1269
731 Ga0207646_10057103 3300025922 Bacteria 3487
732 Ga0207646_10437284 3300025922 Bacteria 1180
733 Ga0207681_10004614 3300025923 Bacteria 8469
734 Ga0207681_10053638 3300025923 Bacteria 2738
735 Ga0207694_10007269 3300025924 Bacteria 8405
736 Ga0207694_10026150 3300025924 Bacteria 4437
737 Ga0207694_10054068 3300025924 Bacteria 3114
738 Ga0207694_10174770 3300025924 Bacteria 1740
739 Ga0207650_10000002 3300025925 Bacteria 1439222
740 Ga0207650_10000255 3300025925 Bacteria 57979
741 Ga0207650_10000465 3300025925 Bacteria 34125
742 Ga0207659_10000537 3300025926 Bacteria 22637
743 Ga0207659_10003927 3300025926 Bacteria 8970
744 Ga0207659_10147010 3300025926 Bacteria 1836
745 Ga0207659_10214227 3300025926 Bacteria 1545
746 Ga0207659_10547691 3300025926 Bacteria 983
747 Ga0207687_10024173 3300025927 Bacteria 4057
748 Ga0207687_10025300 3300025927 Bacteria 3972
749 Ga0207687_10059781 3300025927 Bacteria 2686
750 Ga0207687_10138119 3300025927 Bacteria 1846
751 Ga0207700_10118566 3300025928 Bacteria 2142
752 Ga0207700_10201235 3300025928 Bacteria 1678
753 Ga0207700_10219531 3300025928 Bacteria 1611
754 Ga0207664_10440094 3300025929 Bacteria 1163
755 Ga0207644_10000051 3300025931 Bacteria 93644
756 Ga0207644_10012285 3300025931 Bacteria 5684
757 Ga0207644_10163216 3300025931 Bacteria 1733
758 Ga0207644_10230775 3300025931 Bacteria 1470
759 Ga0207690_10110387 3300025932 Bacteria 1980
760 Ga0207706_10004728 3300025933 Bacteria 12750
761 Ga0207706_10008716 3300025933 Bacteria 9342
762 Ga0207706_10031394 3300025933 Bacteria 4733
763 Ga0207706_10045701 3300025933 Bacteria 3879
764 Ga0207706_10070562 3300025933 Bacteria 3073
765 Ga0207706_10139450 3300025933 Bacteria 2133
766 Ga0207706_10215231 3300025933 Bacteria 1683
767 Ga0207686_10189661 3300025934 Bacteria 1464
768 Ga0207709_10000053 3300025935 Bacteria 225514
769 Ga0207709_10080322 3300025935 Bacteria 2100
770 Ga0207709_10119093 3300025935 Bacteria 1779
771 Ga0207670_10211574 3300025936 Bacteria 1479
772 Ga0207669_10071119 3300025937 Bacteria 2184
773 Ga0207669_10072201 3300025937 Bacteria 2172
774 Ga0207669_10075791 3300025937 Bacteria 2132
775 Ga0207665_10051674 3300025939 Bacteria 2767
776 Ga0207665_10052991 3300025939 Bacteria 2734
777 Ga0207665_10124960 3300025939 Bacteria 1821
778 Ga0207665_10282003 3300025939 Bacteria 1237
779 Ga0207691_10002614 3300025940 Bacteria 17587
780 Ga0207691_10005405 3300025940 Bacteria 12329
781 Ga0207691_10061192 3300025940 Bacteria 3420
782 Ga0207691_10139179 3300025940 Bacteria 2140
783 Ga0207691_10247006 3300025940 Bacteria 1541
784 Ga0207711_10000612 3300025941 Bacteria 36000
785 Ga0207711_10000853 3300025941 Bacteria 29471
786 Ga0207711_10015341 3300025941 Bacteria 6360
787 Ga0207711_10098100 3300025941 Bacteria 2589
788 Ga0207711_10102082 3300025941 Bacteria 2539
789 Ga0207689_10014606 3300025942 Bacteria 6674
790 Ga0207689_10042609 3300025942 Bacteria 3754
791 Ga0207689_10094634 3300025942 Bacteria 2453
792 Ga0207689_10229253 3300025942 Bacteria 1535
793 Ga0207689_10234382 3300025942 Bacteria 1517
794 Ga0207689_10345039 3300025942 Bacteria 1237
795 Ga0207661_10002689 3300025944 Bacteria 12228
796 Ga0207679_10000018 3300025945 Bacteria 238375
797 Ga0207679_10007527 3300025945 Bacteria 6912
798 Ga0207679_10050957 3300025945 Bacteria 3028
799 Ga0207667_10017787 3300025949 Bacteria 7993
800 Ga0207667_10056345 3300025949 Bacteria 4129
801 Ga0207667_10087911 3300025949 Bacteria 3215
802 Ga0207651_10008614 3300025960 Bacteria 5520
803 Ga0207712_10096245 3300025961 Bacteria 2191
804 Ga0207668_10010756 3300025972 Bacteria 5540
805 Ga0207668_10171508 3300025972 Bacteria 1702
806 Ga0207668_10253564 3300025972 Bacteria 1430
807 Ga0207640_10017195 3300025981 Bacteria 4225
808 Ga0207640_10243989 3300025981 Bacteria 1390
809 Ga0207640_10283530 3300025981 Bacteria 1302
810 Ga0207658_10000001 3300025986 Bacteria 1439333
811 Ga0207658_10000245 3300025986 Bacteria 56695
812 Ga0207658_10208579 3300025986 Bacteria 1636
813 Ga0207658_10219819 3300025986 Bacteria 1597
814 Ga0207658_10283721 3300025986 Bacteria 1420
815 Ga0207658_10323900 3300025986 Bacteria 1335
816 Ga0207677_10017504 3300026023 Bacteria 4275
817 Ga0207677_10038016 3300026023 Bacteria 3151
818 Ga0207703_10002492 3300026035 Bacteria 15962
819 Ga0207703_10007488 3300026035 Bacteria 8670
820 Ga0207703_10009648 3300026035 Bacteria 7578
821 Ga0207703_10028651 3300026035 Bacteria 4392
822 Ga0207639_10106578 3300026041 Bacteria 2275
823 Ga0207639_10238081 3300026041 Bacteria 1581
824 Ga0207678_10333334 3300026067 Bacteria 1306
825 Ga0207678_10349841 3300026067 Bacteria 1274
826 Ga0207708_10011893 3300026075 Bacteria 6483
827 Ga0207708_10059720 3300026075 Bacteria 2910
828 Ga0207708_10062233 3300026075 Bacteria 2851
829 Ga0207708_10298909 3300026075 Bacteria 1309
830 Ga0207702_10215430 3300026078 Bacteria 1787
831 Ga0207641_10000449 3300026088 Bacteria 47077
832 Ga0207641_10002491 3300026088 Bacteria 17004
833 Ga0207641_10008790 3300026088 Bacteria 8343
834 Ga0207641_10010128 3300026088 Bacteria 7753
835 Ga0207641_10046674 3300026088 Bacteria 3652
836 Ga0207641_10078234 3300026088 Bacteria 2864
837 Ga0207641_10214616 3300026088 Bacteria 1781
838 Ga0207648_10018031 3300026089 Bacteria 6397
839 Ga0207648_10089678 3300026089 Bacteria 2686
840 Ga0207648_10109352 3300026089 Bacteria 2426
841 Ga0207676_10000001 3300026095 Bacteria 1439222
842 Ga0207676_10008384 3300026095 Bacteria 7346
843 Ga0207676_10136662 3300026095 Bacteria 2092
844 Ga0207676_10149809 3300026095 Bacteria 2008
845 Ga0207674_10000480 3300026116 Bacteria 52689
846 Ga0207674_10018091 3300026116 Bacteria 7671
847 Ga0207674_10359623 3300026116 Bacteria 1407
848 Ga0207674_10543664 3300026116 Bacteria 1122
849 Ga0207675_100000731 3300026118 Bacteria 32584
850 Ga0207675_100002434 3300026118 Bacteria 18439
851 Ga0207675_100010971 3300026118 Bacteria 8488
852 Ga0207675_100116090 3300026118 Bacteria 2530
853 Ga0207683_10000952 3300026121 Bacteria 26522
854 Ga0207698_10192987 3300026142 Bacteria 1816
855 Ga0209281_1000001 3300027111 Bacteria 1933496
856 Ga0209281_1000008 3300027111 Bacteria 867470
857 Ga0209281_1000010 3300027111 Bacteria 726106
858 Ga0209281_1000021 3300027111 Bacteria 541033
859 Ga0209281_1000041 3300027111 Bacteria 347825
860 Ga0209281_1000085 3300027111 Bacteria 252561
861 Ga0209281_1000291 3300027111 Bacteria 91918
862 Ga0209281_1000817 3300027111 Bacteria 28172
863 Ga0209281_1001892 3300027111 Bacteria 10034
864 Ga0209281_1002465 3300027111 Bacteria 7373
865 Ga0209281_1006125 3300027111 Bacteria 3189
866 Ga0209389_1000096 3300027296 Bacteria 80414
867 Ga0209371_1000001 3300027312 Bacteria 2771503
868 Ga0209371_1000010 3300027312 Bacteria 922021
869 Ga0209371_1000047 3300027312 Bacteria 304732
870 Ga0209371_1000056 3300027312 Bacteria 242255
871 Ga0209371_1000170 3300027312 Bacteria 97312
872 Ga0209371_1000537 3300027312 Bacteria 35888
873 Ga0209371_1000590 3300027312 Bacteria 32510
874 Ga0209371_1000614 3300027312 Bacteria 31800
875 Ga0209371_1000615 3300027312 Bacteria 31768
876 Ga0209371_1000803 3300027312 Bacteria 25942
877 Ga0209371_1001366 3300027312 Bacteria 16868
878 Ga0209371_1001830 3300027312 Bacteria 13172
879 Ga0209371_1002782 3300027312 Bacteria 9357
880 Ga0209371_1003576 3300027312 Bacteria 7440
881 Ga0209371_1005234 3300027312 Bacteria 5240
882 Ga0209371_1008716 3300027312 Bacteria 3321
883 Ga0209371_1009171 3300027312 Bacteria 3175
884 Ga0209981_1004109 3300027378 Bacteria 1898
885 Ga0209179_1000004 3300027512 Bacteria 115114
886 Ga0209968_1005067 3300027526 Bacteria 1975
887 Ga0209999_1004925 3300027543 Bacteria 2402
888 Ga0209982_1010547 3300027552 Bacteria 1370
889 Ga0209970_1004874 3300027614 Bacteria 2216
890 Ga0209983_1003394 3300027665 Bacteria 3407
891 Ga0209974_10001231 3300027876 Bacteria 9171
892 Ga0209974_10004627 3300027876 Bacteria 4895
893 Ga0207428_10026727 3300027907 Bacteria 4812
894 Ga0268266_10000027 3300028379 Bacteria 426852
895 Ga0268266_10002005 3300028379 Bacteria 22756
896 Ga0268266_10004969 3300028379 Bacteria 12579
897 Ga0268266_10005939 3300028379 Bacteria 11289
898 Ga0268266_10006560 3300028379 Bacteria 10639
899 Ga0268266_10008567 3300028379 Bacteria 9088
900 Ga0268266_10039841 3300028379 Bacteria 4003
901 Ga0268266_10049903 3300028379 Bacteria 3589
902 Ga0268266_10068821 3300028379 Bacteria 3066
903 Ga0268266_10113057 3300028379 Bacteria 2407
904 Ga0268265_10000783 3300028380 Bacteria 30441
905 Ga0268265_10008164 3300028380 Bacteria 7072
906 Ga0268265_10018356 3300028380 Bacteria 4845
907 Ga0268265_10019513 3300028380 Bacteria 4714
908 Ga0268265_10039095 3300028380 Bacteria 3494
909 Ga0268265_10091440 3300028380 Bacteria 2433
910 Ga0268265_10428590 3300028380 Bacteria 1230
911 Ga0268264_10000004 3300028381 Bacteria 1116842
912 Ga0268264_10000198 3300028381 Bacteria 122906
913 Ga0268264_10035068 3300028381 Bacteria 4130
914 Ga0268264_10078934 3300028381 Bacteria 2807
915 Ga0268264_10134437 3300028381 Bacteria 2197
916 Ga0268264_10266744 3300028381 Bacteria 1598
917 Ga0268264_10323596 3300028381 Bacteria 1459
918 Ga0265326_10031754 3300028558 Bacteria 1505
919 Ga0265319_1008167 3300028563 Bacteria 4614
920 Ga0265319_1009764 3300028563 Bacteria 4053
921 Ga0265319_1031332 3300028563 Bacteria 1852
922 Ga0265334_10000038 3300028573 Bacteria 100961
923 Ga0265334_10001001 3300028573 Bacteria 13979
924 Ga0265334_10019228 3300028573 Bacteria 2813
925 Ga0265318_10056429 3300028577 Bacteria 1468
926 Ga0265323_10003281 3300028653 Bacteria 7196
927 Ga0265323_10023328 3300028653 Bacteria 2359
928 Ga0307515_10049771 3300028794 Bacteria 6293
929 Ga0265338_10012444 3300028800 Bacteria 9699
930 Ga0268256_1000001 3300030500 Bacteria 2771065
931 Ga0268256_1000003 3300030500 Bacteria 1289401
932 Ga0268256_1000022 3300030500 Bacteria 531115
933 Ga0268256_1000142 3300030500 Bacteria 97311
934 Ga0268256_1000270 3300030500 Bacteria 53886
935 Ga0268256_1000438 3300030500 Bacteria 37140
936 Ga0268256_1000514 3300030500 Bacteria 32518
937 Ga0268256_1000528 3300030500 Bacteria 31946
938 Ga0268256_1000596 3300030500 Bacteria 28698
939 Ga0268256_1000671 3300030500 Bacteria 25942
940 Ga0268256_1001116 3300030500 Bacteria 17468
941 Ga0268256_1001173 3300030500 Bacteria 16868
942 Ga0268256_1002997 3300030500 Bacteria 7976
943 Ga0268256_1005156 3300030500 Bacteria 5198
944 Ga0268256_1007231 3300030500 Bacteria 3992
945 Ga0268256_1009672 3300030500 Bacteria 3175
946 Ga0307511_10000020 3300030521 Bacteria 117812
947 Ga0307511_10000048 3300030521 Bacteria 98665
948 Ga0307511_10035568 3300030521 Bacteria 4346
949 Ga0307511_10128895 3300030521 Bacteria 1532
950 Ga0316176_1064153 3300030732 Bacteria 1782
951 Ga0314311_1104646 3300030733 Bacteria 3924
952 Ga0316178_1127053 3300030735 Bacteria 33158
953 Ga0316181_1161353 3300030744 Bacteria 3738
954 Ga0265330_10004820 3300031235 Bacteria 6799
955 Ga0265330_10011277 3300031235 Bacteria 4197
956 Ga0265330_10070524 3300031235 Bacteria 1512
957 Ga0265332_10003208 3300031238 Bacteria 7963
958 Ga0265332_10031061 3300031238 Bacteria 2330
959 Ga0265328_10002929 3300031239 Bacteria 7623
960 Ga0265320_10000288 3300031240 Bacteria 40873
961 Ga0265320_10001726 3300031240 Bacteria 15502
962 Ga0265320_10004740 3300031240 Bacteria 8856
963 Ga0265329_10002627 3300031242 Bacteria 8088
964 Ga0265339_10000257 3300031249 Bacteria 42838
965 Ga0265331_10002121 3300031250 Bacteria 13652
966 Ga0265331_10012306 3300031250 Bacteria 4638
967 Ga0265331_10031593 3300031250 Bacteria 2630
968 Ga0265331_10039489 3300031250 Bacteria 2301
969 Ga0265327_10000014 3300031251 Bacteria 506288
970 Ga0265327_10000053 3300031251 Bacteria 255002
971 Ga0265327_10000378 3300031251 Bacteria 83787
972 Ga0265327_10000393 3300031251 Bacteria 82261
973 Ga0265327_10018866 3300031251 Bacteria 4259
974 Ga0265327_10154962 3300031251 Bacteria 1062
975 Ga0265316_10000372 3300031344 Bacteria 50916
976 Ga0265316_10002394 3300031344 Bacteria 19520
977 Ga0265316_10014619 3300031344 Bacteria 6899
978 Ga0265316_10017611 3300031344 Bacteria 6166
979 Ga0265316_10032319 3300031344 Bacteria 4270
980 Ga0265316_10262931 3300031344 Bacteria 1265
981 Ga0265316_10271002 3300031344 Bacteria 1242
982 Ga0307513_10018691 3300031456 Bacteria 8276
983 Ga0307513_10110114 3300031456 Bacteria 2750
984 Ga0307513_10130480 3300031456 Bacteria 2460
985 Ga0307513_10244331 3300031456 Bacteria 1597
986 Ga0307513_10254971 3300031456 Bacteria 1548
987 Ga0307509_10000025 3300031507 Bacteria 235550
988 Ga0307509_10000803 3300031507 Bacteria 53898
989 Ga0307509_10231173 3300031507 Bacteria 1652
990 Ga0307408_100000004 3300031548 Bacteria 572889
991 Ga0307408_100001639 3300031548 Bacteria 16508
992 Ga0307408_100005859 3300031548 Bacteria 8177
993 Ga0307408_100080937 3300031548 Bacteria 2427
994 Ga0307408_100107962 3300031548 Bacteria 2133
995 Ga0307408_100108793 3300031548 Bacteria 2125
996 Ga0265313_10000102 3300031595 Bacteria 86997
997 Ga0265313_10008626 3300031595 Bacteria 6742
998 Ga0265313_10020319 3300031595 Bacteria 3666
999 Ga0307508_10055899 3300031616 Bacteria 3496
1000 Ga0307508_10100671 3300031616 Bacteria 2485
1001 Ga0316575_10000304 3300031665 Bacteria 13733
1002 Ga0316575_10001006 3300031665 Bacteria 8731
1003 Ga0316575_10003310 3300031665 Bacteria 5550
1004 Ga0316575_10114395 3300031665 Bacteria 1102
1005 Ga0316579_10000020 3300031691 Bacteria 38222
1006 Ga0316579_10000561 3300031691 Bacteria 12400
1007 Ga0316579_10002231 3300031691 Bacteria 7301
1008 Ga0316579_10004590 3300031691 Bacteria 5495
1009 Ga0316579_10103275 3300031691 Bacteria 1366
1010 Ga0265314_10000633 3300031711 Bacteria 43095
1011 Ga0265314_10015358 3300031711 Bacteria 6079
1012 Ga0265342_10003602 3300031712 Bacteria 12634
1013 Ga0265342_10007163 3300031712 Bacteria 8208
1014 Ga0265342_10009307 3300031712 Bacteria 6937
1015 Ga0316576_10000668 3300031727 Bacteria 16695
1016 Ga0316576_10000860 3300031727 Bacteria 15368
1017 Ga0316576_10103088 3300031727 Bacteria 2134
1018 Ga0316576_10105409 3300031727 Bacteria 2110
1019 Ga0316576_10113712 3300031727 Bacteria 2030
1020 Ga0316578_10001245 3300031728 Bacteria 10146
1021 Ga0316578_10010790 3300031728 Bacteria 4755
1022 Ga0316578_10019197 3300031728 Bacteria 3757
1023 Ga0316578_10154562 3300031728 Bacteria 1382
1024 Ga0307516_10002023 3300031730 Bacteria 27657
1025 Ga0307405_10034091 3300031731 Bacteria 3026
1026 Ga0307405_10061177 3300031731 Bacteria 2379
1027 Ga0307405_10089753 3300031731 Bacteria 2031
1028 Ga0316577_10005445 3300031733 Bacteria 6675
1029 Ga0316577_10044108 3300031733 Bacteria 2494
1030 Ga0316577_10057326 3300031733 Bacteria 2175
1031 Ga0316577_10114108 3300031733 Bacteria 1516
1032 Ga0316577_10149472 3300031733 Bacteria 1316
1033 Ga0316577_10152770 3300031733 Bacteria 1301
1034 Ga0316577_10176566 3300031733 Bacteria 1206
1035 Ga0307413_10056679 3300031824 Bacteria 2391
1036 Ga0307410_10005034 3300031852 Bacteria 6941
1037 Ga0307410_10049015 3300031852 Bacteria 2833
1038 Ga0307410_10085034 3300031852 Bacteria 2231
1039 Ga0307410_10459756 3300031852 Bacteria 1040
1040 Ga0307406_10001124 3300031901 Bacteria 14950
1041 Ga0307406_10043227 3300031901 Bacteria 2817
1042 Ga0307406_10077487 3300031901 Bacteria 2199
1043 Ga0307406_10092199 3300031901 Bacteria 2042
1044 Ga0307406_10165655 3300031901 Bacteria 1594
1045 Ga0307406_10203491 3300031901 Bacteria 1459
1046 Ga0307407_10004720 3300031903 Bacteria 5824
1047 Ga0307407_10098987 3300031903 Bacteria 1805
1048 Ga0307412_10141884 3300031911 Bacteria 1761
1049 Ga0307409_100005208 3300031995 Bacteria 7443
1050 Ga0307409_100014790 3300031995 Bacteria 5092
1051 Ga0307409_100070959 3300031995 Bacteria 2767
1052 Ga0307409_100245117 3300031995 Bacteria 1634
1053 Ga0307409_100258105 3300031995 Bacteria 1598
1054 Ga0307416_100069259 3300032002 Bacteria 2919
1055 Ga0307416_100077214 3300032002 Bacteria 2796
1056 Ga0307416_100120503 3300032002 Bacteria 2336
1057 Ga0307416_100206713 3300032002 Bacteria 1868
1058 Ga0307416_100395146 3300032002 Bacteria 1418
1059 Ga0307414_10043050 3300032004 Bacteria 3073
1060 Ga0307414_10061592 3300032004 Bacteria 2659
1061 Ga0307414_10083568 3300032004 Bacteria 2345
1062 Ga0307411_10082429 3300032005 Bacteria 2218
1063 Ga0307411_10251760 3300032005 Bacteria 1389
1064 Ga0307415_100057292 3300032126 Bacteria 2677
1065 Ga0307415_100139775 3300032126 Bacteria 1848
1066 Ga0307415_100403739 3300032126 Bacteria 1167
1067 Ga0316583_10004819 3300032133 Bacteria 4819
1068 Ga0316583_10011760 3300032133 Bacteria 3157
1069 Ga0316583_10016149 3300032133 Bacteria 2688
1070 Ga0316583_10029047 3300032133 Bacteria 1972
1071 Ga0316583_10041474 3300032133 Bacteria 1629
1072 Ga0316585_10000061 3300032137 Bacteria 17614
1073 Ga0316585_10004523 3300032137 Bacteria 3875
1074 Ga0316580_10000117 3300032139 Bacteria 14877
1075 Ga0316593_10001291 3300032168 Bacteria 5446
1076 Ga0316593_10002011 3300032168 Bacteria 4689
1077 Ga0316593_10002668 3300032168 Bacteria 4286
1078 Ga0316593_10028286 3300032168 Bacteria 1806
1079 Ga0316593_10043287 3300032168 Bacteria 1504
1080 Ga0316593_10044287 3300032168 Bacteria 1489
1081 Ga0316593_10115695 3300032168 Bacteria 960
1082 Ga0307510_10000002 3300033180 Bacteria 801565
1083 Ga0307510_10009847 3300033180 Bacteria 11371
1084 Ga0316592_1031668 3300033524 Bacteria 1152
1085 Ga0316588_1005585 3300033528 Bacteria 2460
1086 Ga0316596_1002845 3300033541 Bacteria 3741
1087 Ga0316596_1010918 3300033541 Bacteria 2209
1088 Ga0316596_1044853 3300033541 Bacteria 1165
1089 Ga0373928_0049724 3300035084 Bacteria 986
1090 Ga0373944_0017675 3300035089 Bacteria 2028
1091 Ga0373952_0042825 3300035092 Bacteria 1053
1092 Ga0373923_0051613 3300035111 Bacteria 1726
1093 Ga0373936_0018998 3300035113 Bacteria 2661
1094 Ga0373956_0051721 3300035119 Bacteria 1847
1095 Ga0373956_0139503 3300035119 Bacteria 1138
1096 Ga0373960_0065864 3300035121 Bacteria 1109
1097 Ga0373946_0050473 3300035171 Bacteria 1738
1098 Ga0373942_0013241 3300035207 Bacteria 1981
1099 Ga0316574_0000114 3300035398 Bacteria 24287
1100 Ga0316574_0004645 3300035398 Bacteria 7232
1101 Ga0316574_0005360 3300035398 Bacteria 6833
1102 Ga0316574_0008947 3300035398 Bacteria 5591
1103 Ga0316574_0008971 3300035398 Bacteria 5584
1104 Ga0316574_0026483 3300035398 Bacteria 3488
1105 Ga0316574_0029285 3300035398 Bacteria 3325
1106 Ga0316574_0042552 3300035398 Bacteria 2803
1107 Ga0316574_0052242 3300035398 Bacteria 2548
1108 Ga0316574_0080961 3300035398 Bacteria 2062
1109 Ga0316574_0098376 3300035398 Bacteria 1871
1110 Ga0316574_0108623 3300035398 Bacteria 1778
1111 Ga0316574_0283467 3300035398 Bacteria 1055
1112 Ga0373931_0030826 3300035691 Bacteria 2763
1113 Ga0373927_0000001 3300035695 Bacteria 1082160
1114 Ga0373927_0021708 3300035695 Bacteria 4207
1115 Ga0373933_0185408 3300035724 Bacteria 1328
1116 Ga0373947_0030858 3300035725 Bacteria 3151
1117 Ga0373937_0038612 3300036401 Bacteria 4351
1118 Ga0373937_0047434 3300036401 Bacteria 3930
1119 Ga0316582_0000007 3300036647 Bacteria 45992
1120 Ga0316582_0003413 3300036647 Bacteria 7785
1121 Ga0316582_0006912 3300036647 Bacteria 6002
1122 Ga0316582_0016729 3300036647 Bacteria 4225
1123 Ga0316582_0024156 3300036647 Bacteria 3634
1124 Ga0316582_0035728 3300036647 Bacteria 3071
1125 Ga0316582_0038276 3300036647 Bacteria 2979
1126 Ga0316582_0041091 3300036647 Bacteria 2888
1127 Ga0316582_0041179 3300036647 Bacteria 2886
1128 Ga0316582_0064160 3300036647 Bacteria 2362
1129 Ga0316582_0078637 3300036647 Bacteria 2149
1130 Ga0316582_0146041 3300036647 Bacteria 1597
1131 Ga0316582_0169632 3300036647 Bacteria 1481
1132 Ga0316584_0000232 3300036712 Bacteria 27591
1133 Ga0316584_0002851 3300036712 Bacteria 11092
1134 Ga0316584_0009768 3300036712 Bacteria 6676
1135 Ga0316584_0018982 3300036712 Bacteria 4968
1136 Ga0316584_0030381 3300036712 Bacteria 3991
1137 Ga0316584_0073367 3300036712 Bacteria 2565
1138 Ga0316584_0108722 3300036712 Bacteria 2075
1139 Ga0316584_0125469 3300036712 Bacteria 1917
1140 Ga0316584_0176615 3300036712 Bacteria 1582
1141 Ga0316584_0246158 3300036712 Bacteria 1307
1142 Ga0316584_0311274 3300036712 Bacteria 1138
1143 Ga0316584_0314946 3300036712 Bacteria 1130
1144 Ga0395900_0001068 3300037418 Bacteria 34919
1145 Ga0395900_0105484 3300037418 Bacteria 2895
1146 Ga0395900_0182742 3300037418 Bacteria 2130
1147 Ga0395898_0024577 3300037466 Bacteria 6076
1148 Ga0395898_0034972 3300037466 Bacteria 5000
1149 Ga0395898_0079942 3300037466 Bacteria 3153
1150 Ga0395905_0002379 3300037471 Bacteria 20938
1151 Ga0395905_0005298 3300037471 Bacteria 13187
1152 Ga0395905_0025823 3300037471 Bacteria 5537
1153 Ga0395905_0044845 3300037471 Bacteria 4148
1154 Ga0395905_0071400 3300037471 Bacteria 3255
1155 Ga0395905_0075585 3300037471 Bacteria 3157
1156 Ga0395905_0461978 3300037471 Bacteria 1168
1157 Ga0316581_0000648 3300037588 Bacteria 6984
1158 Ga0436364_0108855 3300037853 Bacteria 36564
1159 Ga0436364_0258695 3300037853 Bacteria 3375
1160 Ga0395901_0001545 3300038443 Bacteria 23841
1161 Ga0395901_0052496 3300038443 Bacteria 4237
1162 Ga0395901_0243441 3300038443 Bacteria 1875
1163 Ga0237819_00849 3300038705 Bacteria 9629
1164 Ga0400484_06088 3300038725 Bacteria 1320
1165 Ga0400485_07089 3300038735 Bacteria 55387
1166 Ga0400485_11804 3300038735 Bacteria 10571
1167 Ga0400488_13288 3300038741 Bacteria 19966
1168 Ga0400486_00736 3300038742 Bacteria 47794
1169 Ga0400486_07003 3300038742 Bacteria 4701
1170 Ga0400486_13241 3300038742 Bacteria 9538
1171 Ga0400486_22850 3300038742 Bacteria 10767
1172 Ga0400483_018680 3300039062 Bacteria 5037
1173 Ga0400483_026308 3300039062 Bacteria 223136
1174 Ga0400483_026438 3300039062 Bacteria 3153
1175 Ga0400483_071935 3300039062 Bacteria 165886
1176 Ga0400483_108467 3300039062 Bacteria 1265
1177 Ga0400483_149853 3300039062 Bacteria 2338
1178 Ga0400483_172565 3300039062 Bacteria 3869
1179 Ga0400483_218643 3300039062 Bacteria 1473
1180 Ga0400483_250036 3300039062 Bacteria 396353
1181 Ga0400483_254606 3300039062 Bacteria 1228
1182 Ga0400489_36940 3300039093 Bacteria 24345
1183 Ga0400487_01345 3300039110 Bacteria 4814
1184 Ga0400487_03987 3300039110 Bacteria 26943
1185 Ga0400487_36948 3300039110 Bacteria 2044
1186 Ga0436365_0143511 3300039437 Bacteria 1802
1187 Ga0436365_0282597 3300039437 Bacteria 5445
1188 Ga0436365_0727636 3300039437 Bacteria 99848
1189 Ga0436365_1553232 3300039437 Bacteria 4076
1190 Ga0436365_1894950 3300039437 Bacteria 12272
1191 Ga0436365_1935856 3300039437 Bacteria 1463
1192 Ga0436360_1218743 3300039438 Bacteria 2895
1193 Ga0436360_1310758 3300039438 Bacteria 4611
1194 Ga0436361_0219666 3300039447 Bacteria 2647
1195 Ga0436361_0466583 3300039447 Bacteria 2322
1196 Ga0436363_0159060 3300039450 Bacteria 8605
1197 Ga0436363_0691036 3300039450 Bacteria 9348
1198 Ga0436363_0812865 3300039450 Bacteria 3570
1199 Ga0436363_1113543 3300039450 Bacteria 16475
1200 Ga0436363_1428747 3300039450 Bacteria 2382
1201 Ga0436363_1459742 3300039450 Bacteria 1123
1202 Ga0436362_0660090 3300039453 Bacteria 2283
1203 Ga0436362_0920641 3300039453 Bacteria 3660
1204 Ga0439436_0035177 3300041404 Bacteria 1447
1205 Ga0439438_000001 3300041405 Bacteria 1263568
1206 Ga0439438_008039 3300041405 Bacteria 3543
1207 Ga0439438_009532 3300041405 Bacteria 3137
1208 Ga0439438_009561 3300041405 Bacteria 3130
1209 Ga0439447_000496 3300041407 Bacteria 14645
1210 Ga0439447_003555 3300041407 Bacteria 5520
1211 Ga0439466_0000003 3300041411 Bacteria 486229
1212 Ga0451804_0813252 3300041463 Bacteria 1505
1213 Ga0439437_000020 3300042000 Bacteria 13819
1214 Ga0439432_001341 3300042006 Bacteria 9318
1215 Ga0439452_000001 3300042010 Bacteria 1725439
1216 Ga0439452_000003 3300042010 Bacteria 942815
1217 Ga0439452_000029 3300042010 Bacteria 197977
1218 Ga0439452_000924 3300042010 Bacteria 13287
1219 Ga0439452_001015 3300042010 Bacteria 12433
1220 Ga0450911_000001 3300042115 Bacteria 311012
1221 Ga0450907_002033 3300042146 Bacteria 4030
1222 Ga0439446_0001464 3300042156 Bacteria 5389
1223 Ga0439464_0000691 3300042439 Bacteria 7298
1224 Ga0439464_0011620 3300042439 Bacteria 2334
1225 Ga0451577_0000053 3300042876 Bacteria 279563
1226 Ga0451577_0000278 3300042876 Bacteria 99268
1227 Ga0451577_0000357 3300042876 Bacteria 85114
1228 Ga0451577_0000658 3300042876 Bacteria 54482
1229 Ga0451577_0001280 3300042876 Bacteria 34616
1230 Ga0451577_0010849 3300042876 Bacteria 8658
1231 Ga0451577_0024333 3300042876 Bacteria 5510
1232 Ga0451577_0062112 3300042876 Bacteria 3331
1233 Ga0451577_0064571 3300042876 Bacteria 3264
1234 Ga0451577_0077761 3300042876 Bacteria 2958
1235 Ga0451577_0146880 3300042876 Bacteria 2120
1236 Ga0439440_0020307 3300042993 Bacteria 1489
1237 Ga0466969_0014511 3300044656 Bacteria 4141
1238 Ga0466969_0067862 3300044656 Bacteria 1720
1239 Ga0466969_0073240 3300044656 Bacteria 1644
1240 Ga0466981_0000098 3300044669 Bacteria 21564
1241 Ga0453683_0000002 3300044673 Bacteria 1244396
1242 Ga0453683_0000134 3300044673 Bacteria 108503
1243 Ga0453683_0000776 3300044673 Bacteria 31663
1244 Ga0453683_0000890 3300044673 Bacteria 28654
1245 Ga0453683_0001476 3300044673 Bacteria 20196
1246 Ga0453683_0001508 3300044673 Bacteria 19892
1247 Ga0453683_0004290 3300044673 Bacteria 10169
1248 Ga0453683_0006328 3300044673 Bacteria 8133
1249 Ga0453683_0011688 3300044673 Bacteria 5783
1250 Ga0453683_0012171 3300044673 Bacteria 5645
1251 Ga0466966_0037684 3300044684 Bacteria 3116
1252 Ga0466961_0012615 3300044693 Bacteria 5412
1253 Ga0466964_0004046 3300044706 Bacteria 5391
1254 Ga0453684_0000103 3300044712 Bacteria 366458
1255 Ga0453684_0000140 3300044712 Bacteria 319864
1256 Ga0453684_0000208 3300044712 Bacteria 255911
1257 Ga0453684_0000901 3300044712 Bacteria 99151
1258 Ga0453684_0001103 3300044712 Bacteria 84832
1259 Ga0453684_0003636 3300044712 Bacteria 34280
1260 Ga0453684_0005156 3300044712 Bacteria 26283
1261 Ga0453684_0007469 3300044712 Bacteria 20072
1262 Ga0453684_0009108 3300044712 Bacteria 17488
