F496250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2008 | 720 | 1939 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0473085|Ga0453684_0473085_381_818 |
| Length | 145 |
| Sequence | VLKKARGNLIKFCLSMTTDTLGDSLARIRNAIMRKQKQVELQKSRMVAEVCRILQENKFIKEFDIKDDARVINVTLNYEDGESSKLVSSLQRVSKPGLRIYRGYKELRPVLNGYGIAIISTPKGVMSDRDARKNKVGGELLCEIY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 6 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 7 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 8 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 11 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 12 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 13 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 14 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 15 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 16 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 17 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 18 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 19 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 20 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 21 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 22 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 23 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 24 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 25 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 26 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 27 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 28 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 29 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 30 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 31 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 32 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 33 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 34 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 35 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 36 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 37 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 38 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 39 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 40 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 41 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 42 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 43 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 44 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 45 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 46 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 47 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 48 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 49 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 50 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 51 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 52 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 53 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 54 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 55 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 56 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 57 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 58 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 59 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 60 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 61 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 62 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 63 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 64 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 65 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 66 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 67 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 68 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 69 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 70 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 71 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 72 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 73 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 74 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 75 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 76 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 77 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 78 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 79 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 80 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 81 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 82 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 83 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 84 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 85 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 86 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 87 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 88 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 89 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 90 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 91 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 92 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 93 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 94 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 95 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 96 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 97 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 100 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 101 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 103 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 104 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 105 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 106 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 115 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 119 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 121 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 131 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 142 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 146 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 147 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 148 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 155 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 163 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 165 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 166 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 167 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 169 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 170 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 171 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 172 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 173 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 174 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 175 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 176 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 177 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 178 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 179 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 180 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 181 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 182 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 183 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 184 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 185 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 188 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 189 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 190 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 191 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 193 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 194 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 195 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 196 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 197 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 198 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 199 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 200 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 202 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 203 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 220 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 221 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 222 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 223 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 224 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 225 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 226 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 227 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 228 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 229 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 241 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 245 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 247 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 248 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 249 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 250 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 251 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 257 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 324 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 327 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 331 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 332 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 333 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 334 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 335 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 336 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 337 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 338 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 340 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 341 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 342 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 343 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 344 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 345 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 346 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 347 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 348 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 350 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 351 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 352 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 353 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 354 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 355 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 356 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 357 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 358 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 359 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 360 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 361 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 362 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 363 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 364 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 365 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 366 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 368 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 369 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 372 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 373 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 374 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 375 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 376 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 377 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 378 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 379 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 380 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 381 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 382 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 383 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 385 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 386 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 387 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 388 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 389 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 390 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 391 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 392 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 393 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 394 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 395 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 396 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 397 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 398 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 399 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 400 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 402 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 403 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 404 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 405 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 406 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 407 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 408 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 409 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 410 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 411 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 412 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 413 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 414 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 415 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 416 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 417 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 418 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 419 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 420 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 421 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 422 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 423 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 424 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 425 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 426 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 427 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 428 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 429 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 430 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 431 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 432 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 433 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 434 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 435 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 436 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 437 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 438 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 439 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 440 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 441 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 442 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 443 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 444 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 445 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 446 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 447 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 448 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 449 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 450 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 451 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 452 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 453 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 454 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 455 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 456 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 457 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 458 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 459 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 460 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 461 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 462 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 463 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 464 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 465 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 466 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 467 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 468 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 469 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 470 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 471 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 472 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 473 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 474 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 475 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 476 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 477 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 478 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 479 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 480 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 568 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 569 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 570 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 571 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 572 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 573 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 574 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 575 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 576 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 577 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 578 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 579 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 580 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 581 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 582 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 583 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 584 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 585 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 586 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 596 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 597 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 598 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 599 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 600 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 601 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 602 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 603 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 604 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 605 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 606 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 607 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 608 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 612 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 613 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 614 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 615 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 622 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 623 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 628 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 629 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 631 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 632 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 633 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 634 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 635 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 636 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 637 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 638 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 639 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 640 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 641 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 642 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 645 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 646 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 647 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 648 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 649 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 651 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 653 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 654 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 655 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 656 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 657 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 658 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 659 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 660 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 661 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 662 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 663 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 664 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 665 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 666 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 668 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 671 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 675 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 676 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 677 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 678 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 679 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 680 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 681 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 682 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 683 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 684 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 685 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 686 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 687 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 688 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 689 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 690 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 691 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 692 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 693 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 694 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 695 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 696 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 697 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 698 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 699 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 700 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 701 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 702 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 703 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 704 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 705 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 706 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 707 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 708 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 709 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 710 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 711 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 712 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 713 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 714 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 715 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 716 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 717 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 718 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 719 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 720 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.43 |
| Metatranscriptomes | 4.13 |
| Isolates | 3.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.05 |
| Endosphere | 9.26 |
| Nodule | 0.35 |
| Rhizoplane | 4.83 |
| Rhizosphere | 79.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1228071 | 2162886007 | Bacteria | 838 |
| 2 | LJNas_1015535 | 3300000546 | Bacteria | 811 |
| 3 | JGI24752J21851_1044283 | 3300001976 | Bacteria | 599 |
| 4 | JGI24747J21853_1009316 | 3300001978 | Bacteria | 969 |
| 5 | JGI24739J22299_10006228 | 3300001989 | Bacteria | 4506 |
| 6 | JGI24750J21931_1030210 | 3300002070 | Bacteria | 792 |
| 7 | JGI24744J21845_10066100 | 3300002077 | Bacteria | 660 |
| 8 | JGI24035J26624_1018097 | 3300002126 | Bacteria | 732 |
| 9 | JGI24033J26618_1051580 | 3300002155 | Bacteria | 591 |
| 10 | JGI24742J22300_10015246 | 3300002244 | Bacteria | 1293 |
| 11 | JGI25158J39367_1016229 | 3300002739 | Bacteria | 943 |
| 12 | JGI25152J39213_1001073 | 3300002773 | Bacteria | 12895 |
| 13 | JGI25150J39212_1003907 | 3300002774 | Bacteria | 3415 |
| 14 | JGI25159J45721_1048433 | 3300002987 | Bacteria | 590 |
| 15 | Ga0006778J45830_1009213 | 3300003162 | Bacteria | 15395 |
| 16 | Ga0006759J45824_1029126 | 3300003163 | Bacteria | 2169 |
| 17 | Ga0006759J45824_1064290 | 3300003163 | Bacteria | 1084 |
| 18 | JGI25153J46596_10007740 | 3300003215 | Bacteria | 5229 |
| 19 | JGI25153J46596_10008637 | 3300003215 | Bacteria | 4845 |
| 20 | Ga0006758J48902_1016024 | 3300003300 | Bacteria | 1731 |
| 21 | Ga0006770J48903_1001899 | 3300003305 | Bacteria | 11120 |
| 22 | Ga0006777J48905_1014855 | 3300003308 | Bacteria | 5027 |
| 23 | Ga0006777J48905_1103387 | 3300003308 | Bacteria | 751 |
| 24 | rootH2_10169529 | 3300003320 | Bacteria | 5511 |
| 25 | rootL2_10001301 | 3300003322 | Bacteria | 6102 |
| 26 | JGI26128J50194_1000191 | 3300003347 | Bacteria | 2835 |
| 27 | JGI26138J51218_106156 | 3300003504 | Bacteria | 554 |
| 28 | Ga0007427J51700_118227 | 3300003559 | Bacteria | 1005 |
| 29 | Ga0007409J51694_1045076 | 3300003575 | Bacteria | 738 |
| 30 | Ga0007409J51694_1147697 | 3300003575 | Bacteria | 560 |
| 31 | Ga0007416J51690_1051124 | 3300003577 | Bacteria | 2960 |
| 32 | Ga0007429J51699_1075853 | 3300003579 | Bacteria | 689 |
| 33 | Ga0032354_1038952 | 3300003693 | Bacteria | 2112 |
| 34 | Ga0032354_1072421 | 3300003693 | Bacteria | 2730 |
| 35 | Ga0032354_1076006 | 3300003693 | Bacteria | 606 |
| 36 | Ga0055539_1013170 | 3300003752 | Bacteria | 1014 |
| 37 | Ga0055526_1000791 | 3300003771 | Bacteria | 23567 |
| 38 | Ga0055530_10019398 | 3300003791 | Bacteria | 2061 |
| 39 | Ga0058862_10046561 | 3300004803 | Bacteria | 3584 |
| 40 | Ga0065165_1001259 | 3300005262 | Bacteria | 28658 |
| 41 | Ga0065714_10138237 | 3300005288 | Bacteria | 1192 |
| 42 | Ga0065704_10187738 | 3300005289 | Bacteria | 1204 |
| 43 | Ga0065712_10080555 | 3300005290 | Bacteria | 3093 |
| 44 | Ga0065712_10107042 | 3300005290 | Bacteria | 1904 |
| 45 | Ga0065712_10788760 | 3300005290 | Bacteria | 516 |
| 46 | Ga0065715_10005249 | 3300005293 | Bacteria | 3239 |
| 47 | Ga0065715_10024824 | 3300005293 | Bacteria | 1256 |
| 48 | Ga0065715_10636148 | 3300005293 | Bacteria | 687 |
| 49 | Ga0065707_10401468 | 3300005295 | Bacteria | 852 |
| 50 | Ga0070658_10152764 | 3300005327 | Bacteria | 1933 |
| 51 | Ga0070658_10160545 | 3300005327 | Bacteria | 1885 |
| 52 | Ga0070658_10646415 | 3300005327 | Bacteria | 917 |
| 53 | Ga0070658_10996892 | 3300005327 | Bacteria | 729 |
| 54 | Ga0070676_10002282 | 3300005328 | Bacteria | 9791 |
| 55 | Ga0070676_10021276 | 3300005328 | Bacteria | 3630 |
| 56 | Ga0070676_10052224 | 3300005328 | Bacteria | 2403 |
| 57 | Ga0070676_10078497 | 3300005328 | Bacteria | 1997 |
| 58 | Ga0070676_10294672 | 3300005328 | Bacteria | 1097 |
| 59 | Ga0070676_10334482 | 3300005328 | Bacteria | 1036 |
| 60 | Ga0070676_10684369 | 3300005328 | Bacteria | 747 |
| 61 | Ga0070676_11223034 | 3300005328 | Bacteria | 571 |
| 62 | Ga0070683_100315172 | 3300005329 | Bacteria | 1488 |
| 63 | Ga0070683_100470633 | 3300005329 | Bacteria | 1200 |
| 64 | Ga0070683_101311876 | 3300005329 | Bacteria | 696 |
| 65 | Ga0070690_100006927 | 3300005330 | Bacteria | 6450 |
| 66 | Ga0070690_100231854 | 3300005330 | Bacteria | 1298 |
| 67 | Ga0070690_101044094 | 3300005330 | Bacteria | 646 |
| 68 | Ga0070690_101437765 | 3300005330 | Bacteria | 556 |
| 69 | Ga0070670_100023628 | 3300005331 | Bacteria | 5290 |
| 70 | Ga0070670_100054237 | 3300005331 | Bacteria | 3441 |
| 71 | Ga0070670_100064589 | 3300005331 | Bacteria | 3140 |
| 72 | Ga0070670_100065507 | 3300005331 | Bacteria | 3117 |
| 73 | Ga0070670_100183537 | 3300005331 | Bacteria | 1816 |
| 74 | Ga0070670_100305986 | 3300005331 | Bacteria | 1391 |
| 75 | Ga0070670_100436330 | 3300005331 | Bacteria | 1159 |
| 76 | Ga0070670_101289446 | 3300005331 | Bacteria | 668 |
| 77 | Ga0070677_10126334 | 3300005333 | Bacteria | 1161 |
| 78 | Ga0070677_10384582 | 3300005333 | Bacteria | 736 |
| 79 | Ga0070677_10614212 | 3300005333 | Bacteria | 603 |
| 80 | Ga0068869_100077114 | 3300005334 | Bacteria | 2478 |
| 81 | Ga0068869_100146255 | 3300005334 | Bacteria | 1829 |
| 82 | Ga0068869_100263074 | 3300005334 | Bacteria | 1381 |
| 83 | Ga0068869_100284560 | 3300005334 | Bacteria | 1330 |
| 84 | Ga0068869_100900370 | 3300005334 | Bacteria | 766 |
| 85 | Ga0070666_10221816 | 3300005335 | Bacteria | 1334 |
| 86 | Ga0070666_10235916 | 3300005335 | Bacteria | 1293 |
| 87 | Ga0070666_10239237 | 3300005335 | Bacteria | 1283 |
| 88 | Ga0070666_10589561 | 3300005335 | Bacteria | 811 |
| 89 | Ga0070680_100032809 | 3300005336 | Bacteria | 4180 |
| 90 | Ga0070682_100031523 | 3300005337 | Bacteria | 3206 |
| 91 | Ga0070682_100057764 | 3300005337 | Bacteria | 2445 |
| 92 | Ga0070682_100093827 | 3300005337 | Bacteria | 1968 |
| 93 | Ga0070682_100149406 | 3300005337 | Bacteria | 1601 |
| 94 | Ga0070682_100351164 | 3300005337 | Bacteria | 1099 |
| 95 | Ga0070682_100881295 | 3300005337 | Bacteria | 734 |
| 96 | Ga0068868_100133352 | 3300005338 | Bacteria | 2034 |
| 97 | Ga0068868_100211639 | 3300005338 | Bacteria | 1620 |
| 98 | Ga0068868_100449603 | 3300005338 | Bacteria | 1120 |
| 99 | Ga0068868_100578715 | 3300005338 | Bacteria | 992 |
| 100 | Ga0068868_100797352 | 3300005338 | Bacteria | 852 |
| 101 | Ga0068868_100874744 | 3300005338 | Bacteria | 815 |
| 102 | Ga0068868_102073964 | 3300005338 | Bacteria | 540 |
| 103 | Ga0068868_102090024 | 3300005338 | Bacteria | 538 |
| 104 | Ga0070660_100467133 | 3300005339 | Bacteria | 1048 |
| 105 | Ga0070660_100475236 | 3300005339 | Bacteria | 1038 |
| 106 | Ga0070660_100572021 | 3300005339 | Bacteria | 943 |
| 107 | Ga0070660_101051513 | 3300005339 | Bacteria | 688 |
| 108 | Ga0070660_101233271 | 3300005339 | Bacteria | 634 |
| 109 | Ga0070689_100015417 | 3300005340 | Bacteria | 5572 |
| 110 | Ga0070689_100546341 | 3300005340 | Bacteria | 998 |
| 111 | Ga0070689_100756953 | 3300005340 | Bacteria | 852 |
| 112 | Ga0070689_100903169 | 3300005340 | Bacteria | 782 |
| 113 | Ga0070691_10071558 | 3300005341 | Bacteria | 1684 |
| 114 | Ga0070687_100132497 | 3300005343 | Bacteria | 1441 |
| 115 | Ga0070687_100201346 | 3300005343 | Bacteria | 1206 |
| 116 | Ga0070661_100092952 | 3300005344 | Bacteria | 2235 |
| 117 | Ga0070661_100105291 | 3300005344 | Bacteria | 2102 |
| 118 | Ga0070661_100476134 | 3300005344 | Bacteria | 996 |
| 119 | Ga0070661_100979681 | 3300005344 | Bacteria | 701 |
| 120 | Ga0070668_100072291 | 3300005347 | Bacteria | 2687 |
| 121 | Ga0070668_100277179 | 3300005347 | Bacteria | 1399 |
| 122 | Ga0070668_100603159 | 3300005347 | Bacteria | 961 |
| 123 | Ga0070668_100707992 | 3300005347 | Bacteria | 888 |
| 124 | Ga0070669_100017536 | 3300005353 | Bacteria | 5107 |
| 125 | Ga0070669_100031250 | 3300005353 | Bacteria | 3846 |
| 126 | Ga0070669_100306076 | 3300005353 | Bacteria | 1279 |
| 127 | Ga0070669_100685263 | 3300005353 | Bacteria | 864 |
| 128 | Ga0070675_100044665 | 3300005354 | Bacteria | 3623 |
| 129 | Ga0070675_100107037 | 3300005354 | Bacteria | 2361 |
| 130 | Ga0070675_100124843 | 3300005354 | Bacteria | 2189 |
| 131 | Ga0070675_100131492 | 3300005354 | Bacteria | 2133 |
| 132 | Ga0070675_100137403 | 3300005354 | Bacteria | 2087 |
| 133 | Ga0070675_100188013 | 3300005354 | Bacteria | 1788 |
| 134 | Ga0070675_100347697 | 3300005354 | Bacteria | 1314 |
| 135 | Ga0070675_100413240 | 3300005354 | Bacteria | 1205 |
| 136 | Ga0070671_100019537 | 3300005355 | Bacteria | 5516 |
| 137 | Ga0070671_100085884 | 3300005355 | Bacteria | 2632 |
| 138 | Ga0070671_100133178 | 3300005355 | Bacteria | 2094 |
| 139 | Ga0070671_100189988 | 3300005355 | Bacteria | 1740 |
| 140 | Ga0070671_100383911 | 3300005355 | Bacteria | 1201 |
| 141 | Ga0070671_100963231 | 3300005355 | Bacteria | 747 |
| 142 | Ga0070674_100039880 | 3300005356 | Bacteria | 3174 |
| 143 | Ga0070674_100056124 | 3300005356 | Bacteria | 2730 |
| 144 | Ga0070674_100096649 | 3300005356 | Bacteria | 2144 |
| 145 | Ga0070674_100310754 | 3300005356 | Bacteria | 1260 |
| 146 | Ga0070674_100364718 | 3300005356 | Bacteria | 1171 |
| 147 | Ga0070674_100399417 | 3300005356 | Bacteria | 1123 |
| 148 | Ga0070674_100667031 | 3300005356 | Bacteria | 885 |
| 149 | Ga0070674_100687011 | 3300005356 | Bacteria | 874 |
| 150 | Ga0070674_100854573 | 3300005356 | Bacteria | 789 |
| 151 | Ga0070674_101003197 | 3300005356 | Bacteria | 733 |
| 152 | Ga0070674_101903081 | 3300005356 | Bacteria | 540 |
| 153 | Ga0070673_100015167 | 3300005364 | Bacteria | 5401 |
| 154 | Ga0070673_100034303 | 3300005364 | Bacteria | 3838 |
| 155 | Ga0070673_100092283 | 3300005364 | Bacteria | 2476 |
| 156 | Ga0070673_100192497 | 3300005364 | Bacteria | 1752 |
| 157 | Ga0070673_100341751 | 3300005364 | Bacteria | 1326 |
| 158 | Ga0070673_100682053 | 3300005364 | Bacteria | 942 |
| 159 | Ga0070688_100100587 | 3300005365 | Bacteria | 1905 |
| 160 | Ga0070688_100304757 | 3300005365 | Bacteria | 1152 |
| 161 | Ga0070688_100375525 | 3300005365 | Bacteria | 1047 |
| 162 | Ga0070659_100250633 | 3300005366 | Bacteria | 1467 |
| 163 | Ga0070659_100378036 | 3300005366 | Bacteria | 1193 |
| 164 | Ga0070659_100428407 | 3300005366 | Bacteria | 1120 |
| 165 | Ga0070659_100865268 | 3300005366 | Bacteria | 788 |
| 166 | Ga0070659_101257943 | 3300005366 | Bacteria | 655 |
| 167 | Ga0070659_101322051 | 3300005366 | Bacteria | 639 |
| 168 | Ga0070659_101646251 | 3300005366 | Bacteria | 573 |
| 169 | Ga0070667_100022362 | 3300005367 | Bacteria | 5245 |
| 170 | Ga0070667_100083378 | 3300005367 | Bacteria | 2738 |
| 171 | Ga0070667_100129962 | 3300005367 | Bacteria | 2197 |
| 172 | Ga0070667_100158747 | 3300005367 | Bacteria | 1990 |
| 173 | Ga0070667_100191574 | 3300005367 | Bacteria | 1811 |
| 174 | Ga0070667_100204785 | 3300005367 | Bacteria | 1752 |
| 175 | Ga0070667_100231002 | 3300005367 | Bacteria | 1649 |
| 176 | Ga0070709_10079106 | 3300005434 | Bacteria | 2141 |
| 177 | Ga0070709_10501440 | 3300005434 | Bacteria | 922 |
| 178 | Ga0070709_11202713 | 3300005434 | Bacteria | 609 |
| 179 | Ga0070714_100019666 | 3300005435 | Bacteria | 5505 |
| 180 | Ga0070713_100092760 | 3300005436 | Bacteria | 2601 |
| 181 | Ga0070710_10297749 | 3300005437 | Bacteria | 1052 |
| 182 | Ga0070701_10012276 | 3300005438 | Bacteria | 3858 |
| 183 | Ga0070701_10134721 | 3300005438 | Bacteria | 1407 |
| 184 | Ga0070701_10711485 | 3300005438 | Bacteria | 677 |
| 185 | Ga0070711_101263279 | 3300005439 | Bacteria | 640 |
| 186 | Ga0070705_101369690 | 3300005440 | Bacteria | 589 |
| 187 | Ga0070700_100111081 | 3300005441 | Bacteria | 1822 |
| 188 | Ga0070700_100185857 | 3300005441 | Bacteria | 1449 |
| 189 | Ga0070700_100203545 | 3300005441 | Bacteria | 1392 |
| 190 | Ga0070700_100366844 | 3300005441 | Bacteria | 1072 |
| 191 | Ga0070700_100575157 | 3300005441 | Bacteria | 879 |
| 192 | Ga0070694_100354195 | 3300005444 | Bacteria | 1138 |
| 193 | Ga0070694_100435416 | 3300005444 | Bacteria | 1032 |
| 194 | Ga0070694_101210701 | 3300005444 | Bacteria | 633 |
| 195 | Ga0070663_100003492 | 3300005455 | Bacteria | 9070 |
| 196 | Ga0070663_100383305 | 3300005455 | Bacteria | 1145 |
| 197 | Ga0070663_100460622 | 3300005455 | Bacteria | 1050 |
| 198 | Ga0070663_101254864 | 3300005455 | Bacteria | 653 |
| 199 | Ga0070663_101578771 | 3300005455 | Bacteria | 585 |
| 200 | Ga0070678_100082508 | 3300005456 | Bacteria | 2441 |
| 201 | Ga0070678_100104114 | 3300005456 | Bacteria | 2206 |
| 202 | Ga0070678_100137945 | 3300005456 | Bacteria | 1947 |
| 203 | Ga0070678_100500637 | 3300005456 | Bacteria | 1072 |
| 204 | Ga0070678_100776147 | 3300005456 | Bacteria | 868 |
| 205 | Ga0070678_100914938 | 3300005456 | Bacteria | 802 |
| 206 | Ga0070662_100051713 | 3300005457 | Bacteria | 2968 |
| 207 | Ga0070662_100193386 | 3300005457 | Bacteria | 1610 |
| 208 | Ga0070662_100613806 | 3300005457 | Bacteria | 915 |
| 209 | Ga0070662_100782507 | 3300005457 | Bacteria | 810 |
| 210 | Ga0070681_10088377 | 3300005458 | Bacteria | 3051 |
| 211 | Ga0068867_100000552 | 3300005459 | Bacteria | 24723 |
| 212 | Ga0068867_100002598 | 3300005459 | Bacteria | 12737 |
| 213 | Ga0068867_100011425 | 3300005459 | Bacteria | 6266 |
| 214 | Ga0068867_100064867 | 3300005459 | Bacteria | 2716 |
| 215 | Ga0068867_100069225 | 3300005459 | Bacteria | 2635 |
| 216 | Ga0068867_100087646 | 3300005459 | Bacteria | 2357 |
| 217 | Ga0068867_100276422 | 3300005459 | Bacteria | 1375 |
| 218 | Ga0068867_100284808 | 3300005459 | Bacteria | 1356 |
| 219 | Ga0068867_100292499 | 3300005459 | Bacteria | 1340 |
| 220 | Ga0068867_100336428 | 3300005459 | Bacteria | 1255 |
| 221 | Ga0068867_100582762 | 3300005459 | Bacteria | 973 |
| 222 | Ga0068867_100695754 | 3300005459 | Bacteria | 896 |
| 223 | Ga0070685_10075272 | 3300005466 | Bacteria | 2010 |
| 224 | Ga0070685_10101298 | 3300005466 | Bacteria | 1759 |
| 225 | Ga0070685_10394830 | 3300005466 | Bacteria | 957 |
| 226 | Ga0070685_10423778 | 3300005466 | Bacteria | 927 |
| 227 | Ga0070685_10454733 | 3300005466 | Bacteria | 898 |
| 228 | Ga0070706_101474223 | 3300005467 | Bacteria | 622 |
| 229 | Ga0070707_100905496 | 3300005468 | Bacteria | 847 |
| 230 | Ga0070699_101072406 | 3300005518 | Bacteria | 739 |
| 231 | Ga0070679_100007565 | 3300005530 | Bacteria | 10160 |
| 232 | Ga0070679_101164604 | 3300005530 | Bacteria | 716 |
| 233 | Ga0070684_100178663 | 3300005535 | Bacteria | 1929 |
| 234 | Ga0070684_100247020 | 3300005535 | Bacteria | 1631 |
| 235 | Ga0070697_100735690 | 3300005536 | Bacteria | 871 |
| 236 | Ga0068853_100320550 | 3300005539 | Bacteria | 1437 |
| 237 | Ga0068853_100330775 | 3300005539 | Bacteria | 1414 |
| 238 | Ga0068853_100868330 | 3300005539 | Bacteria | 866 |
| 239 | Ga0068853_100880616 | 3300005539 | Bacteria | 859 |
| 240 | Ga0068853_100930104 | 3300005539 | Bacteria | 836 |
| 241 | Ga0068853_101141703 | 3300005539 | Bacteria | 752 |
| 242 | Ga0070672_100006187 | 3300005543 | Bacteria | 8016 |
| 243 | Ga0070672_100010859 | 3300005543 | Bacteria | 6333 |
| 244 | Ga0070672_100044598 | 3300005543 | Bacteria | 3426 |
| 245 | Ga0070672_100198587 | 3300005543 | Bacteria | 1677 |
| 246 | Ga0070672_100378493 | 3300005543 | Bacteria | 1210 |
| 247 | Ga0070672_100571956 | 3300005543 | Bacteria | 983 |
| 248 | Ga0070672_100747572 | 3300005543 | Bacteria | 858 |
| 249 | Ga0070672_101096081 | 3300005543 | Bacteria | 707 |
| 250 | Ga0070672_101600140 | 3300005543 | Bacteria | 584 |
| 251 | Ga0070672_101794085 | 3300005543 | Bacteria | 551 |
| 252 | Ga0070686_100304762 | 3300005544 | Bacteria | 1182 |
| 253 | Ga0070686_100621476 | 3300005544 | Bacteria | 853 |
| 254 | Ga0070695_100207075 | 3300005545 | Bacteria | 1405 |
| 255 | Ga0070695_100315217 | 3300005545 | Bacteria | 1161 |
| 256 | Ga0070696_100094917 | 3300005546 | Bacteria | 2129 |
| 257 | Ga0070693_100023342 | 3300005547 | Bacteria | 3305 |
| 258 | Ga0070693_100069686 | 3300005547 | Bacteria | 2067 |
| 259 | Ga0070665_100320840 | 3300005548 | Bacteria | 1553 |
| 260 | Ga0070665_100373744 | 3300005548 | Bacteria | 1432 |
| 261 | Ga0070665_100468764 | 3300005548 | Bacteria | 1270 |
| 262 | Ga0070665_100552322 | 3300005548 | Bacteria | 1164 |
| 263 | Ga0070665_100751082 | 3300005548 | Bacteria | 988 |
| 264 | Ga0070704_100096958 | 3300005549 | Bacteria | 2212 |
| 265 | Ga0070704_102227173 | 3300005549 | Bacteria | 510 |
| 266 | Ga0068855_100040434 | 3300005563 | Bacteria | 5534 |
| 267 | Ga0068855_100058607 | 3300005563 | Bacteria | 4509 |
| 268 | Ga0068855_100288384 | 3300005563 | Bacteria | 1820 |
| 269 | Ga0068855_100490245 | 3300005563 | Bacteria | 1337 |
| 270 | Ga0070664_100155787 | 3300005564 | Bacteria | 2018 |
| 271 | Ga0070664_100238231 | 3300005564 | Bacteria | 1633 |
| 272 | Ga0070664_100273368 | 3300005564 | Bacteria | 1522 |
| 273 | Ga0070664_100284562 | 3300005564 | Bacteria | 1491 |
| 274 | Ga0070664_100380435 | 3300005564 | Bacteria | 1288 |
| 275 | Ga0070664_102024331 | 3300005564 | Bacteria | 546 |
| 276 | Ga0070664_102082275 | 3300005564 | Bacteria | 538 |
| 277 | Ga0068857_100040688 | 3300005577 | Bacteria | 4122 |
| 278 | Ga0068857_100209439 | 3300005577 | Bacteria | 1778 |
| 279 | Ga0068857_100519076 | 3300005577 | Bacteria | 1119 |
| 280 | Ga0068857_100685991 | 3300005577 | Bacteria | 972 |
| 281 | Ga0068857_100767834 | 3300005577 | Bacteria | 919 |
| 282 | Ga0068857_101282743 | 3300005577 | Bacteria | 710 |
| 283 | Ga0068854_100044785 | 3300005578 | Bacteria | 3143 |
| 284 | Ga0068854_100230274 | 3300005578 | Bacteria | 1470 |
| 285 | Ga0068854_102251975 | 3300005578 | Bacteria | 504 |
| 286 | Ga0068856_100183859 | 3300005614 | Bacteria | 2104 |
| 287 | Ga0068856_100244565 | 3300005614 | Bacteria | 1809 |
| 288 | Ga0068856_100345416 | 3300005614 | Bacteria | 1507 |
| 289 | Ga0068856_101672088 | 3300005614 | Bacteria | 649 |
| 290 | Ga0070702_100403402 | 3300005615 | Bacteria | 979 |
| 291 | Ga0070702_100490995 | 3300005615 | Bacteria | 899 |
| 292 | Ga0070702_100832465 | 3300005615 | Bacteria | 716 |
| 293 | Ga0068852_100102229 | 3300005616 | Bacteria | 2589 |
| 294 | Ga0068852_100307390 | 3300005616 | Bacteria | 1536 |
| 295 | Ga0068852_100315873 | 3300005616 | Bacteria | 1516 |
| 296 | Ga0068852_100651676 | 3300005616 | Bacteria | 1060 |
| 297 | Ga0068852_100824589 | 3300005616 | Bacteria | 942 |
| 298 | Ga0068852_100889233 | 3300005616 | Bacteria | 907 |
| 299 | Ga0068852_101084487 | 3300005616 | Bacteria | 821 |
| 300 | Ga0068859_100047020 | 3300005617 | Bacteria | 4334 |
| 301 | Ga0068859_100130187 | 3300005617 | Bacteria | 2587 |
| 302 | Ga0068859_100627269 | 3300005617 | Bacteria | 1167 |
| 303 | Ga0068859_100701377 | 3300005617 | Bacteria | 1103 |
| 304 | Ga0068859_100794112 | 3300005617 | Bacteria | 1034 |
| 305 | Ga0068859_100993513 | 3300005617 | Bacteria | 921 |
| 306 | Ga0068859_101730399 | 3300005617 | Bacteria | 691 |
| 307 | Ga0068864_100043033 | 3300005618 | Bacteria | 3866 |
| 308 | Ga0068864_100144620 | 3300005618 | Bacteria | 2148 |
| 309 | Ga0068864_100277415 | 3300005618 | Bacteria | 1563 |
| 310 | Ga0068864_100353670 | 3300005618 | Bacteria | 1387 |
| 311 | Ga0068864_101060311 | 3300005618 | Bacteria | 805 |
| 312 | Ga0068864_101644636 | 3300005618 | Bacteria | 646 |
| 313 | Ga0068864_102557003 | 3300005618 | Bacteria | 516 |
| 314 | Ga0068866_10091328 | 3300005718 | Bacteria | 1659 |
| 315 | Ga0068866_10091532 | 3300005718 | Bacteria | 1657 |
| 316 | Ga0068866_10957394 | 3300005718 | Bacteria | 606 |
| 317 | Ga0068861_100004770 | 3300005719 | Bacteria | 9115 |
| 318 | Ga0068861_100016735 | 3300005719 | Bacteria | 5194 |
| 319 | Ga0068861_100021676 | 3300005719 | Bacteria | 4620 |
| 320 | Ga0068861_100170807 | 3300005719 | Bacteria | 1802 |
| 321 | Ga0068861_100174810 | 3300005719 | Bacteria | 1783 |
| 322 | Ga0068861_100885579 | 3300005719 | Bacteria | 844 |
| 323 | Ga0068861_102523344 | 3300005719 | Bacteria | 517 |
| 324 | Ga0068851_10332137 | 3300005834 | Bacteria | 881 |
| 325 | Ga0068870_10164633 | 3300005840 | Bacteria | 1318 |
| 326 | Ga0068870_10224043 | 3300005840 | Bacteria | 1152 |
| 327 | Ga0068870_10231402 | 3300005840 | Bacteria | 1136 |
| 328 | Ga0068870_10523936 | 3300005840 | Bacteria | 794 |
| 329 | Ga0068870_10569048 | 3300005840 | Bacteria | 765 |
| 330 | Ga0068870_10983496 | 3300005840 | Bacteria | 601 |
| 331 | Ga0068870_11243514 | 3300005840 | Bacteria | 540 |
| 332 | Ga0068863_100011076 | 3300005841 | Bacteria | 8745 |
| 333 | Ga0068863_100156589 | 3300005841 | Bacteria | 2181 |
| 334 | Ga0068863_100242760 | 3300005841 | Bacteria | 1739 |
| 335 | Ga0068863_100316460 | 3300005841 | Bacteria | 1515 |
| 336 | Ga0068863_100368482 | 3300005841 | Bacteria | 1401 |
| 337 | Ga0068863_100901362 | 3300005841 | Bacteria | 884 |
| 338 | Ga0068863_101044897 | 3300005841 | Bacteria | 820 |
| 339 | Ga0068858_100008125 | 3300005842 | Bacteria | 10091 |
| 340 | Ga0068858_100194536 | 3300005842 | Bacteria | 1916 |
| 341 | Ga0068858_100477508 | 3300005842 | Bacteria | 1203 |
| 342 | Ga0068860_100008442 | 3300005843 | Bacteria | 10260 |
| 343 | Ga0068860_100048811 | 3300005843 | Bacteria | 4034 |
| 344 | Ga0068860_100065679 | 3300005843 | Bacteria | 3445 |
| 345 | Ga0068860_100074726 | 3300005843 | Bacteria | 3223 |
| 346 | Ga0068860_100125358 | 3300005843 | Bacteria | 2461 |
| 347 | Ga0068860_100210653 | 3300005843 | Bacteria | 1885 |
| 348 | Ga0068860_100214297 | 3300005843 | Bacteria | 1868 |
| 349 | Ga0068860_100234051 | 3300005843 | Bacteria | 1785 |
| 350 | Ga0068860_100722091 | 3300005843 | Bacteria | 1007 |
| 351 | Ga0068862_100009442 | 3300005844 | Bacteria | 8069 |
| 352 | Ga0068862_100098243 | 3300005844 | Bacteria | 2557 |
| 353 | Ga0068862_100103723 | 3300005844 | Bacteria | 2490 |
| 354 | Ga0068862_100137286 | 3300005844 | Bacteria | 2168 |
| 355 | Ga0068862_100145559 | 3300005844 | Bacteria | 2106 |
| 356 | Ga0068862_100471684 | 3300005844 | Bacteria | 1186 |
| 357 | Ga0068862_100722741 | 3300005844 | Bacteria | 966 |
| 358 | Ga0068862_101455220 | 3300005844 | Bacteria | 689 |
| 359 | Ga0081455_10008699 | 3300005937 | Bacteria | 10513 |
| 360 | Ga0081455_10199133 | 3300005937 | Bacteria | 1501 |
| 361 | Ga0075365_10100810 | 3300006038 | Bacteria | 1977 |
| 362 | Ga0075365_10318739 | 3300006038 | Bacteria | 1095 |
| 363 | Ga0075365_10467937 | 3300006038 | Bacteria | 890 |
| 364 | Ga0075368_10058905 | 3300006042 | Bacteria | 1536 |
| 365 | Ga0075368_10064460 | 3300006042 | Bacteria | 1471 |
| 366 | Ga0075368_10064476 | 3300006042 | Bacteria | 1471 |
| 367 | Ga0075363_100005889 | 3300006048 | Bacteria | 5519 |
| 368 | Ga0075363_100049841 | 3300006048 | Bacteria | 2230 |
| 369 | Ga0075363_100204317 | 3300006048 | Bacteria | 1129 |
| 370 | Ga0075363_100312622 | 3300006048 | Bacteria | 913 |
| 371 | Ga0075363_100707422 | 3300006048 | Bacteria | 609 |
| 372 | Ga0075363_100816685 | 3300006048 | Bacteria | 568 |
| 373 | Ga0075364_10032491 | 3300006051 | Bacteria | 3355 |
| 374 | Ga0075364_10038599 | 3300006051 | Bacteria | 3094 |
| 375 | Ga0075364_10134805 | 3300006051 | Bacteria | 1658 |
| 376 | Ga0075364_10564781 | 3300006051 | Bacteria | 778 |
| 377 | Ga0075364_10573168 | 3300006051 | Bacteria | 771 |
| 378 | Ga0075432_10133565 | 3300006058 | Bacteria | 942 |
| 379 | Ga0070715_10079026 | 3300006163 | Bacteria | 1489 |
| 380 | Ga0070715_10111151 | 3300006163 | Bacteria | 1293 |
| 381 | Ga0070716_100069303 | 3300006173 | Bacteria | 2066 |
| 382 | Ga0070716_100521023 | 3300006173 | Bacteria | 881 |
| 383 | Ga0075362_10000222 | 3300006177 | Bacteria | 15765 |
| 384 | Ga0075362_10060918 | 3300006177 | Bacteria | 1706 |
| 385 | Ga0075362_10085974 | 3300006177 | Bacteria | 1455 |
| 386 | Ga0075362_10168463 | 3300006177 | Bacteria | 1057 |
| 387 | Ga0075362_10285808 | 3300006177 | Bacteria | 816 |
| 388 | Ga0075362_10374102 | 3300006177 | Bacteria | 716 |
| 389 | Ga0075362_10474507 | 3300006177 | Bacteria | 637 |
| 390 | Ga0075367_10000855 | 3300006178 | Bacteria | 12145 |
| 391 | Ga0075367_10010768 | 3300006178 | Bacteria | 4815 |
| 392 | Ga0075367_10092185 | 3300006178 | Bacteria | 1844 |
| 393 | Ga0075367_10246017 | 3300006178 | Bacteria | 1121 |
| 394 | Ga0075367_10348297 | 3300006178 | Bacteria | 935 |
| 395 | Ga0075367_10707440 | 3300006178 | Bacteria | 641 |
| 396 | Ga0075369_10005325 | 3300006186 | Bacteria | 4797 |
| 397 | Ga0075369_10110152 | 3300006186 | Bacteria | 1241 |
| 398 | Ga0075369_10215809 | 3300006186 | Bacteria | 887 |
| 399 | Ga0075369_10423981 | 3300006186 | Bacteria | 628 |
| 400 | Ga0075366_10033848 | 3300006195 | Bacteria | 3011 |
| 401 | Ga0075366_10050535 | 3300006195 | Bacteria | 2469 |
| 402 | Ga0075366_10058278 | 3300006195 | Bacteria | 2294 |
| 403 | Ga0075366_10077134 | 3300006195 | Bacteria | 1989 |
| 404 | Ga0075366_10081535 | 3300006195 | Bacteria | 1932 |
| 405 | Ga0075366_10096819 | 3300006195 | Bacteria | 1770 |
| 406 | Ga0075366_10138878 | 3300006195 | Bacteria | 1468 |
| 407 | Ga0075366_10153936 | 3300006195 | Bacteria | 1392 |
| 408 | Ga0075366_10166789 | 3300006195 | Bacteria | 1335 |
| 409 | Ga0075366_10263345 | 3300006195 | Bacteria | 1052 |
| 410 | Ga0075366_10321927 | 3300006195 | Bacteria | 947 |
| 411 | Ga0075366_10328391 | 3300006195 | Bacteria | 937 |
| 412 | Ga0075366_10469892 | 3300006195 | Bacteria | 777 |
| 413 | Ga0075366_10507801 | 3300006195 | Bacteria | 745 |
| 414 | Ga0075366_10965137 | 3300006195 | Bacteria | 531 |
| 415 | Ga0097621_100115517 | 3300006237 | Bacteria | 2272 |
| 416 | Ga0097621_100139427 | 3300006237 | Bacteria | 2071 |
| 417 | Ga0097621_100480099 | 3300006237 | Bacteria | 1123 |
| 418 | Ga0097621_100512914 | 3300006237 | Bacteria | 1087 |
| 419 | Ga0097621_100662626 | 3300006237 | Bacteria | 958 |
| 420 | Ga0097621_100944722 | 3300006237 | Bacteria | 805 |
| 421 | Ga0075370_10001150 | 3300006353 | Bacteria | 11110 |
| 422 | Ga0075370_10023630 | 3300006353 | Bacteria | 3387 |
| 423 | Ga0075370_10064344 | 3300006353 | Bacteria | 2091 |
| 424 | Ga0068871_100126623 | 3300006358 | Bacteria | 2162 |
| 425 | Ga0068871_100221491 | 3300006358 | Bacteria | 1639 |
| 426 | Ga0068871_100408440 | 3300006358 | Bacteria | 1210 |
| 427 | Ga0068871_100453812 | 3300006358 | Bacteria | 1149 |
| 428 | Ga0068871_100540442 | 3300006358 | Bacteria | 1054 |
| 429 | Ga0068871_100982475 | 3300006358 | Bacteria | 785 |
| 430 | Ga0075428_100000808 | 3300006844 | Bacteria | 32725 |
| 431 | Ga0075430_100218759 | 3300006846 | Bacteria | 1580 |
| 432 | Ga0075430_100233239 | 3300006846 | Bacteria | 1526 |