1263 Ga0453684_0015233 3300044712 Bacteria 12193
1264 Ga0453684_0015895 3300044712 Bacteria 11835
1265 Ga0453684_0015961 3300044712 Bacteria 11806
1266 Ga0453684_0031712 3300044712 Bacteria 7417
1267 Ga0453684_0038916 3300044712 Bacteria 6488
1268 Ga0453684_0039645 3300044712 Bacteria 6413
1269 Ga0453684_0048486 3300044712 Bacteria 5615
1270 Ga0453684_0054521 3300044712 Bacteria 5207
1271 Ga0453684_0066964 3300044712 Bacteria 4570
1272 Ga0453684_0099195 3300044712 Bacteria 3569
1273 Ga0453684_0151847 3300044712 Bacteria 2751
1274 Ga0453684_0232259 3300044712 Bacteria 2129
1275 Ga0453684_0311784 3300044712 Bacteria 1785
1276 Ga0466971_0001567 3300044719 Bacteria 9650
1277 Ga0466957_0042109 3300044842 Bacteria 2762
1278 Ga0466957_0108526 3300044842 Bacteria 1758
1279 Ga0466960_0000099 3300044901 Bacteria 28412
1280 Ga0466959_0001323 3300045049 Bacteria 15053
1281 Ga0466959_0052418 3300045049 Bacteria 2988
1282 Ga0466959_0126545 3300045049 Bacteria 1813
1283 Ga0451576_0000245 3300045051 Bacteria 133069
1284 Ga0451576_0000334 3300045051 Bacteria 113861
1285 Ga0451576_0000392 3300045051 Bacteria 101819
1286 Ga0451576_0001954 3300045051 Bacteria 32866
1287 Ga0451576_0002362 3300045051 Bacteria 28450
1288 Ga0451576_0038612 3300045051 Bacteria 5053
1289 Ga0451576_0060974 3300045051 Bacteria 3934
1290 Ga0451576_0076569 3300045051 Bacteria 3481
1291 Ga0451576_0077607 3300045051 Bacteria 3457
1292 Ga0451576_0135357 3300045051 Bacteria 2569
1293 Ga0451576_0138667 3300045051 Bacteria 2537
1294 Ga0451576_0351849 3300045051 Bacteria 1542
1295 Ga0451576_0381518 3300045051 Bacteria 1477
1296 Ga0451576_0724984 3300045051 Bacteria 1044
1297 Ga0495627_000028 3300046453 Bacteria 234737
1298 Ga0495603_0006470 3300046455 Bacteria 7015
1299 Ga0495603_0012418 3300046455 Bacteria 5156
1300 Ga0495603_0090006 3300046455 Bacteria 1795
1301 Ga0495590_0006925 3300046457 Bacteria 4399
1302 Ga0495591_000011 3300046458 Bacteria 309685
1303 Ga0495591_000080 3300046458 Bacteria 107876
1304 Ga0495638_0000843 3300046460 Bacteria 32065
1305 Ga0495638_0098815 3300046460 Bacteria 1748
1306 Ga0495651_0152519 3300046462 Bacteria 1664
1307 Ga0495650_0000012 3300046471 Bacteria 613144
1308 Ga0495650_0000016 3300046471 Bacteria 554693
1309 Ga0495650_0000153 3300046471 Bacteria 156161
1310 Ga0495650_0002966 3300046471 Bacteria 12843
1311 Ga0495580_0001074 3300046472 Bacteria 24024
1312 Ga0495580_0046654 3300046472 Bacteria 3073
1313 Ga0495580_0158291 3300046472 Bacteria 1568
1314 Ga0495639_0008418 3300046475 Bacteria 4423
1315 Ga0495639_0092869 3300046475 Bacteria 1418
1316 Ga0495664_0181793 3300046477 Bacteria 1275
1317 Ga0495585_0038462 3300046492 Bacteria 2693
1318 Ga0495594_0034599 3300046499 Bacteria 2749
1319 Ga0495594_0137944 3300046499 Bacteria 1383
1320 Ga0495607_0004502 3300046501 Bacteria 10226
1321 Ga0495607_0005367 3300046501 Bacteria 9202
1322 Ga0495606_0000094 3300046507 Bacteria 151840
1323 Ga0495616_0005517 3300046513 Bacteria 7773
1324 Ga0495616_0119180 3300046513 Bacteria 1220
1325 Ga0495618_0050360 3300046514 Bacteria 2631
1326 Ga0495620_0000083 3300046515 Bacteria 78909
1327 Ga0495620_0074771 3300046515 Bacteria 1380
1328 Ga0495630_0054602 3300046517 Bacteria 2993
1329 Ga0495630_0117139 3300046517 Bacteria 2019
1330 Ga0495632_0006084 3300046519 Bacteria 7826
1331 Ga0495632_0038082 3300046519 Bacteria 2436
1332 Ga0495632_0073281 3300046519 Bacteria 1642
1333 Ga0495637_0000174 3300046520 Bacteria 49455
1334 Ga0495643_0002111 3300046522 Bacteria 16411
1335 Ga0495643_0009801 3300046522 Bacteria 5926
1336 Ga0495666_0047145 3300046526 Bacteria 2076
1337 Ga0495654_0000078 3300046530 Bacteria 110443
1338 Ga0495654_0160843 3300046530 Bacteria 986
1339 Ga0495586_0005152 3300046535 Bacteria 6997
1340 Ga0495598_0006537 3300046537 Bacteria 2636
1341 Ga0495668_0082637 3300046616 Bacteria 1762
1342 Ga0495634_0131022 3300046642 Bacteria 1599
1343 Ga0495625_0001242 3300046660 Bacteria 32175
1344 Ga0495625_0017227 3300046660 Bacteria 5658
1345 Ga0495625_0076652 3300046660 Bacteria 2337
1346 Ga0495661_0000092 3300046665 Bacteria 109902
1347 Ga0495661_0002800 3300046665 Bacteria 13209
1348 Ga0495588_0104458 3300046674 Bacteria 1490
1349 Ga0495647_0001412 3300046681 Bacteria 7421
1350 Ga0495658_0111014 3300046683 Bacteria 1649
1351 Ga0495669_0053556 3300046684 Bacteria 1815
1352 Ga0495669_0183799 3300046684 Bacteria 997
1353 Ga0495613_0028561 3300046689 Bacteria 4149
1354 Ga0495671_0015585 3300046692 Bacteria 4068
1355 Ga0495649_0003485 3300046694 Bacteria 10601
1356 Ga0495649_0060928 3300046694 Bacteria 2029
1357 Ga0495649_0178377 3300046694 Bacteria 1109
1358 Ga0495589_0000002 3300046794 Bacteria 758846
1359 Ga0495660_0000007 3300046810 Bacteria 485295
1360 Ga0495660_0010823 3300046810 Bacteria 5296
1361 Ga0495660_0117064 3300046810 Bacteria 1352
1362 Ga0495581_0026485 3300047315 Bacteria 3361
1363 Ga0495581_0113069 3300047315 Bacteria 1579
1364 Ga0495672_0000009 3300047320 Bacteria 557755
1365 Ga0495672_0000012 3300047320 Bacteria 519975
1366 Ga0495676_0078702 3300047321 Bacteria 2509
1367 Ga0495683_0000175 3300047323 Bacteria 62928
1368 Ga0495679_000032 3300047446 Bacteria 171636
1369 Ga0495679_000119 3300047446 Bacteria 69255
1370 Ga0495673_0000022 3300047469 Bacteria 544086
1371 Ga0495686_0035071 3300047472 Bacteria 3227
1372 Ga0495602_0215536 3300048088 Bacteria 1453
1373 Ga0495615_0001674 3300048090 Bacteria 3359
1374 Ga0496100_0009521 3300048903 Bacteria 5461
1375 Ga0496101_0000029 3300048904 Bacteria 198515
1376 Ga0496101_0045076 3300048904 Bacteria 3158
1377 Ga0496101_0073186 3300048904 Bacteria 2517
1378 Ga0496102_0004688 3300048905 Bacteria 11565
1379 Ga0496102_0017917 3300048905 Bacteria 6212
1380 Ga0496102_0047140 3300048905 Bacteria 3915
1381 Ga0496103_0034542 3300048906 Bacteria 3093
1382 Ga0496104_0001318 3300048907 Bacteria 21417
1383 Ga0496104_0006179 3300048907 Bacteria 10518
1384 Ga0496104_0148023 3300048907 Bacteria 2255
1385 Ga0496104_0231879 3300048907 Bacteria 1758
1386 Ga0496104_0283059 3300048907 Bacteria 1571
1387 Ga0496104_0296664 3300048907 Bacteria 1529
1388 Ga0496105_0005778 3300048908 Bacteria 9433
1389 Ga0496105_0128274 3300048908 Bacteria 2091
1390 Ga0496105_0162472 3300048908 Bacteria 1833
1391 Ga0496105_0458476 3300048908 Bacteria 1005
1392 Ga0496106_0040511 3300048909 Bacteria 3489
1393 Ga0496106_0155790 3300048909 Bacteria 1804
1394 Ga0496106_0169019 3300048909 Bacteria 1732
1395 Ga0496106_0213333 3300048909 Bacteria 1538
1396 Ga0496108_0009930 3300048911 Bacteria 7717
1397 Ga0496108_0031413 3300048911 Bacteria 4407
1398 Ga0496108_0318809 3300048911 Bacteria 1355
1399 Ga0496109_0024724 3300048912 Bacteria 5343
1400 Ga0496109_0045598 3300048912 Bacteria 3979
1401 Ga0496109_0515619 3300048912 Bacteria 1128
1402 Ga0496110_0003845 3300048913 Bacteria 11565
1403 Ga0496110_0186949 3300048913 Bacteria 1881
1404 Ga0496110_0405517 3300048913 Bacteria 1243
1405 Ga0496110_0577838 3300048913 Bacteria 1020
1406 Ga0496111_0012444 3300048914 Bacteria 5761
1407 Ga0496111_0228854 3300048914 Bacteria 1381
1408 Ga0496112_0006853 3300048915 Bacteria 10046
1409 Ga0496112_0010953 3300048915 Bacteria 8258
1410 Ga0496112_0046021 3300048915 Bacteria 4278
1411 Ga0496112_0132838 3300048915 Bacteria 2460
1412 Ga0496112_0497106 3300048915 Bacteria 1155
1413 Ga0496113_0015336 3300048916 Bacteria 5263
1414 Ga0496113_0057769 3300048916 Bacteria 2917
1415 Ga0496114_0007786 3300048917 Bacteria 8476
1416 Ga0496114_0082230 3300048917 Bacteria 2722
1417 Ga0496114_0165394 3300048917 Bacteria 1925
1418 Ga0496115_0028920 3300048918 Bacteria 4347
1419 Ga0496115_0330922 3300048918 Bacteria 1244
1420 Ga0496116_0000031 3300048919 Bacteria 420043
1421 Ga0496116_0000127 3300048919 Bacteria 158773
1422 Ga0496116_0000226 3300048919 Bacteria 104792
1423 Ga0496116_0000572 3300048919 Bacteria 49208
1424 Ga0496116_0014162 3300048919 Bacteria 6382
1425 Ga0496116_0014235 3300048919 Bacteria 6365
1426 Ga0496116_0035327 3300048919 Bacteria 3511
1427 Ga0496116_0037864 3300048919 Bacteria 3357
1428 Ga0496117_0000004 3300048920 Bacteria 877131
1429 Ga0496117_0000135 3300048920 Bacteria 160708
1430 Ga0496117_0000180 3300048920 Bacteria 128746
1431 Ga0496117_0004890 3300048920 Bacteria 14447
1432 Ga0496117_0005651 3300048920 Bacteria 13047
1433 Ga0496117_0014392 3300048920 Bacteria 6819
1434 Ga0496117_0110788 3300048920 Bacteria 1710
1435 Ga0496117_0123000 3300048920 Bacteria 1590
1436 Ga0496118_0000024 3300048921 Bacteria 385236
1437 Ga0496118_0000098 3300048921 Bacteria 160610
1438 Ga0496118_0004392 3300048921 Bacteria 16755
1439 Ga0496118_0004762 3300048921 Bacteria 15873
1440 Ga0496118_0012358 3300048921 Bacteria 8208
1441 Ga0496118_0015435 3300048921 Bacteria 7068
1442 Ga0496118_0019027 3300048921 Bacteria 6156
1443 Ga0496118_0021029 3300048921 Bacteria 5760
1444 Ga0496118_0022741 3300048921 Bacteria 5467
1445 Ga0496118_0024262 3300048921 Bacteria 5242
1446 Ga0496119_0000607 3300048922 Bacteria 48405
1447 Ga0496119_0000910 3300048922 Bacteria 38340
1448 Ga0496119_0001660 3300048922 Bacteria 26100
1449 Ga0496119_0002597 3300048922 Bacteria 19610
1450 Ga0496119_0007945 3300048922 Bacteria 9439
1451 Ga0496119_0008110 3300048922 Bacteria 9306
1452 Ga0496119_0019994 3300048922 Bacteria 4901
1453 Ga0496119_0021335 3300048922 Bacteria 4685
1454 Ga0496119_0021590 3300048922 Bacteria 4644
1455 Ga0496119_0034044 3300048922 Bacteria 3364
1456 Ga0496119_0035277 3300048922 Bacteria 3279
1457 Ga0496120_0000043 3300048923 Bacteria 195584
1458 Ga0496120_0000346 3300048923 Bacteria 76271
1459 Ga0496120_0000739 3300048923 Bacteria 47763
1460 Ga0496120_0001541 3300048923 Bacteria 27015
1461 Ga0496120_0003009 3300048923 Bacteria 15982
1462 Ga0496120_0003653 3300048923 Bacteria 13782
1463 Ga0496120_0015232 3300048923 Bacteria 5082
1464 Ga0496120_0016089 3300048923 Bacteria 4901
1465 Ga0496120_0045632 3300048923 Bacteria 2537
1466 Ga0496120_0112820 3300048923 Bacteria 1417
1467 Ga0496121_0000185 3300048924 Bacteria 138586
1468 Ga0496121_0007154 3300048924 Bacteria 13531
1469 Ga0496121_0008012 3300048924 Bacteria 12609
1470 Ga0496121_0037688 3300048924 Bacteria 4290
1471 Ga0496121_0046234 3300048924 Bacteria 3728
1472 Ga0496121_0080512 3300048924 Bacteria 2581
1473 Ga0496121_0159178 3300048924 Bacteria 1653
1474 Ga0496122_0000013 3300048925 Bacteria 501039
1475 Ga0496122_0000026 3300048925 Bacteria 360871
1476 Ga0496122_0000796 3300048925 Bacteria 60440
1477 Ga0496122_0010913 3300048925 Bacteria 9291
1478 Ga0496122_0012528 3300048925 Bacteria 8429
1479 Ga0496122_0055971 3300048925 Bacteria 2945
1480 Ga0496123_0000005 3300048926 Bacteria 658131
1481 Ga0496123_0000010 3300048926 Bacteria 501039
1482 Ga0496123_0000599 3300048926 Bacteria 61266
1483 Ga0496123_0000621 3300048926 Bacteria 59502
1484 Ga0496123_0001489 3300048926 Bacteria 32524
1485 Ga0496123_0004145 3300048926 Bacteria 15498
1486 Ga0496123_0004462 3300048926 Bacteria 14683
1487 Ga0496123_0018848 3300048926 Bacteria 5466
1488 Ga0496123_0083936 3300048926 Bacteria 1923
1489 Ga0496124_0000039 3300048927 Bacteria 307831
1490 Ga0496124_0000494 3300048927 Bacteria 67573
1491 Ga0496124_0002320 3300048927 Bacteria 25093
1492 Ga0496124_0002333 3300048927 Bacteria 25044
1493 Ga0496124_0005214 3300048927 Bacteria 14755
1494 Ga0496124_0015872 3300048927 Bacteria 7194
1495 Ga0496124_0016619 3300048927 Bacteria 6983
1496 Ga0496124_0020877 3300048927 Bacteria 6042
1497 Ga0496124_0029781 3300048927 Bacteria 4856
1498 Ga0496124_0047403 3300048927 Bacteria 3677
1499 Ga0496124_0087394 3300048927 Bacteria 2549
1500 Ga0496124_0095622 3300048927 Bacteria 2414
1501 Ga0496124_0098955 3300048927 Bacteria 2365
1502 Ga0496124_0173730 3300048927 Bacteria 1665
1503 Ga0496124_0213909 3300048927 Bacteria 1456
1504 Ga0496124_0230474 3300048927 Bacteria 1385
1505 Ga0496125_0000016 3300048928 Bacteria 512512
1506 Ga0496125_0000019 3300048928 Bacteria 474989
1507 Ga0496125_0000153 3300048928 Bacteria 152777
1508 Ga0496125_0000745 3300048928 Bacteria 53735
1509 Ga0496125_0008522 3300048928 Bacteria 10715
1510 Ga0496125_0018794 3300048928 Bacteria 6547
1511 Ga0496125_0023684 3300048928 Bacteria 5661
1512 Ga0496125_0029647 3300048928 Bacteria 4913
1513 Ga0496125_0044766 3300048928 Bacteria 3735
1514 Ga0496125_0053288 3300048928 Bacteria 3317
1515 Ga0496125_0161595 3300048928 Bacteria 1520
1516 Ga0496126_0001127 3300048929 Bacteria 44689
1517 Ga0496126_0002546 3300048929 Bacteria 24392
1518 Ga0496126_0008468 3300048929 Bacteria 11089
1519 Ga0496126_0048112 3300048929 Bacteria 3900
1520 Ga0496126_0051568 3300048929 Bacteria 3744
1521 Ga0496126_0237310 3300048929 Bacteria 1525
1522 Ga0496126_0300690 3300048929 Bacteria 1324
1523 Ga0501292_015342 3300049515 Bacteria 1197
1524 Ga0501031_0015367 3300049568 Bacteria 4972
1525 Ga0501031_0030309 3300049568 Bacteria 3528
1526 Ga0501031_0054386 3300049568 Bacteria 2608
1527 Ga0501031_0204757 3300049568 Bacteria 1287
1528 Ga0501031_0239317 3300049568 Bacteria 1180
1529 Ga0501031_0331000 3300049568 Bacteria 986
1530 Ga0501032_0000083 3300049569 Bacteria 82166
1531 Ga0501032_0104156 3300049569 Bacteria 1880
1532 Ga0501032_0289367 3300049569 Bacteria 1060
1533 Ga0501033_0089127 3300049570 Bacteria 2257
1534 Ga0501033_0094288 3300049570 Bacteria 2189
1535 Ga0501033_0173183 3300049570 Bacteria 1549
1536 Ga0501033_0330693 3300049570 Bacteria 1069
1537 Ga0501034_0000001 3300049571 Bacteria 2184493
1538 Ga0501034_0000111 3300049571 Bacteria 150159
1539 Ga0501034_0000631 3300049571 Bacteria 54635
1540 Ga0501034_0002511 3300049571 Bacteria 22011
1541 Ga0501034_0003433 3300049571 Bacteria 18098
1542 Ga0501034_0057611 3300049571 Bacteria 3906
1543 Ga0501034_0077903 3300049571 Bacteria 3320
1544 Ga0501034_0239514 3300049571 Bacteria 1761
1545 Ga0501036_0009735 3300049572 Bacteria 7915
1546 Ga0501036_0013571 3300049572 Bacteria 6772
1547 Ga0501036_0016266 3300049572 Bacteria 6213
1548 Ga0501036_0055144 3300049572 Bacteria 3367
1549 Ga0501036_0076855 3300049572 Bacteria 2825
1550 Ga0501036_0076916 3300049572 Bacteria 2823
1551 Ga0501036_0091520 3300049572 Bacteria 2569
1552 Ga0501036_0257519 3300049572 Bacteria 1462
1553 Ga0501037_0001430 3300049573 Bacteria 17514
1554 Ga0501037_0004422 3300049573 Bacteria 10209
1555 Ga0501037_0011895 3300049573 Bacteria 6408
1556 Ga0501037_0062375 3300049573 Bacteria 2717
1557 Ga0501038_0008351 3300049574 Bacteria 9526
1558 Ga0501038_0010540 3300049574 Bacteria 8453
1559 Ga0501038_0052946 3300049574 Bacteria 3497
1560 Ga0501038_0132136 3300049574 Bacteria 2048
1561 Ga0501038_0140845 3300049574 Bacteria 1973
1562 Ga0501039_0000035 3300049575 Bacteria 126278
1563 Ga0501039_0013944 3300049575 Bacteria 6149
1564 Ga0501039_0025923 3300049575 Bacteria 4507
1565 Ga0501039_0031295 3300049575 Bacteria 4101
1566 Ga0501039_0149154 3300049575 Bacteria 1837
1567 Ga0501039_0290130 3300049575 Bacteria 1286
1568 Ga0501039_0360399 3300049575 Bacteria 1142
1569 Ga0501040_0000117 3300049576 Bacteria 42158
1570 Ga0501040_0002406 3300049576 Bacteria 12044
1571 Ga0501040_0004032 3300049576 Bacteria 9541
1572 Ga0501040_0022464 3300049576 Bacteria 4221
1573 Ga0501040_0025603 3300049576 Bacteria 3967
1574 Ga0501040_0035462 3300049576 Bacteria 3383
1575 Ga0501040_0061595 3300049576 Bacteria 2581
1576 Ga0501040_0099925 3300049576 Bacteria 2022
1577 Ga0501040_0142674 3300049576 Bacteria 1687
1578 Ga0501040_0195594 3300049576 Bacteria 1435
1579 Ga0501041_0000547 3300049577 Bacteria 19456
1580 Ga0501041_0011399 3300049577 Bacteria 5253
1581 Ga0501041_0011926 3300049577 Bacteria 5145
1582 Ga0501041_0046822 3300049577 Bacteria 2631
1583 Ga0501041_0100575 3300049577 Bacteria 1789
1584 Ga0501041_0104429 3300049577 Bacteria 1755
1585 Ga0501042_0000083 3300049578 Bacteria 36197
1586 Ga0501042_0000919 3300049578 Bacteria 16528
1587 Ga0501042_0001267 3300049578 Bacteria 14710
1588 Ga0501042_0009392 3300049578 Bacteria 6516
1589 Ga0501042_0049715 3300049578 Bacteria 2991
1590 Ga0501042_0060212 3300049578 Bacteria 2712
1591 Ga0501042_0062585 3300049578 Bacteria 2659
1592 Ga0501042_0086617 3300049578 Bacteria 2246
1593 Ga0501042_0101190 3300049578 Bacteria 2072
1594 Ga0501042_0310415 3300049578 Bacteria 1139
1595 Ga0501043_0000235 3300049579 Bacteria 50082
1596 Ga0501043_0001265 3300049579 Bacteria 22213
1597 Ga0501043_0007584 3300049579 Bacteria 8601
1598 Ga0501043_0080879 3300049579 Bacteria 2553
1599 Ga0501046_0005185 3300049580 Bacteria 11665
1600 Ga0501046_0010871 3300049580 Bacteria 7801
1601 Ga0501046_0033195 3300049580 Bacteria 4173
1602 Ga0501046_0041883 3300049580 Bacteria 3652
1603 Ga0501046_0071056 3300049580 Bacteria 2705
1604 Ga0501046_0084993 3300049580 Bacteria 2440
1605 Ga0501046_0103404 3300049580 Bacteria 2183
1606 Ga0501046_0110712 3300049580 Bacteria 2098
1607 Ga0501047_0065774 3300049581 Bacteria 3494
1608 Ga0501047_0274976 3300049581 Bacteria 1530
1609 Ga0501047_0321700 3300049581 Bacteria 1386
1610 Ga0501048_0008026 3300049582 Bacteria 7993
1611 Ga0501048_0028232 3300049582 Bacteria 4073
1612 Ga0501048_0029246 3300049582 Bacteria 3998
1613 Ga0501048_0036840 3300049582 Bacteria 3514
1614 Ga0501067_0042426 3300049583 Bacteria 2526
1615 Ga0501067_0171500 3300049583 Bacteria 1208
1616 Ga0501067_0197094 3300049583 Bacteria 1122
1617 Ga0501068_0013168 3300049584 Bacteria 4703
1618 Ga0501068_0018969 3300049584 Bacteria 3987
1619 Ga0501068_0036925 3300049584 Bacteria 2924
1620 Ga0501068_0038439 3300049584 Bacteria 2867
1621 Ga0501068_0041932 3300049584 Bacteria 2751
1622 Ga0501068_0181525 3300049584 Bacteria 1331
1623 Ga0501069_0002974 3300049585 Bacteria 8720
1624 Ga0501070_0057491 3300049586 Bacteria 3224
1625 Ga0501070_0213484 3300049586 Bacteria 1583
1626 Ga0501071_0003522 3300049587 Bacteria 9793
1627 Ga0501071_0023335 3300049587 Bacteria 4320
1628 Ga0501071_0030797 3300049587 Bacteria 3797
1629 Ga0501071_0047520 3300049587 Bacteria 3083
1630 Ga0501071_0070816 3300049587 Bacteria 2541
1631 Ga0501071_0091045 3300049587 Bacteria 2240
1632 Ga0501071_0360650 3300049587 Bacteria 1107
1633 Ga0501072_0002580 3300049588 Bacteria 13575
1634 Ga0501072_0029867 3300049588 Bacteria 4259
1635 Ga0501072_0041751 3300049588 Bacteria 3603
1636 Ga0501072_0045187 3300049588 Bacteria 3462
1637 Ga0501072_0182599 3300049588 Bacteria 1673
1638 Ga0501072_0216725 3300049588 Bacteria 1525
1639 Ga0501072_0233281 3300049588 Bacteria 1466
1640 Ga0501072_0354556 3300049588 Bacteria 1164
1641 Ga0501073_0002174 3300049589 Bacteria 14657
1642 Ga0501073_0002203 3300049589 Bacteria 14576
1643 Ga0501073_0003195 3300049589 Bacteria 12295
1644 Ga0501073_0011918 3300049589 Bacteria 6347
1645 Ga0501073_0042830 3300049589 Bacteria 3194
1646 Ga0501073_0051903 3300049589 Bacteria 2872
1647 Ga0501074_0045225 3300049590 Bacteria 3186
1648 Ga0501074_0046570 3300049590 Bacteria 3135
1649 Ga0501074_0060237 3300049590 Bacteria 2734
1650 Ga0501074_0085926 3300049590 Bacteria 2254
1651 Ga0501074_0094559 3300049590 Bacteria 2140
1652 Ga0501074_0162020 3300049590 Bacteria 1597
1653 Ga0501074_0190039 3300049590 Bacteria 1464
1654 Ga0501074_0214848 3300049590 Bacteria 1370
1655 Ga0501075_0001934 3300049591 Bacteria 13661
1656 Ga0501075_0002970 3300049591 Bacteria 11345
1657 Ga0501075_0015291 3300049591 Bacteria 5505
1658 Ga0501075_0021569 3300049591 Bacteria 4698
1659 Ga0501075_0022923 3300049591 Bacteria 4566
1660 Ga0501075_0033611 3300049591 Bacteria 3815
1661 Ga0501075_0064953 3300049591 Bacteria 2753
1662 Ga0501076_0005189 3300049592 Bacteria 9325
1663 Ga0501076_0010763 3300049592 Bacteria 6799
1664 Ga0501076_0017411 3300049592 Bacteria 5461
1665 Ga0501076_0021390 3300049592 Bacteria 4962
1666 Ga0501076_0027519 3300049592 Bacteria 4408
1667 Ga0501076_0075806 3300049592 Bacteria 2696
1668 Ga0501076_0229464 3300049592 Bacteria 1517
1669 Ga0501077_0009289 3300049593 Bacteria 6103
1670 Ga0501077_0014244 3300049593 Bacteria 4994
1671 Ga0501077_0016766 3300049593 Bacteria 4619
1672 Ga0501077_0035021 3300049593 Bacteria 3196
1673 Ga0501077_0062790 3300049593 Bacteria 2356
1674 Ga0501077_0067722 3300049593 Bacteria 2263
1675 Ga0501077_0107633 3300049593 Bacteria 1767
1676 Ga0501077_0121095 3300049593 Bacteria 1658
1677 Ga0501198_009062 3300049649 Bacteria 1455
1678 Ga0501201_005317 3300049651 Bacteria 1202
1679 Ga0501216_014709 3300049660 Bacteria 1311
1680 Ga0501217_016126 3300049661 Bacteria 1709
1681 Ga0501223_016096 3300049663 Bacteria 1479
1682 Ga0501257_039723 3300049686 Bacteria 1153
1683 Ga0501221_027351 3300049704 Bacteria 1165
1684 Ga0501225_0011087 3300049705 Bacteria 2541
1685 Ga0501079_0009499 3300049741 Bacteria 7373
1686 Ga0501079_0010315 3300049741 Bacteria 7098
1687 Ga0501079_0012424 3300049741 Bacteria 6497
1688 Ga0501079_0017612 3300049741 Bacteria 5456
1689 Ga0501079_0035861 3300049741 Bacteria 3818
1690 Ga0501079_0060493 3300049741 Bacteria 2921
1691 Ga0501079_0107990 3300049741 Bacteria 2160
1692 Ga0501079_0132275 3300049741 Bacteria 1941
1693 Ga0501080_0002504 3300049742 Bacteria 16090
1694 Ga0501080_0008777 3300049742 Bacteria 9185
1695 Ga0501080_0013038 3300049742 Bacteria 7632
1696 Ga0501080_0026708 3300049742 Bacteria 5365
1697 Ga0501080_0049146 3300049742 Bacteria 3926
1698 Ga0501080_0060695 3300049742 Bacteria 3520
1699 Ga0501080_0108015 3300049742 Bacteria 2579
1700 Ga0501080_0157332 3300049742 Bacteria 2099
1701 Ga0501081_0003765 3300049743 Bacteria 9712
1702 Ga0501081_0004698 3300049743 Bacteria 8782
1703 Ga0501081_0014989 3300049743 Bacteria 5115
1704 Ga0501081_0017926 3300049743 Bacteria 4696
1705 Ga0501081_0022284 3300049743 Bacteria 4236
1706 Ga0501081_0045012 3300049743 Bacteria 3030
1707 Ga0501081_0071324 3300049743 Bacteria 2421
1708 Ga0501081_0090903 3300049743 Bacteria 2146
1709 Ga0501083_0001924 3300049744 Bacteria 14282
1710 Ga0501083_0006699 3300049744 Bacteria 8174
1711 Ga0501083_0018991 3300049744 Bacteria 4785
1712 Ga0501083_0028126 3300049744 Bacteria 3877
1713 Ga0501083_0040058 3300049744 Bacteria 3181
1714 Ga0501083_0102351 3300049744 Bacteria 1888
1715 Ga0501083_0103777 3300049744 Bacteria 1873
1716 Ga0501083_0198825 3300049744 Bacteria 1308
1717 Ga0501279_011995 3300049775 Bacteria 1177
1718 Ga0501035_0008587 3300049822 Bacteria 9508
1719 Ga0501035_0018241 3300049822 Bacteria 6464
1720 Ga0501035_0053601 3300049822 Bacteria 3605
1721 Ga0501035_0200901 3300049822 Bacteria 1710
1722 Ga0501044_0001025 3300049823 Bacteria 33664
1723 Ga0501044_0004772 3300049823 Bacteria 15163
1724 Ga0501044_0034687 3300049823 Bacteria 5289
1725 Ga0501044_0252408 3300049823 Bacteria 1704
1726 Ga0501044_0253422 3300049823 Bacteria 1700
1727 Ga0501044_0423712 3300049823 Bacteria 1241
1728 Ga0501044_0493273 3300049823 Bacteria 1127
1729 Ga0501045_0025790 3300049824 Bacteria 4226
1730 Ga0501045_0046476 3300049824 Bacteria 3161
1731 Ga0501045_0049749 3300049824 Bacteria 3056
1732 Ga0501045_0080137 3300049824 Bacteria 2407
1733 Ga0501045_0182589 3300049824 Bacteria 1563
1734 Ga0501045_0274665 3300049824 Bacteria 1254
1735 Ga0501226_000003 3300049853 Bacteria 358977
1736 nmdc:mga03683_5_c1 3300050489 Bacteria 157897
1737 nmdc:mga00v17_12789_c1 3300050491 Bacteria 4638
1738 nmdc:mga00v17_142015_c1 3300050491 Bacteria 1540
1739 nmdc:mga00v17_95_c1 3300050491 Bacteria 52432
1740 nmdc:mga0yw44_124019_c1 3300050492 Bacteria 1666
1741 nmdc:mga05p37_2021_c1 3300050507 Bacteria 19081
1742 nmdc:mga05p37_20776_c1 3300050507 Bacteria 7946
1743 nmdc:mga05p37_36937_c1 3300050507 Bacteria 5992
1744 nmdc:mga05p37_508807_c1 3300050507 Bacteria 1380
1745 nmdc:mga05p37_5259_c1 3300050507 Bacteria 15191
1746 nmdc:mga05p37_561729_c1 3300050507 Bacteria 1296
1747 nmdc:mga05p37_580485_c1 3300050507 Bacteria 1270
1748 nmdc:mga05p37_717383_c1 3300050507 Bacteria 1108
1749 nmdc:mga05p37_74297_c1 3300050507 Bacteria 4184
1750 nmdc:mga09592_175155_c1 3300050508 Bacteria 1855
1751 nmdc:mga09592_291293_c1 3300050508 Bacteria 1415
1752 nmdc:mga09592_58571_c1 3300050508 Bacteria 3258
1753 nmdc:mga0qj67_12711_c1 3300050509 Bacteria 6350
1754 nmdc:mga0qj67_181929_c1 3300050509 Bacteria 1707
1755 nmdc:mga0qj67_202320_c1 3300050509 Bacteria 1613
1756 nmdc:mga0qj67_35466_c1 3300050509 Bacteria 3900
1757 nmdc:mga0qj67_86741_c1 3300050509 Bacteria 2511
1758 nmdc:mga0qj67_94900_c1 3300050509 Bacteria 2400
1759 nmdc:mga06r32_11152_c1 3300050510 Bacteria 8093
1760 nmdc:mga06r32_205043_c1 3300050510 Bacteria 1960
1761 nmdc:mga06r32_376815_c1 3300050510 Bacteria 1402
1762 nmdc:mga06r32_655_c1 3300050510 Bacteria 29828
1763 nmdc:mga06r32_6951_c1 3300050510 Bacteria 10178
1764 nmdc:mga06r32_8_c1 3300050510 Bacteria 120971
1765 nmdc:mga08y16_11018_c1 3300050511 Bacteria 9494
1766 nmdc:mga08y16_227641_c1 3300050511 Bacteria 1929
1767 nmdc:mga08y16_31617_c1 3300050511 Bacteria 5566
1768 nmdc:mga08y16_401325_c1 3300050511 Bacteria 1403
1769 nmdc:mga08y16_6430_c1 3300050511 Bacteria 12317
1770 nmdc:mga08y16_86717_c1 3300050511 Bacteria 3262
1771 nmdc:mga0n895_254252_c1 3300050512 Bacteria 1783
1772 nmdc:mga0n895_259497_c1 3300050512 Bacteria 1764
1773 nmdc:mga0n895_27398_c1 3300050512 Bacteria 5414
1774 nmdc:mga0n895_308182_c1 3300050512 Bacteria 1605
1775 nmdc:mga0n895_39895_c1 3300050512 Bacteria 4559
1776 nmdc:mga0n895_44251_c1 3300050512 Bacteria 4342
1777 nmdc:mga0rr50_11989_c1 3300050513 Bacteria 5579
1778 nmdc:mga0rr50_132155_c1 3300050513 Bacteria 2000
1779 nmdc:mga0rr50_284088_c1 3300050513 Bacteria 1381
1780 nmdc:mga08x19_141863_c1 3300050514 Bacteria 1623
1781 nmdc:mga08x19_288_c1 3300050514 Bacteria 37103
1782 nmdc:mga08x19_36830_c1 3300050514 Bacteria 3100
1783 nmdc:mga0a205_10397_c3 3300050515 Bacteria 5739
1784 nmdc:mga0a205_12207_c1 3300050515 Bacteria 7944
1785 nmdc:mga0a205_17204_c1 3300050515 Bacteria 6772
1786 nmdc:mga0a205_236593_c1 3300050515 Bacteria 1708
1787 nmdc:mga0a205_53663_c2 3300050515 Bacteria 1997
1788 nmdc:mga0a205_81801_c1 3300050515 Bacteria 3120
1789 Ga0495601_0009426 3300053077 Bacteria 5774
1790 Ga0495619_0239583 3300053085 Bacteria 1257