| 433 | Ga0075430_100302039 | 3300006846 | Bacteria | 1324 |
| 434 | Ga0075434_100381290 | 3300006871 | Bacteria | 1431 |
| 435 | Ga0075434_100441455 | 3300006871 | Bacteria | 1323 |
| 436 | Ga0075434_100855539 | 3300006871 | Bacteria | 925 |
| 437 | Ga0075429_100034628 | 3300006880 | Bacteria | 4388 |
| 438 | Ga0075429_100043701 | 3300006880 | Bacteria | 3899 |
| 439 | Ga0075429_100123917 | 3300006880 | Bacteria | 2259 |
| 440 | Ga0068865_100004060 | 3300006881 | Bacteria | 8794 |
| 441 | Ga0068865_100647903 | 3300006881 | Bacteria | 897 |
| 442 | Ga0068865_100882343 | 3300006881 | Bacteria | 777 |
| 443 | Ga0068865_101254167 | 3300006881 | Bacteria | 658 |
| 444 | Ga0075436_100000862 | 3300006914 | Bacteria | 20155 |
| 445 | Ga0097620_100047018 | 3300006931 | Bacteria | 4334 |
| 446 | Ga0097620_100130185 | 3300006931 | Bacteria | 2587 |
| 447 | Ga0097620_100627282 | 3300006931 | Bacteria | 1167 |
| 448 | Ga0097620_100701492 | 3300006931 | Bacteria | 1103 |
| 449 | Ga0097620_100794090 | 3300006931 | Bacteria | 1034 |
| 450 | Ga0097620_100993489 | 3300006931 | Bacteria | 921 |
| 451 | Ga0097620_101730416 | 3300006931 | Bacteria | 691 |
| 452 | Ga0099826_10000024 | 3300006948 | Bacteria | 148974 |
| 453 | Ga0075435_100054923 | 3300007076 | Bacteria | 3215 |
| 454 | Ga0105251_10023641 | 3300009011 | Bacteria | 3167 |
| 455 | Ga0105244_10533668 | 3300009036 | Bacteria | 541 |
| 456 | Ga0105240_10230108 | 3300009093 | Bacteria | 2155 |
| 457 | Ga0105240_10627271 | 3300009093 | Bacteria | 1181 |
| 458 | Ga0105240_11610931 | 3300009093 | Bacteria | 679 |
| 459 | Ga0111539_10002099 | 3300009094 | Bacteria | 26631 |
| 460 | Ga0111539_10529840 | 3300009094 | Bacteria | 1372 |
| 461 | Ga0111539_11140813 | 3300009094 | Bacteria | 906 |
| 462 | Ga0111539_11150091 | 3300009094 | Bacteria | 902 |
| 463 | Ga0111539_11374449 | 3300009094 | Bacteria | 819 |
| 464 | Ga0111539_11423128 | 3300009094 | Bacteria | 804 |
| 465 | Ga0111539_11738195 | 3300009094 | Bacteria | 723 |
| 466 | Ga0111539_12219808 | 3300009094 | Bacteria | 637 |
| 467 | Ga0105245_10300472 | 3300009098 | Bacteria | 1575 |
| 468 | Ga0105245_10397024 | 3300009098 | Bacteria | 1377 |
| 469 | Ga0105245_10973459 | 3300009098 | Bacteria | 892 |
| 470 | Ga0105245_12137730 | 3300009098 | Bacteria | 613 |
| 471 | Ga0105247_10117961 | 3300009101 | Bacteria | 1716 |
| 472 | Ga0105247_10250972 | 3300009101 | Bacteria | 1209 |
| 473 | Ga0114129_10778086 | 3300009147 | Bacteria | 1223 |
| 474 | Ga0114129_10804073 | 3300009147 | Bacteria | 1199 |
| 475 | Ga0105243_10001789 | 3300009148 | Bacteria | 18454 |
| 476 | Ga0105243_10177569 | 3300009148 | Bacteria | 1849 |
| 477 | Ga0105243_10194189 | 3300009148 | Bacteria | 1775 |
| 478 | Ga0105243_10230579 | 3300009148 | Bacteria | 1643 |
| 479 | Ga0105243_10387979 | 3300009148 | Bacteria | 1294 |
| 480 | Ga0105243_10913307 | 3300009148 | Bacteria | 874 |
| 481 | Ga0105243_11520960 | 3300009148 | Bacteria | 693 |
| 482 | Ga0105243_11762942 | 3300009148 | Bacteria | 649 |
| 483 | Ga0105241_10082907 | 3300009174 | Bacteria | 2514 |
| 484 | Ga0105242_10059064 | 3300009176 | Bacteria | 3146 |
| 485 | Ga0105242_10090242 | 3300009176 | Bacteria | 2577 |
| 486 | Ga0105242_12014288 | 3300009176 | Bacteria | 620 |
| 487 | Ga0105248_10028458 | 3300009177 | Bacteria | 6225 |
| 488 | Ga0105248_10047589 | 3300009177 | Bacteria | 4810 |
| 489 | Ga0105248_10208334 | 3300009177 | Bacteria | 2203 |
| 490 | Ga0105248_10511830 | 3300009177 | Bacteria | 1353 |
| 491 | Ga0105248_10531205 | 3300009177 | Bacteria | 1327 |
| 492 | Ga0105248_10542893 | 3300009177 | Bacteria | 1311 |
| 493 | Ga0105248_11419336 | 3300009177 | Bacteria | 786 |
| 494 | Ga0105248_12022369 | 3300009177 | Bacteria | 655 |
| 495 | Ga0105237_10020609 | 3300009545 | Bacteria | 6794 |
| 496 | Ga0105237_10393453 | 3300009545 | Bacteria | 1391 |
| 497 | Ga0105237_12755999 | 3300009545 | Bacteria | 503 |
| 498 | Ga0105238_10064333 | 3300009551 | Bacteria | 3668 |
| 499 | Ga0105238_10951806 | 3300009551 | Bacteria | 878 |
| 500 | Ga0105238_11583629 | 3300009551 | Bacteria | 685 |
| 501 | Ga0105249_10309743 | 3300009553 | Bacteria | 1587 |
| 502 | Ga0105249_10484018 | 3300009553 | Bacteria | 1281 |
| 503 | Ga0105249_10993164 | 3300009553 | Bacteria | 908 |
| 504 | Ga0105239_10444502 | 3300010375 | Bacteria | 1470 |
| 505 | Ga0105239_10557327 | 3300010375 | Unclassified | 1305 |
| 506 | Ga0105239_11816629 | 3300010375 | Bacteria | 706 |
| 507 | Ga0105246_10452402 | 3300011119 | Bacteria | 1079 |
| 508 | Ga0105246_10873656 | 3300011119 | Bacteria | 804 |
| 509 | Ga0105246_10919730 | 3300011119 | Bacteria | 786 |
| 510 | Ga0105246_10963508 | 3300011119 | Bacteria | 770 |
| 511 | Ga0157317_1014804 | 3300012475 | Bacteria | 642 |
| 512 | Ga0157328_1000557 | 3300012478 | Bacteria | 1382 |
| 513 | Ga0157318_1012036 | 3300012482 | Bacteria | 662 |
| 514 | Ga0157341_1001034 | 3300012494 | Bacteria | 1580 |
| 515 | Ga0157345_1013061 | 3300012498 | Bacteria | 759 |
| 516 | Ga0157314_1004276 | 3300012500 | Bacteria | 1045 |
| 517 | Ga0157313_1006133 | 3300012503 | Bacteria | 893 |
| 518 | Ga0157342_1044135 | 3300012507 | Bacteria | 606 |
| 519 | Ga0157315_1018239 | 3300012508 | Bacteria | 714 |
| 520 | Ga0157327_1001789 | 3300012512 | Bacteria | 1398 |
| 521 | Ga0157373_10040286 | 3300013100 | Bacteria | 3343 |
| 522 | Ga0157373_10230096 | 3300013100 | Bacteria | 1309 |
| 523 | Ga0157371_10020143 | 3300013102 | Bacteria | 4909 |
| 524 | Ga0157370_10299273 | 3300013104 | Bacteria | 1485 |
| 525 | Ga0157370_11085771 | 3300013104 | Bacteria | 723 |
| 526 | Ga0157369_10115967 | 3300013105 | Bacteria | 2844 |
| 527 | Ga0157369_10254222 | 3300013105 | Bacteria | 1833 |
| 528 | Ga0157369_11576446 | 3300013105 | Bacteria | 668 |
| 529 | Ga0157374_10009298 | 3300013296 | Bacteria | 8429 |
| 530 | Ga0157374_10039033 | 3300013296 | Bacteria | 4368 |
| 531 | Ga0157374_10093529 | 3300013296 | Bacteria | 2871 |
| 532 | Ga0157374_10183964 | 3300013296 | Bacteria | 2042 |
| 533 | Ga0157374_10261841 | 3300013296 | Bacteria | 1703 |
| 534 | Ga0157374_10684056 | 3300013296 | Bacteria | 1038 |
| 535 | Ga0157378_10008661 | 3300013297 | Bacteria | 8856 |
| 536 | Ga0157378_10248653 | 3300013297 | Bacteria | 1701 |
| 537 | Ga0157378_10328899 | 3300013297 | Bacteria | 1487 |
| 538 | Ga0157378_10415154 | 3300013297 | Bacteria | 1329 |
| 539 | Ga0157378_10458589 | 3300013297 | Bacteria | 1266 |
| 540 | Ga0157378_10477084 | 3300013297 | Bacteria | 1242 |
| 541 | Ga0157378_10478068 | 3300013297 | Bacteria | 1241 |
| 542 | Ga0157378_12237547 | 3300013297 | Bacteria | 598 |
| 543 | Ga0163162_10004148 | 3300013306 | Bacteria | 13915 |
| 544 | Ga0163162_10033165 | 3300013306 | Bacteria | 5130 |
| 545 | Ga0163162_10211873 | 3300013306 | Bacteria | 2067 |
| 546 | Ga0163162_10241802 | 3300013306 | Bacteria | 1936 |
| 547 | Ga0163162_10424477 | 3300013306 | Bacteria | 1462 |
| 548 | Ga0163162_10491825 | 3300013306 | Bacteria | 1358 |
| 549 | Ga0163162_10646134 | 3300013306 | Bacteria | 1182 |
| 550 | Ga0163162_11021846 | 3300013306 | Bacteria | 935 |
| 551 | Ga0157372_10023087 | 3300013307 | Bacteria | 6740 |
| 552 | Ga0157372_10549579 | 3300013307 | Bacteria | 1346 |
| 553 | Ga0157372_11041560 | 3300013307 | Bacteria | 947 |
| 554 | Ga0157375_10026295 | 3300013308 | Bacteria | 5420 |
| 555 | Ga0157375_10041626 | 3300013308 | Bacteria | 4438 |
| 556 | Ga0157375_10054039 | 3300013308 | Bacteria | 3954 |
| 557 | Ga0157375_10151438 | 3300013308 | Bacteria | 2455 |
| 558 | Ga0157375_10225576 | 3300013308 | Bacteria | 2033 |
| 559 | Ga0157375_10239233 | 3300013308 | Bacteria | 1975 |
| 560 | Ga0157375_10240286 | 3300013308 | Bacteria | 1971 |
| 561 | Ga0157375_10250739 | 3300013308 | Bacteria | 1931 |
| 562 | Ga0157375_10493225 | 3300013308 | Bacteria | 1389 |
| 563 | Ga0157375_10545902 | 3300013308 | Bacteria | 1321 |
| 564 | Ga0157375_11614891 | 3300013308 | Bacteria | 767 |
| 565 | Ga0163163_10098438 | 3300014325 | Bacteria | 2946 |
| 566 | Ga0163163_10176222 | 3300014325 | Bacteria | 2185 |
| 567 | Ga0163163_10404151 | 3300014325 | Bacteria | 1424 |
| 568 | Ga0163163_10652447 | 3300014325 | Bacteria | 1116 |
| 569 | Ga0163163_10733157 | 3300014325 | Bacteria | 1052 |
| 570 | Ga0163163_10975385 | 3300014325 | Bacteria | 911 |
| 571 | Ga0157380_10205210 | 3300014326 | Bacteria | 1752 |
| 572 | Ga0157380_10220567 | 3300014326 | Bacteria | 1696 |
| 573 | Ga0157380_10534216 | 3300014326 | Bacteria | 1147 |
| 574 | Ga0157380_11328546 | 3300014326 | Bacteria | 767 |
| 575 | Ga0182008_10034449 | 3300014497 | Bacteria | 2538 |
| 576 | Ga0182008_10334392 | 3300014497 | Bacteria | 800 |
| 577 | Ga0157377_10000368 | 3300014745 | Bacteria | 20109 |
| 578 | Ga0157377_10396808 | 3300014745 | Bacteria | 938 |
| 579 | Ga0157379_10037733 | 3300014968 | Bacteria | 4309 |
| 580 | Ga0157379_10040412 | 3300014968 | Bacteria | 4162 |
| 581 | Ga0157379_10061342 | 3300014968 | Bacteria | 3362 |
| 582 | Ga0157379_10090060 | 3300014968 | Bacteria | 2752 |
| 583 | Ga0157379_10251368 | 3300014968 | Bacteria | 1605 |
| 584 | Ga0157379_10728786 | 3300014968 | Bacteria | 932 |
| 585 | Ga0157379_10958172 | 3300014968 | Bacteria | 814 |
| 586 | Ga0157379_11369269 | 3300014968 | Bacteria | 685 |
| 587 | Ga0157379_12031019 | 3300014968 | Bacteria | 569 |
| 588 | Ga0157376_10085443 | 3300014969 | Bacteria | 2719 |
| 589 | Ga0157376_10957460 | 3300014969 | Bacteria | 877 |
| 590 | Ga0157376_10983337 | 3300014969 | Bacteria | 866 |
| 591 | Ga0157376_11269830 | 3300014969 | Bacteria | 766 |
| 592 | Ga0157376_13087901 | 3300014969 | Bacteria | 504 |
| 593 | Ga0182007_10061846 | 3300015262 | Bacteria | 1228 |
| 594 | Ga0163161_10009049 | 3300017792 | Bacteria | 6888 |
| 595 | Ga0163161_10021239 | 3300017792 | Bacteria | 4564 |
| 596 | Ga0163161_10042621 | 3300017792 | Bacteria | 3265 |
| 597 | Ga0163161_10057420 | 3300017792 | Bacteria | 2828 |
| 598 | Ga0163161_10378130 | 3300017792 | Bacteria | 1131 |
| 599 | Ga0163161_11431780 | 3300017792 | Bacteria | 604 |
| 600 | Ga0206353_11953414 | 3300020082 | Bacteria | 794 |
| 601 | Ga0213872_10000672 | 3300021361 | Bacteria | 25868 |
| 602 | Ga0213874_10021138 | 3300021377 | Bacteria | 1791 |
| 603 | Ga0213874_10078842 | 3300021377 | Bacteria | 1064 |
| 604 | Ga0207425_1000680 | 3300025245 | Bacteria | 18554 |
| 605 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 606 | Ga0209673_1004093 | 3300025273 | Bacteria | 8026 |
| 607 | Ga0209673_1032334 | 3300025273 | Bacteria | 1613 |
| 608 | Ga0207673_1016945 | 3300025290 | Bacteria | 971 |
| 609 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 610 | Ga0209758_1000910 | 3300025297 | Bacteria | 40059 |
| 611 | Ga0209758_1011080 | 3300025297 | Bacteria | 5275 |
| 612 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 613 | Ga0209256_1009680 | 3300025299 | Bacteria | 4174 |
| 614 | Ga0209051_1018074 | 3300025303 | Bacteria | 3132 |
| 615 | Ga0207697_10011122 | 3300025315 | Bacteria | 3814 |
| 616 | Ga0207697_10027047 | 3300025315 | Bacteria | 2346 |
| 617 | Ga0207697_10029574 | 3300025315 | Bacteria | 2242 |
| 618 | Ga0207656_10100216 | 3300025321 | Bacteria | 1327 |
| 619 | Ga0207656_10182284 | 3300025321 | Bacteria | 1008 |
| 620 | Ga0207713_1023386 | 3300025735 | Bacteria | 2909 |
| 621 | Ga0207653_10294067 | 3300025885 | Bacteria | 629 |
| 622 | Ga0207682_10002147 | 3300025893 | Bacteria | 8941 |
| 623 | Ga0207682_10021887 | 3300025893 | Bacteria | 2516 |
| 624 | Ga0207682_10077687 | 3300025893 | Bacteria | 1417 |
| 625 | Ga0207682_10277013 | 3300025893 | Bacteria | 784 |
| 626 | Ga0207682_10432489 | 3300025893 | Bacteria | 623 |
| 627 | Ga0207692_10217960 | 3300025898 | Bacteria | 1130 |
| 628 | Ga0207642_10092854 | 3300025899 | Bacteria | 1495 |
| 629 | Ga0207642_10108364 | 3300025899 | Bacteria | 1409 |
| 630 | Ga0207642_10492183 | 3300025899 | Bacteria | 749 |
| 631 | Ga0207642_11028319 | 3300025899 | Bacteria | 531 |
| 632 | Ga0207710_10306473 | 3300025900 | Bacteria | 803 |
| 633 | Ga0207688_10037622 | 3300025901 | Bacteria | 2684 |
| 634 | Ga0207688_10063302 | 3300025901 | Bacteria | 2086 |
| 635 | Ga0207688_10077775 | 3300025901 | Bacteria | 1891 |
| 636 | Ga0207688_10144333 | 3300025901 | Bacteria | 1402 |
| 637 | Ga0207688_10231679 | 3300025901 | Bacteria | 1115 |
| 638 | Ga0207680_10187572 | 3300025903 | Bacteria | 1402 |
| 639 | Ga0207680_10257091 | 3300025903 | Bacteria | 1208 |
| 640 | Ga0207680_10353603 | 3300025903 | Bacteria | 1032 |
| 641 | Ga0207680_10645731 | 3300025903 | Bacteria | 758 |
| 642 | Ga0207680_10957317 | 3300025903 | Bacteria | 613 |
| 643 | Ga0207685_10158287 | 3300025905 | Bacteria | 1032 |
| 644 | Ga0207685_10675810 | 3300025905 | Bacteria | 560 |
| 645 | Ga0207645_10009972 | 3300025907 | Bacteria | 6544 |
| 646 | Ga0207645_10012543 | 3300025907 | Bacteria | 5748 |
| 647 | Ga0207645_10027678 | 3300025907 | Bacteria | 3659 |
| 648 | Ga0207645_10047232 | 3300025907 | Bacteria | 2749 |
| 649 | Ga0207645_10048474 | 3300025907 | Bacteria | 2713 |
| 650 | Ga0207645_10086402 | 3300025907 | Bacteria | 2015 |
| 651 | Ga0207645_10139657 | 3300025907 | Bacteria | 1578 |
| 652 | Ga0207645_10301667 | 3300025907 | Bacteria | 1067 |
| 653 | Ga0207645_10880985 | 3300025907 | Bacteria | 608 |
| 654 | Ga0207643_10070432 | 3300025908 | Bacteria | 2011 |
| 655 | Ga0207643_10697330 | 3300025908 | Bacteria | 656 |
| 656 | Ga0207643_10876353 | 3300025908 | Bacteria | 582 |
| 657 | Ga0207643_11141960 | 3300025908 | Bacteria | 502 |
| 658 | Ga0207705_10812019 | 3300025909 | Bacteria | 726 |
| 659 | Ga0207705_11234190 | 3300025909 | Bacteria | 573 |
| 660 | Ga0207705_11441062 | 3300025909 | Bacteria | 523 |
| 661 | Ga0207684_10500490 | 3300025910 | Bacteria | 1041 |
| 662 | Ga0207684_10803308 | 3300025910 | Bacteria | 795 |
| 663 | Ga0207654_10442697 | 3300025911 | Bacteria | 910 |
| 664 | Ga0207671_10730804 | 3300025914 | Bacteria | 787 |
| 665 | Ga0207693_10536869 | 3300025915 | Bacteria | 912 |
| 666 | Ga0207663_10369763 | 3300025916 | Bacteria | 1090 |
| 667 | Ga0207660_10046145 | 3300025917 | Bacteria | 3073 |
| 668 | Ga0207662_10034330 | 3300025918 | Bacteria | 2960 |
| 669 | Ga0207662_10036401 | 3300025918 | Bacteria | 2876 |
| 670 | Ga0207662_10097784 | 3300025918 | Bacteria | 1815 |
| 671 | Ga0207662_10201054 | 3300025918 | Bacteria | 1290 |
| 672 | Ga0207657_10092779 | 3300025919 | Bacteria | 2516 |
| 673 | Ga0207657_10109580 | 3300025919 | Bacteria | 2282 |
| 674 | Ga0207657_10218405 | 3300025919 | Bacteria | 1528 |
| 675 | Ga0207649_10004699 | 3300025920 | Bacteria | 7389 |
| 676 | Ga0207649_10183146 | 3300025920 | Bacteria | 1467 |
| 677 | Ga0207652_10002940 | 3300025921 | Bacteria | 14249 |
| 678 | Ga0207652_11225289 | 3300025921 | Bacteria | 652 |
| 679 | Ga0207681_10005925 | 3300025923 | Bacteria | 7494 |
| 680 | Ga0207681_10021332 | 3300025923 | Bacteria | 4116 |
| 681 | Ga0207681_10041280 | 3300025923 | Bacteria | 3075 |
| 682 | Ga0207681_10071603 | 3300025923 | Bacteria | 2418 |
| 683 | Ga0207681_10111387 | 3300025923 | Bacteria | 1991 |
| 684 | Ga0207681_10901391 | 3300025923 | Bacteria | 740 |
| 685 | Ga0207694_10034844 | 3300025924 | Bacteria | 3861 |
| 686 | Ga0207694_10452972 | 3300025924 | Bacteria | 1071 |
| 687 | Ga0207694_10505280 | 3300025924 | Bacteria | 1012 |
| 688 | Ga0207694_10688670 | 3300025924 | Bacteria | 862 |
| 689 | Ga0207650_10002454 | 3300025925 | Bacteria | 12900 |
| 690 | Ga0207650_10022053 | 3300025925 | Bacteria | 4507 |
| 691 | Ga0207650_10054455 | 3300025925 | Bacteria | 2967 |
| 692 | Ga0207650_10387104 | 3300025925 | Bacteria | 1155 |
| 693 | Ga0207650_10640715 | 3300025925 | Bacteria | 895 |
| 694 | Ga0207650_10727506 | 3300025925 | Bacteria | 839 |
| 695 | Ga0207659_10003025 | 3300025926 | Bacteria | 10030 |
| 696 | Ga0207659_10052760 | 3300025926 | Bacteria | 2898 |
| 697 | Ga0207659_10056531 | 3300025926 | Bacteria | 2811 |
| 698 | Ga0207659_10061691 | 3300025926 | Bacteria | 2703 |
| 699 | Ga0207659_10142255 | 3300025926 | Bacteria | 1863 |
| 700 | Ga0207659_11013374 | 3300025926 | Bacteria | 714 |
| 701 | Ga0207687_10108511 | 3300025927 | Bacteria | 2055 |
| 702 | Ga0207687_10753634 | 3300025927 | Bacteria | 829 |
| 703 | Ga0207644_10027492 | 3300025931 | Bacteria | 3929 |
| 704 | Ga0207644_10118657 | 3300025931 | Bacteria | 2010 |
| 705 | Ga0207644_10151897 | 3300025931 | Bacteria | 1792 |
| 706 | Ga0207644_10184530 | 3300025931 | Bacteria | 1637 |
| 707 | Ga0207644_10256867 | 3300025931 | Bacteria | 1396 |
| 708 | Ga0207644_10258810 | 3300025931 | Bacteria | 1391 |
| 709 | Ga0207644_10388082 | 3300025931 | Bacteria | 1140 |
| 710 | Ga0207644_10639011 | 3300025931 | Bacteria | 885 |
| 711 | Ga0207644_11256548 | 3300025931 | Bacteria | 622 |
| 712 | Ga0207690_10056794 | 3300025932 | Bacteria | 2642 |
| 713 | Ga0207690_10791310 | 3300025932 | Bacteria | 783 |
| 714 | Ga0207690_11306269 | 3300025932 | Bacteria | 606 |
| 715 | Ga0207706_10035361 | 3300025933 | Bacteria | 4443 |
| 716 | Ga0207706_10079225 | 3300025933 | Bacteria | 2889 |
| 717 | Ga0207706_10375437 | 3300025933 | Bacteria | 1234 |
| 718 | Ga0207706_10595316 | 3300025933 | Bacteria | 950 |
| 719 | Ga0207706_10597721 | 3300025933 | Bacteria | 948 |
| 720 | Ga0207706_11166811 | 3300025933 | Bacteria | 641 |
| 721 | Ga0207686_10048318 | 3300025934 | Bacteria | 2635 |
| 722 | Ga0207686_10050824 | 3300025934 | Bacteria | 2580 |
| 723 | Ga0207686_10072816 | 3300025934 | Bacteria | 2215 |
| 724 | Ga0207686_10255208 | 3300025934 | Bacteria | 1283 |
| 725 | Ga0207709_10001005 | 3300025935 | Bacteria | 20902 |
| 726 | Ga0207709_10020689 | 3300025935 | Bacteria | 3715 |
| 727 | Ga0207709_10146045 | 3300025935 | Bacteria | 1632 |
| 728 | Ga0207709_10431056 | 3300025935 | Bacteria | 1015 |
| 729 | Ga0207670_10450600 | 3300025936 | Bacteria | 1037 |
| 730 | Ga0207670_11438900 | 3300025936 | Bacteria | 585 |
| 731 | Ga0207670_11564474 | 3300025936 | Bacteria | 561 |
| 732 | Ga0207669_10027395 | 3300025937 | Bacteria | 3119 |
| 733 | Ga0207669_10068174 | 3300025937 | Bacteria | 2220 |
| 734 | Ga0207669_10093241 | 3300025937 | Bacteria | 1967 |
| 735 | Ga0207669_10124757 | 3300025937 | Bacteria | 1756 |
| 736 | Ga0207669_10367135 | 3300025937 | Bacteria | 1117 |
| 737 | Ga0207669_10527251 | 3300025937 | Bacteria | 949 |
| 738 | Ga0207669_10835859 | 3300025937 | Bacteria | 765 |
| 739 | Ga0207669_11153017 | 3300025937 | Bacteria | 655 |
| 740 | Ga0207669_11346721 | 3300025937 | Bacteria | 607 |
| 741 | Ga0207704_10474258 | 3300025938 | Bacteria | 1003 |
| 742 | Ga0207704_10660232 | 3300025938 | Bacteria | 862 |
| 743 | Ga0207704_11151269 | 3300025938 | Bacteria | 660 |
| 744 | Ga0207665_10131977 | 3300025939 | Bacteria | 1774 |
| 745 | Ga0207665_10452521 | 3300025939 | Bacteria | 985 |
| 746 | Ga0207691_10002550 | 3300025940 | Bacteria | 17799 |
| 747 | Ga0207691_10071477 | 3300025940 | Bacteria | 3131 |
| 748 | Ga0207691_10104939 | 3300025940 | Bacteria | 2518 |
| 749 | Ga0207691_10126451 | 3300025940 | Bacteria | 2261 |
| 750 | Ga0207691_10214431 | 3300025940 | Bacteria | 1671 |
| 751 | Ga0207691_10216133 | 3300025940 | Bacteria | 1663 |
| 752 | Ga0207691_10242604 | 3300025940 | Bacteria | 1557 |
| 753 | Ga0207691_10821521 | 3300025940 | Bacteria | 780 |
| 754 | Ga0207691_11185143 | 3300025940 | Bacteria | 634 |
| 755 | Ga0207711_10023140 | 3300025941 | Bacteria | 5200 |
| 756 | Ga0207711_10072285 | 3300025941 | Bacteria | 2996 |
| 757 | Ga0207711_10471526 | 3300025941 | Bacteria | 1169 |
| 758 | Ga0207711_10950482 | 3300025941 | Bacteria | 798 |
| 759 | Ga0207711_11309585 | 3300025941 | Bacteria | 667 |
| 760 | Ga0207689_10033146 | 3300025942 | Bacteria | 4292 |
| 761 | Ga0207689_10038004 | 3300025942 | Bacteria | 3989 |
| 762 | Ga0207689_10117050 | 3300025942 | Bacteria | 2191 |
| 763 | Ga0207689_10127570 | 3300025942 | Bacteria | 2092 |
| 764 | Ga0207689_10232116 | 3300025942 | Bacteria | 1525 |
| 765 | Ga0207689_10684752 | 3300025942 | Bacteria | 864 |
| 766 | Ga0207689_10711450 | 3300025942 | Bacteria | 847 |
| 767 | Ga0207689_10764762 | 3300025942 | Bacteria | 815 |
| 768 | Ga0207689_10776336 | 3300025942 | Bacteria | 809 |
| 769 | Ga0207689_11600848 | 3300025942 | Bacteria | 542 |
| 770 | Ga0207661_10026944 | 3300025944 | Bacteria | 4386 |
| 771 | Ga0207679_10016048 | 3300025945 | Bacteria | 4965 |
| 772 | Ga0207679_10127063 | 3300025945 | Bacteria | 2039 |
| 773 | Ga0207679_10449730 | 3300025945 | Bacteria | 1142 |
| 774 | Ga0207679_10953006 | 3300025945 | Bacteria | 786 |
| 775 | Ga0207679_11307681 | 3300025945 | Bacteria | 665 |
| 776 | Ga0207667_10188077 | 3300025949 | Bacteria | 2119 |
| 777 | Ga0207667_10246512 | 3300025949 | Bacteria | 1828 |
| 778 | Ga0207651_10004839 | 3300025960 | Bacteria | 6859 |
| 779 | Ga0207651_10043195 | 3300025960 | Bacteria | 3006 |
| 780 | Ga0207651_10049602 | 3300025960 | Bacteria | 2845 |
| 781 | Ga0207651_10063480 | 3300025960 | Bacteria | 2579 |
| 782 | Ga0207651_10092035 | 3300025960 | Bacteria | 2222 |
| 783 | Ga0207651_10247449 | 3300025960 | Bacteria | 1457 |
| 784 | Ga0207651_10274919 | 3300025960 | Bacteria | 1389 |
| 785 | Ga0207651_10307666 | 3300025960 | Bacteria | 1320 |
| 786 | Ga0207651_10352293 | 3300025960 | Bacteria | 1240 |
| 787 | Ga0207712_10040645 | 3300025961 | Bacteria | 3193 |
| 788 | Ga0207712_10063392 | 3300025961 | Bacteria | 2632 |
| 789 | Ga0207712_10258983 | 3300025961 | Bacteria | 1410 |
| 790 | Ga0207712_10976782 | 3300025961 | Bacteria | 751 |
| 791 | Ga0207668_10008000 | 3300025972 | Bacteria | 6291 |
| 792 | Ga0207668_10053760 | 3300025972 | Bacteria | 2792 |
| 793 | Ga0207668_10264120 | 3300025972 | Bacteria | 1404 |
| 794 | Ga0207668_10332527 | 3300025972 | Bacteria | 1264 |
| 795 | Ga0207668_10498202 | 3300025972 | Bacteria | 1047 |
| 796 | Ga0207640_10014813 | 3300025981 | Bacteria | 4497 |
| 797 | Ga0207640_10146361 | 3300025981 | Bacteria | 1729 |
| 798 | Ga0207640_10361518 | 3300025981 | Bacteria | 1170 |
| 799 | Ga0207640_10739392 | 3300025981 | Bacteria | 847 |
| 800 | Ga0207640_11342870 | 3300025981 | Bacteria | 639 |
| 801 | Ga0207640_11422139 | 3300025981 | Bacteria | 622 |
| 802 | Ga0207658_10002481 | 3300025986 | Bacteria | 13444 |
| 803 | Ga0207658_10019932 | 3300025986 | Bacteria | 4641 |
| 804 | Ga0207658_10059878 | 3300025986 | Bacteria | 2839 |
| 805 | Ga0207658_10174279 | 3300025986 | Bacteria | 1775 |
| 806 | Ga0207658_10204295 | 3300025986 | Bacteria | 1651 |
| 807 | Ga0207658_10253878 | 3300025986 | Bacteria | 1495 |
| 808 | Ga0207658_10823380 | 3300025986 | Bacteria | 843 |
| 809 | Ga0207658_11440281 | 3300025986 | Bacteria | 630 |
| 810 | Ga0207677_10222318 | 3300026023 | Bacteria | 1515 |
| 811 | Ga0207677_10493235 | 3300026023 | Bacteria | 1057 |
| 812 | Ga0207677_10597666 | 3300026023 | Bacteria | 968 |
| 813 | Ga0207677_10762614 | 3300026023 | Bacteria | 863 |
| 814 | Ga0207677_11440248 | 3300026023 | Bacteria | 635 |
| 815 | Ga0207677_11845572 | 3300026023 | Bacteria | 561 |
| 816 | Ga0207703_10002613 | 3300026035 | Bacteria | 15539 |
| 817 | Ga0207703_10027342 | 3300026035 | Bacteria | 4492 |
| 818 | Ga0207703_10139551 | 3300026035 | Bacteria | 2102 |
| 819 | Ga0207703_10590706 | 3300026035 | Bacteria | 1050 |
| 820 | Ga0207703_11346177 | 3300026035 | Bacteria | 687 |
| 821 | Ga0207639_10460001 | 3300026041 | Bacteria | 1157 |
| 822 | Ga0207639_10601595 | 3300026041 | Bacteria | 1014 |
| 823 | Ga0207678_10008286 | 3300026067 | Bacteria | 9159 |
| 824 | Ga0207678_10090610 | 3300026067 | Bacteria | 2613 |
| 825 | Ga0207678_10099481 | 3300026067 | Bacteria | 2484 |
| 826 | Ga0207678_10230487 | 3300026067 | Bacteria | 1586 |
| 827 | Ga0207678_10696626 | 3300026067 | Bacteria | 894 |
| 828 | Ga0207678_10876259 | 3300026067 | Bacteria | 793 |
| 829 | Ga0207678_11995843 | 3300026067 | Bacteria | 505 |
| 830 | Ga0207708_10036414 | 3300026075 | Bacteria | 3746 |
| 831 | Ga0207708_10154972 | 3300026075 | Bacteria | 1806 |
| 832 | Ga0207708_10168085 | 3300026075 | Bacteria | 1735 |
| 833 | Ga0207708_10175723 | 3300026075 | Bacteria | 1698 |
| 834 | Ga0207702_10004993 | 3300026078 | Bacteria | 11656 |
| 835 | Ga0207702_10150760 | 3300026078 | Bacteria | 2115 |
| 836 | Ga0207702_10429607 | 3300026078 | Bacteria | 1278 |
| 837 | Ga0207702_11220565 | 3300026078 | Bacteria | 746 |
| 838 | Ga0207641_10007438 | 3300026088 | Bacteria | 9110 |
| 839 | Ga0207641_10028453 | 3300026088 | Bacteria | 4618 |
| 840 | Ga0207641_10106203 | 3300026088 | Bacteria | 2481 |
| 841 | Ga0207641_10164506 | 3300026088 | Bacteria | 2019 |
| 842 | Ga0207641_10524581 | 3300026088 | Bacteria | 1152 |
| 843 | Ga0207641_10751729 | 3300026088 | Bacteria | 962 |
| 844 | Ga0207641_10850293 | 3300026088 | Bacteria | 904 |
| 845 | Ga0207641_10953814 | 3300026088 | Bacteria | 853 |
| 846 | Ga0207641_11293854 | 3300026088 | Bacteria | 729 |
| 847 | Ga0207648_10002176 | 3300026089 | Bacteria | 21281 |
| 848 | Ga0207648_10005939 | 3300026089 | Bacteria | 12211 |
| 849 | Ga0207648_10015751 | 3300026089 | Bacteria | 6936 |
| 850 | Ga0207648_10084574 | 3300026089 | Bacteria | 2767 |
| 851 | Ga0207648_10087281 | 3300026089 | Bacteria | 2722 |
| 852 | Ga0207648_10097294 | 3300026089 | Bacteria | 2576 |
| 853 | Ga0207648_10159685 | 3300026089 | Bacteria | 1991 |
| 854 | Ga0207648_10200666 | 3300026089 | Bacteria | 1769 |
| 855 | Ga0207648_10379894 | 3300026089 | Bacteria | 1277 |
| 856 | Ga0207648_10533699 | 3300026089 | Bacteria | 1076 |
| 857 | Ga0207648_10766947 | 3300026089 | Bacteria | 896 |
| 858 | Ga0207676_10005874 | 3300026095 | Bacteria | 8668 |
| 859 | Ga0207676_10038749 | 3300026095 | Bacteria | 3640 |