1791 Ga0500644_0133019 3300053088 Bacteria 981
1792 Ga0500583_0017734 3300053092 Bacteria 2877
1793 Ga0500583_0050946 3300053092 Bacteria 1922
1794 Ga0500641_0018948 3300053096 Bacteria 2595
1795 Ga0500650_0000015 3300053098 Bacteria 71164
1796 Ga0500556_0000396 3300053104 Bacteria 31826
1797 Ga0500572_010893 3300053111 Bacteria 2187
1798 Ga0500594_0013748 3300053118 Bacteria 1928
1799 Ga0500568_0006857 3300053139 Bacteria 5670
1800 Ga0500588_0010421 3300053146 Bacteria 2243
1801 Ga0500616_0000018 3300053153 Bacteria 610976
1802 Ga0500616_0021554 3300053153 Bacteria 3609
1803 Ga0500622_0012338 3300053156 Bacteria 4627
1804 Ga0500636_0004298 3300053177 Bacteria 8063
1805 Ga0501084_0005220 3300054114 Bacteria 10632
1806 Ga0501084_0022291 3300054114 Bacteria 5286
1807 Ga0501084_0028663 3300054114 Bacteria 4655
1808 Ga0501084_0034480 3300054114 Bacteria 4232
1809 Ga0501084_0037110 3300054114 Bacteria 4071
1810 Ga0501084_0058928 3300054114 Bacteria 3213
1811 Ga0501084_0070139 3300054114 Bacteria 2935
1812 Ga0501084_0151702 3300054114 Bacteria 1953
1813 Ga0501084_0509051 3300054114 Bacteria 1018
1814 Ga0590075_004559 3300059424 Bacteria 3283
1815 Ga0590077_026834 3300059426 Bacteria 1246
1816 Ga0501082_0000931 3300060353 Bacteria 25889
1817 Ga0501082_0016376 3300060353 Bacteria 6382
1818 Ga0501082_0038667 3300060353 Bacteria 4115
1819 Ga0501082_0046622 3300060353 Bacteria 3735
1820 Ga0501082_0050995 3300060353 Bacteria 3567
1821 Ga0501082_0063910 3300060353 Bacteria 3169
1822 Ga0501082_0104388 3300060353 Bacteria 2451
1823 Ga0501082_0153081 3300060353 Bacteria 2003
1824 Ga0501082_0178163 3300060353 Bacteria 1848
1825 Ga0466962_0000808 3300061719 Bacteria 14132
1826 Ga0530510_0003427 3300061734 Bacteria 10903
1827 Ga0530510_0034595 3300061734 Bacteria 3640
1828 Ga0530510_0038137 3300061734 Bacteria 3468
1829 Ga0530510_0042114 3300061734 Bacteria 3298
1830 Ga0530510_0042216 3300061734 Bacteria 3294
1831 Ga0530510_0054537 3300061734 Bacteria 2888
1832 Ga0530510_0061146 3300061734 Bacteria 2727
1833 Ga0530510_0235894 3300061734 Bacteria 1361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0181793 Ga0495664_0181793_198_1232 254
2 3300053092 Ga0500583_0017734 Ga0500583_0017734_47_1321 254
3 3300049583 Ga0501067_0042426 Ga0501067_0042426_274_1176 278
4 3300049589 Ga0501073_0002174 Ga0501073_0002174_3191_4093 278
5 3300049590 Ga0501074_0085926 Ga0501074_0085926_29_931 278
6 3300049593 Ga0501077_0014244 Ga0501077_0014244_3545_4447 278
7 3300049742 Ga0501080_0008777 Ga0501080_0008777_5093_5995 278
8 3300054114 Ga0501084_0151702 Ga0501084_0151702_445_1347 278
9 3300005336 Ga0070680_100044281 Ga0070680_1000442813 280
10 3300005458 Ga0070681_10018006 Ga0070681_100180063 280
11 3300005530 Ga0070679_100015491 Ga0070679_1000154916 280
12 3300009093 Ga0105240_10161453 Ga0105240_101614532 280
13 3300025917 Ga0207660_10086767 Ga0207660_100867671 280
14 3300025981 Ga0207640_10243989 Ga0207640_102439892 280
15 3300005444 Ga0070694_100178536 Ga0070694_1001785362 281
16 3300005549 Ga0070704_100309266 Ga0070704_1003092662 281
17 3300006844 Ga0075428_100044435 Ga0075428_1000444353 281
18 3300009094 Ga0111539_10000873 Ga0111539_1000087323 281
19 3300009147 Ga0114129_10035673 Ga0114129_100356737 281
20 3300010159 Ga0099796_10013635 Ga0099796_100136352 281
21 3300027907 Ga0207428_10026727 Ga0207428_100267272 281
22 3300050507 nmdc:mga05p37_717383_c1 nmdc:mga05p37_717383_c1_140_1033 281
23 3300050511 nmdc:mga08y16_6430_c1 nmdc:mga08y16_6430_c1_10438_11331 281
24 3300036712 Ga0316584_0314946 Ga0316584_0314946_220_1086 282
25 3300061734 Ga0530510_0003427 Ga0530510_0003427_3700_4566 282
26 3300031733 Ga0316577_10044108 Ga0316577_100441081 283
27 3300042876 Ga0451577_0077761 Ga0451577_0077761_544_1521 283
28 3300042876 Ga0451577_0146880 Ga0451577_0146880_468_1454 283
29 3300044712 Ga0453684_0005156 Ga0453684_0005156_3128_4006 283
30 iso_pu_bacteria 2687453341 2688396053 283
31 3300044712 Ga0453684_0038916 Ga0453684_0038916_2912_3838 284
32 3300025928 Ga0207700_10219531 Ga0207700_102195312 285
33 3300028563 Ga0265319_1009764 Ga0265319_10097643 285
34 3300028573 Ga0265334_10001001 Ga0265334_100010015 285
35 3300031235 Ga0265330_10004820 Ga0265330_100048205 285
36 3300031238 Ga0265332_10003208 Ga0265332_100032085 285
37 3300031239 Ga0265328_10002929 Ga0265328_100029292 285
38 3300031240 Ga0265320_10004740 Ga0265320_100047405 285
39 3300031242 Ga0265329_10002627 Ga0265329_100026275 285
40 3300031250 Ga0265331_10002121 Ga0265331_100021216 285
41 3300031344 Ga0265316_10002394 Ga0265316_100023945 285
42 3300031344 Ga0265316_10262931 Ga0265316_102629311 285
43 3300031595 Ga0265313_10008626 Ga0265313_100086264 285
44 3300031711 Ga0265314_10015358 Ga0265314_100153585 285
45 3300031712 Ga0265342_10003602 Ga0265342_1000360210 285
46 iso_pu_bacteria 2510065053 2510283610 285
47 iso_pu_bacteria 2510065055 2510292562 285
48 iso_pu_bacteria 2510065058 2510311654 285
49 iso_pu_bacteria 2510917027 2511176668 285
50 iso_pu_bacteria 2511231004 2511254642 285
51 iso_pu_bacteria 2511231006 2511268480 285
52 iso_pu_bacteria 2511231007 2511270692 285
53 iso_pu_bacteria 2511231008 2511277271 285
54 iso_pu_bacteria 2511231010 2511292425 285
55 iso_pu_bacteria 2511231011 2511294709 285
56 iso_pu_bacteria 2511231012 2511303381 285
57 iso_pu_bacteria 2511231014 2511312814 285
58 iso_pu_bacteria 2511231015 2511320254 285
59 iso_pu_bacteria 2511231016 2511328750 285
60 iso_pu_bacteria 2511231017 2511331700 285
61 iso_pu_bacteria 2511231018 2511340200 285
62 iso_pu_bacteria 2511231019 2511343887 285
63 iso_pu_bacteria 2511231020 2511350201 285
64 iso_pu_bacteria 2511231021 2511358527 285
65 iso_pu_bacteria 2511231022 2511362837 285
66 iso_pu_bacteria 2511231023 2511369843 285
67 iso_pu_bacteria 2511231024 2511374044 285
68 iso_pu_bacteria 2511231031 2511416258 285
69 iso_pu_bacteria 2511231156 2511826227 285
70 iso_pu_bacteria 2512047018 2512324847 285
71 iso_pu_bacteria 2512564013 2512636988 285
72 iso_pu_bacteria 2554235132 2554816133 285
73 iso_pu_bacteria 2554235231 2555247193 285
74 iso_pu_bacteria 2554235341 2555668702 285
75 iso_pu_bacteria 2571042588 2573039384 285
76 iso_pu_bacteria 2576861424 2578337503 285
77 iso_pu_bacteria 2579778775 2580935236 285
78 iso_pu_bacteria 2582580891 2583790971 285
79 iso_pu_bacteria 2597489887 2597856884 285
80 iso_pu_bacteria 2597489888 2597863085 285
81 iso_pu_bacteria 2597489889 2597868878 285
82 iso_pu_bacteria 2599185155 2599326655 285
83 iso_pu_bacteria 2599185160 2599357075 285
84 iso_pu_bacteria 2599185161 2599362138 285
85 iso_pu_bacteria 2599185162 2599368458 285
86 iso_pu_bacteria 2599185163 2599375247 285
87 iso_pu_bacteria 2599185164 2599382180 285
88 iso_pu_bacteria 2599185165 2599388627 285
89 iso_pu_bacteria 2599185166 2599394105 285
90 iso_pu_bacteria 2599185167 2599401668 285
91 iso_pu_bacteria 2599185168 2599405870 285
92 iso_pu_bacteria 2599185179 2599451789 285
93 iso_pu_bacteria 2599185181 2599464420 285
94 iso_pu_bacteria 2599185182 2599468744 285
95 iso_pu_bacteria 2599185185 2599483911 285
96 iso_pu_bacteria 2599185186 2599493443 285
97 iso_pu_bacteria 2599185188 2599504229 285
98 iso_pu_bacteria 2599185189 2599509566 285
99 iso_pu_bacteria 2599185190 2599514914 285
100 iso_pu_bacteria 2599185191 2599521011 285
101 iso_pu_bacteria 2599185212 2599613512 285
102 iso_pu_bacteria 2599185248 2599772423 285
103 iso_pu_bacteria 2599185257 2599801557 285
104 iso_pu_bacteria 2599185288 2599882259 285
105 iso_pu_bacteria 2599185289 2599888855 285
106 iso_pu_bacteria 2599185290 2599894289 285
107 iso_pu_bacteria 2599185291 2599900484 285
108 iso_pu_bacteria 2599185300 2599933510 285
109 iso_pu_bacteria 2599185302 2599944038 285
110 iso_pu_bacteria 2599185303 2599952375 285
111 iso_pu_bacteria 2599185304 2599955750 285
112 iso_pu_bacteria 2599185305 2599961380 285
113 iso_pu_bacteria 2599185306 2599967290 285
114 iso_pu_bacteria 2599185307 2599970489 285
115 iso_pu_bacteria 2599185308 2599979315 285
116 iso_pu_bacteria 2599185309 2599985551 285
117 iso_pu_bacteria 2599185310 2599989424 285
118 iso_pu_bacteria 2599185311 2599994347 285
119 iso_pu_bacteria 2599185312 2600000180 285
120 iso_pu_bacteria 2599185313 2600008372 285
121 iso_pu_bacteria 2599185314 2600013200 285
122 iso_pu_bacteria 2599185315 2600019678 285
123 iso_pu_bacteria 2599185316 2600023640 285
124 iso_pu_bacteria 2599185317 2600032521 285
125 iso_pu_bacteria 2599185318 2600038992 285
126 iso_pu_bacteria 2599185319 2600044859 285
127 iso_pu_bacteria 2599185320 2600048487 285
128 iso_pu_bacteria 2599185321 2600054188 285
129 iso_pu_bacteria 2599185322 2600060401 285
130 iso_pu_bacteria 2599185323 2600066505 285
131 iso_pu_bacteria 2599185324 2600073431 285
132 iso_pu_bacteria 2599185325 2600078185 285
133 iso_pu_bacteria 2599185356 2600216697 285
134 iso_pu_bacteria 2600254930 2600361750 285
135 iso_pu_bacteria 2600254931 2600365854 285
136 iso_pu_bacteria 2600254954 2600444490 285
137 iso_pu_bacteria 2600255283 2601624881 285
138 iso_pu_bacteria 2600255296 2601694203 285
139 iso_pu_bacteria 2600255313 2601776706 285
140 iso_pu_bacteria 2600255318 2601795528 285
141 iso_pu_bacteria 2600255389 2602011575 285
142 iso_pu_bacteria 2603880185 2606075598 285
143 iso_pu_bacteria 2603880199 2606128491 285
144 iso_pu_bacteria 2606217733 2608382493 285
145 iso_pu_bacteria 2619619294 2621275832 285
146 iso_pu_bacteria 2619619299 2621300838 285
147 iso_pu_bacteria 2623620443 2624479465 285
148 iso_pu_bacteria 2623620446 2624493536 285
149 iso_pu_bacteria 2643221565 2643841725 285
150 iso_pu_bacteria 2643221571 2643871856 285
151 iso_pu_bacteria 2643221589 2643952601 285
152 iso_pu_bacteria 2643221602 2644022363 285
153 iso_pu_bacteria 2643221633 2644188566 285
154 iso_pu_bacteria 2643221650 2644286136 285
155 iso_pu_bacteria 2643221713 2644623091 285
156 iso_pu_bacteria 2651869719 2652547792 285
157 iso_pu_bacteria 2667528170 2671093145 285
158 iso_pu_bacteria 2667528171 2671098777 285
159 iso_pu_bacteria 2667528176 2671128985 285
160 iso_pu_bacteria 2671180172 2671768506 285
161 iso_pu_bacteria 2675903420 2677898206 285
162 iso_pu_bacteria 2675903515 2678264566 285
163 iso_pu_bacteria 2713897148 2715753859 285
164 iso_pu_bacteria 2713897149 2715757731 285
165 iso_pu_bacteria 2718217725 2718633314 285
166 iso_pu_bacteria 2721755607 2723247905 285
167 iso_pu_bacteria 2738541265 2738670543 285
168 iso_pu_bacteria 2738541271 2738688525 285
169 iso_pu_bacteria 2738541282 2738748936 285
170 iso_pu_bacteria 2738541294 2738810912 285
171 iso_pu_bacteria 2738541303 2738857978 285
172 iso_pu_bacteria 2738541309 2738898272 285
173 iso_pu_bacteria 2738543004 2739202291 285
174 iso_pu_bacteria 2738543015 2739261140 285
175 iso_pu_bacteria 2738543016 2739264257 285
176 iso_pu_bacteria 2738543020 2739288063 285
177 iso_pu_bacteria 2738543021 2739293608 285
178 iso_pu_bacteria 2738543025 2739315990 285
179 iso_pu_bacteria 2740892503 2743736312 285
180 iso_pu_bacteria 2744054620 2745005020 285
181 iso_pu_bacteria 2744054657 2745166698 285
182 iso_pu_bacteria 2765235841 2765582959 285
183 iso_pu_bacteria 2773857670 2774121313 285
184 iso_pu_bacteria 2773857672 2774128618 285
185 iso_pu_bacteria 2773857673 2774137623 285
186 iso_pu_bacteria 2784132063 2784265626 285
187 iso_pu_bacteria 2784132072 2784317393 285
188 iso_pu_bacteria 2791355520 2794595119 285
189 iso_pu_bacteria 2806310737 2807407470 285
190 iso_pu_bacteria 2806310745 2807455807 285
191 iso_pu_bacteria 2808606361 2808857018 285
192 iso_pu_bacteria 2808606373 2808903947 285
193 iso_pu_bacteria 2808606376 2808926963 285
194 iso_pu_bacteria 2808606377 2808927393 285
195 iso_pu_bacteria 2808606378 2808937090 285
196 iso_pu_bacteria 2808606379 2808941337 285
197 iso_pu_bacteria 2808606380 2808949103 285
198 iso_pu_bacteria 2808606381 2808950068 285
199 iso_pu_bacteria 2808606382 2808961562 285
200 iso_pu_bacteria 2808606383 2808965406 285
201 iso_pu_bacteria 2808606385 2808979374 285
202 iso_pu_bacteria 2808606388 2808995298 285
203 iso_pu_bacteria 2808606389 2809000353 285
204 iso_pu_bacteria 2808606445 2809216402 285
205 iso_pu_bacteria 2811994881 2812365973 285
206 iso_pu_bacteria 2816332298 2817489862 285
207 iso_pu_bacteria 2816332336 2817619509 285
208 iso_pu_bacteria 2818991456 2819653979 285
209 iso_pu_bacteria 2818991464 2819703898 285
210 iso_pu_bacteria 2821443989 2821450929 285
211 iso_pu_bacteria 2823421272 2823423906 285
212 iso_pu_bacteria 2825651385 2825656490 285
213 iso_pu_bacteria 2826581358 2826583041 285
214 iso_pu_bacteria 2834028612 2834029735 285
215 iso_pu_bacteria 2842805378 2842809486 285
216 iso_pu_bacteria 2842815866 2842817553 285
217 iso_pu_bacteria 2842826826 2842832281 285
218 iso_pu_bacteria 2842832357 2842832664 285
219 iso_pu_bacteria 2842837860 2842841491 285
220 iso_pu_bacteria 2842843487 2842848251 285
221 iso_pu_bacteria 2842849001 2842850704 285
222 iso_pu_bacteria 2842854478 2842856877 285
223 iso_pu_bacteria 2843690924 2843691705 285
224 iso_pu_bacteria 2844665904 2844669204 285
225 iso_pu_bacteria 2846033681 2846034899 285
226 iso_pu_bacteria 2846037992 2846039701 285
227 iso_pu_bacteria 2852612431 2852618381 285
228 iso_pu_bacteria 2852657418 2852658949 285
229 iso_pu_bacteria 2852667396 2852673483 285
230 iso_pu_bacteria 2857460504 2857461523 285
231 iso_pu_bacteria 2857465823 2857466833 285
232 iso_pu_bacteria 2857591370 2857592832 285
233 iso_pu_bacteria 2860339153 2860339990 285
234 iso_pu_bacteria 2860867994 2860869730 285
235 iso_pu_bacteria 2878029506 2878031468 285
236 iso_pu_bacteria 2880230671 2880232339 285
237 iso_pu_bacteria 2881636855 2881637153 285
238 iso_pu_bacteria 2898907183 2898907651 285
239 iso_pu_bacteria 2904518522 2904521770 285
240 iso_pu_bacteria 2904550169 2904553166 285
241 iso_pu_bacteria 2908446538 2908448672 285
242 iso_pu_bacteria 2912963787 2912965493 285
243 iso_pu_bacteria 2913036834 2913041043 285
244 iso_pu_bacteria 2915597211 2915602173 285
245 iso_pu_bacteria 2915606848 2915610949 285
246 iso_pu_bacteria 2917070673 2917072476 285
247 iso_pu_bacteria 2917832318 2917837228 285
248 iso_pu_bacteria 2919063839 2919064060 285
249 iso_pu_bacteria 2919125081 2919126771 285
250 iso_pu_bacteria 2919155634 2919159766 285
251 iso_pu_bacteria 2919385768 2919386432 285
252 iso_pu_bacteria 2919456309 2919457084 285
253 iso_pu_bacteria 2919481497 2919486201 285
254 iso_pu_bacteria 2919487758 2919491285 285
255 iso_pu_bacteria 2919501602 2919503242 285
256 iso_pu_bacteria 2919697872 2919702838 285
257 iso_pu_bacteria 2923153595 2923155326 285
258 iso_pu_bacteria 2923519811 2923519993 285
259 iso_pu_bacteria 2923586266 2923590078 285
260 iso_pu_bacteria 2926063275 2926066187 285
261 iso_pu_bacteria 2929144301 2929148543 285
262 iso_pu_bacteria 2929183550 2929187270 285
263 iso_pu_bacteria 2929189879 2929191702 285
264 iso_pu_bacteria 2931369376 2931374015 285
265 iso_pu_bacteria 2931390751 2931392805 285
266 iso_pu_bacteria 2931396565 2931400118 285
267 iso_pu_bacteria 2935353572 2935354640 285
268 iso_pu_bacteria 2939636861 2939639711 285
269 iso_pu_bacteria 2939651529 2939655487 285
270 iso_pu_bacteria 2945928738 2945928865 285
271 iso_pu_bacteria 2945961074 2945965124 285
272 iso_pu_bacteria 2946006987 2946011067 285
273 iso_pu_bacteria 2946027586 2946029985 285
274 iso_pu_bacteria 2947233263 2947236559 285
275 iso_pu_bacteria 2968558590 2968561430 285
276 iso_pu_bacteria 2969304461 2969306252 285
277 iso_pu_bacteria 2974289157 2974292094 285
278 iso_pu_bacteria 2974298342 2974299256 285
279 iso_pu_bacteria 2984286254 2984290712 285
280 iso_pu_bacteria 2984499530 2984501573 285
281 iso_pu_bacteria 2984504281 2984505030 285
282 iso_pu_bacteria 2984527788 2984528965 285
283 iso_pu_bacteria 2984532647 2984535068 285
284 iso_pu_bacteria 2988225383 2988226500 285
285 iso_pu_bacteria 2988728565 2988730136 285
286 iso_pu_bacteria 2990196909 2990199212 285
287 iso_pu_bacteria 2996632988 2996638527 285
288 iso_pu_bacteria 2998139840 2998141647 285
289 iso_pu_bacteria 2998344455 2998345999 285
290 iso_pu_bacteria 3007252601 3007252880 285
291 iso_pu_bacteria 3007315729 3007318449 285
292 iso_pu_bacteria 3007395558 3007400866 285
293 iso_pu_bacteria 3007419365 3007424526 285
294 iso_pu_bacteria 3007511990 3007513045 285
295 iso_pu_bacteria 3007614139 3007615897 285
296 iso_pu_bacteria 3007619802 3007619913 285
297 iso_pu_bacteria 3007718800 3007722484 285
298 iso_pu_bacteria 3007803356 3007808494 285
299 iso_pu_bacteria 3007855910 3007856238 285
300 iso_pu_bacteria 3007866637 3007868047 285
301 iso_pu_bacteria 3007872151 3007874762 285
302 iso_pu_bacteria 637000220 637319061 285
303 iso_pu_bacteria 643348555 643392913 285
304 iso_pu_bacteria 8011350971 8011354035 285
305 iso_pu_bacteria 8015687852 8015689544 285
306 iso_pu_bacteria 8016728285 8016733124 285
307 iso_pu_bacteria 8019769354 8019774058 285
308 iso_pu_bacteria 8019775933 8019780281 285
309 iso_pu_bacteria 8029995093 8029999109 285
310 iso_pu_bacteria 8034962539 8034964911 285
311 iso_pu_bacteria 8052494512 8052498306 285
312 iso_pu_bacteria 8054285046 8054287220 285
313 iso_pu_bacteria 8054347763 8054352160 285
314 iso_pu_bacteria 8054503363 8054505306 285
315 iso_pu_bacteria 8054929484 8054931441 285
316 iso_pu_bacteria 8055770955 8055772681 285
317 iso_pu_bacteria 8055817908 8055819863 285
318 iso_pu_bacteria 8055878733 8055880438 285
319 iso_pu_bacteria 8056115690 8056119670 285
320 iso_pu_bacteria 8056120720 8056122516 285
321 iso_pu_bacteria 8056125926 8056130155 285
322 iso_pu_bacteria 8056131705 8056133630 285
323 iso_pu_bacteria 8056137416 8056141222 285
324 iso_pu_bacteria 8056143049 8056144834 285
325 iso_pu_bacteria 8056148874 8056150539 285
326 iso_pu_bacteria 8056155041 8056156200 285
327 iso_pu_bacteria 8056161164 8056165053 285
328 iso_pu_bacteria 8056166840 8056169344 285
329 iso_pu_bacteria 8056172158 8056175529 285
330 iso_pu_bacteria 8056177738 8056181174 285
331 iso_pu_bacteria 8056569372 8056573197 285
332 iso_pu_bacteria 8057798959 8057799102 285
333 3300005336 Ga0070680_100166346 Ga0070680_1001663462 286
334 3300005341 Ga0070691_10045594 Ga0070691_100455942 286
335 3300005345 Ga0070692_10036729 Ga0070692_100367291 286
336 3300005459 Ga0068867_100094382 Ga0068867_1000943822 286
337 3300005467 Ga0070706_100000750 Ga0070706_1000007502 286
338 3300005471 Ga0070698_100042856 Ga0070698_1000428562 286
339 3300005530 Ga0070679_100047565 Ga0070679_1000475654 286
340 3300005545 Ga0070695_100086657 Ga0070695_1000866572 286
341 3300005545 Ga0070695_100207421 Ga0070695_1002074213 286
342 3300005546 Ga0070696_100104534 Ga0070696_1001045342 286
343 3300005549 Ga0070704_100074144 Ga0070704_1000741443 286
344 3300005549 Ga0070704_100146967 Ga0070704_1001469672 286
345 3300005564 Ga0070664_100116544 Ga0070664_1001165443 286
346 3300006852 Ga0075433_10080481 Ga0075433_100804812 286
347 3300009147 Ga0114129_10067976 Ga0114129_100679762 286
348 3300009148 Ga0105243_10333609 Ga0105243_103336092 286
349 3300013308 Ga0157375_10034765 Ga0157375_100347652 286
350 3300014326 Ga0157380_10115098 Ga0157380_101150982 286
351 3300014745 Ga0157377_10065877 Ga0157377_100658772 286
352 3300025885 Ga0207653_10000893 Ga0207653_100008937 286
353 3300025907 Ga0207645_10188236 Ga0207645_101882362 286
354 3300025910 Ga0207684_10000041 Ga0207684_10000041248 286
355 3300025942 Ga0207689_10234382 Ga0207689_102343822 286
356 3300026089 Ga0207648_10089678 Ga0207648_100896782 286
357 3300026116 Ga0207674_10018091 Ga0207674_100180915 286
358 3300050507 nmdc:mga05p37_74297_c1 nmdc:mga05p37_74297_c1_2418_3287 286
359 3300050515 nmdc:mga0a205_17204_c1 nmdc:mga0a205_17204_c1_835_1707 286
360 3300053104 Ga0500556_0000396 Ga0500556_0000396_5991_7034 286
361 3300005295 Ga0065707_10095160 Ga0065707_100951602 287
362 3300005295 Ga0065707_10098547 Ga0065707_100985471 287
363 3300005365 Ga0070688_100198668 Ga0070688_1001986682 287
364 3300005719 Ga0068861_100013498 Ga0068861_1000134984 287
365 3300006844 Ga0075428_100020542 Ga0075428_1000205422 287
366 3300006852 Ga0075433_10042202 Ga0075433_100422023 287
367 3300006871 Ga0075434_100003072 Ga0075434_1000030724 287
368 3300009147 Ga0114129_10431843 Ga0114129_104318432 287
369 3300009553 Ga0105249_10014320 Ga0105249_100143203 287
370 3300009553 Ga0105249_10740934 Ga0105249_107409341 287
371 3300025926 Ga0207659_10214227 Ga0207659_102142272 287
372 3300026118 Ga0207675_100002434 Ga0207675_10000243413 287
373 3300031251 Ga0265327_10154962 Ga0265327_101549621 287
374 3300031665 Ga0316575_10114395 Ga0316575_101143952 287
375 3300031730 Ga0307516_10002023 Ga0307516_1000202310 287
376 3300031731 Ga0307405_10034091 Ga0307405_100340912 287
377 3300031733 Ga0316577_10149472 Ga0316577_101494722 287
378 3300031824 Ga0307413_10056679 Ga0307413_100566792 287
379 3300031852 Ga0307410_10085034 Ga0307410_100850342 287
380 3300031852 Ga0307410_10459756 Ga0307410_104597561 287
381 3300031901 Ga0307406_10077487 Ga0307406_100774872 287
382 3300031901 Ga0307406_10092199 Ga0307406_100921992 287
383 3300031903 Ga0307407_10098987 Ga0307407_100989872 287
384 3300031995 Ga0307409_100258105 Ga0307409_1002581052 287
385 3300032002 Ga0307416_100120503 Ga0307416_1001205032 287
386 3300032002 Ga0307416_100395146 Ga0307416_1003951462 287
387 3300032005 Ga0307411_10082429 Ga0307411_100824291 287
388 3300032126 Ga0307415_100139775 Ga0307415_1001397751 287
389 3300032168 Ga0316593_10028286 Ga0316593_100282862 287
390 3300033524 Ga0316592_1031668 Ga0316592_10316682 287
391 3300035084 Ga0373928_0049724 Ga0373928_0049724_27_905 287
392 3300036712 Ga0316584_0176615 Ga0316584_0176615_584_1468 287
393 3300037418 Ga0395900_0182742 Ga0395900_0182742_334_1206 287
394 3300037466 Ga0395898_0079942 Ga0395898_0079942_2071_2943 287
395 3300037471 Ga0395905_0005298 Ga0395905_0005298_12193_13065 287
396 3300037471 Ga0395905_0025823 Ga0395905_0025823_3793_4665 287
397 3300037471 Ga0395905_0075585 Ga0395905_0075585_554_1426 287
398 3300037471 Ga0395905_0461978 Ga0395905_0461978_254_1126 287
399 3300038443 Ga0395901_0052496 Ga0395901_0052496_2849_3721 287
400 3300038443 Ga0395901_0243441 Ga0395901_0243441_79_951 287
401 3300038735 Ga0400485_11804 Ga0400485_11804_6636_7505 287
402 3300038742 Ga0400486_13241 Ga0400486_13241_573_1445 287
403 3300038742 Ga0400486_22850 Ga0400486_22850_1686_2555 287
404 3300039062 Ga0400483_071935 Ga0400483_071935_97872_98741 287
405 3300039093 Ga0400489_36940 Ga0400489_36940_20009_20881 287
406 3300039110 Ga0400487_01345 Ga0400487_01345_1569_2438 287
407 3300042876 Ga0451577_0000357 Ga0451577_0000357_44259_45146 287
408 3300042876 Ga0451577_0010849 Ga0451577_0010849_2858_3748 287
409 3300044656 Ga0466969_0073240 Ga0466969_0073240_564_1454 287
410 3300044673 Ga0453683_0000002 Ga0453683_0000002_1044738_1045616 287
411 3300044673 Ga0453683_0000134 Ga0453683_0000134_3406_4296 287
412 3300044673 Ga0453683_0000776 Ga0453683_0000776_6485_7393 287
413 3300044673 Ga0453683_0001508 Ga0453683_0001508_2591_3508 287
414 3300044673 Ga0453683_0004290 Ga0453683_0004290_2321_3208 287
415 3300044673 Ga0453683_0012171 Ga0453683_0012171_343_1230 287
416 3300044712 Ga0453684_0000140 Ga0453684_0000140_164382_165257 287
417 3300044712 Ga0453684_0001103 Ga0453684_0001103_43948_44835 287
418 3300044712 Ga0453684_0009108 Ga0453684_0009108_4675_5553 287
419 3300044712 Ga0453684_0015895 Ga0453684_0015895_7304_8194 287
420 3300044712 Ga0453684_0015961 Ga0453684_0015961_7881_8765 287
421 3300044712 Ga0453684_0039645 Ga0453684_0039645_940_1809 287
422 3300044712 Ga0453684_0099195 Ga0453684_0099195_685_1563 287
423 3300044712 Ga0453684_0232259 Ga0453684_0232259_760_1638 287
424 3300044842 Ga0466957_0108526 Ga0466957_0108526_808_1683 287
425 3300044901 Ga0466960_0000099 Ga0466960_0000099_20773_21645 287
426 3300045049 Ga0466959_0052418 Ga0466959_0052418_166_1377 287
427 3300045051 Ga0451576_0000245 Ga0451576_0000245_131954_132841 287
428 3300045051 Ga0451576_0000392 Ga0451576_0000392_4487_5377 287
429 3300045051 Ga0451576_0001954 Ga0451576_0001954_13176_14054 287
430 3300045051 Ga0451576_0076569 Ga0451576_0076569_2363_3250 287
431 3300045051 Ga0451576_0351849 Ga0451576_0351849_592_1482 287
432 3300045051 Ga0451576_0381518 Ga0451576_0381518_89_976 287
433 3300046462 Ga0495651_0152519 Ga0495651_0152519_308_1183 287
434 3300046471 Ga0495650_0000012 Ga0495650_0000012_480621_481493 287
435 3300046475 Ga0495639_0008418 Ga0495639_0008418_2869_3741 287
436 3300046535 Ga0495586_0005152 Ga0495586_0005152_5230_6102 287
437 3300046660 Ga0495625_0076652 Ga0495625_0076652_291_1337 287
438 3300047315 Ga0495581_0026485 Ga0495581_0026485_1959_2831 287
439 3300048088 Ga0495602_0215536 Ga0495602_0215536_524_1399 287
440 3300048914 Ga0496111_0228854 Ga0496111_0228854_218_1090 287
441 3300048915 Ga0496112_0010953 Ga0496112_0010953_6869_7741 287
442 3300048927 Ga0496124_0230474 Ga0496124_0230474_232_1104 287
443 3300049571 Ga0501034_0000631 Ga0501034_0000631_38965_39843 287
444 3300049571 Ga0501034_0057611 Ga0501034_0057611_201_1073 287
445 3300049583 Ga0501067_0171500 Ga0501067_0171500_10_1041 287
446 3300049586 Ga0501070_0057491 Ga0501070_0057491_1718_2749 287
447 3300049587 Ga0501071_0030797 Ga0501071_0030797_1772_2803 287
448 3300049588 Ga0501072_0041751 Ga0501072_0041751_788_1819 287
449 3300049589 Ga0501073_0011918 Ga0501073_0011918_1876_2907 287
450 3300049590 Ga0501074_0046570 Ga0501074_0046570_1921_2952 287
451 3300049592 Ga0501076_0021390 Ga0501076_0021390_3147_4178 287
452 3300049593 Ga0501077_0035021 Ga0501077_0035021_725_1756 287
453 3300049741 Ga0501079_0012424 Ga0501079_0012424_1788_2819 287
454 3300049742 Ga0501080_0026708 Ga0501080_0026708_2441_3472 287
455 3300049744 Ga0501083_0198825 Ga0501083_0198825_77_955 287
456 3300050507 nmdc:mga05p37_508807_c1 nmdc:mga05p37_508807_c1_105_983 287
457 3300050512 nmdc:mga0n895_44251_c1 nmdc:mga0n895_44251_c1_10_1089 287
458 3300050514 nmdc:mga08x19_288_c1 nmdc:mga08x19_288_c1_4898_5767 287
459 3300053153 Ga0500616_0021554 Ga0500616_0021554_179_1051 287
460 3300054114 Ga0501084_0037110 Ga0501084_0037110_903_1934 287
461 3300054114 Ga0501084_0509051 Ga0501084_0509051_53_934 287
462 3300060353 Ga0501082_0063910 Ga0501082_0063910_1962_2993 287
463 3300005290 Ga0065712_10009919 Ga0065712_100099194 288
464 3300005339 Ga0070660_100231370 Ga0070660_1002313702 288
465 3300005340 Ga0070689_100335404 Ga0070689_1003354041 288
466 3300005365 Ga0070688_100040884 Ga0070688_1000408843 288
467 3300005367 Ga0070667_100054569 Ga0070667_1000545693 288
468 3300005434 Ga0070709_10301127 Ga0070709_103011272 288
469 3300005436 Ga0070713_100254573 Ga0070713_1002545732 288
470 3300005445 Ga0070708_100052434 Ga0070708_1000524342 288
471 3300005466 Ga0070685_10078226 Ga0070685_100782261 288
472 3300005467 Ga0070706_100241546 Ga0070706_1002415462 288
473 3300005468 Ga0070707_100086913 Ga0070707_1000869133 288
474 3300005471 Ga0070698_100008074 Ga0070698_1000080743 288
475 3300005471 Ga0070698_100023722 Ga0070698_1000237222 288
476 3300005471 Ga0070698_100158917 Ga0070698_1001589172 288
477 3300005518 Ga0070699_100040785 Ga0070699_1000407852 288
478 3300005536 Ga0070697_100001347 Ga0070697_1000013478 288
479 3300005536 Ga0070697_100078078 Ga0070697_1000780783 288
480 3300005841 Ga0068863_100023075 Ga0068863_1000230753 288
481 3300005937 Ga0081455_10010409 Ga0081455_100104092 288
482 3300006173 Ga0070716_100204481 Ga0070716_1002044811 288
483 3300006844 Ga0075428_100024967 Ga0075428_1000249676 288
484 3300006844 Ga0075428_100075140 Ga0075428_1000751402 288
485 3300006844 Ga0075428_100077608 Ga0075428_1000776083 288
486 3300006847 Ga0075431_100000101 Ga0075431_10000010127 288
487 3300006847 Ga0075431_100211379 Ga0075431_1002113792 288
488 3300006880 Ga0075429_100005700 Ga0075429_1000057007 288
489 3300007788 Ga0099795_10000006 Ga0099795_100000065 288
490 3300009094 Ga0111539_10015223 Ga0111539_100152233 288
491 3300009147 Ga0114129_10069188 Ga0114129_100691882 288
492 3300009545 Ga0105237_10176792 Ga0105237_101767923 288
493 3300010159 Ga0099796_10000002 Ga0099796_100000023 288
494 3300013297 Ga0157378_10133325 Ga0157378_101333252 288
495 3300014325 Ga0163163_10112282 Ga0163163_101122823 288
496 3300015261 Ga0182006_1000063 Ga0182006_1000063103 288
497 3300021384 Ga0213876_10168274 Ga0213876_101682741 288
498 3300025898 Ga0207692_10084768 Ga0207692_100847683 288
499 3300025910 Ga0207684_10021678 Ga0207684_100216786 288
500 3300025914 Ga0207671_10109594 Ga0207671_101095942 288
501 3300025915 Ga0207693_10012365 Ga0207693_100123654 288
502 3300025916 Ga0207663_10317806 Ga0207663_103178061 288
503 3300025919 Ga0207657_10169365 Ga0207657_101693652 288
504 3300025920 Ga0207649_10067324 Ga0207649_100673242 288
505 3300025922 Ga0207646_10057103 Ga0207646_100571035 288
506 3300025922 Ga0207646_10437284 Ga0207646_104372841 288
507 3300025939 Ga0207665_10124960 Ga0207665_101249602 288
508 3300025939 Ga0207665_10282003 Ga0207665_102820032 288
509 3300025972 Ga0207668_10171508 Ga0207668_101715082 288
510 3300026088 Ga0207641_10046674 Ga0207641_100466742 288
511 3300027512 Ga0209179_1000004 Ga0209179_100000493 288
512 3300028563 Ga0265319_1008167 Ga0265319_10081674 288
513 3300028563 Ga0265319_1031332 Ga0265319_10313322 288
514 3300028577 Ga0265318_10056429 Ga0265318_100564292 288
515 3300030521 Ga0307511_10000020 Ga0307511_1000002087 288
516 3300031240 Ga0265320_10000288 Ga0265320_1000028821 288
517 3300031240 Ga0265320_10001726 Ga0265320_100017266 288
518 3300032168 Ga0316593_10001291 Ga0316593_100012916 288
519 3300032168 Ga0316593_10002011 Ga0316593_100020111 288
520 3300032168 Ga0316593_10002668 Ga0316593_100026684 288
521 3300032168 Ga0316593_10044287 Ga0316593_100442872 288
522 3300035121 Ga0373960_0065864 Ga0373960_0065864_54_1088 288
523 3300035398 Ga0316574_0004645 Ga0316574_0004645_510_1376 288
524 3300036647 Ga0316582_0016729 Ga0316582_0016729_968_1894 288
525 3300037853 Ga0436364_0258695 Ga0436364_0258695_651_1526 288
526 3300038742 Ga0400486_07003 Ga0400486_07003_1411_2289 288
527 3300039437 Ga0436365_0282597 Ga0436365_0282597_2735_3610 288
528 3300039437 Ga0436365_1935856 Ga0436365_1935856_466_1341 288
529 3300039447 Ga0436361_0219666 Ga0436361_0219666_1721_2596 288
530 3300039450 Ga0436363_0159060 Ga0436363_0159060_4206_5081 288
531 3300039450 Ga0436363_0691036 Ga0436363_0691036_4469_5344 288
532 3300041405 Ga0439438_009532 Ga0439438_009532_2001_2867 288
533 3300042010 Ga0439452_000003 Ga0439452_000003_468694_469560 288
534 3300044673 Ga0453683_0000890 Ga0453683_0000890_21071_21943 288
535 3300044712 Ga0453684_0003636 Ga0453684_0003636_8367_9239 288
536 3300044712 Ga0453684_0007469 Ga0453684_0007469_19144_20016 288
537 3300044712 Ga0453684_0031712 Ga0453684_0031712_3802_4683 288
538 3300044712 Ga0453684_0054521 Ga0453684_0054521_2960_3826 288
539 3300044712 Ga0453684_0311784 Ga0453684_0311784_25_894 288
540 3300045051 Ga0451576_0135357 Ga0451576_0135357_109_978 288
541 3300046460 Ga0495638_0000843 Ga0495638_0000843_7039_8106 288
542 3300046526 Ga0495666_0047145 Ga0495666_0047145_1043_1924 288
543 3300046660 Ga0495625_0001242 Ga0495625_0001242_1514_2581 288
544 3300047315 Ga0495581_0113069 Ga0495581_0113069_97_978 288
545 3300048904 Ga0496101_0073186 Ga0496101_0073186_249_1130 288
546 3300048911 Ga0496108_0318809 Ga0496108_0318809_395_1276 288
547 3300048912 Ga0496109_0515619 Ga0496109_0515619_230_1111 288
548 3300048915 Ga0496112_0132838 Ga0496112_0132838_681_1562 288
549 3300048915 Ga0496112_0497106 Ga0496112_0497106_136_1011 288
550 3300048916 Ga0496113_0057769 Ga0496113_0057769_1307_2188 288
551 3300048927 Ga0496124_0213909 Ga0496124_0213909_238_1110 288
552 3300048928 Ga0496125_0000153 Ga0496125_0000153_124852_125724 288
553 3300049568 Ga0501031_0015367 Ga0501031_0015367_994_1917 288
554 3300049569 Ga0501032_0104156 Ga0501032_0104156_669_1592 288
555 3300049572 Ga0501036_0013571 Ga0501036_0013571_581_1504 288
556 3300049574 Ga0501038_0132136 Ga0501038_0132136_462_1385 288
557 3300049575 Ga0501039_0025923 Ga0501039_0025923_2462_3385 288
558 3300049576 Ga0501040_0004032 Ga0501040_0004032_721_1644 288
559 3300049576 Ga0501040_0022464 Ga0501040_0022464_1562_2485 288
560 3300049577 Ga0501041_0104429 Ga0501041_0104429_289_1212 288
561 3300049578 Ga0501042_0000919 Ga0501042_0000919_9799_10722 288
562 3300049578 Ga0501042_0310415 Ga0501042_0310415_38_961 288
563 3300049580 Ga0501046_0033195 Ga0501046_0033195_793_1716 288
564 3300049582 Ga0501048_0008026 Ga0501048_0008026_5465_6388 288
565 3300049584 Ga0501068_0018969 Ga0501068_0018969_1327_2250 288
566 3300049587 Ga0501071_0003522 Ga0501071_0003522_3121_4044 288
567 3300049587 Ga0501071_0070816 Ga0501071_0070816_1357_2280 288
568 3300049588 Ga0501072_0002580 Ga0501072_0002580_11977_12900 288
569 3300049589 Ga0501073_0051903 Ga0501073_0051903_148_1023 288
570 3300049590 Ga0501074_0094559 Ga0501074_0094559_969_1892 288
571 3300049591 Ga0501075_0022923 Ga0501075_0022923_514_1437 288
572 3300049591 Ga0501075_0064953 Ga0501075_0064953_1491_2414 288
573 3300049592 Ga0501076_0075806 Ga0501076_0075806_682_1605 288
574 3300049593 Ga0501077_0121095 Ga0501077_0121095_491_1414 288
575 3300049741 Ga0501079_0017612 Ga0501079_0017612_559_1482 288
576 3300049741 Ga0501079_0107990 Ga0501079_0107990_581_1504 288
577 3300049743 Ga0501081_0004698 Ga0501081_0004698_5178_6101 288
578 3300049743 Ga0501081_0017926 Ga0501081_0017926_3586_4509 288
579 3300049744 Ga0501083_0103777 Ga0501083_0103777_131_1054 288
580 3300049823 Ga0501044_0493273 Ga0501044_0493273_33_956 288
581 3300049824 Ga0501045_0080137 Ga0501045_0080137_581_1504 288
582 3300049824 Ga0501045_0182589 Ga0501045_0182589_608_1507 288
583 3300050507 nmdc:mga05p37_5259_c1 nmdc:mga05p37_5259_c1_5064_6026 288
584 3300050509 nmdc:mga0qj67_181929_c1 nmdc:mga0qj67_181929_c1_527_1489 288
585 3300050510 nmdc:mga06r32_8_c1 nmdc:mga06r32_8_c1_97834_98796 288
586 3300050511 nmdc:mga08y16_11018_c1 nmdc:mga08y16_11018_c1_7132_8094 288
587 3300050511 nmdc:mga08y16_401325_c1 nmdc:mga08y16_401325_c1_137_1018 288
588 3300053088 Ga0500644_0133019 Ga0500644_0133019_90_962 288
589 3300054114 Ga0501084_0028663 Ga0501084_0028663_2163_3086 288
590 3300060353 Ga0501082_0038667 Ga0501082_0038667_827_1750 288
591 3300061734 Ga0530510_0054537 Ga0530510_0054537_1626_2549 288
592 2010549000 RicEn_C5843 RicEn_103670 289
593 2162886007 SwRhRL2b_contig_220770 SwRhRL2b_0943.00001150 289
594 2162886007 SwRhRL2b_contig_2411953 SwRhRL2b_0940.00006850 289
595 2162886007 SwRhRL2b_contig_330100 SwRhRL2b_0797.00000320 289
596 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003444 289
597 3300002737 JGI25162J39368_1000364 JGI25162J39368_10003642 289
598 3300002737 JGI25162J39368_1000384 JGI25162J39368_100038440 289
599 3300002738 JGI25154J39366_1002802 JGI25154J39366_10028024 289
600 3300002771 JGI25163J39215_1000007 JGI25163J39215_100000774 289
601 3300002772 JGI25164J39214_1000014 JGI25164J39214_100001464 289
602 3300002772 JGI25164J39214_1000268 JGI25164J39214_10002682 289
603 3300002772 JGI25164J39214_1000481 JGI25164J39214_10004812 289
604 3300002773 JGI25152J39213_1000329 JGI25152J39213_100032918 289
605 3300003203 JGI25406J46586_10020167 JGI25406J46586_100201671 289
606 3300003214 JGI25165J46597_1000483 JGI25165J46597_10004832 289
607 3300003214 JGI25165J46597_1000497 JGI25165J46597_100049740 289
608 3300003320 rootH2_10254950 rootH2_102549502 289
609 3300003323 rootH1_10031238 rootH1_1003123812 289
610 3300003751 Ga0055538_1000005 Ga0055538_1000005444 289
611 3300003751 Ga0055538_1000058 Ga0055538_100005833 289
612 3300003752 Ga0055539_1000007 Ga0055539_1000007444 289
613 3300003752 Ga0055539_1000087 Ga0055539_100008776 289
614 3300003756 Ga0055533_1000009 Ga0055533_1000009444 289
615 3300003756 Ga0055533_1000097 Ga0055533_100009776 289
616 3300003758 Ga0055532_1000156 Ga0055532_100015622 289
617 3300003758 Ga0055532_1000799 Ga0055532_10007992 289
618 3300003759 Ga0055525_1000010 Ga0055525_1000010444 289
619 3300003759 Ga0055525_1000426 Ga0055525_100042614 289
620 3300003761 Ga0055535_1004882 Ga0055535_10048822 289
621 3300003784 Ga0055534_1003384 Ga0055534_10033842 289
622 3300003794 Ga0055531_10002458 Ga0055531_100024587 289
623 3300003841 Ga0055541_1000005 Ga0055541_1000005121 289
624 3300003841 Ga0055541_1000060 Ga0055541_100006034 289
625 3300003856 Ga0058692_1000074 Ga0058692_100007413 289
626 3300003856 Ga0058692_1001225 Ga0058692_10012255 289
627 3300003856 Ga0058692_1003481 Ga0058692_10034815 289
628 3300003856 Ga0058692_1003490 Ga0058692_10034901 289
629 3300003856 Ga0058692_1005649 Ga0058692_10056492 289
630 3300003856 Ga0058692_1033575 Ga0058692_10335751 289
631 3300005288 Ga0065714_10000071 Ga0065714_100000711 289
632 3300005289 Ga0065704_10000980 Ga0065704_1000098017 289
633 3300005289 Ga0065704_10001655 Ga0065704_100016555 289
634 3300005289 Ga0065704_10092028 Ga0065704_100920281 289
635 3300005289 Ga0065704_10158697 Ga0065704_101586971 289
636 3300005290 Ga0065712_10000132 Ga0065712_1000013231 289
637 3300005290 Ga0065712_10000707 Ga0065712_1000070711 289
638 3300005290 Ga0065712_10102479 Ga0065712_101024791 289
639 3300005293 Ga0065715_10001398 Ga0065715_1000139813 289
640 3300005293 Ga0065715_10030977 Ga0065715_100309773 289
641 3300005295 Ga0065707_10082570 Ga0065707_100825702 289
642 3300005328 Ga0070676_10068134 Ga0070676_100681342 289
643 3300005329 Ga0070683_100002355 Ga0070683_1000023553 289
644 3300005330 Ga0070690_100023708 Ga0070690_1000237082 289
645 3300005330 Ga0070690_100051198 Ga0070690_1000511982 289
646 3300005331 Ga0070670_100000018 Ga0070670_10000001830 289
647 3300005331 Ga0070670_100001613 Ga0070670_1000016133 289
648 3300005331 Ga0070670_100018813 Ga0070670_1000188135 289
649 3300005331 Ga0070670_100055532 Ga0070670_1000555322 289
650 3300005333 Ga0070677_10040300 Ga0070677_100403001 289
651 3300005334 Ga0068869_100090143 Ga0068869_1000901432 289
652 3300005334 Ga0068869_100107006 Ga0068869_1001070062 289
653 3300005334 Ga0068869_100197484 Ga0068869_1001974842 289
654 3300005335 Ga0070666_10004092 Ga0070666_100040925 289
655 3300005335 Ga0070666_10006795 Ga0070666_100067953 289
656 3300005335 Ga0070666_10056938 Ga0070666_100569383 289
657 3300005335 Ga0070666_10104930 Ga0070666_101049302 289
658 3300005336 Ga0070680_100119426 Ga0070680_1001194262 289
659 3300005336 Ga0070680_100207860 Ga0070680_1002078602 289
660 3300005336 Ga0070680_100258712 Ga0070680_1002587122 289
661 3300005337 Ga0070682_100024937 Ga0070682_1000249371 289
662 3300005337 Ga0070682_100044555 Ga0070682_1000445553 289
663 3300005337 Ga0070682_100106763 Ga0070682_1001067632 289
664 3300005338 Ga0068868_100003500 Ga0068868_1000035006 289
665 3300005338 Ga0068868_100005153 Ga0068868_1000051533 289
666 3300005338 Ga0068868_100059471 Ga0068868_1000594712 289
667 3300005338 Ga0068868_100118281 Ga0068868_1001182812 289
668 3300005340 Ga0070689_100011354 Ga0070689_1000113542 289
669 3300005340 Ga0070689_100032368 Ga0070689_1000323682 289
670 3300005340 Ga0070689_100064284 Ga0070689_1000642842 289
671 3300005341 Ga0070691_10030253 Ga0070691_100302533 289
672 3300005343 Ga0070687_100058056 Ga0070687_1000580562 289
673 3300005344 Ga0070661_100000029 Ga0070661_10000002981 289
674 3300005344 Ga0070661_100005120 Ga0070661_1000051204 289
675 3300005347 Ga0070668_100001171 Ga0070668_10000117114 289
676 3300005347 Ga0070668_100009230 Ga0070668_1000092304 289
677 3300005347 Ga0070668_100196877 Ga0070668_1001968772 289
678 3300005347 Ga0070668_100306398 Ga0070668_1003063981 289
679 3300005353 Ga0070669_100156921 Ga0070669_1001569212 289
680 3300005353 Ga0070669_100290882 Ga0070669_1002908822 289
681 3300005354 Ga0070675_100001181 Ga0070675_1000011815 289
682 3300005354 Ga0070675_100045618 Ga0070675_1000456182 289
683 3300005354 Ga0070675_100114160 Ga0070675_1001141602 289
684 3300005354 Ga0070675_100159693 Ga0070675_1001596932 289
685 3300005355 Ga0070671_100000028 Ga0070671_10000002828 289
686 3300005355 Ga0070671_100013664 Ga0070671_1000136644 289
687 3300005355 Ga0070671_100031225 Ga0070671_1000312253 289
688 3300005355 Ga0070671_100135833 Ga0070671_1001358331 289
689 3300005356 Ga0070674_100018888 Ga0070674_1000188884 289
690 3300005364 Ga0070673_100013049 Ga0070673_1000130492 289
691 3300005364 Ga0070673_100025708 Ga0070673_1000257083 289
692 3300005365 Ga0070688_100016981 Ga0070688_1000169812 289
693 3300005365 Ga0070688_100046810 Ga0070688_1000468102 289
694 3300005365 Ga0070688_100077071 Ga0070688_1000770712 289
695 3300005365 Ga0070688_100343284 Ga0070688_1003432841 289
696 3300005366 Ga0070659_100138960 Ga0070659_1001389602 289
697 3300005367 Ga0070667_100000021 Ga0070667_100000021176 289
698 3300005367 Ga0070667_100000665 Ga0070667_10000066510 289
699 3300005367 Ga0070667_100005950 Ga0070667_1000059504 289
700 3300005367 Ga0070667_100013421 Ga0070667_1000134213 289
701 3300005367 Ga0070667_100076374 Ga0070667_1000763742 289
702 3300005367 Ga0070667_100094194 Ga0070667_1000941942 289
703 3300005367 Ga0070667_100165272 Ga0070667_1001652721 289
704 3300005367 Ga0070667_100235897 Ga0070667_1002358972 289
705 3300005367 Ga0070667_100275829 Ga0070667_1002758292 289
706 3300005406 Ga0070703_10025500 Ga0070703_100255001 289
707 3300005434 Ga0070709_10016413 Ga0070709_100164132 289
708 3300005435 Ga0070714_100003443 Ga0070714_1000034438 289
709 3300005436 Ga0070713_100007784 Ga0070713_1000077842 289
710 3300005436 Ga0070713_100455065 Ga0070713_1004550651 289
711 3300005438 Ga0070701_10001019 Ga0070701_100010196 289
712 3300005438 Ga0070701_10004109 Ga0070701_100041092 289
713 3300005438 Ga0070701_10209222 Ga0070701_102092221 289
714 3300005439 Ga0070711_100004071 Ga0070711_1000040712 289
715 3300005439 Ga0070711_100091851 Ga0070711_1000918512 289
716 3300005440 Ga0070705_100038163 Ga0070705_1000381633 289
717 3300005441 Ga0070700_100059584 Ga0070700_1000595842 289
718 3300005444 Ga0070694_100036733 Ga0070694_1000367333 289
719 3300005445 Ga0070708_100006903 Ga0070708_1000069031 289
720 3300005445 Ga0070708_100142572 Ga0070708_1001425723 289
721 3300005455 Ga0070663_100001828 Ga0070663_1000018288 289
722 3300005457 Ga0070662_100003755 Ga0070662_1000037558 289
723 3300005457 Ga0070662_100013156 Ga0070662_1000131562 289
724 3300005457 Ga0070662_100026746 Ga0070662_1000267463 289
725 3300005457 Ga0070662_100027185 Ga0070662_1000271852 289
726 3300005457 Ga0070662_100052942 Ga0070662_1000529423 289
727 3300005457 Ga0070662_100281095 Ga0070662_1002810952 289
728 3300005458 Ga0070681_10004193 Ga0070681_100041933 289
729 3300005458 Ga0070681_10011595 Ga0070681_100115957 289
730 3300005458 Ga0070681_10030666 Ga0070681_100306662 289
731 3300005458 Ga0070681_10050395 Ga0070681_100503953 289
732 3300005458 Ga0070681_10069003 Ga0070681_100690032 289
733 3300005458 Ga0070681_10098337 Ga0070681_100983372 289
734 3300005459 Ga0068867_100071748 Ga0068867_1000717482 289
735 3300005459 Ga0068867_100144024 Ga0068867_1001440241 289
736 3300005466 Ga0070685_10000003 Ga0070685_10000003141 289
737 3300005466 Ga0070685_10018111 Ga0070685_100181112 289
738 3300005466 Ga0070685_10061864 Ga0070685_100618642 289
739 3300005466 Ga0070685_10163736 Ga0070685_101637362 289
740 3300005518 Ga0070699_100177203 Ga0070699_1001772032 289
741 3300005530 Ga0070679_100007495 Ga0070679_1000074957 289
742 3300005530 Ga0070679_100026045 Ga0070679_1000260452 289
743 3300005530 Ga0070679_100027585 Ga0070679_1000275857 289
744 3300005530 Ga0070679_100033927 Ga0070679_1000339274 289
745 3300005530 Ga0070679_100081041 Ga0070679_1000810412 289
746 3300005535 Ga0070684_100024689 Ga0070684_1000246891 289
747 3300005535 Ga0070684_100051366 Ga0070684_1000513663 289
748 3300005535 Ga0070684_100066313 Ga0070684_1000663132 289
749 3300005535 Ga0070684_100328202 Ga0070684_1003282021 289
750 3300005536 Ga0070697_100147712 Ga0070697_1001477122 289
751 3300005539 Ga0068853_100227019 Ga0068853_1002270191 289
752 3300005543 Ga0070672_100022380 Ga0070672_1000223803 289
753 3300005543 Ga0070672_100056355 Ga0070672_1000563552 289
754 3300005543 Ga0070672_100061103 Ga0070672_1000611032 289
755 3300005543 Ga0070672_100093373 Ga0070672_1000933732 289
756 3300005543 Ga0070672_100330483 Ga0070672_1003304832 289
757 3300005544 Ga0070686_100055456 Ga0070686_1000554562 289
758 3300005545 Ga0070695_100133847 Ga0070695_1001338472 289
759 3300005546 Ga0070696_100007274 Ga0070696_1000072746 289
760 3300005546 Ga0070696_100007748 Ga0070696_1000077489 289
761 3300005546 Ga0070696_100031639 Ga0070696_1000316393 289
762 3300005548 Ga0070665_100000055 Ga0070665_100000055154 289
763 3300005548 Ga0070665_100000199 Ga0070665_10000019942 289
764 3300005548 Ga0070665_100003307 Ga0070665_10000330713 289
765 3300005548 Ga0070665_100006847 Ga0070665_1000068474 289
766 3300005548 Ga0070665_100007398 Ga0070665_1000073988 289
767 3300005548 Ga0070665_100038480 Ga0070665_1000384804 289
768 3300005548 Ga0070665_100064924 Ga0070665_1000649243 289
769 3300005548 Ga0070665_100169888 Ga0070665_1001698882 289
770 3300005548 Ga0070665_100424294 Ga0070665_1004242941 289
771 3300005549 Ga0070704_100034947 Ga0070704_1000349472 289
772 3300005549 Ga0070704_100179133 Ga0070704_1001791332 289
773 3300005549 Ga0070704_100182003 Ga0070704_1001820032 289
774 3300005549 Ga0070704_100365522 Ga0070704_1003655222 289
775 3300005563 Ga0068855_100001292 Ga0068855_1000012924 289
776 3300005563 Ga0068855_100014602 Ga0068855_1000146024 289
777 3300005563 Ga0068855_100024485 Ga0068855_1000244852 289
778 3300005563 Ga0068855_100152849 Ga0068855_1001528492 289
779 3300005564 Ga0070664_100001158 Ga0070664_1000011582 289
780 3300005564 Ga0070664_100005346 Ga0070664_1000053463 289
781 3300005564 Ga0070664_100014740 Ga0070664_1000147402 289
782 3300005564 Ga0070664_100035715 Ga0070664_1000357153 289
783 3300005564 Ga0070664_100436508 Ga0070664_1004365081 289
784 3300005577 Ga0068857_100013648 Ga0068857_1000136485 289
785 3300005578 Ga0068854_100010579 Ga0068854_1000105792 289
786 3300005578 Ga0068854_100030055 Ga0068854_1000300553 289
787 3300005614 Ga0068856_100024860 Ga0068856_1000248604 289
788 3300005614 Ga0068856_100124491 Ga0068856_1001244912 289
789 3300005615 Ga0070702_100019415 Ga0070702_1000194153 289
790 3300005615 Ga0070702_100118115 Ga0070702_1001181151 289
791 3300005616 Ga0068852_100093903 Ga0068852_1000939032 289
792 3300005616 Ga0068852_100506301 Ga0068852_1005063011 289
793 3300005617 Ga0068859_100001116 Ga0068859_10000111625 289
794 3300005617 Ga0068859_100006340 Ga0068859_1000063405 289
795 3300005617 Ga0068859_100008989 Ga0068859_1000089896 289
796 3300005617 Ga0068859_100015388 Ga0068859_1000153885 289
797 3300005617 Ga0068859_100029889 Ga0068859_1000298892 289
798 3300005617 Ga0068859_100075395 Ga0068859_1000753953 289
799 3300005617 Ga0068859_100130601 Ga0068859_1001306012 289
800 3300005617 Ga0068859_100167825 Ga0068859_1001678252 289
801 3300005618 Ga0068864_100000002 Ga0068864_100000002513 289
802 3300005618 Ga0068864_100008455 Ga0068864_1000084554 289
803 3300005618 Ga0068864_100009661 Ga0068864_1000096617 289
804 3300005618 Ga0068864_100041187 Ga0068864_1000411873 289
805 3300005618 Ga0068864_100088533 Ga0068864_1000885332 289
806 3300005618 Ga0068864_100134158 Ga0068864_1001341582 289
807 3300005618 Ga0068864_100182202 Ga0068864_1001822021 289
808 3300005718 Ga0068866_10073144 Ga0068866_100731442 289
809 3300005718 Ga0068866_10268261 Ga0068866_102682611 289
810 3300005719 Ga0068861_100026888 Ga0068861_1000268882 289
811 3300005719 Ga0068861_100035468 Ga0068861_1000354682 289
812 3300005719 Ga0068861_100061160 Ga0068861_1000611602 289
813 3300005834 Ga0068851_10000079 Ga0068851_1000007938 289
814 3300005840 Ga0068870_10086934 Ga0068870_100869342 289
815 3300005841 Ga0068863_100007089 Ga0068863_1000070899 289
816 3300005841 Ga0068863_100024281 Ga0068863_1000242812 289
817 3300005841 Ga0068863_100041896 Ga0068863_1000418961 289
818 3300005841 Ga0068863_100072138 Ga0068863_1000721382 289
819 3300005841 Ga0068863_100078989 Ga0068863_1000789892 289
820 3300005841 Ga0068863_100086615 Ga0068863_1000866152 289
821 3300005841 Ga0068863_100121459 Ga0068863_1001214592 289
822 3300005841 Ga0068863_100133426 Ga0068863_1001334262 289
823 3300005841 Ga0068863_100609045 Ga0068863_1006090451 289
824 3300005842 Ga0068858_100006053 Ga0068858_1000060535 289
825 3300005842 Ga0068858_100010397 Ga0068858_1000103974 289
826 3300005842 Ga0068858_100022875 Ga0068858_1000228754 289
827 3300005842 Ga0068858_100092045 Ga0068858_1000920452 289
828 3300005843 Ga0068860_100000913 Ga0068860_10000091310 289
829 3300005843 Ga0068860_100001060 Ga0068860_1000010608 289
830 3300005843 Ga0068860_100001620 Ga0068860_1000016202 289
831 3300005843 Ga0068860_100013404 Ga0068860_1000134044 289
832 3300005843 Ga0068860_100025962 Ga0068860_1000259622 289
833 3300005843 Ga0068860_100088967 Ga0068860_1000889672 289
834 3300005843 Ga0068860_100344781 Ga0068860_1003447812 289
835 3300005844 Ga0068862_100001883 Ga0068862_10000188314 289
836 3300005844 Ga0068862_100001983 Ga0068862_10000198313 289
837 3300005844 Ga0068862_100009858 Ga0068862_1000098584 289
838 3300005844 Ga0068862_100012237 Ga0068862_1000122373 289
839 3300005844 Ga0068862_100025109 Ga0068862_1000251092 289
840 3300005844 Ga0068862_100027094 Ga0068862_1000270944 289
841 3300005844 Ga0068862_100037749 Ga0068862_1000377493 289
842 3300005937 Ga0081455_10001835 Ga0081455_1000183514 289
843 3300005937 Ga0081455_10003741 Ga0081455_100037417 289
844 3300005981 Ga0081538_10004527 Ga0081538_1000452711 289
845 3300005985 Ga0081539_10000006 Ga0081539_10000006436 289
846 3300006028 Ga0070717_10070788 Ga0070717_100707882 289
847 3300006038 Ga0075365_10116355 Ga0075365_101163552 289
848 3300006051 Ga0075364_10004581 Ga0075364_100045811 289
849 3300006051 Ga0075364_10008858 Ga0075364_100088582 289
850 3300006051 Ga0075364_10034264 Ga0075364_100342642 289
851 3300006051 Ga0075364_10034360 Ga0075364_100343603 289
852 3300006051 Ga0075364_10397360 Ga0075364_103973601 289
853 3300006163 Ga0070715_10028423 Ga0070715_100284232 289
854 3300006173 Ga0070716_100037355 Ga0070716_1000373552 289
855 3300006173 Ga0070716_100107674 Ga0070716_1001076742 289
856 3300006175 Ga0070712_100524001 Ga0070712_1005240012 289
857 3300006177 Ga0075362_10000010 Ga0075362_1000001093 289
858 3300006194 Ga0075427_10002554 Ga0075427_100025542 289
859 3300006195 Ga0075366_10039108 Ga0075366_100391083 289
860 3300006237 Ga0097621_100033047 Ga0097621_1000330473 289
861 3300006237 Ga0097621_100438876 Ga0097621_1004388761 289
862 3300006358 Ga0068871_100014457 Ga0068871_1000144572 289
863 3300006358 Ga0068871_100015759 Ga0068871_1000157595 289
864 3300006358 Ga0068871_100053569 Ga0068871_1000535692 289
865 3300006358 Ga0068871_100062819 Ga0068871_1000628193 289
866 3300006358 Ga0068871_100158841 Ga0068871_1001588412 289
867 3300006358 Ga0068871_100170513 Ga0068871_1001705131 289
868 3300006844 Ga0075428_100007229 Ga0075428_1000072293 289
869 3300006844 Ga0075428_100058386 Ga0075428_1000583862 289
870 3300006846 Ga0075430_100001101 Ga0075430_1000011018 289
871 3300006846 Ga0075430_100114221 Ga0075430_1001142212 289
872 3300006846 Ga0075430_100161882 Ga0075430_1001618822 289
873 3300006846 Ga0075430_100335149 Ga0075430_1003351492 289
874 3300006846 Ga0075430_100420585 Ga0075430_1004205851 289
875 3300006847 Ga0075431_100018092 Ga0075431_1000180922 289
876 3300006847 Ga0075431_100099330 Ga0075431_1000993301 289
877 3300006852 Ga0075433_10087637 Ga0075433_100876372 289
878 3300006852 Ga0075433_10116553 Ga0075433_101165532 289
879 3300006852 Ga0075433_10474794 Ga0075433_104747941 289
880 3300006871 Ga0075434_100063615 Ga0075434_1000636152 289
881 3300006871 Ga0075434_100217930 Ga0075434_1002179302 289
882 3300006880 Ga0075429_100005444 Ga0075429_1000054442 289
883 3300006880 Ga0075429_100019349 Ga0075429_1000193492 289