| 860 | Ga0207676_10083692 | 3300026095 | Bacteria | 2599 |
| 861 | Ga0207676_10095279 | 3300026095 | Bacteria | 2454 |
| 862 | Ga0207676_10467768 | 3300026095 | Bacteria | 1192 |
| 863 | Ga0207676_10680064 | 3300026095 | Bacteria | 995 |
| 864 | Ga0207676_11418800 | 3300026095 | Bacteria | 690 |
| 865 | Ga0207674_10158756 | 3300026116 | Bacteria | 2216 |
| 866 | Ga0207674_10171993 | 3300026116 | Bacteria | 2119 |
| 867 | Ga0207674_10522615 | 3300026116 | Bacteria | 1146 |
| 868 | Ga0207675_100006663 | 3300026118 | Bacteria | 10927 |
| 869 | Ga0207675_100166548 | 3300026118 | Bacteria | 2105 |
| 870 | Ga0207675_100255531 | 3300026118 | Bacteria | 1697 |
| 871 | Ga0207675_100263048 | 3300026118 | Bacteria | 1672 |
| 872 | Ga0207675_100264070 | 3300026118 | Bacteria | 1669 |
| 873 | Ga0207675_100314320 | 3300026118 | Bacteria | 1528 |
| 874 | Ga0207675_100373676 | 3300026118 | Bacteria | 1401 |
| 875 | Ga0207675_100375270 | 3300026118 | Bacteria | 1398 |
| 876 | Ga0207675_100537098 | 3300026118 | Bacteria | 1167 |
| 877 | Ga0207675_100632434 | 3300026118 | Bacteria | 1075 |
| 878 | Ga0207675_101729437 | 3300026118 | Bacteria | 645 |
| 879 | Ga0207683_10005923 | 3300026121 | Bacteria | 10474 |
| 880 | Ga0207683_10141534 | 3300026121 | Bacteria | 2168 |
| 881 | Ga0207683_10166036 | 3300026121 | Bacteria | 1997 |
| 882 | Ga0207683_10228474 | 3300026121 | Bacteria | 1697 |
| 883 | Ga0207683_10276638 | 3300026121 | Bacteria | 1534 |
| 884 | Ga0207683_10664863 | 3300026121 | Bacteria | 965 |
| 885 | Ga0207698_10137421 | 3300026142 | Bacteria | 2099 |
| 886 | Ga0207698_10171946 | 3300026142 | Bacteria | 1909 |
| 887 | Ga0207698_10790579 | 3300026142 | Bacteria | 950 |
| 888 | Ga0207698_11099288 | 3300026142 | Bacteria | 808 |
| 889 | Ga0207698_11280264 | 3300026142 | Bacteria | 748 |
| 890 | Ga0209967_1053814 | 3300027364 | Bacteria | 620 |
| 891 | Ga0209982_1051954 | 3300027552 | Bacteria | 661 |
| 892 | Ga0209970_1026685 | 3300027614 | Bacteria | 993 |
| 893 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 894 | Ga0209813_10158999 | 3300027866 | Bacteria | 814 |
| 895 | Ga0209974_10000149 | 3300027876 | Bacteria | 21195 |
| 896 | Ga0207428_10002412 | 3300027907 | Bacteria | 18661 |
| 897 | Ga0207428_10148534 | 3300027907 | Bacteria | 1785 |
| 898 | Ga0207428_10525240 | 3300027907 | Bacteria | 858 |
| 899 | Ga0207428_11140572 | 3300027907 | Bacteria | 544 |
| 900 | Ga0207428_11245660 | 3300027907 | Bacteria | 517 |
| 901 | Ga0268266_10013518 | 3300028379 | Bacteria | 7028 |
| 902 | Ga0268266_10165713 | 3300028379 | Bacteria | 2002 |
| 903 | Ga0268266_10248383 | 3300028379 | Bacteria | 1645 |
| 904 | Ga0268266_10427489 | 3300028379 | Bacteria | 1256 |
| 905 | Ga0268266_11187049 | 3300028379 | Bacteria | 738 |
| 906 | Ga0268266_11880327 | 3300028379 | Bacteria | 573 |
| 907 | Ga0268265_10048765 | 3300028380 | Bacteria | 3181 |
| 908 | Ga0268265_10076755 | 3300028380 | Bacteria | 2622 |
| 909 | Ga0268265_10144177 | 3300028380 | Bacteria | 1998 |
| 910 | Ga0268265_10186906 | 3300028380 | Bacteria | 1785 |
| 911 | Ga0268265_10241678 | 3300028380 | Bacteria | 1594 |
| 912 | Ga0268265_10832986 | 3300028380 | Bacteria | 901 |
| 913 | Ga0268265_11552378 | 3300028380 | Bacteria | 666 |
| 914 | Ga0268264_10002070 | 3300028381 | Bacteria | 17906 |
| 915 | Ga0268264_10002318 | 3300028381 | Bacteria | 16843 |
| 916 | Ga0268264_10053634 | 3300028381 | Bacteria | 3364 |
| 917 | Ga0268264_10085143 | 3300028381 | Bacteria | 2713 |
| 918 | Ga0268264_10510540 | 3300028381 | Bacteria | 1174 |
| 919 | Ga0268264_10944666 | 3300028381 | Bacteria | 867 |
| 920 | Ga0268264_11441364 | 3300028381 | Bacteria | 699 |
| 921 | Ga0268264_11726741 | 3300028381 | Bacteria | 636 |
| 922 | Ga0265334_10000005 | 3300028573 | Bacteria | 242590 |
| 923 | Ga0265336_10000618 | 3300028666 | Bacteria | 19547 |
| 924 | Ga0307517_10014561 | 3300028786 | Bacteria | 10553 |
| 925 | Ga0307517_10110559 | 3300028786 | Bacteria | 2094 |
| 926 | Ga0307515_10002443 | 3300028794 | Bacteria | 40478 |
| 927 | Ga0307515_10053115 | 3300028794 | Bacteria | 5987 |
| 928 | Ga0307515_10186828 | 3300028794 | Bacteria | 1998 |
| 929 | Ga0307515_10541499 | 3300028794 | Bacteria | 774 |
| 930 | Ga0307515_10675781 | 3300028794 | Bacteria | 647 |
| 931 | Ga0265338_10116506 | 3300028800 | Bacteria | 2140 |
| 932 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 933 | Ga0265324_10000500 | 3300029957 | Bacteria | 27131 |
| 934 | Ga0265324_10050377 | 3300029957 | Bacteria | 1431 |
| 935 | Ga0307511_10232578 | 3300030521 | Bacteria | 910 |
| 936 | Ga0307512_10045873 | 3300030522 | Bacteria | 3571 |
| 937 | Ga0307512_10091067 | 3300030522 | Bacteria | 2123 |
| 938 | Ga0307512_10098413 | 3300030522 | Bacteria | 1996 |
| 939 | Ga0265330_10024527 | 3300031235 | Bacteria | 2735 |
| 940 | Ga0265332_10000030 | 3300031238 | Bacteria | 175141 |
| 941 | Ga0265332_10001783 | 3300031238 | Bacteria | 11615 |
| 942 | Ga0265328_10000007 | 3300031239 | Bacteria | 224310 |
| 943 | Ga0265328_10020219 | 3300031239 | Bacteria | 2551 |
| 944 | Ga0265325_10001662 | 3300031241 | Bacteria | 15453 |
| 945 | Ga0265325_10008599 | 3300031241 | Bacteria | 6014 |
| 946 | Ga0265325_10057810 | 3300031241 | Bacteria | 1977 |
| 947 | Ga0265331_10000635 | 3300031250 | Bacteria | 30467 |
| 948 | Ga0265331_10070855 | 3300031250 | Bacteria | 1631 |
| 949 | Ga0265331_10140817 | 3300031250 | Bacteria | 1097 |
| 950 | Ga0265327_10031432 | 3300031251 | Bacteria | 2983 |
| 951 | Ga0265316_10021393 | 3300031344 | Bacteria | 5478 |
| 952 | Ga0265316_10163987 | 3300031344 | Bacteria | 1661 |
| 953 | Ga0265316_10446833 | 3300031344 | Bacteria | 927 |
| 954 | Ga0307513_10007825 | 3300031456 | Bacteria | 13780 |
| 955 | Ga0307513_10019109 | 3300031456 | Bacteria | 8167 |
| 956 | Ga0307513_10034953 | 3300031456 | Bacteria | 5631 |
| 957 | Ga0307513_10058418 | 3300031456 | Bacteria | 4100 |
| 958 | Ga0307513_10063852 | 3300031456 | Bacteria | 3884 |
| 959 | Ga0307513_10097095 | 3300031456 | Bacteria | 2982 |
| 960 | Ga0307513_10184235 | 3300031456 | Bacteria | 1947 |
| 961 | Ga0307513_10262845 | 3300031456 | Bacteria | 1514 |
| 962 | Ga0307513_10418258 | 3300031456 | Bacteria | 1071 |
| 963 | Ga0307509_10000050 | 3300031507 | Bacteria | 165692 |
| 964 | Ga0307509_10003616 | 3300031507 | Bacteria | 23221 |
| 965 | Ga0307509_10091388 | 3300031507 | Bacteria | 3115 |
| 966 | Ga0307509_10111735 | 3300031507 | Bacteria | 2734 |
| 967 | Ga0307509_10141229 | 3300031507 | Bacteria | 2343 |
| 968 | Ga0307509_10147814 | 3300031507 | Bacteria | 2271 |
| 969 | Ga0307509_10504506 | 3300031507 | Bacteria | 894 |
| 970 | Ga0307408_100178067 | 3300031548 | Bacteria | 1703 |
| 971 | Ga0307408_100186366 | 3300031548 | Bacteria | 1668 |
| 972 | Ga0307408_100193528 | 3300031548 | Bacteria | 1640 |
| 973 | Ga0307408_100260880 | 3300031548 | Bacteria | 1434 |
| 974 | Ga0307408_100469453 | 3300031548 | Bacteria | 1095 |
| 975 | Ga0307408_100492733 | 3300031548 | Bacteria | 1071 |
| 976 | Ga0307408_100519381 | 3300031548 | Bacteria | 1046 |
| 977 | Ga0307408_102277064 | 3300031548 | Bacteria | 524 |
| 978 | Ga0265313_10000014 | 3300031595 | Bacteria | 156295 |
| 979 | Ga0307508_10000392 | 3300031616 | Bacteria | 52650 |
| 980 | Ga0307508_10407074 | 3300031616 | Bacteria | 952 |
| 981 | Ga0307508_10537503 | 3300031616 | Bacteria | 766 |
| 982 | Ga0307514_10034392 | 3300031649 | Bacteria | 4039 |
| 983 | Ga0307514_10104256 | 3300031649 | Bacteria | 2029 |
| 984 | Ga0307514_10178976 | 3300031649 | Bacteria | 1370 |
| 985 | Ga0307514_10181649 | 3300031649 | Bacteria | 1355 |
| 986 | Ga0307514_10213346 | 3300031649 | Bacteria | 1195 |
| 987 | Ga0316575_10108836 | 3300031665 | Bacteria | 1130 |
| 988 | Ga0265314_10001521 | 3300031711 | Bacteria | 25613 |
| 989 | Ga0265314_10070955 | 3300031711 | Bacteria | 2332 |
| 990 | Ga0265314_10075432 | 3300031711 | Bacteria | 2243 |
| 991 | Ga0307516_10011689 | 3300031730 | Bacteria | 9527 |
| 992 | Ga0307516_10019197 | 3300031730 | Bacteria | 7085 |
| 993 | Ga0307516_10397791 | 3300031730 | Bacteria | 1037 |
| 994 | Ga0307405_10005729 | 3300031731 | Bacteria | 6033 |
| 995 | Ga0307405_10012091 | 3300031731 | Bacteria | 4554 |
| 996 | Ga0307405_10046436 | 3300031731 | Bacteria | 2668 |
| 997 | Ga0307405_10155277 | 3300031731 | Bacteria | 1614 |
| 998 | Ga0307405_10823826 | 3300031731 | Bacteria | 779 |
| 999 | Ga0307405_11140977 | 3300031731 | Bacteria | 671 |
| 1000 | Ga0307405_12096718 | 3300031731 | Bacteria | 507 |
| 1001 | Ga0307413_10001429 | 3300031824 | Bacteria | 9034 |
| 1002 | Ga0307413_10032313 | 3300031824 | Bacteria | 2965 |
| 1003 | Ga0307413_10035769 | 3300031824 | Bacteria | 2852 |
| 1004 | Ga0307413_10206648 | 3300031824 | Bacteria | 1422 |
| 1005 | Ga0307413_10641796 | 3300031824 | Bacteria | 874 |
| 1006 | Ga0307413_10747659 | 3300031824 | Bacteria | 817 |
| 1007 | Ga0307410_10002645 | 3300031852 | Bacteria | 8733 |
| 1008 | Ga0307410_10006977 | 3300031852 | Bacteria | 6149 |
| 1009 | Ga0307410_10073323 | 3300031852 | Bacteria | 2380 |
| 1010 | Ga0307410_10531987 | 3300031852 | Bacteria | 971 |
| 1011 | Ga0307410_10762095 | 3300031852 | Bacteria | 820 |
| 1012 | Ga0307410_10916788 | 3300031852 | Bacteria | 751 |
| 1013 | Ga0307406_10004866 | 3300031901 | Bacteria | 7314 |
| 1014 | Ga0307406_10054966 | 3300031901 | Bacteria | 2543 |
| 1015 | Ga0307406_10163268 | 3300031901 | Bacteria | 1604 |
| 1016 | Ga0307406_10214883 | 3300031901 | Bacteria | 1425 |
| 1017 | Ga0307407_10006994 | 3300031903 | Bacteria | 5072 |
| 1018 | Ga0307407_10007323 | 3300031903 | Bacteria | 4990 |
| 1019 | Ga0307407_10061462 | 3300031903 | Bacteria | 2196 |
| 1020 | Ga0307407_10323671 | 3300031903 | Bacteria | 1083 |
| 1021 | Ga0307407_11399922 | 3300031903 | Bacteria | 551 |
| 1022 | Ga0307412_10011559 | 3300031911 | Bacteria | 5119 |
| 1023 | Ga0307412_10074922 | 3300031911 | Bacteria | 2320 |
| 1024 | Ga0307412_10094847 | 3300031911 | Bacteria | 2096 |
| 1025 | Ga0307412_10263875 | 3300031911 | Bacteria | 1344 |
| 1026 | Ga0307412_10275217 | 3300031911 | Bacteria | 1319 |
| 1027 | Ga0307412_10300299 | 3300031911 | Bacteria | 1269 |
| 1028 | Ga0307412_10537689 | 3300031911 | Bacteria | 979 |
| 1029 | Ga0307412_10819269 | 3300031911 | Bacteria | 809 |
| 1030 | Ga0307412_12037627 | 3300031911 | Bacteria | 532 |
| 1031 | Ga0307409_100000577 | 3300031995 | Bacteria | 15970 |
| 1032 | Ga0307409_100018987 | 3300031995 | Bacteria | 4642 |
| 1033 | Ga0307409_100034200 | 3300031995 | Bacteria | 3708 |
| 1034 | Ga0307409_100072562 | 3300031995 | Bacteria | 2742 |
| 1035 | Ga0307409_100686881 | 3300031995 | Bacteria | 1021 |
| 1036 | Ga0307416_100028404 | 3300032002 | Bacteria | 4159 |
| 1037 | Ga0307416_100043561 | 3300032002 | Bacteria | 3515 |
| 1038 | Ga0307416_100099454 | 3300032002 | Bacteria | 2526 |
| 1039 | Ga0307416_100550299 | 3300032002 | Bacteria | 1227 |
| 1040 | Ga0307416_100764931 | 3300032002 | Bacteria | 1059 |
| 1041 | Ga0307416_101030487 | 3300032002 | Bacteria | 926 |
| 1042 | Ga0307416_101105132 | 3300032002 | Bacteria | 897 |
| 1043 | Ga0307416_101119617 | 3300032002 | Bacteria | 892 |
| 1044 | Ga0307416_101230578 | 3300032002 | Bacteria | 854 |
| 1045 | Ga0307414_10358891 | 3300032004 | Bacteria | 1253 |
| 1046 | Ga0307414_10678899 | 3300032004 | Bacteria | 931 |
| 1047 | Ga0307411_10001998 | 3300032005 | Bacteria | 8755 |
| 1048 | Ga0307411_10034772 | 3300032005 | Bacteria | 3139 |
| 1049 | Ga0307411_10249959 | 3300032005 | Bacteria | 1393 |
| 1050 | Ga0307411_10330148 | 3300032005 | Bacteria | 1235 |
| 1051 | Ga0307411_10354795 | 3300032005 | Bacteria | 1197 |
| 1052 | Ga0307411_10427072 | 3300032005 | Bacteria | 1102 |
| 1053 | Ga0307411_10540746 | 3300032005 | Bacteria | 992 |
| 1054 | Ga0307411_10603921 | 3300032005 | Bacteria | 944 |
| 1055 | Ga0307411_10655015 | 3300032005 | Bacteria | 910 |
| 1056 | Ga0307411_11130764 | 3300032005 | Bacteria | 707 |
| 1057 | Ga0307411_11544693 | 3300032005 | Bacteria | 611 |
| 1058 | Ga0307411_12146570 | 3300032005 | Bacteria | 523 |
| 1059 | Ga0307415_100034663 | 3300032126 | Bacteria | 3289 |
| 1060 | Ga0307415_100039097 | 3300032126 | Bacteria | 3132 |
| 1061 | Ga0307415_100210379 | 3300032126 | Bacteria | 1551 |
| 1062 | Ga0307415_100239312 | 3300032126 | Bacteria | 1467 |
| 1063 | Ga0307415_100278380 | 3300032126 | Bacteria | 1374 |
| 1064 | Ga0307415_100482114 | 3300032126 | Bacteria | 1080 |
| 1065 | Ga0307415_101335212 | 3300032126 | Bacteria | 680 |
| 1066 | Ga0316583_10161702 | 3300032133 | Bacteria | 779 |
| 1067 | Ga0316593_10000520 | 3300032168 | Bacteria | 7142 |
| 1068 | Ga0316593_10040336 | 3300032168 | Bacteria | 1551 |
| 1069 | Ga0316593_10198099 | 3300032168 | Bacteria | 742 |
| 1070 | Ga0307507_10087876 | 3300033179 | Bacteria | 2685 |
| 1071 | Ga0307507_10154935 | 3300033179 | Bacteria | 1711 |
| 1072 | Ga0307510_10168701 | 3300033180 | Bacteria | 1771 |
| 1073 | Ga0307510_10170741 | 3300033180 | Bacteria | 1754 |
| 1074 | Ga0307510_10523931 | 3300033180 | Bacteria | 629 |
| 1075 | Ga0316592_1032584 | 3300033524 | Eukaryota | 1137 |
| 1076 | Ga0316596_1000040 | 3300033541 | Bacteria | 13770 |
| 1077 | Ga0316596_1229670 | 3300033541 | Unclassified | 520 |
| 1078 | Ga0373950_0134707 | 3300034818 | Bacteria | 555 |
| 1079 | Ga0373959_0046903 | 3300034820 | Bacteria | 923 |
| 1080 | Ga0373938_0017777 | 3300034957 | Bacteria | 1403 |
| 1081 | Ga0373926_0022611 | 3300035083 | Bacteria | 2181 |
| 1082 | Ga0373926_0079568 | 3300035083 | Bacteria | 1211 |
| 1083 | Ga0373928_0014100 | 3300035084 | Bacteria | 1612 |
| 1084 | Ga0373928_0246433 | 3300035084 | Bacteria | 531 |
| 1085 | Ga0373929_0098569 | 3300035085 | Bacteria | 734 |
| 1086 | Ga0373934_0243828 | 3300035086 | Bacteria | 743 |
| 1087 | Ga0373940_0013603 | 3300035088 | Bacteria | 1973 |
| 1088 | Ga0373940_0039203 | 3300035088 | Bacteria | 1296 |
| 1089 | Ga0373944_0026001 | 3300035089 | Bacteria | 1726 |
| 1090 | Ga0373944_0037967 | 3300035089 | Bacteria | 1478 |
| 1091 | Ga0373944_0122902 | 3300035089 | Bacteria | 896 |
| 1092 | Ga0373944_0136517 | 3300035089 | Bacteria | 856 |
| 1093 | Ga0373951_0036869 | 3300035091 | Bacteria | 1168 |
| 1094 | Ga0373952_0009457 | 3300035092 | Bacteria | 1867 |
| 1095 | Ga0373923_0051212 | 3300035111 | Bacteria | 1732 |
| 1096 | Ga0373923_0117766 | 3300035111 | Bacteria | 1184 |
| 1097 | Ga0373932_0015015 | 3300035112 | Bacteria | 1958 |
| 1098 | Ga0373932_0032954 | 3300035112 | Bacteria | 1452 |
| 1099 | Ga0373932_0064786 | 3300035112 | Bacteria | 1119 |
| 1100 | Ga0373932_0138381 | 3300035112 | Bacteria | 826 |
| 1101 | Ga0373936_0023106 | 3300035113 | Bacteria | 2422 |
| 1102 | Ga0373939_0042238 | 3300035114 | Bacteria | 1378 |
| 1103 | Ga0373939_0042737 | 3300035114 | Bacteria | 1372 |
| 1104 | Ga0373939_0101011 | 3300035114 | Bacteria | 990 |
| 1105 | Ga0373941_0291295 | 3300035115 | Bacteria | 649 |
| 1106 | Ga0373945_0062010 | 3300035116 | Bacteria | 1397 |
| 1107 | Ga0373953_0042168 | 3300035117 | Bacteria | 1818 |
| 1108 | Ga0373953_0334618 | 3300035117 | Bacteria | 663 |
| 1109 | Ga0373954_0124223 | 3300035118 | Bacteria | 1254 |
| 1110 | Ga0373956_0085842 | 3300035119 | Bacteria | 1448 |
| 1111 | Ga0373956_0136201 | 3300035119 | Bacteria | 1152 |
| 1112 | Ga0373956_0441351 | 3300035119 | Bacteria | 621 |
| 1113 | Ga0373957_0044948 | 3300035120 | Bacteria | 1672 |
| 1114 | Ga0373957_0070420 | 3300035120 | Bacteria | 1367 |
| 1115 | Ga0373960_0019605 | 3300035121 | Bacteria | 1779 |
| 1116 | Ga0373960_0329674 | 3300035121 | Bacteria | 574 |
| 1117 | Ga0373943_0205596 | 3300035170 | Bacteria | 1091 |
| 1118 | Ga0373943_0250809 | 3300035170 | Bacteria | 994 |
| 1119 | Ga0373943_0421698 | 3300035170 | Bacteria | 772 |
| 1120 | Ga0373946_0057466 | 3300035171 | Bacteria | 1646 |
| 1121 | Ga0373946_0150156 | 3300035171 | Bacteria | 1086 |
| 1122 | Ga0373946_0167214 | 3300035171 | Bacteria | 1036 |
| 1123 | Ga0373946_0367014 | 3300035171 | Bacteria | 722 |
| 1124 | Ga0373955_0018160 | 3300035172 | Bacteria | 3494 |
| 1125 | Ga0373955_0063660 | 3300035172 | Bacteria | 2042 |
| 1126 | Ga0373955_0081524 | 3300035172 | Bacteria | 1829 |
| 1127 | Ga0373955_0092432 | 3300035172 | Bacteria | 1726 |
| 1128 | Ga0373955_0292723 | 3300035172 | Bacteria | 981 |
| 1129 | Ga0373955_0809760 | 3300035172 | Bacteria | 576 |
| 1130 | Ga0373942_0133951 | 3300035207 | Bacteria | 784 |
| 1131 | Ga0373962_0036659 | 3300035242 | Bacteria | 1366 |
| 1132 | Ga0373962_0139983 | 3300035242 | Bacteria | 785 |
| 1133 | Ga0316574_0285455 | 3300035398 | Bacteria | 1051 |
| 1134 | Ga0373924_0102911 | 3300035410 | Bacteria | 1229 |
| 1135 | Ga0373924_0247167 | 3300035410 | Bacteria | 790 |
| 1136 | Ga0373931_0001474 | 3300035691 | Bacteria | 10131 |
| 1137 | Ga0373931_0008660 | 3300035691 | Bacteria | 4836 |
| 1138 | Ga0373931_0226087 | 3300035691 | Bacteria | 1129 |
| 1139 | Ga0373931_0446973 | 3300035691 | Bacteria | 826 |
| 1140 | Ga0373931_0606530 | 3300035691 | Bacteria | 716 |
| 1141 | Ga0373935_0013375 | 3300035692 | Bacteria | 4951 |
| 1142 | Ga0373935_1117509 | 3300035692 | Bacteria | 587 |
| 1143 | Ga0373927_0074508 | 3300035695 | Bacteria | 2198 |
| 1144 | Ga0373927_0108327 | 3300035695 | Bacteria | 1810 |
| 1145 | Ga0373927_0296254 | 3300035695 | Bacteria | 1064 |
| 1146 | Ga0373927_0306888 | 3300035695 | Bacteria | 1045 |
| 1147 | Ga0373927_0421769 | 3300035695 | Bacteria | 881 |
| 1148 | Ga0373933_0864838 | 3300035724 | Bacteria | 595 |
| 1149 | Ga0373947_0114560 | 3300035725 | Bacteria | 1707 |
| 1150 | Ga0373947_0185796 | 3300035725 | Bacteria | 1355 |
| 1151 | Ga0373937_0120811 | 3300036401 | Bacteria | 2441 |
| 1152 | Ga0373937_0488619 | 3300036401 | Bacteria | 1169 |
| 1153 | Ga0373937_0990449 | 3300036401 | Bacteria | 789 |
| 1154 | Ga0316582_0054399 | 3300036647 | Bacteria | 2548 |
| 1155 | Ga0316584_0641455 | 3300036712 | Bacteria | 733 |
| 1156 | Ga0373925_0089907 | 3300037068 | Bacteria | 2346 |
| 1157 | Ga0373925_0375274 | 3300037068 | Bacteria | 1157 |
| 1158 | Ga0373925_0466364 | 3300037068 | Bacteria | 1035 |
| 1159 | Ga0373925_0747219 | 3300037068 | Bacteria | 806 |
| 1160 | Ga0395899_0005268 | 3300037312 | Bacteria | 10047 |
| 1161 | Ga0395899_0342891 | 3300037312 | Bacteria | 1001 |
| 1162 | Ga0395900_0000542 | 3300037418 | Bacteria | 52856 |
| 1163 | Ga0395900_0034072 | 3300037418 | Bacteria | 5242 |
| 1164 | Ga0395900_0770671 | 3300037418 | Bacteria | 891 |
| 1165 | Ga0395898_0003063 | 3300037466 | Bacteria | 18941 |
| 1166 | Ga0395905_0038305 | 3300037471 | Bacteria | 4498 |
| 1167 | Ga0395905_0048048 | 3300037471 | Bacteria | 3999 |
| 1168 | Ga0395901_0033769 | 3300038443 | Bacteria | 5283 |
| 1169 | Ga0400484_00617 | 3300038725 | Bacteria | 1116 |
| 1170 | Ga0400490_00437 | 3300038726 | Bacteria | 17578 |
| 1171 | Ga0400491_22688 | 3300038727 | Unclassified | 1511 |
| 1172 | Ga0400488_24943 | 3300038741 | Bacteria | 4000 |
| 1173 | Ga0400483_081993 | 3300039062 | Bacteria | 8486 |
| 1174 | Ga0400483_092373 | 3300039062 | Bacteria | 3253 |
| 1175 | Ga0400483_098932 | 3300039062 | Bacteria | 1421 |
| 1176 | Ga0400483_151841 | 3300039062 | Bacteria | 5853 |
| 1177 | Ga0400483_207547 | 3300039062 | Bacteria | 4051 |
| 1178 | Ga0400483_226967 | 3300039062 | Bacteria | 1258 |
| 1179 | Ga0400483_232923 | 3300039062 | Bacteria | 3087 |
| 1180 | Ga0400483_238884 | 3300039062 | Bacteria | 1792 |
| 1181 | Ga0400483_258389 | 3300039062 | Bacteria | 1537 |
| 1182 | Ga0400487_16155 | 3300039110 | Unclassified | 1450 |
| 1183 | Ga0436365_0023403 | 3300039437 | Bacteria | 2605 |
| 1184 | Ga0436365_0772335 | 3300039437 | Bacteria | 850 |
| 1185 | Ga0436365_1793886 | 3300039437 | Bacteria | 521 |
| 1186 | Ga0436363_0160364 | 3300039450 | Bacteria | 878 |
| 1187 | Ga0436363_1530821 | 3300039450 | Bacteria | 2990 |
| 1188 | Ga0436363_1604646 | 3300039450 | Bacteria | 932 |
| 1189 | Ga0439436_0032700 | 3300041404 | Bacteria | 1507 |
| 1190 | Ga0439439_0093230 | 3300041406 | Bacteria | 824 |
| 1191 | Ga0439461_0013318 | 3300041410 | Bacteria | 1551 |
| 1192 | Ga0439465_0154212 | 3300041413 | Bacteria | 822 |
| 1193 | Ga0451787_578519 | 3300041441 | Bacteria | 947 |
| 1194 | Ga0451787_682059 | 3300041441 | Bacteria | 1087 |
| 1195 | Ga0451789_0604896 | 3300041443 | Bacteria | 662 |
| 1196 | Ga0451789_0701085 | 3300041443 | Bacteria | 625 |
| 1197 | Ga0451789_0781745 | 3300041443 | Bacteria | 1292 |
| 1198 | Ga0451789_0965253 | 3300041443 | Bacteria | 2538 |
| 1199 | Ga0451789_1079498 | 3300041443 | Bacteria | 760 |
| 1200 | Ga0451790_47197 | 3300041444 | Bacteria | 1058 |
| 1201 | Ga0451794_03533 | 3300041446 | Bacteria | 1513 |
| 1202 | Ga0451794_20639 | 3300041446 | Bacteria | 572 |
| 1203 | Ga0451794_21291 | 3300041446 | Bacteria | 839 |
| 1204 | Ga0451791_1736819 | 3300041451 | Bacteria | 535 |
| 1205 | Ga0451793_0424511 | 3300041452 | Bacteria | 932 |
| 1206 | Ga0451793_0637995 | 3300041452 | Bacteria | 1739 |
| 1207 | Ga0451793_1338571 | 3300041452 | Bacteria | 1262 |
| 1208 | Ga0451797_0593740 | 3300041453 | Bacteria | 1059 |
| 1209 | Ga0451797_0784698 | 3300041453 | Bacteria | 976 |
| 1210 | Ga0451799_28190 | 3300041454 | Bacteria | 627 |
| 1211 | Ga0451799_32497 | 3300041454 | Bacteria | 728 |
| 1212 | Ga0451801_26122 | 3300041455 | Bacteria | 1026 |
| 1213 | Ga0451801_40786 | 3300041455 | Bacteria | 1763 |
| 1214 | Ga0451795_0013989 | 3300041456 | Bacteria | 2986 |
| 1215 | Ga0451803_03143 | 3300041457 | Bacteria | 807 |
| 1216 | Ga0451798_0518391 | 3300041458 | Bacteria | 605 |
| 1217 | Ga0451798_1162362 | 3300041458 | Bacteria | 1067 |
| 1218 | Ga0451800_0475520 | 3300041459 | Bacteria | 1521 |
| 1219 | Ga0451800_1232355 | 3300041459 | Bacteria | 2467 |
| 1220 | Ga0451802_1180715 | 3300041460 | Bacteria | 606 |
| 1221 | Ga0451802_1195489 | 3300041460 | Bacteria | 1135 |
| 1222 | Ga0451805_010137 | 3300041461 | Bacteria | 1322 |
| 1223 | Ga0451805_039282 | 3300041461 | Bacteria | 1073 |
| 1224 | Ga0451806_289060 | 3300041462 | Bacteria | 900 |
| 1225 | Ga0451804_0197986 | 3300041463 | Bacteria | 561 |
| 1226 | Ga0451804_0350671 | 3300041463 | Bacteria | 3764 |
| 1227 | Ga0451804_0672156 | 3300041463 | Bacteria | 559 |
| 1228 | Ga0451804_0722325 | 3300041463 | Bacteria | 707 |
| 1229 | Ga0451807_0646883 | 3300041486 | Bacteria | 1463 |
| 1230 | Ga0451807_0837307 | 3300041486 | Bacteria | 589 |
| 1231 | Ga0451807_0984280 | 3300041486 | Bacteria | 1424 |
| 1232 | Ga0451807_1280507 | 3300041486 | Bacteria | 1302 |
| 1233 | Ga0451807_1334682 | 3300041486 | Bacteria | 746 |
| 1234 | Ga0451807_1506488 | 3300041486 | Bacteria | 1542 |
| 1235 | Ga0451833_0205751 | 3300041491 | Bacteria | 628 |
| 1236 | Ga0451835_0635417 | 3300041492 | Bacteria | 1032 |
| 1237 | Ga0451841_0230757 | 3300041498 | Bacteria | 611 |
| 1238 | Ga0451841_0455622 | 3300041498 | Bacteria | 851 |
| 1239 | Ga0451847_0437573 | 3300041503 | Bacteria | 650 |
| 1240 | Ga0451849_1485536 | 3300041505 | Bacteria | 679 |
| 1241 | Ga0451850_07380 | 3300041506 | Bacteria | 651 |
| 1242 | Ga0451851_0477462 | 3300041507 | Bacteria | 659 |
| 1243 | Ga0451854_06224 | 3300041510 | Bacteria | 513 |
| 1244 | Ga0451855_0043459 | 3300041511 | Bacteria | 1949 |
| 1245 | Ga0451853_0694569 | 3300041512 | Bacteria | 1631 |
| 1246 | Ga0451853_1066481 | 3300041512 | Bacteria | 2648 |
| 1247 | Ga0451853_1718278 | 3300041512 | Bacteria | 900 |
| 1248 | Ga0451853_2708289 | 3300041512 | Bacteria | 544 |
| 1249 | Ga0451853_4042749 | 3300041512 | Bacteria | 1692 |
| 1250 | Ga0451853_4125141 | 3300041512 | Bacteria | 737 |
| 1251 | Ga0452271_65294 | 3300041916 | Bacteria | 1115 |
| 1252 | Ga0439462_0063869 | 3300042015 | Bacteria | 997 |
| 1253 | Ga0450914_006348 | 3300042118 | Bacteria | 1034 |
| 1254 | Ga0450923_163606 | 3300042125 | Bacteria | 543 |
| 1255 | Ga0450888_000936 | 3300042126 | Bacteria | 2776 |
| 1256 | Ga0450888_076627 | 3300042126 | Bacteria | 509 |
| 1257 | Ga0450898_151038 | 3300042134 | Bacteria | 508 |
| 1258 | Ga0450906_073666 | 3300042145 | Bacteria | 613 |
| 1259 | Ga0439458_0062075 | 3300042157 | Bacteria | 934 |
| 1260 | Ga0450909_005658 | 3300042185 | Bacteria | 1799 |
| 1261 | Ga0439434_0095345 | 3300042435 | Bacteria | 955 |
| 1262 | Ga0439444_0186821 | 3300042437 | Bacteria | 517 |
| 1263 | Ga0439464_0163579 | 3300042439 | Bacteria | 700 |
| 1264 | Ga0439460_0110012 | 3300042461 | Bacteria | 893 |
| 1265 | Ga0450916_028444 | 3300042530 | Bacteria | 803 |
| 1266 | Ga0450918_106598 | 3300042531 | Bacteria | 552 |
| 1267 | Ga0450893_0014532 | 3300042532 | Bacteria | 1321 |
| 1268 | Ga0450893_0079748 | 3300042532 | Bacteria | 646 |
| 1269 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 1270 | Ga0451577_0027488 | 3300042876 | Bacteria | 5150 |
| 1271 | Ga0451577_0168788 | 3300042876 | Bacteria | 1971 |
| 1272 | Ga0451577_0221004 | 3300042876 | Bacteria | 1712 |
| 1273 | Ga0451577_0608581 | 3300042876 | Bacteria | 991 |
| 1274 | Ga0451577_0626488 | 3300042876 | Bacteria | 976 |
| 1275 | Ga0451577_0662158 | 3300042876 | Bacteria | 946 |
| 1276 | Ga0451577_0909734 | 3300042876 | Bacteria | 792 |
| 1277 | Ga0451577_1834259 | 3300042876 | Bacteria | 532 |
| 1278 | Ga0453683_0000059 | 3300044673 | Bacteria | 187158 |
| 1279 | Ga0453683_0030079 | 3300044673 | Bacteria | 3434 |
| 1280 | Ga0453683_0041932 | 3300044673 | Bacteria | 2874 |
| 1281 | Ga0466961_0117869 | 3300044693 | Bacteria | 1668 |
| 1282 | Ga0466963_0155056 | 3300044694 | Bacteria | 1592 |
| 1283 | Ga0453684_0000585 | 3300044712 | Bacteria | 135647 |
| 1284 | Ga0453684_0065104 | 3300044712 | Bacteria | 4650 |
| 1285 | Ga0453684_0077473 | 3300044712 | Bacteria | 4166 |
| 1286 | Ga0453684_0261576 | 3300044712 | Bacteria | 1981 |