884 3300006880 Ga0075429_100287461 Ga0075429_1002874612 289
885 3300006881 Ga0068865_100047460 Ga0068865_1000474603 289
886 3300006881 Ga0068865_100299255 Ga0068865_1002992552 289
887 3300006931 Ga0097620_100001116 Ga0097620_10000111625 289
888 3300006931 Ga0097620_100006340 Ga0097620_1000063405 289
889 3300006931 Ga0097620_100008989 Ga0097620_1000089896 289
890 3300006931 Ga0097620_100015387 Ga0097620_1000153875 289
891 3300006931 Ga0097620_100029889 Ga0097620_1000298894 289
892 3300006931 Ga0097620_100075396 Ga0097620_1000753962 289
893 3300006931 Ga0097620_100130609 Ga0097620_1001306092 289
894 3300006931 Ga0097620_100167828 Ga0097620_1001678282 289
895 3300006946 Ga0079104_1000197 Ga0079104_100019729 289
896 3300006946 Ga0079104_1000514 Ga0079104_100051428 289
897 3300006946 Ga0079104_1001292 Ga0079104_10012926 289
898 3300006946 Ga0079104_1002448 Ga0079104_10024489 289
899 3300006946 Ga0079104_1002512 Ga0079104_10025126 289
900 3300006946 Ga0079104_1003341 Ga0079104_10033413 289
901 3300006946 Ga0079104_1003369 Ga0079104_10033691 289
902 3300006946 Ga0079104_1003437 Ga0079104_10034375 289
903 3300006946 Ga0079104_1006151 Ga0079104_10061514 289
904 3300006946 Ga0079104_1025987 Ga0079104_10259871 289
905 3300006948 Ga0099826_10035887 Ga0099826_100358874 289
906 3300007076 Ga0075435_100018350 Ga0075435_1000183505 289
907 3300007265 Ga0099794_10148695 Ga0099794_101486952 289
908 3300007788 Ga0099795_10104419 Ga0099795_101044192 289
909 3300009011 Ga0105251_10000018 Ga0105251_1000001825 289
910 3300009011 Ga0105251_10001518 Ga0105251_100015188 289
911 3300009011 Ga0105251_10002086 Ga0105251_1000208613 289
912 3300009011 Ga0105251_10005905 Ga0105251_100059051 289
913 3300009011 Ga0105251_10007115 Ga0105251_100071152 289
914 3300009011 Ga0105251_10007555 Ga0105251_100075556 289
915 3300009011 Ga0105251_10009232 Ga0105251_100092324 289
916 3300009011 Ga0105251_10011339 Ga0105251_100113392 289
917 3300009011 Ga0105251_10020583 Ga0105251_100205834 289
918 3300009011 Ga0105251_10024146 Ga0105251_100241462 289
919 3300009011 Ga0105251_10032773 Ga0105251_100327732 289
920 3300009011 Ga0105251_10045138 Ga0105251_100451381 289
921 3300009011 Ga0105251_10075660 Ga0105251_100756601 289
922 3300009011 Ga0105251_10195880 Ga0105251_101958801 289
923 3300009036 Ga0105244_10000006 Ga0105244_10000006289 289
924 3300009036 Ga0105244_10000130 Ga0105244_1000013029 289
925 3300009036 Ga0105244_10000194 Ga0105244_1000019448 289
926 3300009036 Ga0105244_10003732 Ga0105244_100037322 289
927 3300009036 Ga0105244_10004174 Ga0105244_100041748 289
928 3300009036 Ga0105244_10005825 Ga0105244_100058252 289
929 3300009036 Ga0105244_10009715 Ga0105244_100097151 289
930 3300009036 Ga0105244_10012013 Ga0105244_100120134 289
931 3300009036 Ga0105244_10016547 Ga0105244_100165472 289
932 3300009036 Ga0105244_10151854 Ga0105244_101518542 289
933 3300009092 Ga0105250_10000008 Ga0105250_10000008163 289
934 3300009092 Ga0105250_10000463 Ga0105250_1000046327 289
935 3300009092 Ga0105250_10000861 Ga0105250_1000086118 289
936 3300009092 Ga0105250_10000873 Ga0105250_100008736 289
937 3300009092 Ga0105250_10004078 Ga0105250_100040782 289
938 3300009092 Ga0105250_10004971 Ga0105250_100049718 289
939 3300009092 Ga0105250_10092131 Ga0105250_100921312 289
940 3300009093 Ga0105240_10004177 Ga0105240_1000417712 289
941 3300009093 Ga0105240_10010688 Ga0105240_1001068810 289
942 3300009093 Ga0105240_10017463 Ga0105240_100174637 289
943 3300009093 Ga0105240_10019484 Ga0105240_100194842 289
944 3300009093 Ga0105240_10053987 Ga0105240_100539872 289
945 3300009093 Ga0105240_10066598 Ga0105240_100665981 289
946 3300009093 Ga0105240_10119421 Ga0105240_101194212 289
947 3300009093 Ga0105240_10130436 Ga0105240_101304362 289
948 3300009093 Ga0105240_10168372 Ga0105240_101683721 289
949 3300009093 Ga0105240_10177955 Ga0105240_101779552 289
950 3300009094 Ga0111539_10026865 Ga0111539_100268653 289
951 3300009094 Ga0111539_10034721 Ga0111539_100347215 289
952 3300009094 Ga0111539_10063563 Ga0111539_100635634 289
953 3300009094 Ga0111539_10122122 Ga0111539_101221222 289
954 3300009094 Ga0111539_10231371 Ga0111539_102313712 289
955 3300009094 Ga0111539_10621530 Ga0111539_106215301 289
956 3300009098 Ga0105245_10003825 Ga0105245_100038255 289
957 3300009098 Ga0105245_10017371 Ga0105245_100173715 289
958 3300009098 Ga0105245_10033089 Ga0105245_100330892 289
959 3300009098 Ga0105245_10067489 Ga0105245_100674893 289
960 3300009101 Ga0105247_10000018 Ga0105247_10000018134 289
961 3300009101 Ga0105247_10001317 Ga0105247_1000131712 289
962 3300009101 Ga0105247_10010208 Ga0105247_100102084 289
963 3300009101 Ga0105247_10049766 Ga0105247_100497662 289
964 3300009101 Ga0105247_10107282 Ga0105247_101072821 289
965 3300009147 Ga0114129_10000264 Ga0114129_1000026417 289
966 3300009147 Ga0114129_10012623 Ga0114129_1001262310 289
967 3300009147 Ga0114129_10038877 Ga0114129_100388772 289
968 3300009147 Ga0114129_10044436 Ga0114129_100444361 289
969 3300009147 Ga0114129_10094564 Ga0114129_100945646 289
970 3300009147 Ga0114129_10227152 Ga0114129_102271522 289
971 3300009147 Ga0114129_10566196 Ga0114129_105661961 289
972 3300009147 Ga0114129_10705837 Ga0114129_107058371 289
973 3300009147 Ga0114129_11098414 Ga0114129_110984141 289
974 3300009148 Ga0105243_10006636 Ga0105243_100066364 289
975 3300009148 Ga0105243_10080145 Ga0105243_100801452 289
976 3300009148 Ga0105243_10110667 Ga0105243_101106672 289
977 3300009148 Ga0105243_10174972 Ga0105243_101749722 289
978 3300009148 Ga0105243_10204350 Ga0105243_102043502 289
979 3300009174 Ga0105241_10000004 Ga0105241_10000004401 289
980 3300009174 Ga0105241_10046552 Ga0105241_100465522 289
981 3300009176 Ga0105242_10024883 Ga0105242_100248834 289
982 3300009176 Ga0105242_10033306 Ga0105242_100333063 289
983 3300009176 Ga0105242_10099479 Ga0105242_100994792 289
984 3300009177 Ga0105248_10011363 Ga0105248_100113634 289
985 3300009177 Ga0105248_10021417 Ga0105248_100214172 289
986 3300009177 Ga0105248_10043085 Ga0105248_100430854 289
987 3300009177 Ga0105248_10048231 Ga0105248_100482312 289
988 3300009177 Ga0105248_10104555 Ga0105248_101045552 289
989 3300009177 Ga0105248_10361166 Ga0105248_103611662 289
990 3300009545 Ga0105237_10001936 Ga0105237_100019365 289
991 3300009545 Ga0105237_10028178 Ga0105237_100281784 289
992 3300009545 Ga0105237_10035084 Ga0105237_100350842 289
993 3300009545 Ga0105237_10119866 Ga0105237_101198662 289
994 3300009551 Ga0105238_10014263 Ga0105238_100142636 289
995 3300009551 Ga0105238_10016722 Ga0105238_100167223 289
996 3300009551 Ga0105238_10163540 Ga0105238_101635402 289
997 3300009551 Ga0105238_10244892 Ga0105238_102448921 289
998 3300009553 Ga0105249_10022843 Ga0105249_100228434 289
999 3300009553 Ga0105249_10044777 Ga0105249_100447772 289
1000 3300009553 Ga0105249_10061511 Ga0105249_100615112 289
1001 3300010375 Ga0105239_10065885 Ga0105239_100658853 289
1002 3300010375 Ga0105239_10147879 Ga0105239_101478793 289
1003 3300010375 Ga0105239_10155959 Ga0105239_101559591 289
1004 3300010375 Ga0105239_10237857 Ga0105239_102378572 289
1005 3300010375 Ga0105239_10363334 Ga0105239_103633342 289
1006 3300011119 Ga0105246_10002336 Ga0105246_100023365 289
1007 3300011119 Ga0105246_10007027 Ga0105246_100070271 289
1008 3300011119 Ga0105246_10008602 Ga0105246_100086022 289
1009 3300011119 Ga0105246_10023926 Ga0105246_100239262 289
1010 3300011119 Ga0105246_10168602 Ga0105246_101686023 289
1011 3300013100 Ga0157373_10000220 Ga0157373_1000022021 289
1012 3300013100 Ga0157373_10002523 Ga0157373_100025239 289
1013 3300013100 Ga0157373_10016116 Ga0157373_100161163 289
1014 3300013100 Ga0157373_10041256 Ga0157373_100412562 289
1015 3300013100 Ga0157373_10109652 Ga0157373_101096521 289
1016 3300013100 Ga0157373_10422161 Ga0157373_104221611 289
1017 3300013102 Ga0157371_10000167 Ga0157371_1000016746 289
1018 3300013102 Ga0157371_10001411 Ga0157371_1000141115 289
1019 3300013102 Ga0157371_10001794 Ga0157371_1000179413 289
1020 3300013102 Ga0157371_10002311 Ga0157371_1000231119 289
1021 3300013102 Ga0157371_10004005 Ga0157371_100040053 289
1022 3300013102 Ga0157371_10011396 Ga0157371_100113961 289
1023 3300013102 Ga0157371_10015658 Ga0157371_100156582 289
1024 3300013102 Ga0157371_10028031 Ga0157371_100280312 289
1025 3300013102 Ga0157371_10219708 Ga0157371_102197082 289
1026 3300013104 Ga0157370_10000093 Ga0157370_1000009359 289
1027 3300013104 Ga0157370_10002533 Ga0157370_100025332 289
1028 3300013104 Ga0157370_10003123 Ga0157370_1000312314 289
1029 3300013104 Ga0157370_10008772 Ga0157370_100087721 289
1030 3300013105 Ga0157369_10001855 Ga0157369_1000185514 289
1031 3300013105 Ga0157369_10119966 Ga0157369_101199662 289
1032 3300013105 Ga0157369_10342715 Ga0157369_103427151 289
1033 3300013296 Ga0157374_10004065 Ga0157374_100040655 289
1034 3300013297 Ga0157378_10018446 Ga0157378_100184465 289
1035 3300013297 Ga0157378_10021740 Ga0157378_100217404 289
1036 3300013297 Ga0157378_10043056 Ga0157378_100430565 289
1037 3300013297 Ga0157378_10100999 Ga0157378_101009992 289
1038 3300013297 Ga0157378_10183549 Ga0157378_101835492 289
1039 3300013306 Ga0163162_10003861 Ga0163162_100038616 289
1040 3300013306 Ga0163162_10029073 Ga0163162_100290732 289
1041 3300013306 Ga0163162_10036341 Ga0163162_100363413 289
1042 3300013306 Ga0163162_10064722 Ga0163162_100647221 289
1043 3300013306 Ga0163162_10097983 Ga0163162_100979832 289
1044 3300013306 Ga0163162_10272443 Ga0163162_102724432 289
1045 3300013306 Ga0163162_10574967 Ga0163162_105749671 289
1046 3300013307 Ga0157372_10006015 Ga0157372_100060153 289
1047 3300013307 Ga0157372_10008044 Ga0157372_100080446 289
1048 3300013307 Ga0157372_10028753 Ga0157372_100287533 289
1049 3300013307 Ga0157372_10030083 Ga0157372_100300834 289
1050 3300013307 Ga0157372_10063042 Ga0157372_100630426 289
1051 3300013307 Ga0157372_10074215 Ga0157372_100742152 289
1052 3300013307 Ga0157372_10097892 Ga0157372_100978923 289
1053 3300013307 Ga0157372_10158650 Ga0157372_101586502 289
1054 3300013307 Ga0157372_10194389 Ga0157372_101943892 289
1055 3300013307 Ga0157372_10264176 Ga0157372_102641762 289
1056 3300013308 Ga0157375_10001953 Ga0157375_100019537 289
1057 3300013308 Ga0157375_10009639 Ga0157375_100096394 289
1058 3300014325 Ga0163163_10000634 Ga0163163_1000063425 289
1059 3300014325 Ga0163163_10001921 Ga0163163_1000192112 289
1060 3300014325 Ga0163163_10008122 Ga0163163_100081226 289
1061 3300014325 Ga0163163_10015222 Ga0163163_100152223 289
1062 3300014325 Ga0163163_10034625 Ga0163163_100346252 289
1063 3300014325 Ga0163163_10055836 Ga0163163_100558363 289
1064 3300014325 Ga0163163_10098860 Ga0163163_100988602 289
1065 3300014325 Ga0163163_10131218 Ga0163163_101312182 289
1066 3300014325 Ga0163163_10133406 Ga0163163_101334062 289
1067 3300014326 Ga0157380_10001671 Ga0157380_100016714 289
1068 3300014326 Ga0157380_10005298 Ga0157380_100052982 289
1069 3300014326 Ga0157380_10172300 Ga0157380_101723003 289
1070 3300014326 Ga0157380_10514951 Ga0157380_105149511 289
1071 3300014497 Ga0182008_10001742 Ga0182008_100017422 289
1072 3300014968 Ga0157379_10001546 Ga0157379_100015467 289
1073 3300014968 Ga0157379_10008892 Ga0157379_100088924 289
1074 3300014968 Ga0157379_10010746 Ga0157379_100107466 289
1075 3300014968 Ga0157379_10040546 Ga0157379_100405464 289
1076 3300014968 Ga0157379_10070740 Ga0157379_100707402 289
1077 3300014968 Ga0157379_10106495 Ga0157379_101064952 289
1078 3300014968 Ga0157379_10107019 Ga0157379_101070192 289
1079 3300014968 Ga0157379_10154070 Ga0157379_101540702 289
1080 3300014969 Ga0157376_10004164 Ga0157376_100041644 289
1081 3300014969 Ga0157376_10436604 Ga0157376_104366042 289
1082 3300015261 Ga0182006_1035088 Ga0182006_10350882 289
1083 3300015262 Ga0182007_10010048 Ga0182007_100100482 289
1084 3300015679 Ga0183366_1001 Ga0183366_1001472 289
1085 3300015680 Ga0183370_1001 Ga0183370_1001472 289
1086 3300015685 Ga0183369_1001 Ga0183369_1001472 289
1087 3300015687 Ga0183368_1001 Ga0183368_1001472 289
1088 3300017792 Ga0163161_10000690 Ga0163161_1000069012 289
1089 3300017792 Ga0163161_10038164 Ga0163161_100381643 289
1090 3300017792 Ga0163161_10092573 Ga0163161_100925732 289
1091 3300017792 Ga0163161_10116703 Ga0163161_101167033 289
1092 3300017792 Ga0163161_10375620 Ga0163161_103756202 289
1093 3300021377 Ga0213874_10016012 Ga0213874_100160121 289
1094 3300021384 Ga0213876_10000095 Ga0213876_1000009529 289
1095 3300021384 Ga0213876_10089454 Ga0213876_100894541 289
1096 3300021388 Ga0213875_10003220 Ga0213875_1000322010 289
1097 3300025206 Ga0209435_100577 Ga0209435_1005775 289
1098 3300025207 Ga0209760_100001 Ga0209760_100001290 289
1099 3300025207 Ga0209760_100011 Ga0209760_100011150 289
1100 3300025224 Ga0209784_100001 Ga0209784_100001986 289
1101 3300025224 Ga0209784_100040 Ga0209784_100040116 289
1102 3300025225 Ga0209566_100001 Ga0209566_100001986 289
1103 3300025225 Ga0209566_100051 Ga0209566_100051116 289
1104 3300025226 Ga0209674_100002 Ga0209674_100002986 289
1105 3300025226 Ga0209674_100072 Ga0209674_100072116 289
1106 3300025229 Ga0209147_100053 Ga0209147_10005355 289
1107 3300025229 Ga0209147_100067 Ga0209147_100067116 289
1108 3300025230 Ga0209563_100008 Ga0209563_100008988 289
1109 3300025230 Ga0209563_100073 Ga0209563_100073116 289
1110 3300025231 Ga0207427_100001 Ga0207427_100001963 289
1111 3300025231 Ga0207427_100002 Ga0207427_100002290 289
1112 3300025231 Ga0207427_100008 Ga0207427_100008331 289
1113 3300025233 Ga0209437_100003 Ga0209437_100003409 289
1114 3300025233 Ga0209437_100007 Ga0209437_100007440 289
1115 3300025233 Ga0209437_100014 Ga0209437_100014380 289
1116 3300025233 Ga0209437_100185 Ga0209437_100185118 289
1117 3300025242 Ga0209258_100548 Ga0209258_1005487 289
1118 3300025246 Ga0209646_1000537 Ga0209646_100053712 289
1119 3300025253 Ga0209677_100004 Ga0209677_100004988 289
1120 3300025253 Ga0209677_100063 Ga0209677_100063116 289
1121 3300025258 Ga0209129_1000015 Ga0209129_1000015410 289
1122 3300025261 Ga0209233_1000007 Ga0209233_1000007963 289
1123 3300025261 Ga0209233_1000008 Ga0209233_1000008380 289
1124 3300025261 Ga0209233_1006000 Ga0209233_10060001 289
1125 3300025291 Ga0209675_1000639 Ga0209675_10006399 289
1126 3300025292 Ga0209676_1000016 Ga0209676_1000016566 289
1127 3300025292 Ga0209676_1000021 Ga0209676_1000021273 289
1128 3300025292 Ga0209676_1000033 Ga0209676_1000033384 289
1129 3300025292 Ga0209676_1000474 Ga0209676_10004745 289
1130 3300025298 Ga0209050_1000235 Ga0209050_100023534 289
1131 3300025298 Ga0209050_1000477 Ga0209050_10004779 289
1132 3300025298 Ga0209050_1002491 Ga0209050_10024919 289
1133 3300025303 Ga0209051_1000043 Ga0209051_100004364 289
1134 3300025303 Ga0209051_1000123 Ga0209051_100012382 289
1135 3300025321 Ga0207656_10000210 Ga0207656_100002102 289
1136 3300025321 Ga0207656_10111542 Ga0207656_101115422 289
1137 3300025711 Ga0207696_1000001 Ga0207696_100000151 289
1138 3300025711 Ga0207696_1000003 Ga0207696_1000003590 289
1139 3300025711 Ga0207696_1000081 Ga0207696_1000081151 289
1140 3300025711 Ga0207696_1000152 Ga0207696_1000152109 289
1141 3300025711 Ga0207696_1000328 Ga0207696_100032817 289
1142 3300025711 Ga0207696_1000445 Ga0207696_100044518 289
1143 3300025711 Ga0207696_1000489 Ga0207696_100048919 289
1144 3300025711 Ga0207696_1000546 Ga0207696_100054616 289
1145 3300025711 Ga0207696_1000746 Ga0207696_100074616 289
1146 3300025711 Ga0207696_1004779 Ga0207696_10047792 289
1147 3300025711 Ga0207696_1005024 Ga0207696_10050243 289
1148 3300025711 Ga0207696_1024054 Ga0207696_10240542 289
1149 3300025728 Ga0207655_1000001 Ga0207655_1000001529 289
1150 3300025728 Ga0207655_1000005 Ga0207655_1000005682 289
1151 3300025728 Ga0207655_1000011 Ga0207655_1000011310 289
1152 3300025728 Ga0207655_1000023 Ga0207655_1000023171 289
1153 3300025728 Ga0207655_1000032 Ga0207655_1000032260 289
1154 3300025728 Ga0207655_1000040 Ga0207655_1000040326 289
1155 3300025728 Ga0207655_1000105 Ga0207655_1000105151 289
1156 3300025728 Ga0207655_1000157 Ga0207655_1000157109 289
1157 3300025728 Ga0207655_1001462 Ga0207655_10014624 289
1158 3300025728 Ga0207655_1001726 Ga0207655_10017262 289
1159 3300025728 Ga0207655_1002699 Ga0207655_100269911 289
1160 3300025728 Ga0207655_1003248 Ga0207655_10032486 289
1161 3300025728 Ga0207655_1005181 Ga0207655_10051813 289
1162 3300025728 Ga0207655_1006427 Ga0207655_10064272 289
1163 3300025728 Ga0207655_1011015 Ga0207655_10110154 289
1164 3300025728 Ga0207655_1012418 Ga0207655_10124182 289
1165 3300025728 Ga0207655_1014455 Ga0207655_10144552 289
1166 3300025728 Ga0207655_1017196 Ga0207655_10171963 289
1167 3300025728 Ga0207655_1018887 Ga0207655_10188873 289
1168 3300025728 Ga0207655_1021513 Ga0207655_10215132 289
1169 3300025735 Ga0207713_1000001 Ga0207713_1000001327 289
1170 3300025735 Ga0207713_1000006 Ga0207713_1000006357 289
1171 3300025735 Ga0207713_1000009 Ga0207713_1000009402 289
1172 3300025735 Ga0207713_1000021 Ga0207713_100002110 289
1173 3300025735 Ga0207713_1000093 Ga0207713_100009311 289
1174 3300025735 Ga0207713_1000205 Ga0207713_100020551 289
1175 3300025735 Ga0207713_1000519 Ga0207713_10005196 289
1176 3300025735 Ga0207713_1001549 Ga0207713_100154910 289
1177 3300025735 Ga0207713_1006726 Ga0207713_10067261 289
1178 3300025735 Ga0207713_1010050 Ga0207713_10100503 289
1179 3300025735 Ga0207713_1013428 Ga0207713_10134283 289
1180 3300025735 Ga0207713_1023403 Ga0207713_10234034 289
1181 3300025735 Ga0207713_1025529 Ga0207713_10255293 289
1182 3300025735 Ga0207713_1030955 Ga0207713_10309552 289
1183 3300025735 Ga0207713_1035599 Ga0207713_10355991 289
1184 3300025893 Ga0207682_10067177 Ga0207682_100671772 289
1185 3300025900 Ga0207710_10000049 Ga0207710_10000049172 289
1186 3300025900 Ga0207710_10021222 Ga0207710_100212222 289
1187 3300025900 Ga0207710_10028353 Ga0207710_100283532 289
1188 3300025900 Ga0207710_10044932 Ga0207710_100449322 289
1189 3300025901 Ga0207688_10012708 Ga0207688_100127086 289
1190 3300025903 Ga0207680_10061234 Ga0207680_100612342 289
1191 3300025903 Ga0207680_10145625 Ga0207680_101456252 289
1192 3300025903 Ga0207680_10172452 Ga0207680_101724522 289
1193 3300025903 Ga0207680_10225484 Ga0207680_102254842 289
1194 3300025906 Ga0207699_10007127 Ga0207699_100071272 289
1195 3300025906 Ga0207699_10267587 Ga0207699_102675871 289
1196 3300025907 Ga0207645_10000798 Ga0207645_1000079825 289
1197 3300025908 Ga0207643_10034973 Ga0207643_100349732 289
1198 3300025909 Ga0207705_10216673 Ga0207705_102166732 289
1199 3300025911 Ga0207654_10000006 Ga0207654_10000006418 289
1200 3300025911 Ga0207654_10193486 Ga0207654_101934861 289
1201 3300025912 Ga0207707_10002135 Ga0207707_100021354 289
1202 3300025912 Ga0207707_10002487 Ga0207707_100024877 289
1203 3300025912 Ga0207707_10020681 Ga0207707_100206812 289
1204 3300025912 Ga0207707_10021273 Ga0207707_100212733 289
1205 3300025912 Ga0207707_10205016 Ga0207707_102050163 289
1206 3300025912 Ga0207707_10286700 Ga0207707_102867002 289
1207 3300025912 Ga0207707_10538294 Ga0207707_105382942 289
1208 3300025913 Ga0207695_10007590 Ga0207695_100075902 289
1209 3300025913 Ga0207695_10023781 Ga0207695_100237813 289
1210 3300025913 Ga0207695_10034289 Ga0207695_100342894 289
1211 3300025913 Ga0207695_10082994 Ga0207695_100829943 289
1212 3300025913 Ga0207695_10131969 Ga0207695_101319692 289
1213 3300025913 Ga0207695_10152934 Ga0207695_101529342 289
1214 3300025913 Ga0207695_10185695 Ga0207695_101856952 289
1215 3300025914 Ga0207671_10000287 Ga0207671_1000028721 289
1216 3300025915 Ga0207693_10008931 Ga0207693_100089312 289
1217 3300025916 Ga0207663_10004681 Ga0207663_100046812 289
1218 3300025916 Ga0207663_10014720 Ga0207663_100147203 289
1219 3300025917 Ga0207660_10035893 Ga0207660_100358933 289
1220 3300025917 Ga0207660_10069924 Ga0207660_100699242 289
1221 3300025917 Ga0207660_10100382 Ga0207660_101003822 289
1222 3300025917 Ga0207660_10106088 Ga0207660_101060882 289
1223 3300025917 Ga0207660_10153241 Ga0207660_101532412 289
1224 3300025917 Ga0207660_10210005 Ga0207660_102100052 289
1225 3300025918 Ga0207662_10005511 Ga0207662_100055115 289
1226 3300025918 Ga0207662_10173442 Ga0207662_101734422 289
1227 3300025918 Ga0207662_10415513 Ga0207662_104155131 289
1228 3300025919 Ga0207657_10007983 Ga0207657_100079833 289
1229 3300025919 Ga0207657_10124817 Ga0207657_101248173 289
1230 3300025920 Ga0207649_10000068 Ga0207649_1000006883 289
1231 3300025921 Ga0207652_10011454 Ga0207652_100114542 289
1232 3300025921 Ga0207652_10027558 Ga0207652_100275583 289
1233 3300025921 Ga0207652_10118304 Ga0207652_101183042 289
1234 3300025921 Ga0207652_10154454 Ga0207652_101544542 289
1235 3300025921 Ga0207652_10252647 Ga0207652_102526472 289
1236 3300025921 Ga0207652_10382849 Ga0207652_103828491 289
1237 3300025923 Ga0207681_10004614 Ga0207681_100046143 289
1238 3300025923 Ga0207681_10053638 Ga0207681_100536382 289
1239 3300025924 Ga0207694_10007269 Ga0207694_100072692 289
1240 3300025924 Ga0207694_10026150 Ga0207694_100261502 289
1241 3300025924 Ga0207694_10054068 Ga0207694_100540682 289
1242 3300025924 Ga0207694_10174770 Ga0207694_101747701 289
1243 3300025925 Ga0207650_10000002 Ga0207650_10000002507 289
1244 3300025925 Ga0207650_10000255 Ga0207650_1000025556 289
1245 3300025925 Ga0207650_10000465 Ga0207650_1000046523 289
1246 3300025926 Ga0207659_10000537 Ga0207659_100005375 289
1247 3300025926 Ga0207659_10003927 Ga0207659_100039272 289
1248 3300025926 Ga0207659_10147010 Ga0207659_101470101 289
1249 3300025926 Ga0207659_10547691 Ga0207659_105476911 289
1250 3300025927 Ga0207687_10024173 Ga0207687_100241733 289
1251 3300025927 Ga0207687_10025300 Ga0207687_100253002 289
1252 3300025927 Ga0207687_10059781 Ga0207687_100597812 289
1253 3300025927 Ga0207687_10138119 Ga0207687_101381192 289
1254 3300025928 Ga0207700_10118566 Ga0207700_101185661 289
1255 3300025928 Ga0207700_10201235 Ga0207700_102012351 289
1256 3300025929 Ga0207664_10440094 Ga0207664_104400942 289
1257 3300025931 Ga0207644_10000051 Ga0207644_1000005169 289
1258 3300025931 Ga0207644_10012285 Ga0207644_100122852 289
1259 3300025931 Ga0207644_10163216 Ga0207644_101632162 289
1260 3300025931 Ga0207644_10230775 Ga0207644_102307751 289
1261 3300025932 Ga0207690_10110387 Ga0207690_101103871 289
1262 3300025933 Ga0207706_10004728 Ga0207706_1000472811 289
1263 3300025933 Ga0207706_10008716 Ga0207706_100087162 289
1264 3300025933 Ga0207706_10031394 Ga0207706_100313942 289
1265 3300025933 Ga0207706_10045701 Ga0207706_100457013 289
1266 3300025933 Ga0207706_10070562 Ga0207706_100705621 289
1267 3300025933 Ga0207706_10139450 Ga0207706_101394502 289
1268 3300025933 Ga0207706_10215231 Ga0207706_102152311 289
1269 3300025934 Ga0207686_10189661 Ga0207686_101896612 289
1270 3300025935 Ga0207709_10000053 Ga0207709_10000053162 289
1271 3300025935 Ga0207709_10080322 Ga0207709_100803221 289
1272 3300025935 Ga0207709_10119093 Ga0207709_101190932 289
1273 3300025936 Ga0207670_10211574 Ga0207670_102115741 289
1274 3300025937 Ga0207669_10071119 Ga0207669_100711192 289
1275 3300025937 Ga0207669_10072201 Ga0207669_100722012 289
1276 3300025937 Ga0207669_10075791 Ga0207669_100757912 289
1277 3300025939 Ga0207665_10051674 Ga0207665_100516742 289
1278 3300025939 Ga0207665_10052991 Ga0207665_100529912 289
1279 3300025940 Ga0207691_10002614 Ga0207691_100026149 289
1280 3300025940 Ga0207691_10005405 Ga0207691_100054052 289
1281 3300025940 Ga0207691_10061192 Ga0207691_100611922 289
1282 3300025940 Ga0207691_10139179 Ga0207691_101391792 289
1283 3300025940 Ga0207691_10247006 Ga0207691_102470062 289
1284 3300025941 Ga0207711_10000612 Ga0207711_100006122 289
1285 3300025941 Ga0207711_10000853 Ga0207711_100008535 289
1286 3300025941 Ga0207711_10015341 Ga0207711_100153413 289
1287 3300025941 Ga0207711_10098100 Ga0207711_100981001 289
1288 3300025941 Ga0207711_10102082 Ga0207711_101020823 289
1289 3300025942 Ga0207689_10014606 Ga0207689_100146063 289
1290 3300025942 Ga0207689_10042609 Ga0207689_100426091 289
1291 3300025942 Ga0207689_10094634 Ga0207689_100946342 289
1292 3300025942 Ga0207689_10229253 Ga0207689_102292532 289
1293 3300025942 Ga0207689_10345039 Ga0207689_103450391 289
1294 3300025944 Ga0207661_10002689 Ga0207661_1000268910 289
1295 3300025945 Ga0207679_10000018 Ga0207679_10000018120 289
1296 3300025945 Ga0207679_10007527 Ga0207679_100075274 289
1297 3300025945 Ga0207679_10050957 Ga0207679_100509572 289
1298 3300025949 Ga0207667_10017787 Ga0207667_100177873 289
1299 3300025949 Ga0207667_10056345 Ga0207667_100563452 289
1300 3300025949 Ga0207667_10087911 Ga0207667_100879112 289
1301 3300025960 Ga0207651_10008614 Ga0207651_100086142 289
1302 3300025961 Ga0207712_10096245 Ga0207712_100962451 289
1303 3300025972 Ga0207668_10010756 Ga0207668_100107565 289
1304 3300025972 Ga0207668_10253564 Ga0207668_102535642 289
1305 3300025981 Ga0207640_10017195 Ga0207640_100171953 289
1306 3300025981 Ga0207640_10283530 Ga0207640_102835302 289
1307 3300025986 Ga0207658_10000001 Ga0207658_10000001845 289
1308 3300025986 Ga0207658_10000245 Ga0207658_1000024533 289
1309 3300025986 Ga0207658_10208579 Ga0207658_102085792 289
1310 3300025986 Ga0207658_10219819 Ga0207658_102198192 289
1311 3300025986 Ga0207658_10283721 Ga0207658_102837212 289
1312 3300025986 Ga0207658_10323900 Ga0207658_103239002 289
1313 3300026023 Ga0207677_10017504 Ga0207677_100175042 289
1314 3300026023 Ga0207677_10038016 Ga0207677_100380162 289
1315 3300026035 Ga0207703_10002492 Ga0207703_1000249213 289
1316 3300026035 Ga0207703_10007488 Ga0207703_100074885 289
1317 3300026035 Ga0207703_10009648 Ga0207703_100096483 289
1318 3300026035 Ga0207703_10028651 Ga0207703_100286514 289
1319 3300026041 Ga0207639_10106578 Ga0207639_101065782 289
1320 3300026041 Ga0207639_10238081 Ga0207639_102380812 289
1321 3300026067 Ga0207678_10333334 Ga0207678_103333341 289
1322 3300026067 Ga0207678_10349841 Ga0207678_103498412 289
1323 3300026075 Ga0207708_10011893 Ga0207708_100118932 289