| 1287 | Ga0453684_0340103 | 3300044712 | Bacteria | 1695 |
| 1288 | Ga0453684_0462151 | 3300044712 | Bacteria | 1411 |
| 1289 | Ga0453684_0473085 | 3300044712 | Bacteria | 1391 |
| 1290 | Ga0453684_1184361 | 3300044712 | Bacteria | 803 |
| 1291 | Ga0453684_1793636 | 3300044712 | Bacteria | 624 |
| 1292 | Ga0466971_0003261 | 3300044719 | Bacteria | 6925 |
| 1293 | Ga0466957_0004472 | 3300044842 | Bacteria | 7796 |
| 1294 | Ga0466959_0074108 | 3300045049 | Bacteria | 2462 |
| 1295 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 1296 | Ga0451576_0000909 | 3300045051 | Bacteria | 56035 |
| 1297 | Ga0451576_0010036 | 3300045051 | Bacteria | 10905 |
| 1298 | Ga0451576_0025038 | 3300045051 | Bacteria | 6436 |
| 1299 | Ga0451576_0079035 | 3300045051 | Bacteria | 3422 |
| 1300 | Ga0451576_0131416 | 3300045051 | Bacteria | 2610 |
| 1301 | Ga0451576_0168870 | 3300045051 | Bacteria | 2283 |
| 1302 | Ga0451576_0177787 | 3300045051 | Bacteria | 2222 |
| 1303 | Ga0451576_1144103 | 3300045051 | Bacteria | 814 |
| 1304 | Ga0451576_1160016 | 3300045051 | Bacteria | 807 |
| 1305 | Ga0466958_0062229 | 3300045836 | Bacteria | 2275 |
| 1306 | Ga0495617_066779 | 3300046452 | Bacteria | 1185 |
| 1307 | Ga0495592_0000203 | 3300046454 | Bacteria | 50733 |
| 1308 | Ga0495592_0002591 | 3300046454 | Bacteria | 12773 |
| 1309 | Ga0495603_0167391 | 3300046455 | Bacteria | 1273 |
| 1310 | Ga0495590_0011864 | 3300046457 | Bacteria | 3248 |
| 1311 | Ga0495590_0076553 | 3300046457 | Bacteria | 1177 |
| 1312 | Ga0495590_0128399 | 3300046457 | Bacteria | 911 |
| 1313 | Ga0495590_0406464 | 3300046457 | Bacteria | 523 |
| 1314 | Ga0495591_001371 | 3300046458 | Bacteria | 15266 |
| 1315 | Ga0495629_0208823 | 3300046459 | Bacteria | 1349 |
| 1316 | Ga0495629_0333459 | 3300046459 | Bacteria | 1036 |
| 1317 | Ga0495638_0020600 | 3300046460 | Bacteria | 4356 |
| 1318 | Ga0495638_0023580 | 3300046460 | Bacteria | 4022 |
| 1319 | Ga0495638_0131647 | 3300046460 | Bacteria | 1468 |
| 1320 | Ga0495638_0162714 | 3300046460 | Bacteria | 1286 |
| 1321 | Ga0495641_0101699 | 3300046461 | Bacteria | 1282 |
| 1322 | Ga0495651_0800123 | 3300046462 | Bacteria | 582 |
| 1323 | Ga0495653_0190214 | 3300046463 | Bacteria | 1401 |
| 1324 | Ga0495650_0000787 | 3300046471 | Bacteria | 38830 |
| 1325 | Ga0495580_0265795 | 3300046472 | Bacteria | 1173 |
| 1326 | Ga0495582_0285985 | 3300046473 | Bacteria | 947 |
| 1327 | Ga0495582_0385106 | 3300046473 | Bacteria | 808 |
| 1328 | Ga0495605_0003552 | 3300046474 | Bacteria | 9242 |
| 1329 | Ga0495605_0242295 | 3300046474 | Bacteria | 774 |
| 1330 | Ga0495605_0454085 | 3300046474 | Bacteria | 527 |
| 1331 | Ga0495639_0103968 | 3300046475 | Bacteria | 1343 |
| 1332 | Ga0495639_0485717 | 3300046475 | Bacteria | 630 |
| 1333 | Ga0495664_0167471 | 3300046477 | Bacteria | 1333 |
| 1334 | Ga0495664_0693486 | 3300046477 | Bacteria | 602 |
| 1335 | Ga0495584_0002357 | 3300046491 | Bacteria | 10763 |
| 1336 | Ga0495585_0124260 | 3300046492 | Bacteria | 1363 |
| 1337 | Ga0495585_0262788 | 3300046492 | Bacteria | 858 |
| 1338 | Ga0495596_0334463 | 3300046500 | Bacteria | 589 |
| 1339 | Ga0495607_0010060 | 3300046501 | Bacteria | 6371 |
| 1340 | Ga0495583_0124309 | 3300046506 | Bacteria | 1083 |
| 1341 | Ga0495606_0004907 | 3300046507 | Bacteria | 13094 |
| 1342 | Ga0495608_0037016 | 3300046511 | Bacteria | 3282 |
| 1343 | Ga0495608_0636945 | 3300046511 | Bacteria | 638 |
| 1344 | Ga0495608_0684824 | 3300046511 | Bacteria | 611 |
| 1345 | Ga0495610_0007369 | 3300046512 | Bacteria | 7341 |
| 1346 | Ga0495610_0025318 | 3300046512 | Bacteria | 3186 |
| 1347 | Ga0495610_0096636 | 3300046512 | Bacteria | 1330 |
| 1348 | Ga0495610_0146980 | 3300046512 | Bacteria | 1009 |
| 1349 | Ga0495610_0152175 | 3300046512 | Bacteria | 986 |
| 1350 | Ga0495616_0006494 | 3300046513 | Bacteria | 7072 |
| 1351 | Ga0495616_0052060 | 3300046513 | Bacteria | 2039 |
| 1352 | Ga0495616_0074407 | 3300046513 | Bacteria | 1637 |
| 1353 | Ga0495616_0093680 | 3300046513 | Bacteria | 1418 |
| 1354 | Ga0495618_0210570 | 3300046514 | Bacteria | 1229 |
| 1355 | Ga0495618_0263098 | 3300046514 | Bacteria | 1080 |
| 1356 | Ga0495618_0632815 | 3300046514 | Bacteria | 634 |
| 1357 | Ga0495620_0021563 | 3300046515 | Bacteria | 3126 |
| 1358 | Ga0495620_0083017 | 3300046515 | Bacteria | 1294 |
| 1359 | Ga0495620_0086369 | 3300046515 | Bacteria | 1263 |
| 1360 | Ga0495620_0096514 | 3300046515 | Bacteria | 1181 |
| 1361 | Ga0495628_0102358 | 3300046516 | Bacteria | 2210 |
| 1362 | Ga0495628_0375959 | 3300046516 | Bacteria | 1041 |
| 1363 | Ga0495630_0126006 | 3300046517 | Bacteria | 1944 |
| 1364 | Ga0495631_0005719 | 3300046518 | Bacteria | 6484 |
| 1365 | Ga0495631_0022122 | 3300046518 | Bacteria | 2957 |
| 1366 | Ga0495632_0014757 | 3300046519 | Bacteria | 4407 |
| 1367 | Ga0495632_0065630 | 3300046519 | Bacteria | 1753 |
| 1368 | Ga0495632_0082343 | 3300046519 | Bacteria | 1534 |
| 1369 | Ga0495632_0113435 | 3300046519 | Bacteria | 1271 |
| 1370 | Ga0495643_0019121 | 3300046522 | Bacteria | 3966 |
| 1371 | Ga0495643_0474258 | 3300046522 | Bacteria | 541 |
| 1372 | Ga0495644_0000420 | 3300046523 | Bacteria | 18895 |
| 1373 | Ga0495648_0007953 | 3300046524 | Bacteria | 8408 |
| 1374 | Ga0495648_0357937 | 3300046524 | Bacteria | 664 |
| 1375 | Ga0495663_0091107 | 3300046525 | Bacteria | 994 |
| 1376 | Ga0495663_0161528 | 3300046525 | Bacteria | 769 |
| 1377 | Ga0495642_0009990 | 3300046528 | Bacteria | 3636 |
| 1378 | Ga0495642_0053512 | 3300046528 | Bacteria | 1664 |
| 1379 | Ga0495642_0130268 | 3300046528 | Bacteria | 1082 |
| 1380 | Ga0495654_0000178 | 3300046530 | Bacteria | 62611 |
| 1381 | Ga0495654_0056414 | 3300046530 | Bacteria | 1899 |
| 1382 | Ga0495654_0208764 | 3300046530 | Bacteria | 832 |
| 1383 | Ga0495654_0283869 | 3300046530 | Bacteria | 680 |
| 1384 | Ga0495665_0139846 | 3300046531 | Bacteria | 1266 |
| 1385 | Ga0495640_0425133 | 3300046533 | Bacteria | 814 |
| 1386 | Ga0495586_0061618 | 3300046535 | Bacteria | 2042 |
| 1387 | Ga0495587_0030902 | 3300046536 | Bacteria | 3246 |
| 1388 | Ga0495587_0270149 | 3300046536 | Bacteria | 954 |
| 1389 | Ga0495587_0440001 | 3300046536 | Bacteria | 723 |
| 1390 | Ga0495598_0388963 | 3300046537 | Bacteria | 543 |
| 1391 | Ga0495621_0111975 | 3300046539 | Bacteria | 1047 |
| 1392 | Ga0495621_0352693 | 3300046539 | Bacteria | 617 |
| 1393 | Ga0495621_0536312 | 3300046539 | Bacteria | 507 |
| 1394 | Ga0495597_0092274 | 3300046542 | Bacteria | 1284 |
| 1395 | Ga0495645_0004671 | 3300046543 | Bacteria | 9348 |
| 1396 | Ga0495645_0034282 | 3300046543 | Bacteria | 3704 |
| 1397 | Ga0495645_0098975 | 3300046543 | Bacteria | 2075 |
| 1398 | Ga0495622_0022381 | 3300046557 | Bacteria | 2945 |
| 1399 | Ga0495622_0288324 | 3300046557 | Bacteria | 717 |
| 1400 | Ga0495633_0048161 | 3300046558 | Bacteria | 2013 |
| 1401 | Ga0495633_0120456 | 3300046558 | Bacteria | 1216 |
| 1402 | Ga0495633_0191697 | 3300046558 | Bacteria | 940 |
| 1403 | Ga0495633_0282068 | 3300046558 | Bacteria | 756 |
| 1404 | Ga0495667_0115936 | 3300046559 | Bacteria | 1731 |
| 1405 | Ga0495667_0295543 | 3300046559 | Bacteria | 1027 |
| 1406 | Ga0495656_0056918 | 3300046615 | Bacteria | 1691 |
| 1407 | Ga0495656_0140084 | 3300046615 | Bacteria | 1159 |
| 1408 | Ga0495668_0164067 | 3300046616 | Bacteria | 1217 |
| 1409 | Ga0495668_0179895 | 3300046616 | Bacteria | 1158 |
| 1410 | Ga0495668_0435670 | 3300046616 | Bacteria | 721 |
| 1411 | Ga0495634_0205692 | 3300046642 | Bacteria | 1221 |
| 1412 | Ga0495634_0227438 | 3300046642 | Bacteria | 1149 |
| 1413 | Ga0495611_0033426 | 3300046648 | Bacteria | 2269 |
| 1414 | Ga0495611_0137743 | 3300046648 | Bacteria | 1140 |
| 1415 | Ga0495625_0006868 | 3300046660 | Bacteria | 10052 |
| 1416 | Ga0495625_0020303 | 3300046660 | Bacteria | 5131 |
| 1417 | Ga0495625_0039878 | 3300046660 | Bacteria | 3427 |
| 1418 | Ga0495625_0102533 | 3300046660 | Bacteria | 1964 |
| 1419 | Ga0495625_0340532 | 3300046660 | Bacteria | 950 |
| 1420 | Ga0495635_0032495 | 3300046663 | Bacteria | 3620 |
| 1421 | Ga0495635_0542978 | 3300046663 | Bacteria | 762 |
| 1422 | Ga0495635_0818213 | 3300046663 | Bacteria | 600 |
| 1423 | Ga0495659_0077302 | 3300046664 | Bacteria | 1257 |
| 1424 | Ga0495659_0084804 | 3300046664 | Bacteria | 1208 |
| 1425 | Ga0495659_0382341 | 3300046664 | Bacteria | 605 |
| 1426 | Ga0495588_0009938 | 3300046674 | Bacteria | 4411 |
| 1427 | Ga0495657_0043896 | 3300046675 | Bacteria | 3045 |
| 1428 | Ga0495657_0099043 | 3300046675 | Bacteria | 1860 |
| 1429 | Ga0495657_0355767 | 3300046675 | Bacteria | 866 |
| 1430 | Ga0495657_0697551 | 3300046675 | Bacteria | 584 |
| 1431 | Ga0495599_0001475 | 3300046678 | Bacteria | 13496 |
| 1432 | Ga0495623_0049231 | 3300046679 | Bacteria | 2671 |
| 1433 | Ga0495623_0189415 | 3300046679 | Bacteria | 1190 |
| 1434 | Ga0495646_0061137 | 3300046680 | Bacteria | 2244 |
| 1435 | Ga0495647_0085698 | 3300046681 | Bacteria | 1284 |
| 1436 | Ga0495647_0090860 | 3300046681 | Bacteria | 1252 |
| 1437 | Ga0495647_0124789 | 3300046681 | Bacteria | 1086 |
| 1438 | Ga0495647_0125943 | 3300046681 | Bacteria | 1081 |
| 1439 | Ga0495647_0134919 | 3300046681 | Bacteria | 1049 |
| 1440 | Ga0495658_0085813 | 3300046683 | Bacteria | 1856 |
| 1441 | Ga0495658_0097472 | 3300046683 | Bacteria | 1750 |
| 1442 | Ga0495658_0105468 | 3300046683 | Bacteria | 1688 |
| 1443 | Ga0495658_0134744 | 3300046683 | Bacteria | 1506 |
| 1444 | Ga0495658_0223594 | 3300046683 | Bacteria | 1179 |
| 1445 | Ga0495658_0277267 | 3300046683 | Bacteria | 1058 |
| 1446 | Ga0495658_0283602 | 3300046683 | Bacteria | 1045 |
| 1447 | Ga0495658_0296678 | 3300046683 | Bacteria | 1022 |
| 1448 | Ga0495658_0455195 | 3300046683 | Bacteria | 818 |
| 1449 | Ga0495669_0084855 | 3300046684 | Bacteria | 1457 |
| 1450 | Ga0495669_0103028 | 3300046684 | Bacteria | 1327 |
| 1451 | Ga0495669_0321926 | 3300046684 | Bacteria | 746 |
| 1452 | Ga0495613_0091108 | 3300046689 | Bacteria | 2208 |
| 1453 | Ga0495613_0120251 | 3300046689 | Bacteria | 1886 |
| 1454 | Ga0495670_0042455 | 3300046691 | Bacteria | 2269 |
| 1455 | Ga0495670_0424075 | 3300046691 | Bacteria | 720 |
| 1456 | Ga0495671_0000488 | 3300046692 | Bacteria | 30667 |
| 1457 | Ga0495671_0198265 | 3300046692 | Bacteria | 974 |
| 1458 | Ga0495671_0295587 | 3300046692 | Bacteria | 779 |
| 1459 | Ga0495671_0305034 | 3300046692 | Bacteria | 766 |
| 1460 | Ga0495671_0415091 | 3300046692 | Bacteria | 644 |
| 1461 | Ga0495671_0421684 | 3300046692 | Bacteria | 638 |
| 1462 | Ga0495671_0429974 | 3300046692 | Bacteria | 632 |
| 1463 | Ga0495649_0006057 | 3300046694 | Bacteria | 7562 |
| 1464 | Ga0495649_0026025 | 3300046694 | Bacteria | 3256 |
| 1465 | Ga0495649_0225215 | 3300046694 | Bacteria | 969 |
| 1466 | Ga0495649_0406068 | 3300046694 | Bacteria | 683 |
| 1467 | Ga0495649_0444741 | 3300046694 | Bacteria | 648 |
| 1468 | Ga0495589_0074447 | 3300046794 | Bacteria | 1657 |
| 1469 | Ga0495589_0133864 | 3300046794 | Bacteria | 1189 |
| 1470 | Ga0495600_0284384 | 3300046809 | Bacteria | 1046 |
| 1471 | Ga0495600_0740671 | 3300046809 | Bacteria | 589 |
| 1472 | Ga0495660_0000352 | 3300046810 | Bacteria | 40624 |
| 1473 | Ga0495660_0151509 | 3300046810 | Bacteria | 1144 |
| 1474 | Ga0495660_0355899 | 3300046810 | Bacteria | 650 |
| 1475 | Ga0495604_0435394 | 3300047317 | Bacteria | 859 |
| 1476 | Ga0495604_0893880 | 3300047317 | Bacteria | 555 |
| 1477 | Ga0495636_0078088 | 3300047318 | Bacteria | 1422 |
| 1478 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 1479 | Ga0495672_0124253 | 3300047320 | Bacteria | 1367 |
| 1480 | Ga0495676_0010234 | 3300047321 | Bacteria | 8515 |
| 1481 | Ga0495676_0140426 | 3300047321 | Bacteria | 1732 |
| 1482 | Ga0495680_0062566 | 3300047322 | Bacteria | 2861 |
| 1483 | Ga0495680_0156938 | 3300047322 | Bacteria | 1655 |
| 1484 | Ga0495680_0916563 | 3300047322 | Bacteria | 565 |
| 1485 | Ga0495683_0075953 | 3300047323 | Bacteria | 1644 |
| 1486 | Ga0495687_036928 | 3300047443 | Bacteria | 2180 |
| 1487 | Ga0495679_051289 | 3300047446 | Bacteria | 1237 |
| 1488 | Ga0495679_076308 | 3300047446 | Bacteria | 958 |
| 1489 | Ga0495685_088317 | 3300047447 | Bacteria | 1029 |
| 1490 | Ga0495673_0002408 | 3300047469 | Bacteria | 13186 |
| 1491 | Ga0495673_0135384 | 3300047469 | Bacteria | 965 |
| 1492 | Ga0495673_0182094 | 3300047469 | Bacteria | 795 |
| 1493 | Ga0495681_0051412 | 3300047470 | Bacteria | 1938 |
| 1494 | Ga0495681_0191002 | 3300047470 | Bacteria | 836 |
| 1495 | Ga0495684_0188245 | 3300047471 | Bacteria | 1527 |
| 1496 | Ga0495684_0395216 | 3300047471 | Bacteria | 972 |
| 1497 | Ga0495686_0039632 | 3300047472 | Bacteria | 3008 |
| 1498 | Ga0495686_0054615 | 3300047472 | Bacteria | 2500 |
| 1499 | Ga0495686_0066900 | 3300047472 | Bacteria | 2219 |
| 1500 | Ga0495686_0177695 | 3300047472 | Bacteria | 1235 |
| 1501 | Ga0495686_0195418 | 3300047472 | Bacteria | 1164 |
| 1502 | Ga0495686_0580565 | 3300047472 | Bacteria | 582 |
| 1503 | Ga0495593_0038039 | 3300047673 | Bacteria | 2600 |
| 1504 | Ga0495602_0365616 | 3300048088 | Bacteria | 1037 |
| 1505 | Ga0495614_0095045 | 3300048089 | Bacteria | 1299 |
| 1506 | Ga0495626_0074338 | 3300048091 | Bacteria | 1521 |
| 1507 | Ga0495626_0131805 | 3300048091 | Bacteria | 1067 |
| 1508 | Ga0495626_0154700 | 3300048091 | Bacteria | 964 |
| 1509 | Ga0496100_0076364 | 3300048903 | Bacteria | 2249 |
| 1510 | Ga0496100_0447306 | 3300048903 | Bacteria | 990 |
| 1511 | Ga0496100_0546982 | 3300048903 | Bacteria | 895 |
| 1512 | Ga0496100_1019883 | 3300048903 | Bacteria | 651 |
| 1513 | Ga0496101_0024728 | 3300048904 | Bacteria | 4160 |
| 1514 | Ga0496101_0463082 | 3300048904 | Bacteria | 1000 |
| 1515 | Ga0496101_0633712 | 3300048904 | Bacteria | 845 |
| 1516 | Ga0496102_0007579 | 3300048905 | Bacteria | 9273 |
| 1517 | Ga0496102_0060302 | 3300048905 | Bacteria | 3470 |
| 1518 | Ga0496102_0536484 | 3300048905 | Bacteria | 1093 |
| 1519 | Ga0496102_0704384 | 3300048905 | Bacteria | 933 |
| 1520 | Ga0496104_0008378 | 3300048907 | Bacteria | 9189 |
| 1521 | Ga0496104_0104722 | 3300048907 | Bacteria | 2711 |
| 1522 | Ga0496104_0327787 | 3300048907 | Bacteria | 1444 |
| 1523 | Ga0496104_0579646 | 3300048907 | Bacteria | 1032 |
| 1524 | Ga0496105_0009457 | 3300048908 | Bacteria | 7626 |
| 1525 | Ga0496105_0289103 | 3300048908 | Bacteria | 1320 |
| 1526 | Ga0496105_0693498 | 3300048908 | Bacteria | 782 |
| 1527 | Ga0496106_0275442 | 3300048909 | Bacteria | 1347 |
| 1528 | Ga0496106_0453539 | 3300048909 | Bacteria | 1030 |
| 1529 | Ga0496106_1586289 | 3300048909 | Bacteria | 502 |
| 1530 | Ga0496107_0280025 | 3300048910 | Bacteria | 1241 |
| 1531 | Ga0496107_0429419 | 3300048910 | Bacteria | 982 |
| 1532 | Ga0496107_0695193 | 3300048910 | Bacteria | 748 |
| 1533 | Ga0496108_0005999 | 3300048911 | Bacteria | 9840 |
| 1534 | Ga0496108_0042133 | 3300048911 | Bacteria | 3811 |
| 1535 | Ga0496108_0097580 | 3300048911 | Bacteria | 2504 |
| 1536 | Ga0496108_0309768 | 3300048911 | Bacteria | 1376 |
| 1537 | Ga0496108_0356402 | 3300048911 | Bacteria | 1277 |
| 1538 | Ga0496108_0406535 | 3300048911 | Bacteria | 1189 |
| 1539 | Ga0496109_0259357 | 3300048912 | Bacteria | 1637 |
| 1540 | Ga0496109_0267867 | 3300048912 | Bacteria | 1609 |
| 1541 | Ga0496109_0618045 | 3300048912 | Bacteria | 1020 |
| 1542 | Ga0496109_1217504 | 3300048912 | Bacteria | 689 |
| 1543 | Ga0496110_0026383 | 3300048913 | Bacteria | 4971 |
| 1544 | Ga0496110_0367167 | 3300048913 | Bacteria | 1311 |
| 1545 | Ga0496111_0004330 | 3300048914 | Bacteria | 8955 |
| 1546 | Ga0496111_0558089 | 3300048914 | Bacteria | 840 |
| 1547 | Ga0496112_0411585 | 3300048915 | Bacteria | 1291 |
| 1548 | Ga0496112_0462843 | 3300048915 | Bacteria | 1206 |
| 1549 | Ga0496112_0475015 | 3300048915 | Bacteria | 1187 |
| 1550 | Ga0496113_0211725 | 3300048916 | Bacteria | 1543 |
| 1551 | Ga0496113_0215057 | 3300048916 | Bacteria | 1531 |
| 1552 | Ga0496113_0310758 | 3300048916 | Bacteria | 1263 |
| 1553 | Ga0496113_0885539 | 3300048916 | Bacteria | 707 |
| 1554 | Ga0496114_0009046 | 3300048917 | Bacteria | 7897 |
| 1555 | Ga0496114_0198844 | 3300048917 | Bacteria | 1755 |
| 1556 | Ga0496114_0430906 | 3300048917 | Bacteria | 1168 |
| 1557 | Ga0496114_0574004 | 3300048917 | Bacteria | 995 |
| 1558 | Ga0496115_0030230 | 3300048918 | Bacteria | 4260 |
| 1559 | Ga0496115_0446021 | 3300048918 | Bacteria | 1046 |
| 1560 | Ga0496116_0013625 | 3300048919 | Bacteria | 6538 |
| 1561 | Ga0496119_0010829 | 3300048922 | Bacteria | 7630 |
| 1562 | Ga0496120_0023855 | 3300048923 | Bacteria | 3823 |
| 1563 | Ga0496123_0395689 | 3300048926 | Bacteria | 630 |
| 1564 | Ga0501306_001000 | 3300049127 | Bacteria | 2483 |
| 1565 | Ga0501306_010649 | 3300049127 | Bacteria | 1161 |
| 1566 | Ga0501308_000386 | 3300049128 | Bacteria | 2793 |
| 1567 | Ga0501308_004862 | 3300049128 | Bacteria | 1314 |
| 1568 | Ga0501308_012337 | 3300049128 | Bacteria | 975 |
| 1569 | Ga0501308_015871 | 3300049128 | Bacteria | 896 |
| 1570 | Ga0501309_007735 | 3300049129 | Bacteria | 1338 |
| 1571 | Ga0501309_015019 | 3300049129 | Bacteria | 1044 |
| 1572 | Ga0501309_018080 | 3300049129 | Bacteria | 971 |
| 1573 | Ga0501310_005085 | 3300049130 | Bacteria | 1342 |
| 1574 | Ga0501310_011089 | 3300049130 | Bacteria | 1016 |
| 1575 | Ga0501310_011540 | 3300049130 | Bacteria | 1001 |
| 1576 | Ga0501310_039742 | 3300049130 | Bacteria | 652 |
| 1577 | Ga0501304_001736 | 3300049160 | Bacteria | 1438 |
| 1578 | Ga0501304_009642 | 3300049160 | Bacteria | 832 |
| 1579 | Ga0501305_000819 | 3300049161 | Bacteria | 2765 |
| 1580 | Ga0501305_005417 | 3300049161 | Bacteria | 1545 |
| 1581 | Ga0501305_009585 | 3300049161 | Bacteria | 1276 |
| 1582 | Ga0501305_010469 | 3300049161 | Bacteria | 1238 |
| 1583 | Ga0501305_038350 | 3300049161 | Bacteria | 772 |
| 1584 | Ga0501305_122394 | 3300049161 | Bacteria | 500 |
| 1585 | Ga0501307_000963 | 3300049162 | Bacteria | 2241 |
| 1586 | Ga0501307_025529 | 3300049162 | Bacteria | 794 |
| 1587 | Ga0501307_068984 | 3300049162 | Bacteria | 561 |
| 1588 | Ga0495678_000882 | 3300049459 | Bacteria | 26697 |
| 1589 | Ga0495678_217698 | 3300049459 | Bacteria | 581 |
| 1590 | Ga0495682_0000520 | 3300049460 | Bacteria | 26623 |
| 1591 | Ga0495682_0049136 | 3300049460 | Bacteria | 1537 |
| 1592 | Ga0495682_0058348 | 3300049460 | Bacteria | 1396 |
| 1593 | Ga0501290_008662 | 3300049513 | Bacteria | 1289 |
| 1594 | Ga0501292_005043 | 3300049515 | Bacteria | 1828 |
| 1595 | Ga0501292_046069 | 3300049515 | Bacteria | 763 |
| 1596 | Ga0501299_044313 | 3300049522 | Bacteria | 902 |
| 1597 | Ga0501311_004807 | 3300049527 | Bacteria | 1454 |
| 1598 | Ga0501311_027374 | 3300049527 | Bacteria | 809 |
| 1599 | Ga0501311_039844 | 3300049527 | Bacteria | 709 |
| 1600 | Ga0501312_002743 | 3300049528 | Bacteria | 1929 |
| 1601 | Ga0501312_020297 | 3300049528 | Bacteria | 982 |
| 1602 | Ga0501312_025631 | 3300049528 | Bacteria | 899 |
| 1603 | Ga0501312_101904 | 3300049528 | Bacteria | 539 |
| 1604 | Ga0501313_004401 | 3300049529 | Bacteria | 1446 |
| 1605 | Ga0501313_009732 | 3300049529 | Bacteria | 1086 |
| 1606 | Ga0501313_018129 | 3300049529 | Bacteria | 854 |
| 1607 | Ga0501315_013634 | 3300049531 | Bacteria | 1020 |
| 1608 | Ga0501315_031783 | 3300049531 | Bacteria | 764 |
| 1609 | Ga0501316_001021 | 3300049532 | Bacteria | 2235 |
| 1610 | Ga0501317_020404 | 3300049533 | Bacteria | 893 |
| 1611 | Ga0501317_049831 | 3300049533 | Bacteria | 662 |
| 1612 | Ga0501318_000548 | 3300049534 | Bacteria | 2463 |
| 1613 | Ga0501320_002265 | 3300049536 | Bacteria | 1522 |
| 1614 | Ga0501320_017439 | 3300049536 | Bacteria | 803 |
| 1615 | Ga0501323_006346 | 3300049539 | Bacteria | 1319 |
| 1616 | Ga0501323_011600 | 3300049539 | Bacteria | 1066 |
| 1617 | Ga0501323_051180 | 3300049539 | Bacteria | 627 |
| 1618 | Ga0501325_029777 | 3300049541 | Bacteria | 620 |
| 1619 | Ga0501031_0414151 | 3300049568 | Bacteria | 871 |
| 1620 | Ga0501032_0525586 | 3300049569 | Bacteria | 755 |
| 1621 | Ga0501033_0049659 | 3300049570 | Bacteria | 3114 |
| 1622 | Ga0501033_0106171 | 3300049570 | Bacteria | 2046 |
| 1623 | Ga0501033_0713753 | 3300049570 | Bacteria | 682 |
| 1624 | Ga0501036_0023621 | 3300049572 | Bacteria | 5181 |
| 1625 | Ga0501036_0041349 | 3300049572 | Bacteria | 3901 |
| 1626 | Ga0501036_0048255 | 3300049572 | Bacteria | 3605 |
| 1627 | Ga0501036_0061179 | 3300049572 | Bacteria | 3190 |
| 1628 | Ga0501036_0230381 | 3300049572 | Bacteria | 1555 |
| 1629 | Ga0501036_0533062 | 3300049572 | Bacteria | 976 |
| 1630 | Ga0501036_1443853 | 3300049572 | Bacteria | 557 |
| 1631 | Ga0501037_0024581 | 3300049573 | Bacteria | 4455 |
| 1632 | Ga0501037_0067017 | 3300049573 | Bacteria | 2614 |
| 1633 | Ga0501037_0071416 | 3300049573 | Bacteria | 2525 |
| 1634 | Ga0501037_0146633 | 3300049573 | Bacteria | 1688 |
| 1635 | Ga0501038_0015092 | 3300049574 | Bacteria | 7031 |
| 1636 | Ga0501038_0090870 | 3300049574 | Bacteria | 2558 |
| 1637 | Ga0501039_0021546 | 3300049575 | Bacteria | 4943 |
| 1638 | Ga0501039_0115981 | 3300049575 | Bacteria | 2096 |
| 1639 | Ga0501039_0428377 | 3300049575 | Bacteria | 1039 |
| 1640 | Ga0501039_0702981 | 3300049575 | Bacteria | 790 |
| 1641 | Ga0501040_0008066 | 3300049576 | Bacteria | 6839 |
| 1642 | Ga0501040_0157352 | 3300049576 | Bacteria | 1605 |
| 1643 | Ga0501040_0315558 | 3300049576 | Bacteria | 1118 |
| 1644 | Ga0501040_0716304 | 3300049576 | Bacteria | 724 |
| 1645 | Ga0501040_0970565 | 3300049576 | Bacteria | 616 |
| 1646 | Ga0501040_1098647 | 3300049576 | Bacteria | 577 |
| 1647 | Ga0501041_0001598 | 3300049577 | Bacteria | 12636 |
| 1648 | Ga0501041_0119305 | 3300049577 | Bacteria | 1638 |
| 1649 | Ga0501041_0275567 | 3300049577 | Bacteria | 1058 |
| 1650 | Ga0501041_0315177 | 3300049577 | Bacteria | 986 |
| 1651 | Ga0501041_0665193 | 3300049577 | Bacteria | 666 |
| 1652 | Ga0501041_0775507 | 3300049577 | Bacteria | 614 |
| 1653 | Ga0501042_0001373 | 3300049578 | Bacteria | 14288 |
| 1654 | Ga0501042_0144131 | 3300049578 | Bacteria | 1718 |
| 1655 | Ga0501042_0158721 | 3300049578 | Bacteria | 1631 |
| 1656 | Ga0501042_0295714 | 3300049578 | Bacteria | 1170 |
| 1657 | Ga0501042_0741520 | 3300049578 | Bacteria | 714 |
| 1658 | Ga0501042_1295130 | 3300049578 | Bacteria | 531 |
| 1659 | Ga0501043_0000090 | 3300049579 | Bacteria | 81336 |
| 1660 | Ga0501043_0033943 | 3300049579 | Bacteria | 4014 |
| 1661 | Ga0501043_0542364 | 3300049579 | Bacteria | 865 |
| 1662 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 1663 | Ga0501046_0015243 | 3300049580 | Bacteria | 6464 |
| 1664 | Ga0501046_0105554 | 3300049580 | Bacteria | 2157 |
| 1665 | Ga0501046_0179631 | 3300049580 | Bacteria | 1583 |
| 1666 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 1667 | Ga0501047_0364875 | 3300049581 | Bacteria | 1280 |
| 1668 | Ga0501048_0003429 | 3300049582 | Bacteria | 12039 |
| 1669 | Ga0501048_0009558 | 3300049582 | Bacteria | 7281 |
| 1670 | Ga0501048_0067468 | 3300049582 | Bacteria | 2528 |
| 1671 | Ga0501048_0282946 | 3300049582 | Bacteria | 1179 |
| 1672 | Ga0501048_0590393 | 3300049582 | Bacteria | 797 |
| 1673 | Ga0501067_0031483 | 3300049583 | Bacteria | 2943 |
| 1674 | Ga0501067_0424614 | 3300049583 | Bacteria | 742 |
| 1675 | Ga0501067_0472701 | 3300049583 | Bacteria | 701 |
| 1676 | Ga0501068_0001465 | 3300049584 | Bacteria | 12558 |
| 1677 | Ga0501068_0026867 | 3300049584 | Bacteria | 3395 |
| 1678 | Ga0501068_0041518 | 3300049584 | Bacteria | 2764 |
| 1679 | Ga0501068_0525903 | 3300049584 | Bacteria | 768 |
| 1680 | Ga0501069_0333741 | 3300049585 | Bacteria | 892 |
| 1681 | Ga0501070_0044235 | 3300049586 | Bacteria | 3706 |
| 1682 | Ga0501070_0169408 | 3300049586 | Bacteria | 1799 |
| 1683 | Ga0501070_0297912 | 3300049586 | Bacteria | 1314 |
| 1684 | Ga0501071_0003527 | 3300049587 | Bacteria | 9786 |
| 1685 | Ga0501071_0024289 | 3300049587 | Bacteria | 4238 |
| 1686 | Ga0501071_0102836 | 3300049587 | Bacteria | 2107 |
| 1687 | Ga0501071_0144858 | 3300049587 | Bacteria | 1770 |
| 1688 | Ga0501071_0160335 | 3300049587 | Bacteria | 1681 |
| 1689 | Ga0501071_0259097 | 3300049587 | Bacteria | 1313 |
| 1690 | Ga0501071_1294920 | 3300049587 | Bacteria | 563 |
| 1691 | Ga0501072_0025385 | 3300049588 | Bacteria | 4617 |
| 1692 | Ga0501072_0063312 | 3300049588 | Bacteria | 2917 |
| 1693 | Ga0501072_0101863 | 3300049588 | Bacteria | 2282 |
| 1694 | Ga0501072_0140535 | 3300049588 | Bacteria | 1925 |
| 1695 | Ga0501072_0321792 | 3300049588 | Bacteria | 1229 |
| 1696 | Ga0501072_0327339 | 3300049588 | Bacteria | 1217 |
| 1697 | Ga0501072_0407521 | 3300049588 | Bacteria | 1078 |
| 1698 | Ga0501072_0513025 | 3300049588 | Bacteria | 948 |
| 1699 | Ga0501072_0916870 | 3300049588 | Bacteria | 684 |
| 1700 | Ga0501073_0000525 | 3300049589 | Bacteria | 26880 |
| 1701 | Ga0501073_0216221 | 3300049589 | Bacteria | 1324 |
| 1702 | Ga0501074_0001124 | 3300049590 | Bacteria | 17502 |
| 1703 | Ga0501074_0018349 | 3300049590 | Bacteria | 5081 |
| 1704 | Ga0501074_0089815 | 3300049590 | Bacteria | 2200 |
| 1705 | Ga0501074_0222352 | 3300049590 | Bacteria | 1344 |
| 1706 | Ga0501075_0015597 | 3300049591 | Bacteria | 5453 |
| 1707 | Ga0501075_0055471 | 3300049591 | Bacteria | 2981 |
| 1708 | Ga0501075_0062590 | 3300049591 | Bacteria | 2805 |
| 1709 | Ga0501075_0231797 | 3300049591 | Bacteria | 1408 |
| 1710 | Ga0501075_0247801 | 3300049591 | Bacteria | 1358 |
| 1711 | Ga0501075_0307152 | 3300049591 | Bacteria | 1209 |
| 1712 | Ga0501075_0484848 | 3300049591 | Bacteria | 943 |
| 1713 | Ga0501076_0004639 | 3300049592 | Bacteria | 9791 |
| 1714 | Ga0501076_0022764 | 3300049592 | Bacteria | 4818 |
| 1715 | Ga0501076_0028505 | 3300049592 | Bacteria | 4336 |
| 1716 | Ga0501076_0046380 | 3300049592 | Bacteria | 3434 |
| 1717 | Ga0501076_0079520 | 3300049592 | Bacteria | 2631 |
| 1718 | Ga0501077_0002875 | 3300049593 | Bacteria | 10325 |
| 1719 | Ga0501077_0007629 | 3300049593 | Bacteria | 6677 |
| 1720 | Ga0501077_0029086 | 3300049593 | Bacteria | 3512 |
| 1721 | Ga0501077_0049998 | 3300049593 | Bacteria | 2657 |
| 1722 | Ga0501077_0059648 | 3300049593 | Bacteria | 2422 |
| 1723 | Ga0501077_0271589 | 3300049593 | Bacteria | 1079 |
| 1724 | Ga0501199_034729 | 3300049650 | Bacteria | 634 |
| 1725 | Ga0501206_009648 | 3300049653 | Bacteria | 1286 |
| 1726 | Ga0501206_015309 | 3300049653 | Bacteria | 1061 |
| 1727 | Ga0501207_022199 | 3300049654 | Bacteria | 1024 |
| 1728 | Ga0501222_041246 | 3300049662 | Bacteria | 656 |
| 1729 | Ga0501228_000607 | 3300049666 | Bacteria | 2339 |
| 1730 | Ga0501239_055810 | 3300049672 | Bacteria | 583 |
| 1731 | Ga0501242_069704 | 3300049674 | Bacteria | 549 |
| 1732 | Ga0501219_009206 | 3300049703 | Bacteria | 729 |
| 1733 | Ga0501234_053845 | 3300049707 | Bacteria | 673 |
| 1734 | Ga0501079_0004772 | 3300049741 | Bacteria | 10039 |
| 1735 | Ga0501079_0006996 | 3300049741 | Bacteria | 8503 |
| 1736 | Ga0501079_0179169 | 3300049741 | Bacteria | 1653 |
| 1737 | Ga0501079_0431909 | 3300049741 | Bacteria | 1034 |
| 1738 | Ga0501079_1077032 | 3300049741 | Bacteria | 633 |
| 1739 | Ga0501079_1097558 | 3300049741 | Bacteria | 627 |
| 1740 | Ga0501080_0001373 | 3300049742 | Bacteria | 20360 |
| 1741 | Ga0501080_0011395 | 3300049742 | Bacteria | 8144 |
| 1742 | Ga0501080_0028144 | 3300049742 | Bacteria | 5226 |
| 1743 | Ga0501080_0037660 | 3300049742 | Bacteria | 4517 |
| 1744 | Ga0501080_0286093 | 3300049742 | Bacteria | 1498 |
| 1745 | Ga0501080_0748801 | 3300049742 | Bacteria | 859 |
| 1746 | Ga0501080_0794587 | 3300049742 | Bacteria | 830 |
| 1747 | Ga0501080_1256064 | 3300049742 | Bacteria | 635 |
| 1748 | Ga0501081_0006719 | 3300049743 | Bacteria | 7480 |
| 1749 | Ga0501081_0018126 | 3300049743 | Bacteria | 4672 |
| 1750 | Ga0501081_0332797 | 3300049743 | Bacteria | 1117 |
| 1751 | Ga0501081_1326275 | 3300049743 | Bacteria | 546 |
| 1752 | Ga0501083_0004501 | 3300049744 | Bacteria | 9845 |
| 1753 | Ga0501083_0032077 | 3300049744 | Bacteria | 3604 |
| 1754 | Ga0501083_0079781 | 3300049744 | Bacteria | 2170 |
| 1755 | Ga0501083_0670429 | 3300049744 | Bacteria | 674 |
| 1756 | Ga0501265_013043 | 3300049762 | Bacteria | 1042 |
| 1757 | Ga0501280_000425 | 3300049776 | Bacteria | 10117 |
| 1758 | Ga0501281_07163 | 3300049777 | Bacteria | 778 |
| 1759 | Ga0501035_0180906 | 3300049822 | Bacteria | 1816 |
| 1760 | Ga0501035_0729904 | 3300049822 | Bacteria | 797 |
| 1761 | Ga0501044_0057237 | 3300049823 | Bacteria | 4001 |
| 1762 | Ga0501044_0344411 | 3300049823 | Bacteria | 1411 |
| 1763 | Ga0501044_0644482 | 3300049823 | Bacteria | 949 |
| 1764 | Ga0501044_0934012 | 3300049823 | Bacteria | 741 |
| 1765 | Ga0501045_0000882 | 3300049824 | Bacteria | 19499 |
| 1766 | Ga0501045_0008747 | 3300049824 | Bacteria | 7062 |
| 1767 | Ga0501045_0084307 | 3300049824 | Bacteria | 2344 |
| 1768 | Ga0501045_0089934 | 3300049824 | Bacteria | 2268 |
| 1769 | Ga0501045_0477922 | 3300049824 | Bacteria | 926 |
| 1770 | Ga0501045_1369787 | 3300049824 | Bacteria | 514 |
| 1771 | nmdc:mga03683_177263_c1 | 3300050489 | Bacteria | 971 |
| 1772 | nmdc:mga03683_18745_c1 | 3300050489 | Bacteria | 2635 |
| 1773 | nmdc:mga03683_330406_c1 | 3300050489 | Bacteria | 719 |
| 1774 | nmdc:mga03n38_4851_c1 | 3300050490 | Bacteria | 4507 |
| 1775 | nmdc:mga03n38_660515_c1 | 3300050490 | Bacteria | 600 |
| 1776 | nmdc:mga00v17_103467_c1 | 3300050491 | Bacteria | 1800 |
| 1777 | nmdc:mga00v17_1065507_c1 | 3300050491 | Bacteria | 507 |
| 1778 | nmdc:mga00v17_17620_c1 | 3300050491 | Bacteria | 4047 |
| 1779 | nmdc:mga00v17_53813_c1 | 3300050491 | Bacteria | 2454 |
| 1780 | nmdc:mga00v17_744286_c1 | 3300050491 | Bacteria | 627 |
| 1781 | nmdc:mga00v17_803227_c1 | 3300050491 | Bacteria | 599 |
| 1782 | nmdc:mga0yw44_11539_c1 | 3300050492 | Bacteria | 4567 |
| 1783 | nmdc:mga0yw44_283449_c1 | 3300050492 | Bacteria | 1108 |
| 1784 | nmdc:mga0k408_1021_c1 | 3300050493 | Bacteria | 15347 |
| 1785 | nmdc:mga0k408_109049_c1 | 3300050493 | Bacteria | 1636 |
| 1786 | nmdc:mga0k408_12806_c1 | 3300050493 | Bacteria | 4590 |
| 1787 | nmdc:mga0k408_137955_c1 | 3300050493 | Bacteria | 1450 |
| 1788 | nmdc:mga0k408_145503_c1 | 3300050493 | Bacteria | 1411 |
| 1789 | nmdc:mga0k408_149455_c1 | 3300050493 | Bacteria | 1391 |
| 1790 | nmdc:mga0k408_153215_c1 | 3300050493 | Bacteria | 1373 |
| 1791 | nmdc:mga0k408_17814_c1 | 3300050493 | Bacteria | 3959 |
| 1792 | nmdc:mga0k408_205529_c1 | 3300050493 | Bacteria | 1176 |
| 1793 | nmdc:mga0k408_210024_c1 | 3300050493 | Bacteria | 1162 |
| 1794 | nmdc:mga0k408_219_c1 | 3300050493 | Bacteria | 23656 |
| 1795 | nmdc:mga0k408_23422_c1 | 3300050493 | Bacteria | 3483 |
| 1796 | nmdc:mga0k408_23786_c1 | 3300050493 | Bacteria | 3460 |
| 1797 | nmdc:mga0k408_28249_c1 | 3300050493 | Bacteria | 3190 |
| 1798 | nmdc:mga0k408_283141_c1 | 3300050493 | Bacteria | 990 |
| 1799 | nmdc:mga0k408_318491_c1 | 3300050493 | Bacteria | 928 |
| 1800 | nmdc:mga0k408_43703_c1 | 3300050493 | Bacteria | 2583 |
| 1801 | nmdc:mga0k408_46982_c1 | 3300050493 | Bacteria | 2494 |
| 1802 | nmdc:mga0k408_49108_c1 | 3300050493 | Bacteria | 2443 |
| 1803 | nmdc:mga0k408_57150_c1 | 3300050493 | Bacteria | 2265 |
| 1804 | nmdc:mga0k408_59396_c1 | 3300050493 | Bacteria | 2222 |
| 1805 | nmdc:mga0k408_61835_c1 | 3300050493 | Bacteria | 2177 |
| 1806 | nmdc:mga0k408_65064_c1 | 3300050493 | Bacteria | 2122 |
| 1807 | nmdc:mga0k408_712_c1 | 3300050493 | Bacteria | 18213 |
| 1808 | nmdc:mga06z11_229350_c1 | 3300050494 | Bacteria | 1088 |
| 1809 | nmdc:mga06z11_267106_c1 | 3300050494 | Bacteria | 1011 |
| 1810 | nmdc:mga06z11_3023_c1 | 3300050494 | Bacteria | 6473 |
| 1811 | nmdc:mga06z11_31530_c1 | 3300050494 | Bacteria | 2577 |
| 1812 | nmdc:mga04h51_184316_c1 | 3300050495 | Bacteria | 814 |
| 1813 | nmdc:mga07m45_109788_c1 | 3300050496 | Bacteria | 1588 |
| 1814 | nmdc:mga07m45_15127_c1 | 3300050496 | Bacteria | 4120 |
| 1815 | nmdc:mga07m45_196968_c1 | 3300050496 | Bacteria | 1172 |
| 1816 | nmdc:mga07m45_20386_c1 | 3300050496 | Bacteria | 3601 |
| 1817 | nmdc:mga07m45_359059_c1 | 3300050496 | Bacteria | 847 |
| 1818 | nmdc:mga07m45_521105_c1 | 3300050496 | Bacteria | 688 |
| 1819 | nmdc:mga07m45_69529_c1 | 3300050496 | Bacteria | 2002 |
| 1820 | nmdc:mga07m45_74068_c1 | 3300050496 | Bacteria | 1940 |
| 1821 | nmdc:mga07m45_752759_c1 | 3300050496 | Bacteria | 559 |
| 1822 | nmdc:mga07m45_905430_c1 | 3300050496 | Bacteria | 505 |
| 1823 | nmdc:mga05p37_1575417_c1 | 3300050507 | Bacteria | 649 |
| 1824 | nmdc:mga09592_38477_c1 | 3300050508 | Bacteria | 4016 |
| 1825 | nmdc:mga09592_533821_c1 | 3300050508 | Bacteria | 1008 |
| 1826 | nmdc:mga0qj67_274367_c1 | 3300050509 | Bacteria | 1367 |
| 1827 | nmdc:mga0qj67_50093_c1 | 3300050509 | Bacteria | 3301 |
| 1828 | nmdc:mga0qj67_662317_c1 | 3300050509 | Bacteria | 832 |
| 1829 | nmdc:mga08y16_1296713_c1 | 3300050511 | Bacteria | 695 |
| 1830 | nmdc:mga08y16_208685_c1 | 3300050511 | Bacteria | 2023 |
| 1831 | nmdc:mga08y16_2559_c1 | 3300050511 | Bacteria | 18707 |
| 1832 | nmdc:mga08y16_397291_c1 | 3300050511 | Bacteria | 1411 |
| 1833 | nmdc:mga08y16_485070_c1 | 3300050511 | Bacteria | 1257 |
| 1834 | nmdc:mga08y16_731543_c1 | 3300050511 | Bacteria | 987 |
| 1835 | nmdc:mga08y16_977479_c1 | 3300050511 | Bacteria | 828 |
| 1836 | nmdc:mga0n895_158049_c1 | 3300050512 | Bacteria | 2298 |
| 1837 | nmdc:mga0n895_1599570_c1 | 3300050512 | Bacteria | 616 |
| 1838 | nmdc:mga0n895_789078_c1 | 3300050512 | Bacteria | 941 |
| 1839 | nmdc:mga0rr50_369987_c1 | 3300050513 | Bacteria | 1207 |
| 1840 | nmdc:mga0rr50_423398_c1 | 3300050513 | Bacteria | 1126 |
| 1841 | nmdc:mga0rr50_474247_c1 | 3300050513 | Bacteria | 1062 |
| 1842 | nmdc:mga08x19_2026_c1 | 3300050514 | Bacteria | 12425 |
| 1843 | nmdc:mga0sz30_3989_c1 | 3300050516 | Bacteria | 5314 |
| 1844 | Ga0495601_0002182 | 3300053077 | Bacteria | 11016 |
| 1845 | Ga0495601_0338822 | 3300053077 | Bacteria | 978 |
| 1846 | Ga0495601_0761682 | 3300053077 | Bacteria | 616 |
| 1847 | Ga0495612_0100041 | 3300053078 | Bacteria | 1234 |
| 1848 | Ga0495612_0132131 | 3300053078 | Bacteria | 1079 |
| 1849 | Ga0500635_0116347 | 3300053080 | Bacteria | 997 |
| 1850 | Ga0495655_0027539 | 3300053083 | Bacteria | 1349 |
| 1851 | Ga0495655_0065643 | 3300053083 | Bacteria | 1002 |
| 1852 | Ga0495655_0252931 | 3300053083 | Bacteria | 593 |
| 1853 | Ga0495595_0249086 | 3300053084 | Bacteria | 889 |
| 1854 | Ga0495595_0329422 | 3300053084 | Bacteria | 769 |
| 1855 | Ga0495595_0730298 | 3300053084 | Bacteria | 508 |
| 1856 | Ga0495619_0071847 | 3300053085 | Bacteria | 2316 |
| 1857 | Ga0495619_0076699 | 3300053085 | Bacteria | 2244 |
| 1858 | Ga0495619_0264261 | 3300053085 | Bacteria | 1192 |
| 1859 | Ga0495619_0656583 | 3300053085 | Bacteria | 715 |
| 1860 | Ga0500578_0000292 | 3300053086 | Bacteria | 61943 |
| 1861 | Ga0500578_0079895 | 3300053086 | Bacteria | 2081 |
| 1862 | Ga0500643_048658 | 3300053087 | Bacteria | 1218 |
| 1863 | Ga0500644_0003475 | 3300053088 | Bacteria | 3899 |
| 1864 | Ga0500644_0024450 | 3300053088 | Bacteria | 1847 |
| 1865 | Ga0500646_0014216 | 3300053090 | Bacteria | 2064 |
| 1866 | Ga0500646_0053402 | 3300053090 | Bacteria | 1172 |
| 1867 | Ga0500646_0333222 | 3300053090 | Bacteria | 550 |
| 1868 | Ga0500651_0000274 | 3300053093 | Bacteria | 30518 |
| 1869 | Ga0500651_0129786 | 3300053093 | Bacteria | 1525 |
| 1870 | Ga0500651_0169517 | 3300053093 | Bacteria | 1302 |
| 1871 | Ga0500566_0399313 | 3300053094 | Bacteria | 616 |
| 1872 | Ga0500641_0352164 | 3300053096 | Bacteria | 591 |
| 1873 | Ga0500648_382663 | 3300053097 | Bacteria | 548 |
| 1874 | Ga0500650_0150156 | 3300053098 | Bacteria | 1077 |
| 1875 | Ga0500562_019007 | 3300053108 | Bacteria | 1775 |
| 1876 | Ga0500562_081775 | 3300053108 | Bacteria | 874 |
| 1877 | Ga0500569_001743 | 3300053109 | Bacteria | 4166 |
| 1878 | Ga0500593_000235 | 3300053117 | Bacteria | 22775 |
| 1879 | Ga0500593_079766 | 3300053117 | Bacteria | 1405 |
| 1880 | Ga0500594_0013014 | 3300053118 | Bacteria | 1970 |
| 1881 | Ga0500607_155896 | 3300053121 | Bacteria | 1051 |
| 1882 | Ga0500608_169075 | 3300053122 | Bacteria | 939 |
| 1883 | Ga0500621_000035 | 3300053126 | Bacteria | 26463 |
| 1884 | Ga0500628_006199 | 3300053129 | Bacteria | 2015 |
| 1885 | Ga0500628_019518 | 3300053129 | Bacteria | 1350 |
| 1886 | Ga0500628_167610 | 3300053129 | Bacteria | 622 |
| 1887 | Ga0500642_0002530 | 3300053130 | Bacteria | 5383 |
| 1888 | Ga0500652_000400 | 3300053131 | Bacteria | 15538 |
| 1889 | Ga0500652_069558 | 3300053131 | Bacteria | 1457 |
| 1890 | Ga0500658_0026976 | 3300053134 | Bacteria | 2217 |
| 1891 | Ga0500658_0190721 | 3300053134 | Bacteria | 935 |
| 1892 | Ga0500559_0000097 | 3300053136 | Bacteria | 70124 |
| 1893 | Ga0500564_150120 | 3300053138 | Bacteria | 994 |
| 1894 | Ga0500568_0013644 | 3300053139 | Bacteria | 3696 |
| 1895 | Ga0500568_0015583 | 3300053139 | Bacteria | 3401 |
| 1896 | Ga0500568_0079576 | 3300053139 | Bacteria | 1245 |
| 1897 | Ga0500577_0017376 | 3300053142 | Bacteria | 2289 |
| 1898 | Ga0500579_268554 | 3300053143 | Bacteria | 534 |
| 1899 | Ga0500588_0096304 | 3300053146 | Bacteria | 1014 |
| 1900 | Ga0500589_225266 | 3300053147 | Bacteria | 704 |
| 1901 | Ga0500604_0178893 | 3300053151 | Bacteria | 726 |
| 1902 | Ga0500616_0096791 | 3300053153 | Bacteria | 1450 |
| 1903 | Ga0500619_000012 | 3300053154 | Bacteria | 57280 |
| 1904 | Ga0500619_259909 | 3300053154 | Bacteria | 569 |
| 1905 | Ga0500620_057705 | 3300053155 | Bacteria | 1316 |
| 1906 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 1907 | Ga0500622_0000978 | 3300053156 | Bacteria | 24237 |
| 1908 | Ga0500627_0176007 | 3300053158 | Bacteria | 963 |
| 1909 | Ga0500638_200485 | 3300053162 | Bacteria | 845 |
| 1910 | Ga0500636_0125261 | 3300053177 | Bacteria | 1437 |
| 1911 | Ga0500649_215694 | 3300053722 | Bacteria | 601 |
| 1912 | Ga0500570_133500 | 3300053724 | Bacteria | 935 |
| 1913 | Ga0500645_030754 | 3300053730 | Bacteria | 1615 |
| 1914 | Ga0500613_001534 | 3300053738 | Bacteria | 1645 |
| 1915 | Ga0500587_000541 | 3300053739 | Bacteria | 4638 |
| 1916 | Ga0500587_006132 | 3300053739 | Bacteria | 1604 |
| 1917 | Ga0501084_0008704 | 3300054114 | Bacteria | 8394 |
| 1918 | Ga0501084_0022568 | 3300054114 | Bacteria | 5252 |
| 1919 | Ga0501084_0144399 | 3300054114 | Bacteria | 2004 |
| 1920 | Ga0501084_0152777 | 3300054114 | Bacteria | 1946 |
| 1921 | Ga0501084_0285140 | 3300054114 | Bacteria | 1395 |
| 1922 | Ga0501084_0285445 | 3300054114 | Bacteria | 1394 |
| 1923 | Ga0501084_0502704 | 3300054114 | Bacteria | 1024 |
| 1924 | Ga0501084_0638875 | 3300054114 | Bacteria | 899 |
| 1925 | Ga0501084_0874625 | 3300054114 | Bacteria | 756 |
| 1926 | Ga0500661_024419 | 3300055283 | Bacteria | 1069 |
| 1927 | Ga0590075_024840 | 3300059424 | Bacteria | 1505 |
| 1928 | Ga0501082_0004231 | 3300060353 | Bacteria | 12537 |
| 1929 | Ga0501082_0043889 | 3300060353 | Bacteria | 3857 |
| 1930 | Ga0501082_0087089 | 3300060353 | Bacteria | 2694 |
| 1931 | Ga0501082_1949896 | 3300060353 | Bacteria | 512 |
| 1932 | Ga0466962_0341172 | 3300061719 | Bacteria | 745 |
| 1933 | Ga0530510_0006785 | 3300061734 | Bacteria | 7977 |
| 1934 | Ga0530510_0007174 | 3300061734 | Bacteria | 7756 |
| 1935 | Ga0530510_0119058 | 3300061734 | Bacteria | 1938 |
| 1936 | Ga0530510_0121012 | 3300061734 | Bacteria | 1922 |
| 1937 | Ga0530510_0170978 | 3300061734 | Bacteria | 1609 |
| 1938 | Ga0530510_0195752 | 3300061734 | Bacteria | 1501 |
| 1939 | Ga0530510_0329770 | 3300061734 | Bacteria | 1145 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046694 | Ga0495649_0026025 | Ga0495649_0026025_24_338 | 103 |
| 2 | 3300047446 | Ga0495679_051289 | Ga0495679_051289_24_338 | 103 |
| 3 | 3300044712 | Ga0453684_1793636 | Ga0453684_1793636_266_607 | 113 |
| 4 | 3300046809 | Ga0495600_0740671 | Ga0495600_0740671_10_351 | 113 |
| 5 | 3300049529 | Ga0501313_009732 | Ga0501313_009732_701_1042 | 113 |
| 6 | 3300049539 | Ga0501323_051180 | Ga0501323_051180_212_553 | 113 |
| 7 | 3300049777 | Ga0501281_07163 | Ga0501281_07163_15_356 | 113 |
| 8 | 3300050489 | nmdc:mga03683_177263_c1 | nmdc:mga03683_177263_c1_10_351 | 113 |
| 9 | 3300053722 | Ga0500649_215694 | Ga0500649_215694_199_540 | 113 |
| 10 | 3300055283 | Ga0500661_024419 | Ga0500661_024419_712_1053 | 113 |
| 11 | 3300009093 | Ga0105240_11610931 | Ga0105240_116109312 | 117 |
| 12 | 3300039110 | Ga0400487_16155 | Ga0400487_16155_584_943 | 118 |
| 13 | 3300039437 | Ga0436365_1793886 | Ga0436365_1793886_142_501 | 119 |
| 14 | 3300005563 | Ga0068855_100288384 | Ga0068855_1002883844 | 120 |
| 15 | 3300009093 | Ga0105240_10230108 | Ga0105240_102301081 | 120 |
| 16 | 3300025919 | Ga0207657_10109580 | Ga0207657_101095802 | 120 |
| 17 | 3300025949 | Ga0207667_10246512 | Ga0207667_102465122 | 120 |
| 18 | 3300032005 | Ga0307411_11544693 | Ga0307411_115446931 | 120 |
| 19 | 3300037418 | Ga0395900_0034072 | Ga0395900_0034072_1664_2059 | 120 |
| 20 | 3300037471 | Ga0395905_0048048 | Ga0395905_0048048_1617_2012 | 120 |
| 21 | 3300038443 | Ga0395901_0033769 | Ga0395901_0033769_2633_3028 | 120 |
| 22 | 3300046537 | Ga0495598_0388963 | Ga0495598_0388963_88_483 | 120 |
| 23 | 3300046692 | Ga0495671_0421684 | Ga0495671_0421684_155_550 | 120 |
| 24 | 3300006871 | Ga0075434_100381290 | Ga0075434_1003812902 | 121 |
| 25 | 3300050512 | nmdc:mga0n895_158049_c1 | nmdc:mga0n895_158049_c1_1389_1784 | 121 |
| 26 | 3300035089 | Ga0373944_0037967 | Ga0373944_0037967_20_388 | 122 |
| 27 | 3300035113 | Ga0373936_0023106 | Ga0373936_0023106_2041_2409 | 122 |
| 28 | 3300041451 | Ga0451791_1736819 | Ga0451791_1736819_151_519 | 122 |
| 29 | 3300041503 | Ga0451847_0437573 | Ga0451847_0437573_10_378 | 122 |
| 30 | 3300042126 | Ga0450888_000936 | Ga0450888_000936_21_389 | 122 |
| 31 | 3300049536 | Ga0501320_017439 | Ga0501320_017439_417_785 | 122 |
| 32 | 3300049541 | Ga0501325_029777 | Ga0501325_029777_235_603 | 122 |
| 33 | 3300049576 | Ga0501040_1098647 | Ga0501040_1098647_195_563 | 122 |
| 34 | 3300049579 | Ga0501043_0033943 | Ga0501043_0033943_11_379 | 122 |
| 35 | 3300049653 | Ga0501206_015309 | Ga0501206_015309_11_379 | 122 |
| 36 | 3300049744 | Ga0501083_0670429 | Ga0501083_0670429_16_384 | 122 |
| 37 | 3300049824 | Ga0501045_1369787 | Ga0501045_1369787_134_502 | 122 |
| 38 | 3300050493 | nmdc:mga0k408_43703_c1 | nmdc:mga0k408_43703_c1_2195_2563 | 122 |
| 39 | 3300050512 | nmdc:mga0n895_789078_c1 | nmdc:mga0n895_789078_c1_560_928 | 122 |
| 40 | 3300013308 | Ga0157375_10054039 | Ga0157375_100540398 | 123 |
| 41 | 3300035695 | Ga0373927_0296254 | Ga0373927_0296254_188_583 | 124 |
| 42 | 3300042876 | Ga0451577_1834259 | Ga0451577_1834259_68_457 | 124 |
| 43 | 3300049130 | Ga0501310_039742 | Ga0501310_039742_29_418 | 124 |
| 44 | iso_pu_bacteria | 2671180115 | 2671589088 | 125 |
| 45 | iso_pu_bacteria | 2842733646 | 2842737855 | 125 |
| 46 | iso_pu_bacteria | 2844425489 | 2844429341 | 125 |
| 47 | iso_pu_bacteria | 2847085930 | 2847090216 | 125 |
| 48 | iso_pu_bacteria | 2885198086 | 2885203832 | 125 |
| 49 | iso_pu_bacteria | 2885211737 | 2885217833 | 125 |
| 50 | iso_pu_bacteria | 2904456579 | 2904457935 | 125 |
| 51 | iso_pu_bacteria | 2904541872 | 2904546672 | 125 |
| 52 | iso_pu_bacteria | 2908669403 | 2908674746 | 125 |
| 53 | iso_pu_bacteria | 2919704043 | 2919708820 | 125 |
| 54 | iso_pu_bacteria | 2928064002 | 2928067946 | 125 |
| 55 | iso_pu_bacteria | 2928070936 | 2928072519 | 125 |
| 56 | iso_pu_bacteria | 2929160207 | 2929166123 | 125 |
| 57 | 3300005327 | Ga0070658_10646415 | Ga0070658_106464151 | 126 |
| 58 | 3300005444 | Ga0070694_100354195 | Ga0070694_1003541952 | 126 |
| 59 | 3300005840 | Ga0068870_10523936 | Ga0068870_105239362 | 126 |
| 60 | 3300006871 | Ga0075434_100441455 | Ga0075434_1004414553 | 126 |
| 61 | 3300006914 | Ga0075436_100000862 | Ga0075436_10000086215 | 126 |
| 62 | 3300007076 | Ga0075435_100054923 | Ga0075435_1000549232 | 126 |
| 63 | 3300009147 | Ga0114129_10804073 | Ga0114129_108040733 | 126 |
| 64 | 3300025885 | Ga0207653_10294067 | Ga0207653_102940671 | 126 |
| 65 | 3300025908 | Ga0207643_10876353 | Ga0207643_108763532 | 126 |
| 66 | 3300028380 | Ga0268265_10832986 | Ga0268265_108329863 | 126 |
| 67 | 3300031911 | Ga0307412_10537689 | Ga0307412_105376893 | 126 |
| 68 | 3300032002 | Ga0307416_100099454 | Ga0307416_1000994543 | 126 |
| 69 | 3300042876 | Ga0451577_0662158 | Ga0451577_0662158_517_912 | 126 |
| 70 | 3300044693 | Ga0466961_0117869 | Ga0466961_0117869_318_713 | 126 |
| 71 | 3300044842 | Ga0466957_0004472 | Ga0466957_0004472_132_527 | 126 |
| 72 | 3300045049 | Ga0466959_0074108 | Ga0466959_0074108_670_1065 | 126 |
| 73 | 3300045836 | Ga0466958_0062229 | Ga0466958_0062229_1237_1632 | 126 |
| 74 | 3300050514 | nmdc:mga08x19_2026_c1 | nmdc:mga08x19_2026_c1_8210_8605 | 126 |
| 75 | 3300061719 | Ga0466962_0341172 | Ga0466962_0341172_104_499 | 126 |
| 76 | 3300009036 | Ga0105244_10533668 | Ga0105244_105336682 | 127 |
| 77 | 3300013102 | Ga0157371_10020143 | Ga0157371_100201432 | 127 |
| 78 | 3300013308 | Ga0157375_10225576 | Ga0157375_102255762 | 127 |
| 79 | 3300039062 | Ga0400483_081993 | Ga0400483_081993_2939_3325 | 127 |
| 80 | 3300039062 | Ga0400483_151841 | Ga0400483_151841_4139_4525 | 127 |
| 81 | 3300046458 | Ga0495591_001371 | Ga0495591_001371_11003_11389 | 127 |
| 82 | 3300046471 | Ga0495650_0000787 | Ga0495650_0000787_17226_17612 | 127 |
| 83 | 3300046474 | Ga0495605_0003552 | Ga0495605_0003552_2122_2508 | 127 |
| 84 | 3300046474 | Ga0495605_0454085 | Ga0495605_0454085_39_425 | 127 |
| 85 | 3300046491 | Ga0495584_0002357 | Ga0495584_0002357_1479_1865 | 127 |
| 86 | 3300046501 | Ga0495607_0010060 | Ga0495607_0010060_1076_1462 | 127 |
| 87 | 3300046507 | Ga0495606_0004907 | Ga0495606_0004907_4523_4909 | 127 |
| 88 | 3300046513 | Ga0495616_0052060 | Ga0495616_0052060_1114_1500 | 127 |
| 89 | 3300046518 | Ga0495631_0005719 | Ga0495631_0005719_1401_1787 | 127 |
| 90 | 3300046523 | Ga0495644_0000420 | Ga0495644_0000420_8763_9149 | 127 |
| 91 | 3300046524 | Ga0495648_0007953 | Ga0495648_0007953_5214_5600 | 127 |
| 92 | 3300046530 | Ga0495654_0000178 | Ga0495654_0000178_17187_17573 | 127 |
| 93 | 3300046692 | Ga0495671_0000488 | Ga0495671_0000488_13342_13728 | 127 |
| 94 | 3300046794 | Ga0495589_0133864 | Ga0495589_0133864_626_1012 | 127 |
| 95 | 3300046810 | Ga0495660_0000352 | Ga0495660_0000352_22805_23191 | 127 |
| 96 | 3300047320 | Ga0495672_0000011 | Ga0495672_0000011_5214_5600 | 127 |
| 97 | 3300047323 | Ga0495683_0075953 | Ga0495683_0075953_391_777 | 127 |
| 98 | 3300047469 | Ga0495673_0002408 | Ga0495673_0002408_10695_11081 | 127 |
| 99 | 3300048919 | Ga0496116_0013625 | Ga0496116_0013625_981_1367 | 127 |
| 100 | 3300048922 | Ga0496119_0010829 | Ga0496119_0010829_5130_5516 | 127 |
| 101 | 3300048923 | Ga0496120_0023855 | Ga0496120_0023855_438_824 | 127 |
| 102 | 3300049459 | Ga0495678_000882 | Ga0495678_000882_17425_17811 | 127 |
| 103 | 3300049460 | Ga0495682_0000520 | Ga0495682_0000520_17354_17740 | 127 |
| 104 | 3300053126 | Ga0500621_000035 | Ga0500621_000035_8744_9130 | 127 |
| 105 | iso_pu_bacteria | 2513020051 | 2513227574 | 127 |
| 106 | iso_pu_bacteria | 2513237150 | 2513956736 | 127 |
| 107 | iso_pu_bacteria | 2513237165 | 2514044435 | 127 |
| 108 | iso_pu_bacteria | 2547132103 | 2547375773 | 127 |
| 109 | iso_pu_bacteria | 2547132512 | 2548846597 | 127 |
| 110 | iso_pu_bacteria | 2585428057 | 2587725922 | 127 |
| 111 | iso_pu_bacteria | 2585428058 | 2587735573 | 127 |
| 112 | iso_pu_bacteria | 2585428062 | 2587758988 | 127 |
| 113 | iso_pu_bacteria | 2588253510 | 2588292865 | 127 |
| 114 | iso_pu_bacteria | 2599185214 | 2599621937 | 127 |
| 115 | iso_pu_bacteria | 2599185226 | 2599676899 | 127 |
| 116 | iso_pu_bacteria | 2599185227 | 2599685129 | 127 |
| 117 | iso_pu_bacteria | 2599185229 | 2599691447 | 127 |
| 118 | iso_pu_bacteria | 2643221544 | 2643746686 | 127 |
| 119 | iso_pu_bacteria | 2643221585 | 2643937422 | 127 |
| 120 | iso_pu_bacteria | 2643221592 | 2643967974 | 127 |
| 121 | iso_pu_bacteria | 2643221625 | 2644143126 | 127 |
| 122 | iso_pu_bacteria | 2643221639 | 2644218752 | 127 |
| 123 | iso_pu_bacteria | 2643221646 | 2644256839 | 127 |
| 124 | iso_pu_bacteria | 2643221648 | 2644271786 | 127 |
| 125 | iso_pu_bacteria | 2643221654 | 2644305902 | 127 |
| 126 | iso_pu_bacteria | 2643221656 | 2644314960 | 127 |
| 127 | iso_pu_bacteria | 2643221658 | 2644326991 | 127 |
| 128 | iso_pu_bacteria | 2643221660 | 2644338011 | 127 |
| 129 | iso_pu_bacteria | 2643221672 | 2644398791 | 127 |
| 130 | iso_pu_bacteria | 2643221683 | 2644466486 | 127 |
| 131 | iso_pu_bacteria | 2738541277 | 2738721910 | 127 |
| 132 | iso_pu_bacteria | 2738541307 | 2738882076 | 127 |
| 133 | iso_pu_bacteria | 2738541337 | 2739057973 | 127 |
| 134 | iso_pu_bacteria | 2738543013 | 2739251116 | 127 |
| 135 | iso_pu_bacteria | 2738543019 | 2739282274 | 127 |
| 136 | iso_pu_bacteria | 2818991446 | 2819598011 | 127 |
| 137 | iso_pu_bacteria | 2831265667 | 2831269001 | 127 |
| 138 | iso_pu_bacteria | 2831864461 | 2831867515 | 127 |
| 139 | iso_pu_bacteria | 2838054893 | 2838058427 | 127 |
| 140 | iso_pu_bacteria | 2842677519 | 2842678335 | 127 |
| 141 | iso_pu_bacteria | 2842747753 | 2842752786 | 127 |
| 142 | iso_pu_bacteria | 2846033681 | 2846034384 | 127 |
| 143 | iso_pu_bacteria | 2846037992 | 2846041875 | 127 |
| 144 | iso_pu_bacteria | 2886848708 | 2886854503 | 127 |
| 145 | iso_pu_bacteria | 2899924645 | 2899929430 | 127 |
| 146 | iso_pu_bacteria | 2901300506 | 2901304175 | 127 |
| 147 | iso_pu_bacteria | 2904449895 | 2904451081 | 127 |
| 148 | iso_pu_bacteria | 2904479285 | 2904482741 | 127 |
| 149 | iso_pu_bacteria | 2919462493 | 2919465709 | 127 |
| 150 | iso_pu_bacteria | 2928037797 | 2928040126 | 127 |
| 151 | iso_pu_bacteria | 2928044640 | 2928047125 | 127 |
| 152 | iso_pu_bacteria | 2928051484 | 2928057672 | 127 |
| 153 | iso_pu_bacteria | 2928084124 | 2928085707 | 127 |
| 154 | iso_pu_bacteria | 2929520902 | 2929526444 | 127 |
| 155 | iso_pu_bacteria | 2939631187 | 2939635356 | 127 |
| 156 | iso_pu_bacteria | 2945909444 | 2945914969 | 127 |
| 157 | iso_pu_bacteria | 2945945610 | 2945950994 | 127 |
| 158 | iso_pu_bacteria | 2945972063 | 2945974342 | 127 |
| 159 | iso_pu_bacteria | 2945984333 | 2945989628 | 127 |
| 160 | iso_pu_bacteria | 644736347 | 644749246 | 127 |
| 161 | 3300037312 | Ga0395899_0005268 | Ga0395899_0005268_7070_7459 | 128 |
| 162 | 3300037418 | Ga0395900_0000542 | Ga0395900_0000542_27152_27538 | 128 |
| 163 | 3300037466 | Ga0395898_0003063 | Ga0395898_0003063_10409_10795 | 128 |
| 164 | 3300044719 | Ga0466971_0003261 | Ga0466971_0003261_3956_4342 | 128 |
| 165 | 3300047471 | Ga0495684_0395216 | Ga0495684_0395216_23_409 | 128 |
| 166 | 3300003320 | rootH2_10169529 | rootH2_101695299 | 129 |
| 167 | 3300009094 | Ga0111539_10002099 | Ga0111539_1000209917 | 129 |
| 168 | 3300009094 | Ga0111539_11423128 | Ga0111539_114231282 | 129 |
| 169 | 3300034818 | Ga0373950_0134707 | Ga0373950_0134707_82_471 | 129 |
| 170 | 3300034820 | Ga0373959_0046903 | Ga0373959_0046903_188_577 | 129 |
| 171 | 3300034957 | Ga0373938_0017777 | Ga0373938_0017777_408_797 | 129 |
| 172 | 3300035085 | Ga0373929_0098569 | Ga0373929_0098569_99_488 | 129 |
| 173 | 3300035088 | Ga0373940_0039203 | Ga0373940_0039203_867_1256 | 129 |
| 174 | 3300035111 | Ga0373923_0051212 | Ga0373923_0051212_540_929 | 129 |