1324 3300026075 Ga0207708_10059720 Ga0207708_100597202 289
1325 3300026075 Ga0207708_10062233 Ga0207708_100622332 289
1326 3300026075 Ga0207708_10298909 Ga0207708_102989092 289
1327 3300026078 Ga0207702_10215430 Ga0207702_102154302 289
1328 3300026088 Ga0207641_10000449 Ga0207641_1000044914 289
1329 3300026088 Ga0207641_10002491 Ga0207641_100024916 289
1330 3300026088 Ga0207641_10008790 Ga0207641_100087903 289
1331 3300026088 Ga0207641_10010128 Ga0207641_100101284 289
1332 3300026088 Ga0207641_10078234 Ga0207641_100782342 289
1333 3300026088 Ga0207641_10214616 Ga0207641_102146162 289
1334 3300026089 Ga0207648_10018031 Ga0207648_100180312 289
1335 3300026089 Ga0207648_10109352 Ga0207648_101093522 289
1336 3300026095 Ga0207676_10000001 Ga0207676_10000001507 289
1337 3300026095 Ga0207676_10008384 Ga0207676_100083842 289
1338 3300026095 Ga0207676_10136662 Ga0207676_101366622 289
1339 3300026095 Ga0207676_10149809 Ga0207676_101498091 289
1340 3300026116 Ga0207674_10000480 Ga0207674_100004801 289
1341 3300026116 Ga0207674_10359623 Ga0207674_103596231 289
1342 3300026116 Ga0207674_10543664 Ga0207674_105436642 289
1343 3300026118 Ga0207675_100000731 Ga0207675_10000073119 289
1344 3300026118 Ga0207675_100010971 Ga0207675_1000109712 289
1345 3300026118 Ga0207675_100116090 Ga0207675_1001160902 289
1346 3300026121 Ga0207683_10000952 Ga0207683_1000095216 289
1347 3300026142 Ga0207698_10192987 Ga0207698_101929872 289
1348 3300027111 Ga0209281_1000001 Ga0209281_10000011447 289
1349 3300027111 Ga0209281_1000008 Ga0209281_1000008380 289
1350 3300027111 Ga0209281_1000010 Ga0209281_1000010634 289
1351 3300027111 Ga0209281_1000021 Ga0209281_100002195 289
1352 3300027111 Ga0209281_1000041 Ga0209281_1000041310 289
1353 3300027111 Ga0209281_1000085 Ga0209281_100008514 289
1354 3300027111 Ga0209281_1000291 Ga0209281_10002918 289
1355 3300027111 Ga0209281_1000817 Ga0209281_100081718 289
1356 3300027111 Ga0209281_1001892 Ga0209281_10018923 289
1357 3300027111 Ga0209281_1002465 Ga0209281_10024651 289
1358 3300027111 Ga0209281_1006125 Ga0209281_10061253 289
1359 3300027296 Ga0209389_1000096 Ga0209389_100009613 289
1360 3300027312 Ga0209371_1000001 Ga0209371_1000001429 289
1361 3300027312 Ga0209371_1000010 Ga0209371_1000010529 289
1362 3300027312 Ga0209371_1000047 Ga0209371_1000047268 289
1363 3300027312 Ga0209371_1000056 Ga0209371_100005641 289
1364 3300027312 Ga0209371_1000170 Ga0209371_100017071 289
1365 3300027312 Ga0209371_1000537 Ga0209371_100053725 289
1366 3300027312 Ga0209371_1000590 Ga0209371_100059034 289
1367 3300027312 Ga0209371_1000614 Ga0209371_100061435 289
1368 3300027312 Ga0209371_1000615 Ga0209371_100061520 289
1369 3300027312 Ga0209371_1000803 Ga0209371_100080319 289
1370 3300027312 Ga0209371_1001366 Ga0209371_10013669 289
1371 3300027312 Ga0209371_1001830 Ga0209371_10018306 289
1372 3300027312 Ga0209371_1002782 Ga0209371_10027821 289
1373 3300027312 Ga0209371_1003576 Ga0209371_10035762 289
1374 3300027312 Ga0209371_1005234 Ga0209371_10052346 289
1375 3300027312 Ga0209371_1008716 Ga0209371_10087162 289
1376 3300027312 Ga0209371_1009171 Ga0209371_10091714 289
1377 3300027378 Ga0209981_1004109 Ga0209981_10041091 289
1378 3300027526 Ga0209968_1005067 Ga0209968_10050672 289
1379 3300027543 Ga0209999_1004925 Ga0209999_10049252 289
1380 3300027552 Ga0209982_1010547 Ga0209982_10105471 289
1381 3300027614 Ga0209970_1004874 Ga0209970_10048741 289
1382 3300027665 Ga0209983_1003394 Ga0209983_10033941 289
1383 3300027876 Ga0209974_10001231 Ga0209974_100012312 289
1384 3300027876 Ga0209974_10004627 Ga0209974_100046275 289
1385 3300028379 Ga0268266_10000027 Ga0268266_10000027322 289
1386 3300028379 Ga0268266_10002005 Ga0268266_100020057 289
1387 3300028379 Ga0268266_10004969 Ga0268266_1000496912 289
1388 3300028379 Ga0268266_10005939 Ga0268266_100059398 289
1389 3300028379 Ga0268266_10006560 Ga0268266_100065609 289
1390 3300028379 Ga0268266_10008567 Ga0268266_100085676 289
1391 3300028379 Ga0268266_10039841 Ga0268266_100398412 289
1392 3300028379 Ga0268266_10049903 Ga0268266_100499032 289
1393 3300028379 Ga0268266_10068821 Ga0268266_100688213 289
1394 3300028379 Ga0268266_10113057 Ga0268266_101130572 289
1395 3300028380 Ga0268265_10000783 Ga0268265_1000078319 289
1396 3300028380 Ga0268265_10008164 Ga0268265_100081643 289
1397 3300028380 Ga0268265_10018356 Ga0268265_100183562 289
1398 3300028380 Ga0268265_10019513 Ga0268265_100195133 289
1399 3300028380 Ga0268265_10039095 Ga0268265_100390953 289
1400 3300028380 Ga0268265_10091440 Ga0268265_100914402 289
1401 3300028380 Ga0268265_10428590 Ga0268265_104285901 289
1402 3300028381 Ga0268264_10000004 Ga0268264_10000004514 289
1403 3300028381 Ga0268264_10000198 Ga0268264_1000019854 289
1404 3300028381 Ga0268264_10035068 Ga0268264_100350682 289
1405 3300028381 Ga0268264_10078934 Ga0268264_100789342 289
1406 3300028381 Ga0268264_10134437 Ga0268264_101344372 289
1407 3300028381 Ga0268264_10266744 Ga0268264_102667442 289
1408 3300028381 Ga0268264_10323596 Ga0268264_103235962 289
1409 3300028558 Ga0265326_10031754 Ga0265326_100317542 289
1410 3300028573 Ga0265334_10000038 Ga0265334_1000003822 289
1411 3300028573 Ga0265334_10019228 Ga0265334_100192282 289
1412 3300028653 Ga0265323_10003281 Ga0265323_100032815 289
1413 3300028653 Ga0265323_10023328 Ga0265323_100233281 289
1414 3300028794 Ga0307515_10049771 Ga0307515_100497712 289
1415 3300028800 Ga0265338_10012444 Ga0265338_100124445 289
1416 3300030500 Ga0268256_1000001 Ga0268256_10000012212 289
1417 3300030500 Ga0268256_1000003 Ga0268256_1000003451 289
1418 3300030500 Ga0268256_1000022 Ga0268256_1000022336 289
1419 3300030500 Ga0268256_1000142 Ga0268256_100014236 289
1420 3300030500 Ga0268256_1000270 Ga0268256_100027011 289
1421 3300030500 Ga0268256_1000438 Ga0268256_10004384 289
1422 3300030500 Ga0268256_1000514 Ga0268256_100051434 289
1423 3300030500 Ga0268256_1000528 Ga0268256_10005287 289
1424 3300030500 Ga0268256_1000596 Ga0268256_100059619 289
1425 3300030500 Ga0268256_1000671 Ga0268256_100067119 289
1426 3300030500 Ga0268256_1001116 Ga0268256_100111611 289
1427 3300030500 Ga0268256_1001173 Ga0268256_10011738 289
1428 3300030500 Ga0268256_1002997 Ga0268256_10029974 289
1429 3300030500 Ga0268256_1005156 Ga0268256_10051561 289
1430 3300030500 Ga0268256_1007231 Ga0268256_10072312 289
1431 3300030500 Ga0268256_1009672 Ga0268256_10096721 289
1432 3300030521 Ga0307511_10000048 Ga0307511_1000004816 289
1433 3300030521 Ga0307511_10035568 Ga0307511_100355682 289
1434 3300030521 Ga0307511_10128895 Ga0307511_101288952 289
1435 3300030732 Ga0316176_1064153 Ga0316176_10641532 289
1436 3300030733 Ga0314311_1104646 Ga0314311_11046464 289
1437 3300030735 Ga0316178_1127053 Ga0316178_112705312 289
1438 3300030744 Ga0316181_1161353 Ga0316181_11613532 289
1439 3300031235 Ga0265330_10011277 Ga0265330_100112771 289
1440 3300031235 Ga0265330_10070524 Ga0265330_100705242 289
1441 3300031238 Ga0265332_10031061 Ga0265332_100310612 289
1442 3300031249 Ga0265339_10000257 Ga0265339_1000025717 289
1443 3300031250 Ga0265331_10012306 Ga0265331_100123062 289
1444 3300031250 Ga0265331_10031593 Ga0265331_100315932 289
1445 3300031250 Ga0265331_10039489 Ga0265331_100394892 289
1446 3300031251 Ga0265327_10000014 Ga0265327_10000014118 289
1447 3300031251 Ga0265327_10000053 Ga0265327_10000053135 289
1448 3300031251 Ga0265327_10000378 Ga0265327_100003784 289
1449 3300031251 Ga0265327_10000393 Ga0265327_1000039320 289
1450 3300031251 Ga0265327_10018866 Ga0265327_100188662 289
1451 3300031344 Ga0265316_10000372 Ga0265316_1000037221 289
1452 3300031344 Ga0265316_10014619 Ga0265316_100146191 289
1453 3300031344 Ga0265316_10017611 Ga0265316_100176114 289
1454 3300031344 Ga0265316_10032319 Ga0265316_100323195 289
1455 3300031344 Ga0265316_10271002 Ga0265316_102710022 289
1456 3300031456 Ga0307513_10018691 Ga0307513_100186912 289
1457 3300031456 Ga0307513_10110114 Ga0307513_101101142 289
1458 3300031456 Ga0307513_10130480 Ga0307513_101304802 289
1459 3300031456 Ga0307513_10244331 Ga0307513_102443312 289
1460 3300031456 Ga0307513_10254971 Ga0307513_102549712 289
1461 3300031507 Ga0307509_10000025 Ga0307509_100000255 289
1462 3300031507 Ga0307509_10000803 Ga0307509_1000080334 289
1463 3300031507 Ga0307509_10231173 Ga0307509_102311732 289
1464 3300031548 Ga0307408_100000004 Ga0307408_100000004133 289
1465 3300031548 Ga0307408_100001639 Ga0307408_10000163916 289
1466 3300031548 Ga0307408_100005859 Ga0307408_1000058595 289
1467 3300031548 Ga0307408_100080937 Ga0307408_1000809372 289
1468 3300031548 Ga0307408_100107962 Ga0307408_1001079622 289
1469 3300031548 Ga0307408_100108793 Ga0307408_1001087932 289
1470 3300031595 Ga0265313_10000102 Ga0265313_1000010248 289
1471 3300031595 Ga0265313_10020319 Ga0265313_100203192 289
1472 3300031616 Ga0307508_10055899 Ga0307508_100558992 289
1473 3300031616 Ga0307508_10100671 Ga0307508_101006712 289
1474 3300031665 Ga0316575_10000304 Ga0316575_100003042 289
1475 3300031665 Ga0316575_10001006 Ga0316575_100010066 289
1476 3300031665 Ga0316575_10003310 Ga0316575_100033105 289
1477 3300031691 Ga0316579_10000020 Ga0316579_1000002026 289
1478 3300031691 Ga0316579_10000561 Ga0316579_100005619 289
1479 3300031691 Ga0316579_10002231 Ga0316579_100022314 289
1480 3300031691 Ga0316579_10004590 Ga0316579_100045905 289
1481 3300031691 Ga0316579_10103275 Ga0316579_101032752 289
1482 3300031711 Ga0265314_10000633 Ga0265314_1000063321 289
1483 3300031712 Ga0265342_10007163 Ga0265342_100071635 289
1484 3300031712 Ga0265342_10009307 Ga0265342_100093076 289
1485 3300031727 Ga0316576_10000668 Ga0316576_1000066810 289
1486 3300031727 Ga0316576_10000860 Ga0316576_100008609 289
1487 3300031727 Ga0316576_10103088 Ga0316576_101030882 289
1488 3300031727 Ga0316576_10105409 Ga0316576_101054091 289
1489 3300031727 Ga0316576_10113712 Ga0316576_101137122 289
1490 3300031728 Ga0316578_10001245 Ga0316578_100012455 289
1491 3300031728 Ga0316578_10010790 Ga0316578_100107904 289
1492 3300031728 Ga0316578_10019197 Ga0316578_100191972 289
1493 3300031728 Ga0316578_10154562 Ga0316578_101545622 289
1494 3300031731 Ga0307405_10061177 Ga0307405_100611772 289
1495 3300031731 Ga0307405_10089753 Ga0307405_100897532 289
1496 3300031733 Ga0316577_10005445 Ga0316577_100054453 289
1497 3300031733 Ga0316577_10057326 Ga0316577_100573262 289
1498 3300031733 Ga0316577_10114108 Ga0316577_101141081 289
1499 3300031733 Ga0316577_10152770 Ga0316577_101527702 289
1500 3300031733 Ga0316577_10176566 Ga0316577_101765661 289
1501 3300031852 Ga0307410_10005034 Ga0307410_100050342 289
1502 3300031852 Ga0307410_10049015 Ga0307410_100490152 289
1503 3300031901 Ga0307406_10001124 Ga0307406_1000112416 289
1504 3300031901 Ga0307406_10043227 Ga0307406_100432271 289
1505 3300031901 Ga0307406_10165655 Ga0307406_101656552 289
1506 3300031901 Ga0307406_10203491 Ga0307406_102034911 289
1507 3300031903 Ga0307407_10004720 Ga0307407_100047204 289
1508 3300031911 Ga0307412_10141884 Ga0307412_101418842 289
1509 3300031995 Ga0307409_100005208 Ga0307409_1000052084 289
1510 3300031995 Ga0307409_100014790 Ga0307409_1000147902 289
1511 3300031995 Ga0307409_100070959 Ga0307409_1000709592 289
1512 3300031995 Ga0307409_100245117 Ga0307409_1002451172 289
1513 3300032002 Ga0307416_100069259 Ga0307416_1000692592 289
1514 3300032002 Ga0307416_100077214 Ga0307416_1000772142 289
1515 3300032002 Ga0307416_100206713 Ga0307416_1002067131 289
1516 3300032004 Ga0307414_10043050 Ga0307414_100430504 289
1517 3300032004 Ga0307414_10061592 Ga0307414_100615922 289
1518 3300032004 Ga0307414_10083568 Ga0307414_100835682 289
1519 3300032005 Ga0307411_10251760 Ga0307411_102517602 289
1520 3300032126 Ga0307415_100057292 Ga0307415_1000572922 289
1521 3300032126 Ga0307415_100403739 Ga0307415_1004037392 289
1522 3300032133 Ga0316583_10004819 Ga0316583_100048193 289
1523 3300032133 Ga0316583_10011760 Ga0316583_100117603 289
1524 3300032133 Ga0316583_10016149 Ga0316583_100161492 289
1525 3300032133 Ga0316583_10029047 Ga0316583_100290472 289
1526 3300032133 Ga0316583_10041474 Ga0316583_100414742 289
1527 3300032137 Ga0316585_10000061 Ga0316585_1000006117 289
1528 3300032137 Ga0316585_10004523 Ga0316585_100045231 289
1529 3300032139 Ga0316580_10000117 Ga0316580_100001171 289
1530 3300032168 Ga0316593_10043287 Ga0316593_100432871 289
1531 3300032168 Ga0316593_10115695 Ga0316593_101156951 289
1532 3300033180 Ga0307510_10000002 Ga0307510_10000002357 289
1533 3300033180 Ga0307510_10009847 Ga0307510_100098473 289
1534 3300033528 Ga0316588_1005585 Ga0316588_10055852 289
1535 3300033541 Ga0316596_1002845 Ga0316596_10028452 289
1536 3300033541 Ga0316596_1010918 Ga0316596_10109182 289
1537 3300033541 Ga0316596_1044853 Ga0316596_10448532 289
1538 3300035089 Ga0373944_0017675 Ga0373944_0017675_875_1747 289
1539 3300035092 Ga0373952_0042825 Ga0373952_0042825_57_1019 289
1540 3300035111 Ga0373923_0051613 Ga0373923_0051613_421_1458 289
1541 3300035113 Ga0373936_0018998 Ga0373936_0018998_358_1230 289
1542 3300035119 Ga0373956_0051721 Ga0373956_0051721_344_1216 289
1543 3300035119 Ga0373956_0139503 Ga0373956_0139503_56_1099 289
1544 3300035171 Ga0373946_0050473 Ga0373946_0050473_556_1593 289
1545 3300035207 Ga0373942_0013241 Ga0373942_0013241_169_1044 289
1546 3300035398 Ga0316574_0000114 Ga0316574_0000114_17997_18869 289
1547 3300035398 Ga0316574_0005360 Ga0316574_0005360_2932_3804 289
1548 3300035398 Ga0316574_0008947 Ga0316574_0008947_3175_4095 289
1549 3300035398 Ga0316574_0008971 Ga0316574_0008971_2307_3212 289
1550 3300035398 Ga0316574_0026483 Ga0316574_0026483_2291_3169 289
1551 3300035398 Ga0316574_0029285 Ga0316574_0029285_1031_1903 289
1552 3300035398 Ga0316574_0042552 Ga0316574_0042552_215_1084 289
1553 3300035398 Ga0316574_0052242 Ga0316574_0052242_865_1737 289
1554 3300035398 Ga0316574_0080961 Ga0316574_0080961_1079_1951 289
1555 3300035398 Ga0316574_0098376 Ga0316574_0098376_278_1153 289
1556 3300035398 Ga0316574_0108623 Ga0316574_0108623_726_1601 289
1557 3300035398 Ga0316574_0283467 Ga0316574_0283467_44_916 289
1558 3300035691 Ga0373931_0030826 Ga0373931_0030826_1341_2210 289
1559 3300035695 Ga0373927_0000001 Ga0373927_0000001_918115_919071 289
1560 3300035695 Ga0373927_0021708 Ga0373927_0021708_1160_2197 289
1561 3300035724 Ga0373933_0185408 Ga0373933_0185408_63_1019 289
1562 3300035725 Ga0373947_0030858 Ga0373947_0030858_1174_2046 289
1563 3300036401 Ga0373937_0038612 Ga0373937_0038612_741_1778 289
1564 3300036401 Ga0373937_0047434 Ga0373937_0047434_693_1562 289
1565 3300036647 Ga0316582_0000007 Ga0316582_0000007_5673_6545 289
1566 3300036647 Ga0316582_0003413 Ga0316582_0003413_1801_2676 289
1567 3300036647 Ga0316582_0006912 Ga0316582_0006912_207_1079 289
1568 3300036647 Ga0316582_0024156 Ga0316582_0024156_1974_2846 289
1569 3300036647 Ga0316582_0035728 Ga0316582_0035728_2005_2880 289
1570 3300036647 Ga0316582_0038276 Ga0316582_0038276_1216_2121 289
1571 3300036647 Ga0316582_0041091 Ga0316582_0041091_433_1305 289
1572 3300036647 Ga0316582_0041179 Ga0316582_0041179_1286_2155 289
1573 3300036647 Ga0316582_0064160 Ga0316582_0064160_218_1093 289
1574 3300036647 Ga0316582_0078637 Ga0316582_0078637_637_1509 289
1575 3300036647 Ga0316582_0146041 Ga0316582_0146041_602_1477 289
1576 3300036647 Ga0316582_0169632 Ga0316582_0169632_298_1173 289
1577 3300036712 Ga0316584_0000232 Ga0316584_0000232_25272_26144 289
1578 3300036712 Ga0316584_0002851 Ga0316584_0002851_5657_6529 289
1579 3300036712 Ga0316584_0009768 Ga0316584_0009768_1639_2511 289
1580 3300036712 Ga0316584_0018982 Ga0316584_0018982_1415_2290 289
1581 3300036712 Ga0316584_0030381 Ga0316584_0030381_3078_3950 289
1582 3300036712 Ga0316584_0073367 Ga0316584_0073367_807_1679 289
1583 3300036712 Ga0316584_0108722 Ga0316584_0108722_662_1537 289
1584 3300036712 Ga0316584_0125469 Ga0316584_0125469_271_1410 289
1585 3300036712 Ga0316584_0246158 Ga0316584_0246158_95_967 289
1586 3300036712 Ga0316584_0311274 Ga0316584_0311274_123_998 289
1587 3300037418 Ga0395900_0001068 Ga0395900_0001068_19157_20029 289
1588 3300037418 Ga0395900_0105484 Ga0395900_0105484_852_1727 289
1589 3300037466 Ga0395898_0024577 Ga0395898_0024577_3817_5010 289
1590 3300037466 Ga0395898_0034972 Ga0395898_0034972_3182_4057 289
1591 3300037471 Ga0395905_0002379 Ga0395905_0002379_8687_9556 289
1592 3300037471 Ga0395905_0044845 Ga0395905_0044845_284_1156 289
1593 3300037471 Ga0395905_0071400 Ga0395905_0071400_580_1449 289
1594 3300037588 Ga0316581_0000648 Ga0316581_0000648_2320_3192 289
1595 3300037853 Ga0436364_0108855 Ga0436364_0108855_18314_19189 289
1596 3300038443 Ga0395901_0001545 Ga0395901_0001545_252_1127 289
1597 3300038705 Ga0237819_00849 Ga0237819_00849_6404_7288 289
1598 3300038725 Ga0400484_06088 Ga0400484_06088_123_992 289
1599 3300038735 Ga0400485_07089 Ga0400485_07089_44841_45740 289
1600 3300038741 Ga0400488_13288 Ga0400488_13288_6233_7132 289
1601 3300038742 Ga0400486_00736 Ga0400486_00736_42069_42968 289
1602 3300039062 Ga0400483_018680 Ga0400483_018680_2633_3505 289
1603 3300039062 Ga0400483_026308 Ga0400483_026308_57929_58801 289
1604 3300039062 Ga0400483_026438 Ga0400483_026438_1513_2385 289
1605 3300039062 Ga0400483_108467 Ga0400483_108467_30_899 289
1606 3300039062 Ga0400483_149853 Ga0400483_149853_1111_1983 289
1607 3300039062 Ga0400483_172565 Ga0400483_172565_1185_2057 289
1608 3300039062 Ga0400483_218643 Ga0400483_218643_394_1263 289
1609 3300039062 Ga0400483_250036 Ga0400483_250036_264535_265407 289
1610 3300039062 Ga0400483_254606 Ga0400483_254606_316_1188 289
1611 3300039110 Ga0400487_03987 Ga0400487_03987_6251_7150 289
1612 3300039110 Ga0400487_36948 Ga0400487_36948_717_1589 289
1613 3300039437 Ga0436365_0143511 Ga0436365_0143511_84_1244 289
1614 3300039437 Ga0436365_0727636 Ga0436365_0727636_21551_22420 289
1615 3300039437 Ga0436365_1553232 Ga0436365_1553232_2188_3189 289
1616 3300039437 Ga0436365_1894950 Ga0436365_1894950_2290_3174 289
1617 3300039438 Ga0436360_1218743 Ga0436360_1218743_1060_2019 289
1618 3300039438 Ga0436360_1310758 Ga0436360_1310758_1264_2283 289
1619 3300039447 Ga0436361_0466583 Ga0436361_0466583_1343_2302 289
1620 3300039450 Ga0436363_0812865 Ga0436363_0812865_359_1441 289
1621 3300039450 Ga0436363_1113543 Ga0436363_1113543_3476_4453 289
1622 3300039450 Ga0436363_1428747 Ga0436363_1428747_884_1837 289
1623 3300039450 Ga0436363_1459742 Ga0436363_1459742_32_907 289
1624 3300039453 Ga0436362_0660090 Ga0436362_0660090_872_1831 289
1625 3300039453 Ga0436362_0920641 Ga0436362_0920641_123_1124 289
1626 3300041404 Ga0439436_0035177 Ga0439436_0035177_277_1164 289
1627 3300041405 Ga0439438_000001 Ga0439438_000001_126581_127453 289
1628 3300041405 Ga0439438_008039 Ga0439438_008039_2096_2968 289
1629 3300041405 Ga0439438_009561 Ga0439438_009561_2052_2927 289
1630 3300041407 Ga0439447_000496 Ga0439447_000496_7145_8020 289
1631 3300041407 Ga0439447_003555 Ga0439447_003555_214_1101 289
1632 3300041411 Ga0439466_0000003 Ga0439466_0000003_402764_403639 289
1633 3300041463 Ga0451804_0813252 Ga0451804_0813252_110_1228 289
1634 3300042000 Ga0439437_000020 Ga0439437_000020_10522_11409 289
1635 3300042006 Ga0439432_001341 Ga0439432_001341_2475_3347 289
1636 3300042010 Ga0439452_000001 Ga0439452_000001_67223_68098 289
1637 3300042010 Ga0439452_000029 Ga0439452_000029_145601_146470 289
1638 3300042010 Ga0439452_000924 Ga0439452_000924_9979_10848 289
1639 3300042010 Ga0439452_001015 Ga0439452_001015_3811_4680 289
1640 3300042115 Ga0450911_000001 Ga0450911_000001_67410_68297 289
1641 3300042146 Ga0450907_002033 Ga0450907_002033_79_954 289
1642 3300042156 Ga0439446_0001464 Ga0439446_0001464_382_1269 289
1643 3300042439 Ga0439464_0000691 Ga0439464_0000691_5821_6708 289
1644 3300042439 Ga0439464_0011620 Ga0439464_0011620_457_1332 289
1645 3300042876 Ga0451577_0000053 Ga0451577_0000053_167021_167893 289
1646 3300042876 Ga0451577_0000278 Ga0451577_0000278_63315_64187 289
1647 3300042876 Ga0451577_0000658 Ga0451577_0000658_25693_26565 289
1648 3300042876 Ga0451577_0001280 Ga0451577_0001280_17136_18014 289
1649 3300042876 Ga0451577_0024333 Ga0451577_0024333_386_1258 289
1650 3300042876 Ga0451577_0062112 Ga0451577_0062112_264_1136 289
1651 3300042876 Ga0451577_0064571 Ga0451577_0064571_81_953 289
1652 3300042993 Ga0439440_0020307 Ga0439440_0020307_420_1460 289
1653 3300044656 Ga0466969_0014511 Ga0466969_0014511_1201_2385 289
1654 3300044656 Ga0466969_0067862 Ga0466969_0067862_263_1519 289
1655 3300044669 Ga0466981_0000098 Ga0466981_0000098_4856_5725 289
1656 3300044673 Ga0453683_0001476 Ga0453683_0001476_11555_12427 289
1657 3300044673 Ga0453683_0006328 Ga0453683_0006328_1031_1903 289
1658 3300044673 Ga0453683_0011688 Ga0453683_0011688_3251_4123 289
1659 3300044684 Ga0466966_0037684 Ga0466966_0037684_1735_2919 289
1660 3300044693 Ga0466961_0012615 Ga0466961_0012615_4031_5215 289
1661 3300044706 Ga0466964_0004046 Ga0466964_0004046_3774_4958 289
1662 3300044712 Ga0453684_0000103 Ga0453684_0000103_253916_254788 289
1663 3300044712 Ga0453684_0000208 Ga0453684_0000208_24060_24938 289
1664 3300044712 Ga0453684_0000901 Ga0453684_0000901_63198_64070 289
1665 3300044712 Ga0453684_0015233 Ga0453684_0015233_9523_10395 289
1666 3300044712 Ga0453684_0048486 Ga0453684_0048486_205_1077 289
1667 3300044712 Ga0453684_0066964 Ga0453684_0066964_3164_4036 289
1668 3300044712 Ga0453684_0151847 Ga0453684_0151847_409_1281 289
1669 3300044719 Ga0466971_0001567 Ga0466971_0001567_6056_7240 289
1670 3300044842 Ga0466957_0042109 Ga0466957_0042109_1261_2445 289
1671 3300045049 Ga0466959_0001323 Ga0466959_0001323_9689_11239 289
1672 3300045049 Ga0466959_0126545 Ga0466959_0126545_453_1640 289
1673 3300045051 Ga0451576_0000334 Ga0451576_0000334_19647_20585 289
1674 3300045051 Ga0451576_0002362 Ga0451576_0002362_3471_4349 289
1675 3300045051 Ga0451576_0038612 Ga0451576_0038612_1306_2268 289
1676 3300045051 Ga0451576_0060974 Ga0451576_0060974_740_1717 289
1677 3300045051 Ga0451576_0077607 Ga0451576_0077607_1275_2150 289
1678 3300045051 Ga0451576_0138667 Ga0451576_0138667_1492_2364 289
1679 3300045051 Ga0451576_0724984 Ga0451576_0724984_17_892 289
1680 3300046453 Ga0495627_000028 Ga0495627_000028_226591_227463 289
1681 3300046455 Ga0495603_0006470 Ga0495603_0006470_2483_3388 289
1682 3300046455 Ga0495603_0012418 Ga0495603_0012418_4260_5135 289
1683 3300046455 Ga0495603_0090006 Ga0495603_0090006_113_982 289
1684 3300046457 Ga0495590_0006925 Ga0495590_0006925_3074_4120 289
1685 3300046458 Ga0495591_000011 Ga0495591_000011_277334_278203 289
1686 3300046458 Ga0495591_000080 Ga0495591_000080_85733_86608 289
1687 3300046460 Ga0495638_0098815 Ga0495638_0098815_279_1325 289
1688 3300046471 Ga0495650_0000016 Ga0495650_0000016_197554_198426 289
1689 3300046471 Ga0495650_0000153 Ga0495650_0000153_21129_21998 289
1690 3300046471 Ga0495650_0002966 Ga0495650_0002966_9412_10296 289
1691 3300046472 Ga0495580_0001074 Ga0495580_0001074_7321_8355 289
1692 3300046472 Ga0495580_0046654 Ga0495580_0046654_1028_1900 289
1693 3300046472 Ga0495580_0158291 Ga0495580_0158291_246_1385 289
1694 3300046475 Ga0495639_0092869 Ga0495639_0092869_195_1094 289
1695 3300046492 Ga0495585_0038462 Ga0495585_0038462_1527_2402 289
1696 3300046499 Ga0495594_0034599 Ga0495594_0034599_606_1481 289
1697 3300046499 Ga0495594_0137944 Ga0495594_0137944_133_1275 289
1698 3300046501 Ga0495607_0004502 Ga0495607_0004502_518_1402 289
1699 3300046501 Ga0495607_0005367 Ga0495607_0005367_5258_6142 289
1700 3300046507 Ga0495606_0000094 Ga0495606_0000094_150613_151497 289
1701 3300046513 Ga0495616_0005517 Ga0495616_0005517_2538_3551 289
1702 3300046513 Ga0495616_0119180 Ga0495616_0119180_52_1182 289
1703 3300046514 Ga0495618_0050360 Ga0495618_0050360_91_1128 289
1704 3300046515 Ga0495620_0000083 Ga0495620_0000083_68699_69583 289
1705 3300046515 Ga0495620_0074771 Ga0495620_0074771_24_1088 289
1706 3300046517 Ga0495630_0054602 Ga0495630_0054602_1942_2904 289
1707 3300046517 Ga0495630_0117139 Ga0495630_0117139_896_1933 289
1708 3300046519 Ga0495632_0006084 Ga0495632_0006084_1778_2662 289
1709 3300046519 Ga0495632_0038082 Ga0495632_0038082_766_1779 289
1710 3300046519 Ga0495632_0073281 Ga0495632_0073281_107_1171 289
1711 3300046520 Ga0495637_0000174 Ga0495637_0000174_48481_49365 289
1712 3300046522 Ga0495643_0002111 Ga0495643_0002111_14244_15131 289
1713 3300046522 Ga0495643_0009801 Ga0495643_0009801_1176_2060 289
1714 3300046530 Ga0495654_0000078 Ga0495654_0000078_176_1051 289
1715 3300046530 Ga0495654_0160843 Ga0495654_0160843_101_973 289
1716 3300046537 Ga0495598_0006537 Ga0495598_0006537_1733_2605 289
1717 3300046616 Ga0495668_0082637 Ga0495668_0082637_415_1461 289
1718 3300046642 Ga0495634_0131022 Ga0495634_0131022_47_919 289
1719 3300046660 Ga0495625_0017227 Ga0495625_0017227_4061_5107 289
1720 3300046665 Ga0495661_0000092 Ga0495661_0000092_242_1129 289
1721 3300046665 Ga0495661_0002800 Ga0495661_0002800_3517_4401 289
1722 3300046674 Ga0495588_0104458 Ga0495588_0104458_460_1365 289
1723 3300046681 Ga0495647_0001412 Ga0495647_0001412_4939_6075 289
1724 3300046683 Ga0495658_0111014 Ga0495658_0111014_371_1243 289
1725 3300046684 Ga0495669_0053556 Ga0495669_0053556_585_1694 289
1726 3300046684 Ga0495669_0183799 Ga0495669_0183799_107_979 289
1727 3300046689 Ga0495613_0028561 Ga0495613_0028561_2827_3702 289
1728 3300046692 Ga0495671_0015585 Ga0495671_0015585_667_1758 289
1729 3300046694 Ga0495649_0003485 Ga0495649_0003485_8726_9793 289
1730 3300046694 Ga0495649_0060928 Ga0495649_0060928_646_1533 289
1731 3300046694 Ga0495649_0178377 Ga0495649_0178377_19_1065 289
1732 3300046794 Ga0495589_0000002 Ga0495589_0000002_584546_585418 289
1733 3300046810 Ga0495660_0000007 Ga0495660_0000007_153916_154788 289
1734 3300046810 Ga0495660_0010823 Ga0495660_0010823_4119_5003 289
1735 3300046810 Ga0495660_0117064 Ga0495660_0117064_138_1013 289
1736 3300047320 Ga0495672_0000009 Ga0495672_0000009_189099_189971 289
1737 3300047320 Ga0495672_0000012 Ga0495672_0000012_118367_119242 289
1738 3300047321 Ga0495676_0078702 Ga0495676_0078702_376_1251 289