| 175 | 3300035112 | Ga0373932_0015015 | Ga0373932_0015015_261_650 | 129 |
| 176 | 3300035112 | Ga0373932_0032954 | Ga0373932_0032954_35_424 | 129 |
| 177 | 3300035112 | Ga0373932_0138381 | Ga0373932_0138381_168_557 | 129 |
| 178 | 3300035114 | Ga0373939_0042238 | Ga0373939_0042238_320_709 | 129 |
| 179 | 3300035114 | Ga0373939_0042737 | Ga0373939_0042737_636_1025 | 129 |
| 180 | 3300035116 | Ga0373945_0062010 | Ga0373945_0062010_391_780 | 129 |
| 181 | 3300035121 | Ga0373960_0019605 | Ga0373960_0019605_842_1231 | 129 |
| 182 | 3300035121 | Ga0373960_0329674 | Ga0373960_0329674_109_498 | 129 |
| 183 | 3300035170 | Ga0373943_0205596 | Ga0373943_0205596_683_1072 | 129 |
| 184 | 3300035171 | Ga0373946_0367014 | Ga0373946_0367014_175_564 | 129 |
| 185 | 3300035172 | Ga0373955_0063660 | Ga0373955_0063660_286_675 | 129 |
| 186 | 3300035172 | Ga0373955_0809760 | Ga0373955_0809760_27_416 | 129 |
| 187 | 3300035242 | Ga0373962_0036659 | Ga0373962_0036659_913_1302 | 129 |
| 188 | 3300035691 | Ga0373931_0001474 | Ga0373931_0001474_5611_6000 | 129 |
| 189 | 3300035691 | Ga0373931_0226087 | Ga0373931_0226087_617_1006 | 129 |
| 190 | 3300035695 | Ga0373927_0108327 | Ga0373927_0108327_674_1063 | 129 |
| 191 | 3300035725 | Ga0373947_0185796 | Ga0373947_0185796_520_909 | 129 |
| 192 | 3300036712 | Ga0316584_0641455 | Ga0316584_0641455_148_537 | 129 |
| 193 | 3300037418 | Ga0395900_0770671 | Ga0395900_0770671_284_673 | 129 |
| 194 | 3300038725 | Ga0400484_00617 | Ga0400484_00617_694_1083 | 129 |
| 195 | 3300038726 | Ga0400490_00437 | Ga0400490_00437_6794_7183 | 129 |
| 196 | 3300038727 | Ga0400491_22688 | Ga0400491_22688_149_538 | 129 |
| 197 | 3300038741 | Ga0400488_24943 | Ga0400488_24943_1628_2017 | 129 |
| 198 | 3300039062 | Ga0400483_092373 | Ga0400483_092373_1760_2149 | 129 |
| 199 | 3300039062 | Ga0400483_098932 | Ga0400483_098932_383_772 | 129 |
| 200 | 3300039062 | Ga0400483_207547 | Ga0400483_207547_1396_1785 | 129 |
| 201 | 3300039062 | Ga0400483_232923 | Ga0400483_232923_499_888 | 129 |
| 202 | 3300039062 | Ga0400483_238884 | Ga0400483_238884_963_1352 | 129 |
| 203 | 3300039062 | Ga0400483_258389 | Ga0400483_258389_746_1135 | 129 |
| 204 | 3300039437 | Ga0436365_0023403 | Ga0436365_0023403_193_582 | 129 |
| 205 | 3300041404 | Ga0439436_0032700 | Ga0439436_0032700_1038_1427 | 129 |
| 206 | 3300041410 | Ga0439461_0013318 | Ga0439461_0013318_25_414 | 129 |
| 207 | 3300041455 | Ga0451801_40786 | Ga0451801_40786_817_1206 | 129 |
| 208 | 3300041457 | Ga0451803_03143 | Ga0451803_03143_41_430 | 129 |
| 209 | 3300041458 | Ga0451798_1162362 | Ga0451798_1162362_258_647 | 129 |
| 210 | 3300041460 | Ga0451802_1180715 | Ga0451802_1180715_95_484 | 129 |
| 211 | 3300041460 | Ga0451802_1195489 | Ga0451802_1195489_484_873 | 129 |
| 212 | 3300041462 | Ga0451806_289060 | Ga0451806_289060_247_636 | 129 |
| 213 | 3300041486 | Ga0451807_1280507 | Ga0451807_1280507_155_544 | 129 |
| 214 | 3300041486 | Ga0451807_1334682 | Ga0451807_1334682_78_467 | 129 |
| 215 | 3300041492 | Ga0451835_0635417 | Ga0451835_0635417_628_1017 | 129 |
| 216 | 3300041507 | Ga0451851_0477462 | Ga0451851_0477462_168_560 | 129 |
| 217 | 3300041510 | Ga0451854_06224 | Ga0451854_06224_51_440 | 129 |
| 218 | 3300041512 | Ga0451853_4125141 | Ga0451853_4125141_123_512 | 129 |
| 219 | 3300042185 | Ga0450909_005658 | Ga0450909_005658_25_414 | 129 |
| 220 | 3300042461 | Ga0439460_0110012 | Ga0439460_0110012_52_441 | 129 |
| 221 | 3300042532 | Ga0450893_0014532 | Ga0450893_0014532_263_652 | 129 |
| 222 | 3300042876 | Ga0451577_0168788 | Ga0451577_0168788_1265_1654 | 129 |
| 223 | 3300042876 | Ga0451577_0608581 | Ga0451577_0608581_484_873 | 129 |
| 224 | 3300042876 | Ga0451577_0626488 | Ga0451577_0626488_33_422 | 129 |
| 225 | 3300044673 | Ga0453683_0030079 | Ga0453683_0030079_1469_1858 | 129 |
| 226 | 3300044673 | Ga0453683_0041932 | Ga0453683_0041932_1917_2306 | 129 |
| 227 | 3300044712 | Ga0453684_0065104 | Ga0453684_0065104_365_754 | 129 |
| 228 | 3300044712 | Ga0453684_0462151 | Ga0453684_0462151_949_1338 | 129 |
| 229 | 3300044712 | Ga0453684_0473085 | Ga0453684_0473085_381_818 | 129 |
| 230 | 3300044712 | Ga0453684_1184361 | Ga0453684_1184361_216_605 | 129 |
| 231 | 3300045051 | Ga0451576_0010036 | Ga0451576_0010036_5858_6247 | 129 |
| 232 | 3300045051 | Ga0451576_0025038 | Ga0451576_0025038_52_441 | 129 |
| 233 | 3300045051 | Ga0451576_0177787 | Ga0451576_0177787_563_952 | 129 |
| 234 | 3300046454 | Ga0495592_0002591 | Ga0495592_0002591_5732_6121 | 129 |
| 235 | 3300046457 | Ga0495590_0011864 | Ga0495590_0011864_1012_1401 | 129 |
| 236 | 3300046459 | Ga0495629_0208823 | Ga0495629_0208823_654_1043 | 129 |
| 237 | 3300046459 | Ga0495629_0333459 | Ga0495629_0333459_304_693 | 129 |
| 238 | 3300046463 | Ga0495653_0190214 | Ga0495653_0190214_360_749 | 129 |
| 239 | 3300046475 | Ga0495639_0103968 | Ga0495639_0103968_906_1295 | 129 |
| 240 | 3300046477 | Ga0495664_0167471 | Ga0495664_0167471_79_468 | 129 |
| 241 | 3300046492 | Ga0495585_0262788 | Ga0495585_0262788_239_628 | 129 |
| 242 | 3300046511 | Ga0495608_0037016 | Ga0495608_0037016_1429_1818 | 129 |
| 243 | 3300046512 | Ga0495610_0146980 | Ga0495610_0146980_296_685 | 129 |
| 244 | 3300046513 | Ga0495616_0093680 | Ga0495616_0093680_573_962 | 129 |
| 245 | 3300046515 | Ga0495620_0086369 | Ga0495620_0086369_18_407 | 129 |
| 246 | 3300046516 | Ga0495628_0102358 | Ga0495628_0102358_1413_1802 | 129 |
| 247 | 3300046516 | Ga0495628_0375959 | Ga0495628_0375959_440_829 | 129 |
| 248 | 3300046519 | Ga0495632_0014757 | Ga0495632_0014757_3273_3662 | 129 |
| 249 | 3300046519 | Ga0495632_0082343 | Ga0495632_0082343_85_474 | 129 |
| 250 | 3300046528 | Ga0495642_0009990 | Ga0495642_0009990_256_645 | 129 |
| 251 | 3300046528 | Ga0495642_0130268 | Ga0495642_0130268_525_914 | 129 |
| 252 | 3300046531 | Ga0495665_0139846 | Ga0495665_0139846_752_1141 | 129 |
| 253 | 3300046536 | Ga0495587_0030902 | Ga0495587_0030902_192_581 | 129 |
| 254 | 3300046539 | Ga0495621_0111975 | Ga0495621_0111975_430_819 | 129 |
| 255 | 3300046539 | Ga0495621_0536312 | Ga0495621_0536312_94_483 | 129 |
| 256 | 3300046543 | Ga0495645_0004671 | Ga0495645_0004671_1579_1968 | 129 |
| 257 | 3300046557 | Ga0495622_0288324 | Ga0495622_0288324_260_649 | 129 |
| 258 | 3300046615 | Ga0495656_0056918 | Ga0495656_0056918_30_419 | 129 |
| 259 | 3300046615 | Ga0495656_0140084 | Ga0495656_0140084_479_868 | 129 |
| 260 | 3300046616 | Ga0495668_0164067 | Ga0495668_0164067_342_731 | 129 |
| 261 | 3300046660 | Ga0495625_0020303 | Ga0495625_0020303_694_1083 | 129 |
| 262 | 3300046660 | Ga0495625_0102533 | Ga0495625_0102533_1198_1587 | 129 |
| 263 | 3300046663 | Ga0495635_0032495 | Ga0495635_0032495_878_1267 | 129 |
| 264 | 3300046664 | Ga0495659_0382341 | Ga0495659_0382341_40_429 | 129 |
| 265 | 3300046674 | Ga0495588_0009938 | Ga0495588_0009938_554_943 | 129 |
| 266 | 3300046675 | Ga0495657_0043896 | Ga0495657_0043896_2044_2433 | 129 |
| 267 | 3300046675 | Ga0495657_0355767 | Ga0495657_0355767_418_807 | 129 |
| 268 | 3300046675 | Ga0495657_0697551 | Ga0495657_0697551_170_559 | 129 |
| 269 | 3300046678 | Ga0495599_0001475 | Ga0495599_0001475_496_885 | 129 |
| 270 | 3300046679 | Ga0495623_0049231 | Ga0495623_0049231_321_710 | 129 |
| 271 | 3300046683 | Ga0495658_0134744 | Ga0495658_0134744_224_613 | 129 |
| 272 | 3300046683 | Ga0495658_0283602 | Ga0495658_0283602_185_574 | 129 |
| 273 | 3300046683 | Ga0495658_0296678 | Ga0495658_0296678_103_492 | 129 |
| 274 | 3300046692 | Ga0495671_0305034 | Ga0495671_0305034_343_732 | 129 |
| 275 | 3300046692 | Ga0495671_0415091 | Ga0495671_0415091_231_620 | 129 |
| 276 | 3300046694 | Ga0495649_0006057 | Ga0495649_0006057_5734_6123 | 129 |
| 277 | 3300046794 | Ga0495589_0074447 | Ga0495589_0074447_603_992 | 129 |
| 278 | 3300046810 | Ga0495660_0151509 | Ga0495660_0151509_155_544 | 129 |
| 279 | 3300047318 | Ga0495636_0078088 | Ga0495636_0078088_549_938 | 129 |
| 280 | 3300047320 | Ga0495672_0124253 | Ga0495672_0124253_968_1357 | 129 |
| 281 | 3300047322 | Ga0495680_0156938 | Ga0495680_0156938_1087_1476 | 129 |
| 282 | 3300047443 | Ga0495687_036928 | Ga0495687_036928_1083_1472 | 129 |
| 283 | 3300047471 | Ga0495684_0188245 | Ga0495684_0188245_342_731 | 129 |
| 284 | 3300047472 | Ga0495686_0177695 | Ga0495686_0177695_565_954 | 129 |
| 285 | 3300048088 | Ga0495602_0365616 | Ga0495602_0365616_82_471 | 129 |
| 286 | 3300048903 | Ga0496100_0076364 | Ga0496100_0076364_475_864 | 129 |
| 287 | 3300048903 | Ga0496100_0546982 | Ga0496100_0546982_366_755 | 129 |
| 288 | 3300048904 | Ga0496101_0024728 | Ga0496101_0024728_3174_3563 | 129 |
| 289 | 3300048904 | Ga0496101_0463082 | Ga0496101_0463082_137_526 | 129 |
| 290 | 3300048905 | Ga0496102_0007579 | Ga0496102_0007579_4023_4412 | 129 |
| 291 | 3300048907 | Ga0496104_0008378 | Ga0496104_0008378_7404_7793 | 129 |
| 292 | 3300048907 | Ga0496104_0104722 | Ga0496104_0104722_1261_1650 | 129 |
| 293 | 3300048907 | Ga0496104_0579646 | Ga0496104_0579646_581_970 | 129 |
| 294 | 3300048908 | Ga0496105_0009457 | Ga0496105_0009457_86_475 | 129 |
| 295 | 3300048909 | Ga0496106_0453539 | Ga0496106_0453539_364_753 | 129 |
| 296 | 3300048910 | Ga0496107_0280025 | Ga0496107_0280025_448_837 | 129 |
| 297 | 3300048910 | Ga0496107_0429419 | Ga0496107_0429419_559_948 | 129 |
| 298 | 3300048910 | Ga0496107_0695193 | Ga0496107_0695193_282_671 | 129 |
| 299 | 3300048911 | Ga0496108_0042133 | Ga0496108_0042133_513_902 | 129 |
| 300 | 3300048911 | Ga0496108_0356402 | Ga0496108_0356402_340_729 | 129 |
| 301 | 3300048911 | Ga0496108_0406535 | Ga0496108_0406535_762_1151 | 129 |
| 302 | 3300048913 | Ga0496110_0026383 | Ga0496110_0026383_1398_1787 | 129 |
| 303 | 3300048913 | Ga0496110_0367167 | Ga0496110_0367167_812_1201 | 129 |
| 304 | 3300048914 | Ga0496111_0004330 | Ga0496111_0004330_2614_3003 | 129 |
| 305 | 3300048915 | Ga0496112_0411585 | Ga0496112_0411585_360_749 | 129 |
| 306 | 3300048916 | Ga0496113_0310758 | Ga0496113_0310758_446_835 | 129 |
| 307 | 3300048917 | Ga0496114_0198844 | Ga0496114_0198844_369_758 | 129 |
| 308 | 3300048918 | Ga0496115_0446021 | Ga0496115_0446021_175_564 | 129 |
| 309 | 3300048926 | Ga0496123_0395689 | Ga0496123_0395689_61_450 | 129 |
| 310 | 3300049127 | Ga0501306_010649 | Ga0501306_010649_340_729 | 129 |
| 311 | 3300049128 | Ga0501308_000386 | Ga0501308_000386_1705_2094 | 129 |
| 312 | 3300049128 | Ga0501308_012337 | Ga0501308_012337_514_903 | 129 |
| 313 | 3300049129 | Ga0501309_007735 | Ga0501309_007735_127_516 | 129 |
| 314 | 3300049129 | Ga0501309_015019 | Ga0501309_015019_436_825 | 129 |
| 315 | 3300049160 | Ga0501304_009642 | Ga0501304_009642_26_415 | 129 |
| 316 | 3300049161 | Ga0501305_009585 | Ga0501305_009585_108_497 | 129 |
| 317 | 3300049161 | Ga0501305_122394 | Ga0501305_122394_23_412 | 129 |
| 318 | 3300049459 | Ga0495678_217698 | Ga0495678_217698_98_487 | 129 |
| 319 | 3300049460 | Ga0495682_0058348 | Ga0495682_0058348_831_1220 | 129 |
| 320 | 3300049513 | Ga0501290_008662 | Ga0501290_008662_377_766 | 129 |
| 321 | 3300049515 | Ga0501292_005043 | Ga0501292_005043_481_870 | 129 |
| 322 | 3300049527 | Ga0501311_004807 | Ga0501311_004807_842_1231 | 129 |
| 323 | 3300049527 | Ga0501311_039844 | Ga0501311_039844_145_534 | 129 |
| 324 | 3300049528 | Ga0501312_002743 | Ga0501312_002743_433_822 | 129 |
| 325 | 3300049528 | Ga0501312_101904 | Ga0501312_101904_26_415 | 129 |
| 326 | 3300049529 | Ga0501313_004401 | Ga0501313_004401_381_770 | 129 |
| 327 | 3300049531 | Ga0501315_031783 | Ga0501315_031783_116_505 | 129 |
| 328 | 3300049532 | Ga0501316_001021 | Ga0501316_001021_1115_1504 | 129 |
| 329 | 3300049534 | Ga0501318_000548 | Ga0501318_000548_1083_1472 | 129 |
| 330 | 3300049536 | Ga0501320_002265 | Ga0501320_002265_794_1183 | 129 |
| 331 | 3300049572 | Ga0501036_0230381 | Ga0501036_0230381_923_1315 | 129 |
| 332 | 3300049573 | Ga0501037_0024581 | Ga0501037_0024581_3283_3672 | 129 |
| 333 | 3300049574 | Ga0501038_0090870 | Ga0501038_0090870_685_1074 | 129 |
| 334 | 3300049576 | Ga0501040_0157352 | Ga0501040_0157352_908_1300 | 129 |
| 335 | 3300049576 | Ga0501040_0315558 | Ga0501040_0315558_428_820 | 129 |
| 336 | 3300049578 | Ga0501042_0295714 | Ga0501042_0295714_444_833 | 129 |
| 337 | 3300049578 | Ga0501042_1295130 | Ga0501042_1295130_125_514 | 129 |
| 338 | 3300049582 | Ga0501048_0067468 | Ga0501048_0067468_1115_1504 | 129 |
| 339 | 3300049586 | Ga0501070_0297912 | Ga0501070_0297912_285_674 | 129 |
| 340 | 3300049587 | Ga0501071_0003527 | Ga0501071_0003527_8417_8806 | 129 |
| 341 | 3300049587 | Ga0501071_0160335 | Ga0501071_0160335_608_1000 | 129 |
| 342 | 3300049588 | Ga0501072_0321792 | Ga0501072_0321792_807_1199 | 129 |
| 343 | 3300049588 | Ga0501072_0407521 | Ga0501072_0407521_306_698 | 129 |
| 344 | 3300049590 | Ga0501074_0222352 | Ga0501074_0222352_478_867 | 129 |
| 345 | 3300049591 | Ga0501075_0055471 | Ga0501075_0055471_1100_1489 | 129 |
| 346 | 3300049591 | Ga0501075_0062590 | Ga0501075_0062590_1367_1759 | 129 |
| 347 | 3300049591 | Ga0501075_0307152 | Ga0501075_0307152_73_465 | 129 |
| 348 | 3300049592 | Ga0501076_0079520 | Ga0501076_0079520_1508_1900 | 129 |
| 349 | 3300049593 | Ga0501077_0271589 | Ga0501077_0271589_542_934 | 129 |
| 350 | 3300049653 | Ga0501206_009648 | Ga0501206_009648_464_853 | 129 |
| 351 | 3300049654 | Ga0501207_022199 | Ga0501207_022199_457_846 | 129 |
| 352 | 3300049741 | Ga0501079_0179169 | Ga0501079_0179169_490_879 | 129 |
| 353 | 3300049742 | Ga0501080_0037660 | Ga0501080_0037660_3371_3760 | 129 |
| 354 | 3300049742 | Ga0501080_0286093 | Ga0501080_0286093_898_1290 | 129 |
| 355 | 3300049742 | Ga0501080_0748801 | Ga0501080_0748801_55_444 | 129 |
| 356 | 3300049762 | Ga0501265_013043 | Ga0501265_013043_465_854 | 129 |
| 357 | 3300049824 | Ga0501045_0477922 | Ga0501045_0477922_156_548 | 129 |
| 358 | 3300050491 | nmdc:mga00v17_1065507_c1 | nmdc:mga00v17_1065507_c1_74_463 | 129 |
| 359 | 3300050491 | nmdc:mga00v17_17620_c1 | nmdc:mga00v17_17620_c1_2710_3099 | 129 |
| 360 | 3300050491 | nmdc:mga00v17_744286_c1 | nmdc:mga00v17_744286_c1_95_484 | 129 |
| 361 | 3300050492 | nmdc:mga0yw44_11539_c1 | nmdc:mga0yw44_11539_c1_371_760 | 129 |
| 362 | 3300050492 | nmdc:mga0yw44_283449_c1 | nmdc:mga0yw44_283449_c1_347_736 | 129 |
| 363 | 3300050493 | nmdc:mga0k408_145503_c1 | nmdc:mga0k408_145503_c1_892_1281 | 129 |
| 364 | 3300050493 | nmdc:mga0k408_57150_c1 | nmdc:mga0k408_57150_c1_107_496 | 129 |
| 365 | 3300050493 | nmdc:mga0k408_65064_c1 | nmdc:mga0k408_65064_c1_923_1312 | 129 |
| 366 | 3300050493 | nmdc:mga0k408_712_c1 | nmdc:mga0k408_712_c1_3816_4205 | 129 |
| 367 | 3300050496 | nmdc:mga07m45_109788_c1 | nmdc:mga07m45_109788_c1_653_1042 | 129 |
| 368 | 3300050496 | nmdc:mga07m45_15127_c1 | nmdc:mga07m45_15127_c1_2782_3171 | 129 |
| 369 | 3300050496 | nmdc:mga07m45_69529_c1 | nmdc:mga07m45_69529_c1_399_788 | 129 |
| 370 | 3300050496 | nmdc:mga07m45_752759_c1 | nmdc:mga07m45_752759_c1_110_499 | 129 |
| 371 | 3300050509 | nmdc:mga0qj67_274367_c1 | nmdc:mga0qj67_274367_c1_524_913 | 129 |
| 372 | 3300050511 | nmdc:mga08y16_2559_c1 | nmdc:mga08y16_2559_c1_13018_13407 | 129 |
| 373 | 3300050511 | nmdc:mga08y16_977479_c1 | nmdc:mga08y16_977479_c1_86_475 | 129 |
| 374 | 3300050513 | nmdc:mga0rr50_474247_c1 | nmdc:mga0rr50_474247_c1_182_571 | 129 |
| 375 | 3300050516 | nmdc:mga0sz30_3989_c1 | nmdc:mga0sz30_3989_c1_2882_3271 | 129 |
| 376 | 3300053077 | Ga0495601_0002182 | Ga0495601_0002182_795_1184 | 129 |
| 377 | 3300053083 | Ga0495655_0065643 | Ga0495655_0065643_149_538 | 129 |
| 378 | 3300053085 | Ga0495619_0071847 | Ga0495619_0071847_1652_2041 | 129 |
| 379 | 3300053093 | Ga0500651_0129786 | Ga0500651_0129786_421_810 | 129 |
| 380 | 3300053122 | Ga0500608_169075 | Ga0500608_169075_417_806 | 129 |
| 381 | 3300053129 | Ga0500628_167610 | Ga0500628_167610_52_534 | 129 |
| 382 | 3300053134 | Ga0500658_0026976 | Ga0500658_0026976_235_624 | 129 |
| 383 | 3300053158 | Ga0500627_0176007 | Ga0500627_0176007_266_655 | 129 |
| 384 | 3300053738 | Ga0500613_001534 | Ga0500613_001534_524_913 | 129 |
| 385 | 3300054114 | Ga0501084_0152777 | Ga0501084_0152777_461_853 | 129 |
| 386 | 3300054114 | Ga0501084_0285140 | Ga0501084_0285140_857_1249 | 129 |
| 387 | 3300060353 | Ga0501082_1949896 | Ga0501082_1949896_19_411 | 129 |
| 388 | 3300061734 | Ga0530510_0121012 | Ga0530510_0121012_127_519 | 129 |
| 389 | 3300061734 | Ga0530510_0329770 | Ga0530510_0329770_659_1051 | 129 |
| 390 | 3300009098 | Ga0105245_10397024 | Ga0105245_103970242 | 130 |
| 391 | 3300010375 | Ga0105239_11816629 | Ga0105239_118166292 | 130 |
| 392 | 3300025960 | Ga0207651_10247449 | Ga0207651_102474492 | 130 |
| 393 | 3300031235 | Ga0265330_10024527 | Ga0265330_100245272 | 130 |
| 394 | 3300031238 | Ga0265332_10001783 | Ga0265332_100017838 | 130 |
| 395 | 3300031239 | Ga0265328_10020219 | Ga0265328_100202194 | 130 |
| 396 | 3300031241 | Ga0265325_10057810 | Ga0265325_100578103 | 130 |
| 397 | 3300031250 | Ga0265331_10000635 | Ga0265331_1000063534 | 130 |
| 398 | 3300031251 | Ga0265327_10031432 | Ga0265327_100314322 | 130 |
| 399 | 3300031344 | Ga0265316_10021393 | Ga0265316_100213934 | 130 |
| 400 | 3300031548 | Ga0307408_100519381 | Ga0307408_1005193812 | 130 |
| 401 | 3300031711 | Ga0265314_10070955 | Ga0265314_100709555 | 130 |
| 402 | 3300032168 | Ga0316593_10000520 | Ga0316593_100005206 | 130 |
| 403 | 3300033524 | Ga0316592_1032584 | Ga0316592_10325842 | 130 |
| 404 | 3300033541 | Ga0316596_1000040 | Ga0316596_100004012 | 130 |
| 405 | 3300036401 | Ga0373937_0990449 | Ga0373937_0990449_282_674 | 130 |
| 406 | 3300036647 | Ga0316582_0054399 | Ga0316582_0054399_467_859 | 130 |
| 407 | 3300037312 | Ga0395899_0342891 | Ga0395899_0342891_445_837 | 130 |
| 408 | 3300042435 | Ga0439434_0095345 | Ga0439434_0095345_31_423 | 130 |
| 409 | 3300046683 | Ga0495658_0277267 | Ga0495658_0277267_195_587 | 130 |
| 410 | 3300049529 | Ga0501313_018129 | Ga0501313_018129_73_465 | 130 |
| 411 | 3300049531 | Ga0501315_013634 | Ga0501315_013634_211_603 | 130 |
| 412 | 3300049572 | Ga0501036_1443853 | Ga0501036_1443853_96_488 | 130 |
| 413 | 3300049576 | Ga0501040_0716304 | Ga0501040_0716304_133_525 | 130 |
| 414 | 3300049577 | Ga0501041_0275567 | Ga0501041_0275567_504_896 | 130 |
| 415 | 3300049578 | Ga0501042_0144131 | Ga0501042_0144131_1036_1428 | 130 |
| 416 | 3300049587 | Ga0501071_1294920 | Ga0501071_1294920_154_546 | 130 |
| 417 | 3300049588 | Ga0501072_0916870 | Ga0501072_0916870_31_423 | 130 |
| 418 | 3300049591 | Ga0501075_0247801 | Ga0501075_0247801_116_508 | 130 |
| 419 | 3300053085 | Ga0495619_0656583 | Ga0495619_0656583_69_461 | 130 |
| 420 | 3300054114 | Ga0501084_0285445 | Ga0501084_0285445_231_623 | 130 |
| 421 | 2162886007 | SwRhRL2b_contig_1228071 | SwRhRL2b_0093.00004480 | 131 |
| 422 | 3300000546 | LJNas_1015535 | LJNas_10155352 | 131 |
| 423 | 3300001976 | JGI24752J21851_1044283 | JGI24752J21851_10442831 | 131 |
| 424 | 3300001978 | JGI24747J21853_1009316 | JGI24747J21853_10093163 | 131 |
| 425 | 3300001989 | JGI24739J22299_10006228 | JGI24739J22299_100062287 | 131 |
| 426 | 3300002070 | JGI24750J21931_1030210 | JGI24750J21931_10302101 | 131 |
| 427 | 3300002077 | JGI24744J21845_10066100 | JGI24744J21845_100661001 | 131 |
| 428 | 3300002126 | JGI24035J26624_1018097 | JGI24035J26624_10180971 | 131 |
| 429 | 3300002155 | JGI24033J26618_1051580 | JGI24033J26618_10515802 | 131 |
| 430 | 3300002244 | JGI24742J22300_10015246 | JGI24742J22300_100152463 | 131 |
| 431 | 3300002739 | JGI25158J39367_1016229 | JGI25158J39367_10162292 | 131 |
| 432 | 3300002773 | JGI25152J39213_1001073 | JGI25152J39213_100107310 | 131 |
| 433 | 3300002774 | JGI25150J39212_1003907 | JGI25150J39212_10039074 | 131 |
| 434 | 3300002987 | JGI25159J45721_1048433 | JGI25159J45721_10484331 | 131 |
| 435 | 3300003162 | Ga0006778J45830_1009213 | Ga0006778J45830_100921317 | 131 |
| 436 | 3300003163 | Ga0006759J45824_1029126 | Ga0006759J45824_10291265 | 131 |
| 437 | 3300003163 | Ga0006759J45824_1064290 | Ga0006759J45824_10642901 | 131 |
| 438 | 3300003215 | JGI25153J46596_10007740 | JGI25153J46596_100077407 | 131 |
| 439 | 3300003215 | JGI25153J46596_10008637 | JGI25153J46596_100086373 | 131 |
| 440 | 3300003300 | Ga0006758J48902_1016024 | Ga0006758J48902_10160244 | 131 |
| 441 | 3300003305 | Ga0006770J48903_1001899 | Ga0006770J48903_10018999 | 131 |
| 442 | 3300003308 | Ga0006777J48905_1014855 | Ga0006777J48905_10148555 | 131 |
| 443 | 3300003308 | Ga0006777J48905_1103387 | Ga0006777J48905_11033872 | 131 |
| 444 | 3300003322 | rootL2_10001301 | rootL2_100013019 | 131 |
| 445 | 3300003347 | JGI26128J50194_1000191 | JGI26128J50194_10001912 | 131 |
| 446 | 3300003504 | JGI26138J51218_106156 | JGI26138J51218_1061561 | 131 |
| 447 | 3300003559 | Ga0007427J51700_118227 | Ga0007427J51700_1182273 | 131 |
| 448 | 3300003575 | Ga0007409J51694_1045076 | Ga0007409J51694_10450762 | 131 |
| 449 | 3300003575 | Ga0007409J51694_1147697 | Ga0007409J51694_11476971 | 131 |
| 450 | 3300003577 | Ga0007416J51690_1051124 | Ga0007416J51690_10511245 | 131 |
| 451 | 3300003579 | Ga0007429J51699_1075853 | Ga0007429J51699_10758532 | 131 |
| 452 | 3300003693 | Ga0032354_1038952 | Ga0032354_10389523 | 131 |
| 453 | 3300003693 | Ga0032354_1072421 | Ga0032354_10724211 | 131 |
| 454 | 3300003693 | Ga0032354_1076006 | Ga0032354_10760061 | 131 |
| 455 | 3300003752 | Ga0055539_1013170 | Ga0055539_10131701 | 131 |
| 456 | 3300003771 | Ga0055526_1000791 | Ga0055526_100079115 | 131 |
| 457 | 3300003791 | Ga0055530_10019398 | Ga0055530_100193981 | 131 |
| 458 | 3300004803 | Ga0058862_10046561 | Ga0058862_100465617 | 131 |
| 459 | 3300005262 | Ga0065165_1001259 | Ga0065165_10012591 | 131 |
| 460 | 3300005288 | Ga0065714_10138237 | Ga0065714_101382373 | 131 |
| 461 | 3300005289 | Ga0065704_10187738 | Ga0065704_101877382 | 131 |
| 462 | 3300005290 | Ga0065712_10080555 | Ga0065712_100805555 | 131 |
| 463 | 3300005290 | Ga0065712_10107042 | Ga0065712_101070422 | 131 |
| 464 | 3300005290 | Ga0065712_10788760 | Ga0065712_107887601 | 131 |
| 465 | 3300005293 | Ga0065715_10005249 | Ga0065715_100052491 | 131 |
| 466 | 3300005293 | Ga0065715_10024824 | Ga0065715_100248243 | 131 |
| 467 | 3300005293 | Ga0065715_10636148 | Ga0065715_106361481 | 131 |
| 468 | 3300005295 | Ga0065707_10401468 | Ga0065707_104014682 | 131 |
| 469 | 3300005327 | Ga0070658_10152764 | Ga0070658_101527644 | 131 |
| 470 | 3300005327 | Ga0070658_10160545 | Ga0070658_101605454 | 131 |
| 471 | 3300005327 | Ga0070658_10996892 | Ga0070658_109968921 | 131 |
| 472 | 3300005328 | Ga0070676_10002282 | Ga0070676_100022823 | 131 |
| 473 | 3300005328 | Ga0070676_10021276 | Ga0070676_100212764 | 131 |
| 474 | 3300005328 | Ga0070676_10052224 | Ga0070676_100522241 | 131 |
| 475 | 3300005328 | Ga0070676_10078497 | Ga0070676_100784973 | 131 |
| 476 | 3300005328 | Ga0070676_10294672 | Ga0070676_102946723 | 131 |
| 477 | 3300005328 | Ga0070676_10334482 | Ga0070676_103344822 | 131 |
| 478 | 3300005328 | Ga0070676_10684369 | Ga0070676_106843692 | 131 |
| 479 | 3300005328 | Ga0070676_11223034 | Ga0070676_112230341 | 131 |
| 480 | 3300005329 | Ga0070683_100315172 | Ga0070683_1003151721 | 131 |
| 481 | 3300005329 | Ga0070683_100470633 | Ga0070683_1004706333 | 131 |
| 482 | 3300005329 | Ga0070683_101311876 | Ga0070683_1013118761 | 131 |
| 483 | 3300005330 | Ga0070690_100006927 | Ga0070690_1000069279 | 131 |
| 484 | 3300005330 | Ga0070690_100231854 | Ga0070690_1002318541 | 131 |
| 485 | 3300005330 | Ga0070690_101044094 | Ga0070690_1010440941 | 131 |
| 486 | 3300005330 | Ga0070690_101437765 | Ga0070690_1014377651 | 131 |
| 487 | 3300005331 | Ga0070670_100023628 | Ga0070670_1000236283 | 131 |
| 488 | 3300005331 | Ga0070670_100054237 | Ga0070670_1000542374 | 131 |
| 489 | 3300005331 | Ga0070670_100064589 | Ga0070670_1000645894 | 131 |
| 490 | 3300005331 | Ga0070670_100065507 | Ga0070670_1000655076 | 131 |
| 491 | 3300005331 | Ga0070670_100183537 | Ga0070670_1001835373 | 131 |
| 492 | 3300005331 | Ga0070670_100305986 | Ga0070670_1003059863 | 131 |
| 493 | 3300005331 | Ga0070670_100436330 | Ga0070670_1004363302 | 131 |
| 494 | 3300005331 | Ga0070670_101289446 | Ga0070670_1012894462 | 131 |
| 495 | 3300005333 | Ga0070677_10126334 | Ga0070677_101263341 | 131 |
| 496 | 3300005333 | Ga0070677_10384582 | Ga0070677_103845821 | 131 |
| 497 | 3300005333 | Ga0070677_10614212 | Ga0070677_106142122 | 131 |
| 498 | 3300005334 | Ga0068869_100077114 | Ga0068869_1000771145 | 131 |
| 499 | 3300005334 | Ga0068869_100146255 | Ga0068869_1001462553 | 131 |
| 500 | 3300005334 | Ga0068869_100263074 | Ga0068869_1002630743 | 131 |
| 501 | 3300005334 | Ga0068869_100284560 | Ga0068869_1002845601 | 131 |
| 502 | 3300005334 | Ga0068869_100900370 | Ga0068869_1009003702 | 131 |
| 503 | 3300005335 | Ga0070666_10221816 | Ga0070666_102218161 | 131 |
| 504 | 3300005335 | Ga0070666_10235916 | Ga0070666_102359162 | 131 |
| 505 | 3300005335 | Ga0070666_10239237 | Ga0070666_102392371 | 131 |
| 506 | 3300005335 | Ga0070666_10589561 | Ga0070666_105895612 | 131 |
| 507 | 3300005336 | Ga0070680_100032809 | Ga0070680_1000328097 | 131 |
| 508 | 3300005337 | Ga0070682_100031523 | Ga0070682_1000315237 | 131 |
| 509 | 3300005337 | Ga0070682_100057764 | Ga0070682_1000577644 | 131 |
| 510 | 3300005337 | Ga0070682_100093827 | Ga0070682_1000938274 | 131 |
| 511 | 3300005337 | Ga0070682_100149406 | Ga0070682_1001494064 | 131 |
| 512 | 3300005337 | Ga0070682_100351164 | Ga0070682_1003511642 | 131 |
| 513 | 3300005337 | Ga0070682_100881295 | Ga0070682_1008812952 | 131 |
| 514 | 3300005338 | Ga0068868_100133352 | Ga0068868_1001333522 | 131 |
| 515 | 3300005338 | Ga0068868_100211639 | Ga0068868_1002116391 | 131 |
| 516 | 3300005338 | Ga0068868_100449603 | Ga0068868_1004496032 | 131 |