1739 3300047323 Ga0495683_0000175 Ga0495683_0000175_21_908 289
1740 3300047446 Ga0495679_000032 Ga0495679_000032_102304_103176 289
1741 3300047446 Ga0495679_000119 Ga0495679_000119_21609_22493 289
1742 3300047469 Ga0495673_0000022 Ga0495673_0000022_276378_277247 289
1743 3300047472 Ga0495686_0035071 Ga0495686_0035071_1527_2585 289
1744 3300048090 Ga0495615_0001674 Ga0495615_0001674_506_1378 289
1745 3300048903 Ga0496100_0009521 Ga0496100_0009521_3452_4321 289
1746 3300048904 Ga0496101_0000029 Ga0496101_0000029_195203_196078 289
1747 3300048904 Ga0496101_0045076 Ga0496101_0045076_1012_1887 289
1748 3300048905 Ga0496102_0004688 Ga0496102_0004688_1964_3202 289
1749 3300048905 Ga0496102_0017917 Ga0496102_0017917_940_1995 289
1750 3300048905 Ga0496102_0047140 Ga0496102_0047140_1350_2627 289
1751 3300048906 Ga0496103_0034542 Ga0496103_0034542_839_2077 289
1752 3300048907 Ga0496104_0001318 Ga0496104_0001318_11262_12131 289
1753 3300048907 Ga0496104_0006179 Ga0496104_0006179_559_1431 289
1754 3300048907 Ga0496104_0148023 Ga0496104_0148023_429_1304 289
1755 3300048907 Ga0496104_0231879 Ga0496104_0231879_716_1588 289
1756 3300048907 Ga0496104_0283059 Ga0496104_0283059_583_1542 289
1757 3300048907 Ga0496104_0296664 Ga0496104_0296664_58_933 289
1758 3300048908 Ga0496105_0005778 Ga0496105_0005778_6170_7183 289
1759 3300048908 Ga0496105_0128274 Ga0496105_0128274_97_972 289
1760 3300048908 Ga0496105_0162472 Ga0496105_0162472_389_1423 289
1761 3300048908 Ga0496105_0458476 Ga0496105_0458476_114_983 289
1762 3300048909 Ga0496106_0040511 Ga0496106_0040511_1559_2434 289
1763 3300048909 Ga0496106_0155790 Ga0496106_0155790_186_1058 289
1764 3300048909 Ga0496106_0169019 Ga0496106_0169019_622_1656 289
1765 3300048909 Ga0496106_0213333 Ga0496106_0213333_448_1317 289
1766 3300048911 Ga0496108_0009930 Ga0496108_0009930_3662_4675 289
1767 3300048911 Ga0496108_0031413 Ga0496108_0031413_3034_3903 289
1768 3300048912 Ga0496109_0024724 Ga0496109_0024724_3039_3908 289
1769 3300048912 Ga0496109_0045598 Ga0496109_0045598_1670_2629 289
1770 3300048913 Ga0496110_0003845 Ga0496110_0003845_3150_4163 289
1771 3300048913 Ga0496110_0186949 Ga0496110_0186949_436_1395 289
1772 3300048913 Ga0496110_0405517 Ga0496110_0405517_152_1024 289
1773 3300048913 Ga0496110_0577838 Ga0496110_0577838_70_945 289
1774 3300048914 Ga0496111_0012444 Ga0496111_0012444_2936_3949 289
1775 3300048915 Ga0496112_0006853 Ga0496112_0006853_3199_4074 289
1776 3300048915 Ga0496112_0046021 Ga0496112_0046021_688_1557 289
1777 3300048916 Ga0496113_0015336 Ga0496113_0015336_1607_2476 289
1778 3300048917 Ga0496114_0007786 Ga0496114_0007786_4367_5236 289
1779 3300048917 Ga0496114_0082230 Ga0496114_0082230_108_1121 289
1780 3300048917 Ga0496114_0165394 Ga0496114_0165394_508_1542 289
1781 3300048918 Ga0496115_0028920 Ga0496115_0028920_580_1455 289
1782 3300048918 Ga0496115_0330922 Ga0496115_0330922_113_1147 289
1783 3300048919 Ga0496116_0000031 Ga0496116_0000031_406473_407345 289
1784 3300048919 Ga0496116_0000127 Ga0496116_0000127_153549_154421 289
1785 3300048919 Ga0496116_0000226 Ga0496116_0000226_51517_52389 289
1786 3300048919 Ga0496116_0000572 Ga0496116_0000572_38093_38968 289
1787 3300048919 Ga0496116_0014162 Ga0496116_0014162_95_964 289
1788 3300048919 Ga0496116_0014235 Ga0496116_0014235_1331_2206 289
1789 3300048919 Ga0496116_0035327 Ga0496116_0035327_1456_2325 289
1790 3300048919 Ga0496116_0037864 Ga0496116_0037864_536_1405 289
1791 3300048920 Ga0496117_0000004 Ga0496117_0000004_686128_687003 289
1792 3300048920 Ga0496117_0000135 Ga0496117_0000135_57334_58572 289
1793 3300048920 Ga0496117_0000180 Ga0496117_0000180_19248_20123 289
1794 3300048920 Ga0496117_0004890 Ga0496117_0004890_9797_10669 289
1795 3300048920 Ga0496117_0005651 Ga0496117_0005651_4762_5637 289
1796 3300048920 Ga0496117_0014392 Ga0496117_0014392_3636_4508 289
1797 3300048920 Ga0496117_0110788 Ga0496117_0110788_306_1175 289
1798 3300048920 Ga0496117_0123000 Ga0496117_0123000_500_1372 289
1799 3300048921 Ga0496118_0000024 Ga0496118_0000024_194233_195108 289
1800 3300048921 Ga0496118_0000098 Ga0496118_0000098_102045_103283 289
1801 3300048921 Ga0496118_0004392 Ga0496118_0004392_5527_6402 289
1802 3300048921 Ga0496118_0004762 Ga0496118_0004762_809_1681 289
1803 3300048921 Ga0496118_0012358 Ga0496118_0012358_785_1657 289
1804 3300048921 Ga0496118_0015435 Ga0496118_0015435_536_1405 289
1805 3300048921 Ga0496118_0019027 Ga0496118_0019027_3890_4945 289
1806 3300048921 Ga0496118_0021029 Ga0496118_0021029_374_1243 289
1807 3300048921 Ga0496118_0022741 Ga0496118_0022741_808_1680 289
1808 3300048921 Ga0496118_0024262 Ga0496118_0024262_2941_3810 289
1809 3300048922 Ga0496119_0000607 Ga0496119_0000607_18472_19341 289
1810 3300048922 Ga0496119_0000910 Ga0496119_0000910_21149_22033 289
1811 3300048922 Ga0496119_0001660 Ga0496119_0001660_14736_15962 289
1812 3300048922 Ga0496119_0002597 Ga0496119_0002597_3987_4862 289
1813 3300048922 Ga0496119_0007945 Ga0496119_0007945_4692_5564 289
1814 3300048922 Ga0496119_0008110 Ga0496119_0008110_8161_9033 289
1815 3300048922 Ga0496119_0019994 Ga0496119_0019994_3988_4863 289
1816 3300048922 Ga0496119_0021335 Ga0496119_0021335_1082_1954 289
1817 3300048922 Ga0496119_0021590 Ga0496119_0021590_3161_4030 289
1818 3300048922 Ga0496119_0034044 Ga0496119_0034044_569_1438 289
1819 3300048922 Ga0496119_0035277 Ga0496119_0035277_2242_3117 289
1820 3300048923 Ga0496120_0000043 Ga0496120_0000043_8279_9151 289
1821 3300048923 Ga0496120_0000346 Ga0496120_0000346_74621_75496 289
1822 3300048923 Ga0496120_0000739 Ga0496120_0000739_22005_23231 289
1823 3300048923 Ga0496120_0001541 Ga0496120_0001541_20001_20876 289
1824 3300048923 Ga0496120_0003009 Ga0496120_0003009_11121_11996 289
1825 3300048923 Ga0496120_0003653 Ga0496120_0003653_9031_9900 289
1826 3300048923 Ga0496120_0015232 Ga0496120_0015232_3651_4523 289
1827 3300048923 Ga0496120_0016089 Ga0496120_0016089_3988_4863 289
1828 3300048923 Ga0496120_0045632 Ga0496120_0045632_569_1438 289
1829 3300048923 Ga0496120_0112820 Ga0496120_0112820_358_1227 289
1830 3300048924 Ga0496121_0000185 Ga0496121_0000185_11809_12684 289
1831 3300048924 Ga0496121_0007154 Ga0496121_0007154_7191_8468 289
1832 3300048924 Ga0496121_0008012 Ga0496121_0008012_1403_2272 289
1833 3300048924 Ga0496121_0037688 Ga0496121_0037688_1074_1943 289
1834 3300048924 Ga0496121_0046234 Ga0496121_0046234_494_1672 289
1835 3300048924 Ga0496121_0080512 Ga0496121_0080512_613_1482 289
1836 3300048924 Ga0496121_0159178 Ga0496121_0159178_576_1631 289
1837 3300048925 Ga0496122_0000013 Ga0496122_0000013_201905_202777 289
1838 3300048925 Ga0496122_0000026 Ga0496122_0000026_10066_10935 289
1839 3300048925 Ga0496122_0000796 Ga0496122_0000796_44798_45667 289
1840 3300048925 Ga0496122_0010913 Ga0496122_0010913_4432_5307 289
1841 3300048925 Ga0496122_0012528 Ga0496122_0012528_5395_6270 289
1842 3300048925 Ga0496122_0055971 Ga0496122_0055971_1948_2817 289
1843 3300048926 Ga0496123_0000005 Ga0496123_0000005_310381_311250 289
1844 3300048926 Ga0496123_0000010 Ga0496123_0000010_298263_299135 289
1845 3300048926 Ga0496123_0000599 Ga0496123_0000599_15601_16470 289
1846 3300048926 Ga0496123_0000621 Ga0496123_0000621_46588_47457 289
1847 3300048926 Ga0496123_0001489 Ga0496123_0001489_9498_10382 289
1848 3300048926 Ga0496123_0004145 Ga0496123_0004145_1342_2217 289
1849 3300048926 Ga0496123_0004462 Ga0496123_0004462_2922_3797 289
1850 3300048926 Ga0496123_0018848 Ga0496123_0018848_1527_2396 289
1851 3300048926 Ga0496123_0083936 Ga0496123_0083936_660_1535 289
1852 3300048927 Ga0496124_0000039 Ga0496124_0000039_70463_71335 289
1853 3300048927 Ga0496124_0000494 Ga0496124_0000494_2000_2869 289
1854 3300048927 Ga0496124_0002320 Ga0496124_0002320_13874_14749 289
1855 3300048927 Ga0496124_0002333 Ga0496124_0002333_10319_11191 289
1856 3300048927 Ga0496124_0005214 Ga0496124_0005214_10690_11565 289
1857 3300048927 Ga0496124_0015872 Ga0496124_0015872_622_1491 289
1858 3300048927 Ga0496124_0016619 Ga0496124_0016619_1903_2778 289
1859 3300048927 Ga0496124_0020877 Ga0496124_0020877_4501_5376 289
1860 3300048927 Ga0496124_0029781 Ga0496124_0029781_3952_4827 289
1861 3300048927 Ga0496124_0047403 Ga0496124_0047403_2566_3441 289
1862 3300048927 Ga0496124_0087394 Ga0496124_0087394_1586_2455 289
1863 3300048927 Ga0496124_0095622 Ga0496124_0095622_48_920 289
1864 3300048927 Ga0496124_0098955 Ga0496124_0098955_624_1499 289
1865 3300048927 Ga0496124_0173730 Ga0496124_0173730_609_1493 289
1866 3300048928 Ga0496125_0000016 Ga0496125_0000016_206326_207195 289
1867 3300048928 Ga0496125_0000019 Ga0496125_0000019_143638_144510 289
1868 3300048928 Ga0496125_0000745 Ga0496125_0000745_12029_13207 289
1869 3300048928 Ga0496125_0008522 Ga0496125_0008522_3808_4677 289
1870 3300048928 Ga0496125_0018794 Ga0496125_0018794_5341_6210 289
1871 3300048928 Ga0496125_0023684 Ga0496125_0023684_456_1340 289
1872 3300048928 Ga0496125_0029647 Ga0496125_0029647_1907_3184 289
1873 3300048928 Ga0496125_0044766 Ga0496125_0044766_546_1415 289
1874 3300048928 Ga0496125_0053288 Ga0496125_0053288_1904_2773 289
1875 3300048928 Ga0496125_0161595 Ga0496125_0161595_475_1344 289
1876 3300048929 Ga0496126_0001127 Ga0496126_0001127_25385_26704 289
1877 3300048929 Ga0496126_0002546 Ga0496126_0002546_10213_11085 289
1878 3300048929 Ga0496126_0008468 Ga0496126_0008468_3368_4237 289
1879 3300048929 Ga0496126_0048112 Ga0496126_0048112_2000_2875 289
1880 3300048929 Ga0496126_0051568 Ga0496126_0051568_613_1482 289
1881 3300048929 Ga0496126_0237310 Ga0496126_0237310_199_1419 289
1882 3300048929 Ga0496126_0300690 Ga0496126_0300690_76_948 289
1883 3300049515 Ga0501292_015342 Ga0501292_015342_86_961 289
1884 3300049568 Ga0501031_0030309 Ga0501031_0030309_819_1718 289
1885 3300049568 Ga0501031_0054386 Ga0501031_0054386_213_1115 289
1886 3300049568 Ga0501031_0204757 Ga0501031_0204757_261_1136 289
1887 3300049568 Ga0501031_0239317 Ga0501031_0239317_21_896 289
1888 3300049568 Ga0501031_0331000 Ga0501031_0331000_34_906 289
1889 3300049569 Ga0501032_0000083 Ga0501032_0000083_68497_69372 289
1890 3300049569 Ga0501032_0289367 Ga0501032_0289367_99_974 289
1891 3300049570 Ga0501033_0089127 Ga0501033_0089127_1353_2225 289
1892 3300049570 Ga0501033_0094288 Ga0501033_0094288_1169_2068 289
1893 3300049570 Ga0501033_0173183 Ga0501033_0173183_601_1503 289
1894 3300049570 Ga0501033_0330693 Ga0501033_0330693_182_1057 289
1895 3300049571 Ga0501034_0000001 Ga0501034_0000001_2088686_2089561 289
1896 3300049571 Ga0501034_0000111 Ga0501034_0000111_97523_98398 289
1897 3300049571 Ga0501034_0002511 Ga0501034_0002511_11415_12299 289
1898 3300049571 Ga0501034_0003433 Ga0501034_0003433_4654_5526 289
1899 3300049571 Ga0501034_0077903 Ga0501034_0077903_2431_3300 289
1900 3300049571 Ga0501034_0239514 Ga0501034_0239514_159_1028 289
1901 3300049572 Ga0501036_0009735 Ga0501036_0009735_3634_4509 289
1902 3300049572 Ga0501036_0016266 Ga0501036_0016266_2200_3099 289
1903 3300049572 Ga0501036_0055144 Ga0501036_0055144_1276_2148 289
1904 3300049572 Ga0501036_0076855 Ga0501036_0076855_1464_2333 289
1905 3300049572 Ga0501036_0076916 Ga0501036_0076916_428_1330 289
1906 3300049572 Ga0501036_0091520 Ga0501036_0091520_123_992 289
1907 3300049572 Ga0501036_0257519 Ga0501036_0257519_23_967 289
1908 3300049573 Ga0501037_0001430 Ga0501037_0001430_13164_14066 289
1909 3300049573 Ga0501037_0004422 Ga0501037_0004422_5395_6264 289
1910 3300049573 Ga0501037_0011895 Ga0501037_0011895_4850_5722 289
1911 3300049573 Ga0501037_0062375 Ga0501037_0062375_29_928 289
1912 3300049574 Ga0501038_0008351 Ga0501038_0008351_2712_3587 289
1913 3300049574 Ga0501038_0010540 Ga0501038_0010540_1912_2784 289
1914 3300049574 Ga0501038_0052946 Ga0501038_0052946_595_1494 289
1915 3300049574 Ga0501038_0140845 Ga0501038_0140845_417_1295 289
1916 3300049575 Ga0501039_0000035 Ga0501039_0000035_88161_89036 289
1917 3300049575 Ga0501039_0013944 Ga0501039_0013944_4637_5539 289
1918 3300049575 Ga0501039_0031295 Ga0501039_0031295_2688_3563 289
1919 3300049575 Ga0501039_0149154 Ga0501039_0149154_611_1510 289
1920 3300049575 Ga0501039_0290130 Ga0501039_0290130_31_906 289
1921 3300049575 Ga0501039_0360399 Ga0501039_0360399_123_1001 289
1922 3300049576 Ga0501040_0000117 Ga0501040_0000117_28322_29194 289
1923 3300049576 Ga0501040_0002406 Ga0501040_0002406_2712_3587 289
1924 3300049576 Ga0501040_0025603 Ga0501040_0025603_575_1474 289
1925 3300049576 Ga0501040_0035462 Ga0501040_0035462_1926_2828 289
1926 3300049576 Ga0501040_0061595 Ga0501040_0061595_1265_2140 289
1927 3300049576 Ga0501040_0099925 Ga0501040_0099925_801_1679 289
1928 3300049576 Ga0501040_0142674 Ga0501040_0142674_175_1077 289
1929 3300049576 Ga0501040_0195594 Ga0501040_0195594_420_1337 289
1930 3300049577 Ga0501041_0000547 Ga0501041_0000547_5211_6086 289
1931 3300049577 Ga0501041_0011399 Ga0501041_0011399_2668_3570 289
1932 3300049577 Ga0501041_0011926 Ga0501041_0011926_1287_2189 289
1933 3300049577 Ga0501041_0046822 Ga0501041_0046822_503_1402 289
1934 3300049577 Ga0501041_0100575 Ga0501041_0100575_439_1356 289
1935 3300049578 Ga0501042_0000083 Ga0501042_0000083_24757_25629 289
1936 3300049578 Ga0501042_0001267 Ga0501042_0001267_2711_3586 289
1937 3300049578 Ga0501042_0009392 Ga0501042_0009392_2167_3069 289
1938 3300049578 Ga0501042_0049715 Ga0501042_0049715_503_1402 289
1939 3300049578 Ga0501042_0060212 Ga0501042_0060212_1510_2388 289
1940 3300049578 Ga0501042_0062585 Ga0501042_0062585_1041_2090 289
1941 3300049578 Ga0501042_0086617 Ga0501042_0086617_105_977 289
1942 3300049578 Ga0501042_0101190 Ga0501042_0101190_958_1875 289
1943 3300049579 Ga0501043_0000235 Ga0501043_0000235_40977_41846 289
1944 3300049579 Ga0501043_0001265 Ga0501043_0001265_12482_13354 289
1945 3300049579 Ga0501043_0007584 Ga0501043_0007584_5361_6263 289
1946 3300049579 Ga0501043_0080879 Ga0501043_0080879_598_1482 289
1947 3300049580 Ga0501046_0005185 Ga0501046_0005185_8096_8998 289
1948 3300049580 Ga0501046_0010871 Ga0501046_0010871_1562_2437 289
1949 3300049580 Ga0501046_0041883 Ga0501046_0041883_920_1822 289
1950 3300049580 Ga0501046_0071056 Ga0501046_0071056_1399_2505 289
1951 3300049580 Ga0501046_0084993 Ga0501046_0084993_456_1334 289
1952 3300049580 Ga0501046_0103404 Ga0501046_0103404_365_1264 289
1953 3300049580 Ga0501046_0110712 Ga0501046_0110712_1000_1872 289
1954 3300049581 Ga0501047_0065774 Ga0501047_0065774_1329_2201 289
1955 3300049581 Ga0501047_0274976 Ga0501047_0274976_175_1146 289
1956 3300049581 Ga0501047_0321700 Ga0501047_0321700_248_1132 289
1957 3300049582 Ga0501048_0028232 Ga0501048_0028232_2006_2905 289
1958 3300049582 Ga0501048_0029246 Ga0501048_0029246_2609_3484 289
1959 3300049582 Ga0501048_0036840 Ga0501048_0036840_1119_2021 289
1960 3300049583 Ga0501067_0197094 Ga0501067_0197094_210_1085 289
1961 3300049584 Ga0501068_0013168 Ga0501068_0013168_3396_4295 289
1962 3300049584 Ga0501068_0036925 Ga0501068_0036925_1321_2193 289
1963 3300049584 Ga0501068_0038439 Ga0501068_0038439_1374_2249 289
1964 3300049584 Ga0501068_0041932 Ga0501068_0041932_1684_2586 289
1965 3300049584 Ga0501068_0181525 Ga0501068_0181525_417_1301 289
1966 3300049585 Ga0501069_0002974 Ga0501069_0002974_611_1513 289
1967 3300049586 Ga0501070_0213484 Ga0501070_0213484_72_974 289
1968 3300049587 Ga0501071_0023335 Ga0501071_0023335_2479_3378 289
1969 3300049587 Ga0501071_0047520 Ga0501071_0047520_847_1749 289
1970 3300049587 Ga0501071_0091045 Ga0501071_0091045_344_1222 289
1971 3300049587 Ga0501071_0360650 Ga0501071_0360650_143_1018 289
1972 3300049588 Ga0501072_0029867 Ga0501072_0029867_2711_3586 289
1973 3300049588 Ga0501072_0045187 Ga0501072_0045187_562_1464 289
1974 3300049588 Ga0501072_0182599 Ga0501072_0182599_164_1063 289
1975 3300049588 Ga0501072_0216725 Ga0501072_0216725_13_915 289
1976 3300049588 Ga0501072_0233281 Ga0501072_0233281_470_1345 289
1977 3300049588 Ga0501072_0354556 Ga0501072_0354556_218_1093 289
1978 3300049589 Ga0501073_0002203 Ga0501073_0002203_5910_6782 289
1979 3300049589 Ga0501073_0003195 Ga0501073_0003195_4641_5543 289
1980 3300049589 Ga0501073_0042830 Ga0501073_0042830_1707_2606 289
1981 3300049590 Ga0501074_0045225 Ga0501074_0045225_896_1798 289
1982 3300049590 Ga0501074_0060237 Ga0501074_0060237_339_1241 289
1983 3300049590 Ga0501074_0162020 Ga0501074_0162020_244_1143 289
1984 3300049590 Ga0501074_0190039 Ga0501074_0190039_241_1116 289
1985 3300049590 Ga0501074_0214848 Ga0501074_0214848_252_1223 289
1986 3300049591 Ga0501075_0001934 Ga0501075_0001934_7353_8228 289
1987 3300049591 Ga0501075_0002970 Ga0501075_0002970_8645_9520 289
1988 3300049591 Ga0501075_0015291 Ga0501075_0015291_3610_4485 289
1989 3300049591 Ga0501075_0021569 Ga0501075_0021569_1655_2533 289
1990 3300049591 Ga0501075_0033611 Ga0501075_0033611_2023_2925 289
1991 3300049592 Ga0501076_0005189 Ga0501076_0005189_6076_6978 289
1992 3300049592 Ga0501076_0010763 Ga0501076_0010763_1621_2520 289
1993 3300049592 Ga0501076_0017411 Ga0501076_0017411_4128_5003 289
1994 3300049592 Ga0501076_0027519 Ga0501076_0027519_951_1826 289
1995 3300049592 Ga0501076_0229464 Ga0501076_0229464_152_1054 289
1996 3300049593 Ga0501077_0009289 Ga0501077_0009289_2170_3045 289
1997 3300049593 Ga0501077_0016766 Ga0501077_0016766_1917_2816 289
1998 3300049593 Ga0501077_0062790 Ga0501077_0062790_1260_2162 289
1999 3300049593 Ga0501077_0067722 Ga0501077_0067722_1118_2020 289
2000 3300049593 Ga0501077_0107633 Ga0501077_0107633_855_1733 289
2001 3300049649 Ga0501198_009062 Ga0501198_009062_98_973 289
2002 3300049651 Ga0501201_005317 Ga0501201_005317_234_1109 289
2003 3300049660 Ga0501216_014709 Ga0501216_014709_351_1226 289
2004 3300049661 Ga0501217_016126 Ga0501217_016126_24_899 289
2005 3300049663 Ga0501223_016096 Ga0501223_016096_495_1370 289
2006 3300049686 Ga0501257_039723 Ga0501257_039723_119_997 289
2007 3300049704 Ga0501221_027351 Ga0501221_027351_100_975 289
2008 3300049705 Ga0501225_0011087 Ga0501225_0011087_181_1056 289
2009 3300049741 Ga0501079_0009499 Ga0501079_0009499_2613_3488 289
2010 3300049741 Ga0501079_0010315 Ga0501079_0010315_5060_5935 289
2011 3300049741 Ga0501079_0035861 Ga0501079_0035861_2042_2941 289
2012 3300049741 Ga0501079_0060493 Ga0501079_0060493_336_1238 289
2013 3300049741 Ga0501079_0132275 Ga0501079_0132275_480_1352 289
2014 3300049742 Ga0501080_0002504 Ga0501080_0002504_12622_13524 289
2015 3300049742 Ga0501080_0013038 Ga0501080_0013038_1791_2663 289
2016 3300049742 Ga0501080_0049146 Ga0501080_0049146_2705_3580 289
2017 3300049742 Ga0501080_0060695 Ga0501080_0060695_930_1805 289
2018 3300049742 Ga0501080_0108015 Ga0501080_0108015_415_1317 289
2019 3300049742 Ga0501080_0157332 Ga0501080_0157332_626_1501 289
2020 3300049743 Ga0501081_0003765 Ga0501081_0003765_105_980 289
2021 3300049743 Ga0501081_0014989 Ga0501081_0014989_2008_2910 289
2022 3300049743 Ga0501081_0022284 Ga0501081_0022284_2711_3586 289
2023 3300049743 Ga0501081_0045012 Ga0501081_0045012_574_1473 289
2024 3300049743 Ga0501081_0071324 Ga0501081_0071324_435_1313 289
2025 3300049743 Ga0501081_0090903 Ga0501081_0090903_353_1252 289
2026 3300049744 Ga0501083_0001924 Ga0501083_0001924_7059_7940 289
2027 3300049744 Ga0501083_0006699 Ga0501083_0006699_6735_7637 289
2028 3300049744 Ga0501083_0018991 Ga0501083_0018991_1630_2661 289
2029 3300049744 Ga0501083_0028126 Ga0501083_0028126_408_1283 289
2030 3300049744 Ga0501083_0040058 Ga0501083_0040058_422_1339 289
2031 3300049744 Ga0501083_0102351 Ga0501083_0102351_909_1808 289
2032 3300049775 Ga0501279_011995 Ga0501279_011995_206_1081 289
2033 3300049822 Ga0501035_0008587 Ga0501035_0008587_5254_6129 289
2034 3300049822 Ga0501035_0018241 Ga0501035_0018241_604_1506 289
2035 3300049822 Ga0501035_0053601 Ga0501035_0053601_1213_2112 289
2036 3300049822 Ga0501035_0200901 Ga0501035_0200901_367_1284 289
2037 3300049823 Ga0501044_0001025 Ga0501044_0001025_9800_10675 289
2038 3300049823 Ga0501044_0004772 Ga0501044_0004772_13605_14477 289
2039 3300049823 Ga0501044_0034687 Ga0501044_0034687_916_1818 289
2040 3300049823 Ga0501044_0252408 Ga0501044_0252408_739_1674 289
2041 3300049823 Ga0501044_0253422 Ga0501044_0253422_510_1379 289
2042 3300049823 Ga0501044_0423712 Ga0501044_0423712_23_898 289
2043 3300049824 Ga0501045_0025790 Ga0501045_0025790_2700_3575 289
2044 3300049824 Ga0501045_0046476 Ga0501045_0046476_1449_2351 289
2045 3300049824 Ga0501045_0049749 Ga0501045_0049749_600_1499 289
2046 3300049824 Ga0501045_0274665 Ga0501045_0274665_244_1146 289
2047 3300049853 Ga0501226_000003 Ga0501226_000003_271492_272379 289
2048 3300050489 nmdc:mga03683_5_c1 nmdc:mga03683_5_c1_74256_75134 289
2049 3300050491 nmdc:mga00v17_12789_c1 nmdc:mga00v17_12789_c1_1514_2383 289
2050 3300050491 nmdc:mga00v17_142015_c1 nmdc:mga00v17_142015_c1_417_1292 289
2051 3300050491 nmdc:mga00v17_95_c1 nmdc:mga00v17_95_c1_16908_17786 289
2052 3300050492 nmdc:mga0yw44_124019_c1 nmdc:mga0yw44_124019_c1_616_1494 289
2053 3300050507 nmdc:mga05p37_2021_c1 nmdc:mga05p37_2021_c1_9141_10013 289
2054 3300050507 nmdc:mga05p37_20776_c1 nmdc:mga05p37_20776_c1_1605_2477 289
2055 3300050507 nmdc:mga05p37_36937_c1 nmdc:mga05p37_36937_c1_1389_2264 289
2056 3300050507 nmdc:mga05p37_561729_c1 nmdc:mga05p37_561729_c1_352_1224 289
2057 3300050507 nmdc:mga05p37_580485_c1 nmdc:mga05p37_580485_c1_10_885 289
2058 3300050508 nmdc:mga09592_175155_c1 nmdc:mga09592_175155_c1_181_1053 289
2059 3300050508 nmdc:mga09592_291293_c1 nmdc:mga09592_291293_c1_286_1158 289
2060 3300050508 nmdc:mga09592_58571_c1 nmdc:mga09592_58571_c1_190_1065 289
2061 3300050509 nmdc:mga0qj67_12711_c1 nmdc:mga0qj67_12711_c1_179_1144 289
2062 3300050509 nmdc:mga0qj67_202320_c1 nmdc:mga0qj67_202320_c1_506_1384 289
2063 3300050509 nmdc:mga0qj67_35466_c1 nmdc:mga0qj67_35466_c1_790_1764 289
2064 3300050509 nmdc:mga0qj67_86741_c1 nmdc:mga0qj67_86741_c1_190_1230 289
2065 3300050509 nmdc:mga0qj67_94900_c1 nmdc:mga0qj67_94900_c1_345_1220 289
2066 3300050510 nmdc:mga06r32_11152_c1 nmdc:mga06r32_11152_c1_4706_5746 289
2067 3300050510 nmdc:mga06r32_205043_c1 nmdc:mga06r32_205043_c1_1013_1885 289
2068 3300050510 nmdc:mga06r32_376815_c1 nmdc:mga06r32_376815_c1_118_993 289
2069 3300050510 nmdc:mga06r32_655_c1 nmdc:mga06r32_655_c1_28403_29377 289
2070 3300050510 nmdc:mga06r32_6951_c1 nmdc:mga06r32_6951_c1_8158_9123 289
2071 3300050511 nmdc:mga08y16_227641_c1 nmdc:mga08y16_227641_c1_57_1022 289
2072 3300050511 nmdc:mga08y16_31617_c1 nmdc:mga08y16_31617_c1_3076_4035 289
2073 3300050511 nmdc:mga08y16_86717_c1 nmdc:mga08y16_86717_c1_1156_2031 289
2074 3300050512 nmdc:mga0n895_254252_c1 nmdc:mga0n895_254252_c1_342_1217 289
2075 3300050512 nmdc:mga0n895_259497_c1 nmdc:mga0n895_259497_c1_854_1729 289
2076 3300050512 nmdc:mga0n895_27398_c1 nmdc:mga0n895_27398_c1_4024_4899 289
2077 3300050512 nmdc:mga0n895_308182_c1 nmdc:mga0n895_308182_c1_359_1240 289
2078 3300050512 nmdc:mga0n895_39895_c1 nmdc:mga0n895_39895_c1_3111_3986 289
2079 3300050513 nmdc:mga0rr50_11989_c1 nmdc:mga0rr50_11989_c1_2899_3774 289
2080 3300050513 nmdc:mga0rr50_132155_c1 nmdc:mga0rr50_132155_c1_97_972 289
2081 3300050513 nmdc:mga0rr50_284088_c1 nmdc:mga0rr50_284088_c1_74_949 289
2082 3300050514 nmdc:mga08x19_141863_c1 nmdc:mga08x19_141863_c1_483_1358 289
2083 3300050514 nmdc:mga08x19_36830_c1 nmdc:mga08x19_36830_c1_845_1867 289
2084 3300050515 nmdc:mga0a205_10397_c3 nmdc:mga0a205_10397_c3_4130_5002 289
2085 3300050515 nmdc:mga0a205_12207_c1 nmdc:mga0a205_12207_c1_1806_2678 289
2086 3300050515 nmdc:mga0a205_236593_c1 nmdc:mga0a205_236593_c1_770_1645 289
2087 3300050515 nmdc:mga0a205_53663_c2 nmdc:mga0a205_53663_c2_584_1459 289
2088 3300050515 nmdc:mga0a205_81801_c1 nmdc:mga0a205_81801_c1_502_1383 289
2089 3300053077 Ga0495601_0009426 Ga0495601_0009426_3861_4730 289
2090 3300053085 Ga0495619_0239583 Ga0495619_0239583_222_1097 289
2091 3300053092 Ga0500583_0050946 Ga0500583_0050946_360_1700 289
2092 3300053096 Ga0500641_0018948 Ga0500641_0018948_1215_2084 289
2093 3300053098 Ga0500650_0000015 Ga0500650_0000015_40731_41603 289
2094 3300053111 Ga0500572_010893 Ga0500572_010893_767_1999 289
2095 3300053118 Ga0500594_0013748 Ga0500594_0013748_373_1653 289
2096 3300053139 Ga0500568_0006857 Ga0500568_0006857_1739_2620 289
2097 3300053146 Ga0500588_0010421 Ga0500588_0010421_445_1725 289
2098 3300053153 Ga0500616_0000018 Ga0500616_0000018_527058_528317 289
2099 3300053156 Ga0500622_0012338 Ga0500622_0012338_429_1574 289
2100 3300053177 Ga0500636_0004298 Ga0500636_0004298_2092_2973 289
2101 3300054114 Ga0501084_0005220 Ga0501084_0005220_1496_2371 289
2102 3300054114 Ga0501084_0022291 Ga0501084_0022291_3929_4807 289
2103 3300054114 Ga0501084_0034480 Ga0501084_0034480_920_1819 289
2104 3300054114 Ga0501084_0058928 Ga0501084_0058928_1523_2425 289
2105 3300054114 Ga0501084_0070139 Ga0501084_0070139_439_1341 289
2106 3300059424 Ga0590075_004559 Ga0590075_004559_868_1749 289
2107 3300059426 Ga0590077_026834 Ga0590077_026834_80_958 289
2108 3300060353 Ga0501082_0000931 Ga0501082_0000931_18378_19253 289
2109 3300060353 Ga0501082_0016376 Ga0501082_0016376_706_1581 289
2110 3300060353 Ga0501082_0046622 Ga0501082_0046622_384_1286 289
2111 3300060353 Ga0501082_0050995 Ga0501082_0050995_2058_2957 289
2112 3300060353 Ga0501082_0104388 Ga0501082_0104388_820_1692 289
2113 3300060353 Ga0501082_0153081 Ga0501082_0153081_60_944 289
2114 3300060353 Ga0501082_0178163 Ga0501082_0178163_611_1513 289
2115 3300061719 Ga0466962_0000808 Ga0466962_0000808_11753_12937 289
2116 3300061734 Ga0530510_0034595 Ga0530510_0034595_2079_2981 289
2117 3300061734 Ga0530510_0038137 Ga0530510_0038137_2044_2946 289
2118 3300061734 Ga0530510_0042114 Ga0530510_0042114_2116_3015 289
2119 3300061734 Ga0530510_0042216 Ga0530510_0042216_1019_1894 289
2120 3300061734 Ga0530510_0061146 Ga0530510_0061146_455_1330 289
2121 3300061734 Ga0530510_0235894 Ga0530510_0235894_64_942 289
2122 iso_pu_bacteria 2971511577 2971511970 289
2123 iso_pu_bacteria 2980176882 2980177110 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02629

CoA_binding

CoA binding domain

6

99

0.98

PF00549

Ligase_CoA

CoA-ligase

152

273

0.96

PF13607

Succ_CoA_lig

Succinyl-CoA ligase like flavodoxin domain

146

285

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oi7-assembly1.cif.gz_A the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus 0.9809 3 289
2nua-assembly1.cif.gz_A c123av mutant of e. coli succinyl-coa synthetase 0.9804 2 288
2nu9-assembly1.cif.gz_A c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form 0.9793 2 286
2scu-assembly1.cif.gz_A a detailed description of the structure of succinyl-coa synthetase from escherichia coli 0.9792 2 286
2nu6-assembly1.cif.gz_A c123aa mutant of e. coli succinyl-coa synthetase 0.9783 2 288
ID Description Score Start End Superfamily
af_A0A1D6EZI1_156_262_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 1.005 121 206 3.40.50.261
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9998 2 123 3.40.50.720
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9917 2 123 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9873 4 123 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9712 4 123 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A379TGP4-F1-model_v4 Succinyl-CoA synthetase subunit alpha (EC 6.2.1.5) 1.007 35 128 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-E4YXI4-F1-model_v4 CoA-binding domain-containing protein 1.007 5 74 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A382W6R5-F1-model_v4 CoA-binding domain-containing protein 1.005 12 104 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2D4K3L3-F1-model_v4 CoA-binding domain-containing protein 1.002 5 106 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A376MTQ6-F1-model_v4 Succinyl-CoA ligase subunit alpha (EC 6.2.1.5) 1.002 54 159 GO:0004775
GO:0004776
GO:0006099
GO:0009361

Feature Viewer

pLDDT pTM Quality
92.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map