| 517 | 3300005338 | Ga0068868_100578715 | Ga0068868_1005787152 | 131 |
| 518 | 3300005338 | Ga0068868_100797352 | Ga0068868_1007973522 | 131 |
| 519 | 3300005338 | Ga0068868_100874744 | Ga0068868_1008747441 | 131 |
| 520 | 3300005338 | Ga0068868_102073964 | Ga0068868_1020739641 | 131 |
| 521 | 3300005338 | Ga0068868_102090024 | Ga0068868_1020900241 | 131 |
| 522 | 3300005339 | Ga0070660_100467133 | Ga0070660_1004671332 | 131 |
| 523 | 3300005339 | Ga0070660_100475236 | Ga0070660_1004752362 | 131 |
| 524 | 3300005339 | Ga0070660_100572021 | Ga0070660_1005720212 | 131 |
| 525 | 3300005339 | Ga0070660_101051513 | Ga0070660_1010515131 | 131 |
| 526 | 3300005339 | Ga0070660_101233271 | Ga0070660_1012332711 | 131 |
| 527 | 3300005340 | Ga0070689_100015417 | Ga0070689_10001541711 | 131 |
| 528 | 3300005340 | Ga0070689_100546341 | Ga0070689_1005463412 | 131 |
| 529 | 3300005340 | Ga0070689_100756953 | Ga0070689_1007569532 | 131 |
| 530 | 3300005340 | Ga0070689_100903169 | Ga0070689_1009031692 | 131 |
| 531 | 3300005341 | Ga0070691_10071558 | Ga0070691_100715584 | 131 |
| 532 | 3300005343 | Ga0070687_100132497 | Ga0070687_1001324973 | 131 |
| 533 | 3300005343 | Ga0070687_100201346 | Ga0070687_1002013462 | 131 |
| 534 | 3300005344 | Ga0070661_100092952 | Ga0070661_1000929524 | 131 |
| 535 | 3300005344 | Ga0070661_100105291 | Ga0070661_1001052914 | 131 |
| 536 | 3300005344 | Ga0070661_100476134 | Ga0070661_1004761342 | 131 |
| 537 | 3300005344 | Ga0070661_100979681 | Ga0070661_1009796812 | 131 |
| 538 | 3300005347 | Ga0070668_100072291 | Ga0070668_1000722916 | 131 |
| 539 | 3300005347 | Ga0070668_100277179 | Ga0070668_1002771793 | 131 |
| 540 | 3300005347 | Ga0070668_100603159 | Ga0070668_1006031592 | 131 |
| 541 | 3300005347 | Ga0070668_100707992 | Ga0070668_1007079922 | 131 |
| 542 | 3300005353 | Ga0070669_100017536 | Ga0070669_1000175365 | 131 |
| 543 | 3300005353 | Ga0070669_100031250 | Ga0070669_1000312507 | 131 |
| 544 | 3300005353 | Ga0070669_100306076 | Ga0070669_1003060763 | 131 |
| 545 | 3300005353 | Ga0070669_100685263 | Ga0070669_1006852631 | 131 |
| 546 | 3300005354 | Ga0070675_100044665 | Ga0070675_1000446655 | 131 |
| 547 | 3300005354 | Ga0070675_100107037 | Ga0070675_1001070374 | 131 |
| 548 | 3300005354 | Ga0070675_100124843 | Ga0070675_1001248432 | 131 |
| 549 | 3300005354 | Ga0070675_100131492 | Ga0070675_1001314923 | 131 |
| 550 | 3300005354 | Ga0070675_100137403 | Ga0070675_1001374034 | 131 |
| 551 | 3300005354 | Ga0070675_100188013 | Ga0070675_1001880133 | 131 |
| 552 | 3300005354 | Ga0070675_100347697 | Ga0070675_1003476972 | 131 |
| 553 | 3300005354 | Ga0070675_100413240 | Ga0070675_1004132402 | 131 |
| 554 | 3300005355 | Ga0070671_100019537 | Ga0070671_1000195377 | 131 |
| 555 | 3300005355 | Ga0070671_100085884 | Ga0070671_1000858845 | 131 |
| 556 | 3300005355 | Ga0070671_100133178 | Ga0070671_1001331784 | 131 |
| 557 | 3300005355 | Ga0070671_100189988 | Ga0070671_1001899882 | 131 |
| 558 | 3300005355 | Ga0070671_100383911 | Ga0070671_1003839111 | 131 |
| 559 | 3300005355 | Ga0070671_100963231 | Ga0070671_1009632311 | 131 |
| 560 | 3300005356 | Ga0070674_100039880 | Ga0070674_1000398806 | 131 |
| 561 | 3300005356 | Ga0070674_100056124 | Ga0070674_1000561245 | 131 |
| 562 | 3300005356 | Ga0070674_100096649 | Ga0070674_1000966494 | 131 |
| 563 | 3300005356 | Ga0070674_100310754 | Ga0070674_1003107542 | 131 |
| 564 | 3300005356 | Ga0070674_100364718 | Ga0070674_1003647182 | 131 |
| 565 | 3300005356 | Ga0070674_100399417 | Ga0070674_1003994173 | 131 |
| 566 | 3300005356 | Ga0070674_100667031 | Ga0070674_1006670312 | 131 |
| 567 | 3300005356 | Ga0070674_100687011 | Ga0070674_1006870112 | 131 |
| 568 | 3300005356 | Ga0070674_100854573 | Ga0070674_1008545732 | 131 |
| 569 | 3300005356 | Ga0070674_101003197 | Ga0070674_1010031972 | 131 |
| 570 | 3300005356 | Ga0070674_101903081 | Ga0070674_1019030811 | 131 |
| 571 | 3300005364 | Ga0070673_100015167 | Ga0070673_1000151679 | 131 |
| 572 | 3300005364 | Ga0070673_100034303 | Ga0070673_1000343035 | 131 |
| 573 | 3300005364 | Ga0070673_100092283 | Ga0070673_1000922834 | 131 |
| 574 | 3300005364 | Ga0070673_100192497 | Ga0070673_1001924972 | 131 |
| 575 | 3300005364 | Ga0070673_100341751 | Ga0070673_1003417513 | 131 |
| 576 | 3300005364 | Ga0070673_100682053 | Ga0070673_1006820532 | 131 |
| 577 | 3300005365 | Ga0070688_100100587 | Ga0070688_1001005873 | 131 |
| 578 | 3300005365 | Ga0070688_100304757 | Ga0070688_1003047573 | 131 |
| 579 | 3300005365 | Ga0070688_100375525 | Ga0070688_1003755252 | 131 |
| 580 | 3300005366 | Ga0070659_100250633 | Ga0070659_1002506331 | 131 |
| 581 | 3300005366 | Ga0070659_100378036 | Ga0070659_1003780362 | 131 |
| 582 | 3300005366 | Ga0070659_100428407 | Ga0070659_1004284072 | 131 |
| 583 | 3300005366 | Ga0070659_100865268 | Ga0070659_1008652681 | 131 |
| 584 | 3300005366 | Ga0070659_101257943 | Ga0070659_1012579431 | 131 |
| 585 | 3300005366 | Ga0070659_101322051 | Ga0070659_1013220511 | 131 |
| 586 | 3300005366 | Ga0070659_101646251 | Ga0070659_1016462512 | 131 |
| 587 | 3300005367 | Ga0070667_100022362 | Ga0070667_1000223628 | 131 |
| 588 | 3300005367 | Ga0070667_100083378 | Ga0070667_1000833784 | 131 |
| 589 | 3300005367 | Ga0070667_100129962 | Ga0070667_1001299624 | 131 |
| 590 | 3300005367 | Ga0070667_100158747 | Ga0070667_1001587472 | 131 |
| 591 | 3300005367 | Ga0070667_100191574 | Ga0070667_1001915741 | 131 |
| 592 | 3300005367 | Ga0070667_100204785 | Ga0070667_1002047853 | 131 |
| 593 | 3300005367 | Ga0070667_100231002 | Ga0070667_1002310023 | 131 |
| 594 | 3300005434 | Ga0070709_10079106 | Ga0070709_100791064 | 131 |
| 595 | 3300005434 | Ga0070709_10501440 | Ga0070709_105014402 | 131 |
| 596 | 3300005434 | Ga0070709_11202713 | Ga0070709_112027132 | 131 |
| 597 | 3300005435 | Ga0070714_100019666 | Ga0070714_1000196669 | 131 |
| 598 | 3300005436 | Ga0070713_100092760 | Ga0070713_1000927603 | 131 |
| 599 | 3300005437 | Ga0070710_10297749 | Ga0070710_102977492 | 131 |
| 600 | 3300005438 | Ga0070701_10012276 | Ga0070701_100122762 | 131 |
| 601 | 3300005438 | Ga0070701_10134721 | Ga0070701_101347211 | 131 |
| 602 | 3300005438 | Ga0070701_10711485 | Ga0070701_107114851 | 131 |
| 603 | 3300005439 | Ga0070711_101263279 | Ga0070711_1012632791 | 131 |
| 604 | 3300005440 | Ga0070705_101369690 | Ga0070705_1013696902 | 131 |
| 605 | 3300005441 | Ga0070700_100111081 | Ga0070700_1001110814 | 131 |
| 606 | 3300005441 | Ga0070700_100185857 | Ga0070700_1001858572 | 131 |
| 607 | 3300005441 | Ga0070700_100203545 | Ga0070700_1002035452 | 131 |
| 608 | 3300005441 | Ga0070700_100366844 | Ga0070700_1003668441 | 131 |
| 609 | 3300005441 | Ga0070700_100575157 | Ga0070700_1005751572 | 131 |
| 610 | 3300005444 | Ga0070694_100435416 | Ga0070694_1004354162 | 131 |
| 611 | 3300005444 | Ga0070694_101210701 | Ga0070694_1012107012 | 131 |
| 612 | 3300005455 | Ga0070663_100003492 | Ga0070663_1000034923 | 131 |
| 613 | 3300005455 | Ga0070663_100383305 | Ga0070663_1003833052 | 131 |
| 614 | 3300005455 | Ga0070663_100460622 | Ga0070663_1004606223 | 131 |
| 615 | 3300005455 | Ga0070663_101254864 | Ga0070663_1012548642 | 131 |
| 616 | 3300005455 | Ga0070663_101578771 | Ga0070663_1015787712 | 131 |
| 617 | 3300005456 | Ga0070678_100082508 | Ga0070678_1000825085 | 131 |
| 618 | 3300005456 | Ga0070678_100104114 | Ga0070678_1001041143 | 131 |
| 619 | 3300005456 | Ga0070678_100137945 | Ga0070678_1001379452 | 131 |
| 620 | 3300005456 | Ga0070678_100500637 | Ga0070678_1005006371 | 131 |
| 621 | 3300005456 | Ga0070678_100776147 | Ga0070678_1007761472 | 131 |
| 622 | 3300005456 | Ga0070678_100914938 | Ga0070678_1009149382 | 131 |
| 623 | 3300005457 | Ga0070662_100051713 | Ga0070662_1000517135 | 131 |
| 624 | 3300005457 | Ga0070662_100193386 | Ga0070662_1001933862 | 131 |
| 625 | 3300005457 | Ga0070662_100613806 | Ga0070662_1006138061 | 131 |
| 626 | 3300005457 | Ga0070662_100782507 | Ga0070662_1007825071 | 131 |
| 627 | 3300005458 | Ga0070681_10088377 | Ga0070681_100883775 | 131 |
| 628 | 3300005459 | Ga0068867_100000552 | Ga0068867_10000055223 | 131 |
| 629 | 3300005459 | Ga0068867_100002598 | Ga0068867_10000259811 | 131 |
| 630 | 3300005459 | Ga0068867_100011425 | Ga0068867_1000114255 | 131 |
| 631 | 3300005459 | Ga0068867_100064867 | Ga0068867_1000648675 | 131 |
| 632 | 3300005459 | Ga0068867_100069225 | Ga0068867_1000692251 | 131 |
| 633 | 3300005459 | Ga0068867_100087646 | Ga0068867_1000876464 | 131 |
| 634 | 3300005459 | Ga0068867_100276422 | Ga0068867_1002764221 | 131 |
| 635 | 3300005459 | Ga0068867_100284808 | Ga0068867_1002848083 | 131 |
| 636 | 3300005459 | Ga0068867_100292499 | Ga0068867_1002924992 | 131 |
| 637 | 3300005459 | Ga0068867_100336428 | Ga0068867_1003364281 | 131 |
| 638 | 3300005459 | Ga0068867_100582762 | Ga0068867_1005827623 | 131 |
| 639 | 3300005459 | Ga0068867_100695754 | Ga0068867_1006957541 | 131 |
| 640 | 3300005466 | Ga0070685_10075272 | Ga0070685_100752723 | 131 |
| 641 | 3300005466 | Ga0070685_10101298 | Ga0070685_101012981 | 131 |
| 642 | 3300005466 | Ga0070685_10394830 | Ga0070685_103948301 | 131 |
| 643 | 3300005466 | Ga0070685_10423778 | Ga0070685_104237782 | 131 |
| 644 | 3300005466 | Ga0070685_10454733 | Ga0070685_104547332 | 131 |
| 645 | 3300005467 | Ga0070706_101474223 | Ga0070706_1014742231 | 131 |
| 646 | 3300005468 | Ga0070707_100905496 | Ga0070707_1009054962 | 131 |
| 647 | 3300005518 | Ga0070699_101072406 | Ga0070699_1010724062 | 131 |
| 648 | 3300005530 | Ga0070679_100007565 | Ga0070679_1000075657 | 131 |
| 649 | 3300005530 | Ga0070679_101164604 | Ga0070679_1011646042 | 131 |
| 650 | 3300005535 | Ga0070684_100178663 | Ga0070684_1001786633 | 131 |
| 651 | 3300005535 | Ga0070684_100247020 | Ga0070684_1002470203 | 131 |
| 652 | 3300005536 | Ga0070697_100735690 | Ga0070697_1007356902 | 131 |
| 653 | 3300005539 | Ga0068853_100320550 | Ga0068853_1003205502 | 131 |
| 654 | 3300005539 | Ga0068853_100330775 | Ga0068853_1003307751 | 131 |
| 655 | 3300005539 | Ga0068853_100868330 | Ga0068853_1008683302 | 131 |
| 656 | 3300005539 | Ga0068853_100880616 | Ga0068853_1008806161 | 131 |
| 657 | 3300005539 | Ga0068853_100930104 | Ga0068853_1009301042 | 131 |
| 658 | 3300005539 | Ga0068853_101141703 | Ga0068853_1011417031 | 131 |
| 659 | 3300005543 | Ga0070672_100006187 | Ga0070672_10000618712 | 131 |
| 660 | 3300005543 | Ga0070672_100010859 | Ga0070672_10001085912 | 131 |
| 661 | 3300005543 | Ga0070672_100044598 | Ga0070672_1000445985 | 131 |
| 662 | 3300005543 | Ga0070672_100198587 | Ga0070672_1001985873 | 131 |
| 663 | 3300005543 | Ga0070672_100378493 | Ga0070672_1003784932 | 131 |
| 664 | 3300005543 | Ga0070672_100571956 | Ga0070672_1005719562 | 131 |
| 665 | 3300005543 | Ga0070672_100747572 | Ga0070672_1007475722 | 131 |
| 666 | 3300005543 | Ga0070672_101096081 | Ga0070672_1010960812 | 131 |
| 667 | 3300005543 | Ga0070672_101600140 | Ga0070672_1016001401 | 131 |
| 668 | 3300005543 | Ga0070672_101794085 | Ga0070672_1017940851 | 131 |
| 669 | 3300005544 | Ga0070686_100304762 | Ga0070686_1003047622 | 131 |
| 670 | 3300005544 | Ga0070686_100621476 | Ga0070686_1006214761 | 131 |
| 671 | 3300005545 | Ga0070695_100207075 | Ga0070695_1002070753 | 131 |
| 672 | 3300005545 | Ga0070695_100315217 | Ga0070695_1003152172 | 131 |
| 673 | 3300005546 | Ga0070696_100094917 | Ga0070696_1000949172 | 131 |
| 674 | 3300005547 | Ga0070693_100023342 | Ga0070693_1000233425 | 131 |
| 675 | 3300005547 | Ga0070693_100069686 | Ga0070693_1000696863 | 131 |
| 676 | 3300005548 | Ga0070665_100320840 | Ga0070665_1003208402 | 131 |
| 677 | 3300005548 | Ga0070665_100373744 | Ga0070665_1003737443 | 131 |
| 678 | 3300005548 | Ga0070665_100468764 | Ga0070665_1004687642 | 131 |
| 679 | 3300005548 | Ga0070665_100552322 | Ga0070665_1005523222 | 131 |
| 680 | 3300005548 | Ga0070665_100751082 | Ga0070665_1007510822 | 131 |
| 681 | 3300005549 | Ga0070704_100096958 | Ga0070704_1000969583 | 131 |
| 682 | 3300005549 | Ga0070704_102227173 | Ga0070704_1022271731 | 131 |
| 683 | 3300005563 | Ga0068855_100040434 | Ga0068855_1000404347 | 131 |
| 684 | 3300005563 | Ga0068855_100058607 | Ga0068855_1000586072 | 131 |
| 685 | 3300005563 | Ga0068855_100490245 | Ga0068855_1004902453 | 131 |
| 686 | 3300005564 | Ga0070664_100155787 | Ga0070664_1001557875 | 131 |
| 687 | 3300005564 | Ga0070664_100238231 | Ga0070664_1002382314 | 131 |
| 688 | 3300005564 | Ga0070664_100273368 | Ga0070664_1002733681 | 131 |
| 689 | 3300005564 | Ga0070664_100284562 | Ga0070664_1002845621 | 131 |
| 690 | 3300005564 | Ga0070664_100380435 | Ga0070664_1003804353 | 131 |
| 691 | 3300005564 | Ga0070664_102024331 | Ga0070664_1020243311 | 131 |
| 692 | 3300005564 | Ga0070664_102082275 | Ga0070664_1020822752 | 131 |
| 693 | 3300005577 | Ga0068857_100040688 | Ga0068857_1000406885 | 131 |
| 694 | 3300005577 | Ga0068857_100209439 | Ga0068857_1002094393 | 131 |
| 695 | 3300005577 | Ga0068857_100519076 | Ga0068857_1005190762 | 131 |
| 696 | 3300005577 | Ga0068857_100685991 | Ga0068857_1006859913 | 131 |
| 697 | 3300005577 | Ga0068857_100767834 | Ga0068857_1007678342 | 131 |
| 698 | 3300005577 | Ga0068857_101282743 | Ga0068857_1012827432 | 131 |
| 699 | 3300005578 | Ga0068854_100044785 | Ga0068854_1000447857 | 131 |
| 700 | 3300005578 | Ga0068854_100230274 | Ga0068854_1002302744 | 131 |
| 701 | 3300005578 | Ga0068854_102251975 | Ga0068854_1022519751 | 131 |
| 702 | 3300005614 | Ga0068856_100183859 | Ga0068856_1001838593 | 131 |
| 703 | 3300005614 | Ga0068856_100244565 | Ga0068856_1002445654 | 131 |
| 704 | 3300005614 | Ga0068856_100345416 | Ga0068856_1003454163 | 131 |
| 705 | 3300005614 | Ga0068856_101672088 | Ga0068856_1016720882 | 131 |
| 706 | 3300005615 | Ga0070702_100403402 | Ga0070702_1004034022 | 131 |
| 707 | 3300005615 | Ga0070702_100490995 | Ga0070702_1004909952 | 131 |
| 708 | 3300005615 | Ga0070702_100832465 | Ga0070702_1008324652 | 131 |
| 709 | 3300005616 | Ga0068852_100102229 | Ga0068852_1001022294 | 131 |
| 710 | 3300005616 | Ga0068852_100307390 | Ga0068852_1003073904 | 131 |
| 711 | 3300005616 | Ga0068852_100315873 | Ga0068852_1003158733 | 131 |
| 712 | 3300005616 | Ga0068852_100651676 | Ga0068852_1006516762 | 131 |
| 713 | 3300005616 | Ga0068852_100824589 | Ga0068852_1008245891 | 131 |
| 714 | 3300005616 | Ga0068852_100889233 | Ga0068852_1008892331 | 131 |
| 715 | 3300005616 | Ga0068852_101084487 | Ga0068852_1010844872 | 131 |
| 716 | 3300005617 | Ga0068859_100047020 | Ga0068859_1000470206 | 131 |
| 717 | 3300005617 | Ga0068859_100130187 | Ga0068859_1001301871 | 131 |
| 718 | 3300005617 | Ga0068859_100627269 | Ga0068859_1006272692 | 131 |
| 719 | 3300005617 | Ga0068859_100701377 | Ga0068859_1007013772 | 131 |
| 720 | 3300005617 | Ga0068859_100794112 | Ga0068859_1007941122 | 131 |
| 721 | 3300005617 | Ga0068859_100993513 | Ga0068859_1009935132 | 131 |
| 722 | 3300005617 | Ga0068859_101730399 | Ga0068859_1017303992 | 131 |
| 723 | 3300005618 | Ga0068864_100043033 | Ga0068864_1000430339 | 131 |
| 724 | 3300005618 | Ga0068864_100144620 | Ga0068864_1001446202 | 131 |
| 725 | 3300005618 | Ga0068864_100277415 | Ga0068864_1002774153 | 131 |
| 726 | 3300005618 | Ga0068864_100353670 | Ga0068864_1003536702 | 131 |
| 727 | 3300005618 | Ga0068864_101060311 | Ga0068864_1010603111 | 131 |
| 728 | 3300005618 | Ga0068864_101644636 | Ga0068864_1016446362 | 131 |
| 729 | 3300005618 | Ga0068864_102557003 | Ga0068864_1025570032 | 131 |
| 730 | 3300005718 | Ga0068866_10091328 | Ga0068866_100913283 | 131 |
| 731 | 3300005718 | Ga0068866_10091532 | Ga0068866_100915323 | 131 |
| 732 | 3300005718 | Ga0068866_10957394 | Ga0068866_109573941 | 131 |
| 733 | 3300005719 | Ga0068861_100004770 | Ga0068861_10000477016 | 131 |
| 734 | 3300005719 | Ga0068861_100016735 | Ga0068861_1000167357 | 131 |
| 735 | 3300005719 | Ga0068861_100021676 | Ga0068861_1000216767 | 131 |
| 736 | 3300005719 | Ga0068861_100170807 | Ga0068861_1001708072 | 131 |
| 737 | 3300005719 | Ga0068861_100174810 | Ga0068861_1001748104 | 131 |
| 738 | 3300005719 | Ga0068861_100885579 | Ga0068861_1008855792 | 131 |
| 739 | 3300005719 | Ga0068861_102523344 | Ga0068861_1025233441 | 131 |
| 740 | 3300005834 | Ga0068851_10332137 | Ga0068851_103321372 | 131 |
| 741 | 3300005840 | Ga0068870_10164633 | Ga0068870_101646332 | 131 |
| 742 | 3300005840 | Ga0068870_10224043 | Ga0068870_102240432 | 131 |
| 743 | 3300005840 | Ga0068870_10231402 | Ga0068870_102314023 | 131 |
| 744 | 3300005840 | Ga0068870_10569048 | Ga0068870_105690482 | 131 |
| 745 | 3300005840 | Ga0068870_10983496 | Ga0068870_109834961 | 131 |
| 746 | 3300005840 | Ga0068870_11243514 | Ga0068870_112435141 | 131 |
| 747 | 3300005841 | Ga0068863_100011076 | Ga0068863_10001107615 | 131 |
| 748 | 3300005841 | Ga0068863_100156589 | Ga0068863_1001565894 | 131 |
| 749 | 3300005841 | Ga0068863_100242760 | Ga0068863_1002427602 | 131 |
| 750 | 3300005841 | Ga0068863_100316460 | Ga0068863_1003164603 | 131 |
| 751 | 3300005841 | Ga0068863_100368482 | Ga0068863_1003684822 | 131 |
| 752 | 3300005841 | Ga0068863_100901362 | Ga0068863_1009013622 | 131 |
| 753 | 3300005841 | Ga0068863_101044897 | Ga0068863_1010448972 | 131 |
| 754 | 3300005842 | Ga0068858_100008125 | Ga0068858_10000812512 | 131 |
| 755 | 3300005842 | Ga0068858_100194536 | Ga0068858_1001945364 | 131 |
| 756 | 3300005842 | Ga0068858_100477508 | Ga0068858_1004775082 | 131 |
| 757 | 3300005843 | Ga0068860_100008442 | Ga0068860_1000084429 | 131 |
| 758 | 3300005843 | Ga0068860_100048811 | Ga0068860_1000488116 | 131 |
| 759 | 3300005843 | Ga0068860_100065679 | Ga0068860_1000656793 | 131 |
| 760 | 3300005843 | Ga0068860_100074726 | Ga0068860_1000747264 | 131 |
| 761 | 3300005843 | Ga0068860_100125358 | Ga0068860_1001253585 | 131 |
| 762 | 3300005843 | Ga0068860_100210653 | Ga0068860_1002106532 | 131 |
| 763 | 3300005843 | Ga0068860_100214297 | Ga0068860_1002142972 | 131 |
| 764 | 3300005843 | Ga0068860_100234051 | Ga0068860_1002340514 | 131 |
| 765 | 3300005843 | Ga0068860_100722091 | Ga0068860_1007220912 | 131 |
| 766 | 3300005844 | Ga0068862_100009442 | Ga0068862_1000094426 | 131 |
| 767 | 3300005844 | Ga0068862_100098243 | Ga0068862_1000982434 | 131 |
| 768 | 3300005844 | Ga0068862_100103723 | Ga0068862_1001037232 | 131 |
| 769 | 3300005844 | Ga0068862_100137286 | Ga0068862_1001372863 | 131 |
| 770 | 3300005844 | Ga0068862_100145559 | Ga0068862_1001455592 | 131 |
| 771 | 3300005844 | Ga0068862_100471684 | Ga0068862_1004716843 | 131 |
| 772 | 3300005844 | Ga0068862_100722741 | Ga0068862_1007227413 | 131 |
| 773 | 3300005844 | Ga0068862_101455220 | Ga0068862_1014552202 | 131 |
| 774 | 3300005937 | Ga0081455_10008699 | Ga0081455_1000869912 | 131 |
| 775 | 3300005937 | Ga0081455_10199133 | Ga0081455_101991332 | 131 |
| 776 | 3300006038 | Ga0075365_10100810 | Ga0075365_101008104 | 131 |
| 777 | 3300006038 | Ga0075365_10318739 | Ga0075365_103187392 | 131 |
| 778 | 3300006038 | Ga0075365_10467937 | Ga0075365_104679372 | 131 |
| 779 | 3300006042 | Ga0075368_10058905 | Ga0075368_100589053 | 131 |
| 780 | 3300006042 | Ga0075368_10064460 | Ga0075368_100644603 | 131 |
| 781 | 3300006042 | Ga0075368_10064476 | Ga0075368_100644762 | 131 |
| 782 | 3300006048 | Ga0075363_100005889 | Ga0075363_1000058894 | 131 |
| 783 | 3300006048 | Ga0075363_100049841 | Ga0075363_1000498413 | 131 |
| 784 | 3300006048 | Ga0075363_100204317 | Ga0075363_1002043173 | 131 |
| 785 | 3300006048 | Ga0075363_100312622 | Ga0075363_1003126222 | 131 |
| 786 | 3300006048 | Ga0075363_100707422 | Ga0075363_1007074222 | 131 |
| 787 | 3300006048 | Ga0075363_100816685 | Ga0075363_1008166852 | 131 |
| 788 | 3300006051 | Ga0075364_10032491 | Ga0075364_100324916 | 131 |
| 789 | 3300006051 | Ga0075364_10038599 | Ga0075364_100385995 | 131 |
| 790 | 3300006051 | Ga0075364_10134805 | Ga0075364_101348054 | 131 |
| 791 | 3300006051 | Ga0075364_10564781 | Ga0075364_105647812 | 131 |
| 792 | 3300006051 | Ga0075364_10573168 | Ga0075364_105731682 | 131 |
| 793 | 3300006058 | Ga0075432_10133565 | Ga0075432_101335652 | 131 |
| 794 | 3300006163 | Ga0070715_10079026 | Ga0070715_100790262 | 131 |
| 795 | 3300006163 | Ga0070715_10111151 | Ga0070715_101111513 | 131 |
| 796 | 3300006173 | Ga0070716_100069303 | Ga0070716_1000693033 | 131 |
| 797 | 3300006173 | Ga0070716_100521023 | Ga0070716_1005210232 | 131 |
| 798 | 3300006177 | Ga0075362_10000222 | Ga0075362_1000022217 | 131 |
| 799 | 3300006177 | Ga0075362_10060918 | Ga0075362_100609181 | 131 |
| 800 | 3300006177 | Ga0075362_10085974 | Ga0075362_100859742 | 131 |
| 801 | 3300006177 | Ga0075362_10168463 | Ga0075362_101684632 | 131 |
| 802 | 3300006177 | Ga0075362_10285808 | Ga0075362_102858082 | 131 |
| 803 | 3300006177 | Ga0075362_10374102 | Ga0075362_103741022 | 131 |
| 804 | 3300006177 | Ga0075362_10474507 | Ga0075362_104745072 | 131 |
| 805 | 3300006178 | Ga0075367_10000855 | Ga0075367_1000085511 | 131 |
| 806 | 3300006178 | Ga0075367_10010768 | Ga0075367_100107683 | 131 |
| 807 | 3300006178 | Ga0075367_10092185 | Ga0075367_100921853 | 131 |
| 808 | 3300006178 | Ga0075367_10246017 | Ga0075367_102460172 | 131 |
| 809 | 3300006178 | Ga0075367_10348297 | Ga0075367_103482971 | 131 |
| 810 | 3300006178 | Ga0075367_10707440 | Ga0075367_107074402 | 131 |
| 811 | 3300006186 | Ga0075369_10005325 | Ga0075369_100053257 | 131 |
| 812 | 3300006186 | Ga0075369_10110152 | Ga0075369_101101523 | 131 |
| 813 | 3300006186 | Ga0075369_10215809 | Ga0075369_102158092 | 131 |
| 814 | 3300006186 | Ga0075369_10423981 | Ga0075369_104239812 | 131 |
| 815 | 3300006195 | Ga0075366_10033848 | Ga0075366_100338483 | 131 |
| 816 | 3300006195 | Ga0075366_10050535 | Ga0075366_100505352 | 131 |
| 817 | 3300006195 | Ga0075366_10058278 | Ga0075366_100582782 | 131 |
| 818 | 3300006195 | Ga0075366_10077134 | Ga0075366_100771343 | 131 |
| 819 | 3300006195 | Ga0075366_10081535 | Ga0075366_100815354 | 131 |
| 820 | 3300006195 | Ga0075366_10096819 | Ga0075366_100968192 | 131 |
| 821 | 3300006195 | Ga0075366_10138878 | Ga0075366_101388784 | 131 |
| 822 | 3300006195 | Ga0075366_10153936 | Ga0075366_101539363 | 131 |
| 823 | 3300006195 | Ga0075366_10166789 | Ga0075366_101667892 | 131 |
| 824 | 3300006195 | Ga0075366_10263345 | Ga0075366_102633453 | 131 |
| 825 | 3300006195 | Ga0075366_10321927 | Ga0075366_103219271 | 131 |
| 826 | 3300006195 | Ga0075366_10328391 | Ga0075366_103283912 | 131 |
| 827 | 3300006195 | Ga0075366_10469892 | Ga0075366_104698922 | 131 |
| 828 | 3300006195 | Ga0075366_10507801 | Ga0075366_105078011 | 131 |
| 829 | 3300006195 | Ga0075366_10965137 | Ga0075366_109651371 | 131 |
| 830 | 3300006237 | Ga0097621_100115517 | Ga0097621_1001155173 | 131 |
| 831 | 3300006237 | Ga0097621_100139427 | Ga0097621_1001394272 | 131 |
| 832 | 3300006237 | Ga0097621_100480099 | Ga0097621_1004800992 | 131 |
| 833 | 3300006237 | Ga0097621_100512914 | Ga0097621_1005129142 | 131 |
| 834 | 3300006237 | Ga0097621_100662626 | Ga0097621_1006626262 | 131 |
| 835 | 3300006237 | Ga0097621_100944722 | Ga0097621_1009447222 | 131 |
| 836 | 3300006353 | Ga0075370_10001150 | Ga0075370_1000115010 | 131 |
| 837 | 3300006353 | Ga0075370_10023630 | Ga0075370_100236307 | 131 |
| 838 | 3300006353 | Ga0075370_10064344 | Ga0075370_100643442 | 131 |
| 839 | 3300006358 | Ga0068871_100126623 | Ga0068871_1001266232 | 131 |
| 840 | 3300006358 | Ga0068871_100221491 | Ga0068871_1002214913 | 131 |
| 841 | 3300006358 | Ga0068871_100408440 | Ga0068871_1004084402 | 131 |
| 842 | 3300006358 | Ga0068871_100453812 | Ga0068871_1004538123 | 131 |
| 843 | 3300006358 | Ga0068871_100540442 | Ga0068871_1005404421 | 131 |
| 844 | 3300006358 | Ga0068871_100982475 | Ga0068871_1009824752 | 131 |
| 845 | 3300006844 | Ga0075428_100000808 | Ga0075428_10000080817 | 131 |
| 846 | 3300006846 | Ga0075430_100218759 | Ga0075430_1002187592 | 131 |
| 847 | 3300006846 | Ga0075430_100233239 | Ga0075430_1002332393 | 131 |
| 848 | 3300006846 | Ga0075430_100302039 | Ga0075430_1003020392 | 131 |
| 849 | 3300006871 | Ga0075434_100855539 | Ga0075434_1008555393 | 131 |
| 850 | 3300006880 | Ga0075429_100034628 | Ga0075429_1000346282 | 131 |
| 851 | 3300006880 | Ga0075429_100043701 | Ga0075429_1000437013 | 131 |
| 852 | 3300006880 | Ga0075429_100123917 | Ga0075429_1001239172 | 131 |
| 853 | 3300006881 | Ga0068865_100004060 | Ga0068865_1000040605 | 131 |
| 854 | 3300006881 | Ga0068865_100647903 | Ga0068865_1006479031 | 131 |
| 855 | 3300006881 | Ga0068865_100882343 | Ga0068865_1008823431 | 131 |
| 856 | 3300006881 | Ga0068865_101254167 | Ga0068865_1012541671 | 131 |
| 857 | 3300006931 | Ga0097620_100047018 | Ga0097620_1000470186 | 131 |
| 858 | 3300006931 | Ga0097620_100130185 | Ga0097620_1001301851 | 131 |
| 859 | 3300006931 | Ga0097620_100627282 | Ga0097620_1006272822 | 131 |
| 860 | 3300006931 | Ga0097620_100701492 | Ga0097620_1007014922 | 131 |
| 861 | 3300006931 | Ga0097620_100794090 | Ga0097620_1007940902 | 131 |
| 862 | 3300006931 | Ga0097620_100993489 | Ga0097620_1009934892 | 131 |
| 863 | 3300006931 | Ga0097620_101730416 | Ga0097620_1017304161 | 131 |
| 864 | 3300006948 | Ga0099826_10000024 | Ga0099826_1000002417 | 131 |
| 865 | 3300009011 | Ga0105251_10023641 | Ga0105251_100236415 | 131 |
| 866 | 3300009093 | Ga0105240_10627271 | Ga0105240_106272711 | 131 |
| 867 | 3300009094 | Ga0111539_10529840 | Ga0111539_105298402 | 131 |
| 868 | 3300009094 | Ga0111539_11140813 | Ga0111539_111408132 | 131 |
| 869 | 3300009094 | Ga0111539_11150091 | Ga0111539_111500911 | 131 |
| 870 | 3300009094 | Ga0111539_11374449 | Ga0111539_113744492 | 131 |
| 871 | 3300009094 | Ga0111539_11738195 | Ga0111539_117381952 | 131 |
| 872 | 3300009094 | Ga0111539_12219808 | Ga0111539_122198081 | 131 |
| 873 | 3300009098 | Ga0105245_10300472 | Ga0105245_103004724 | 131 |
| 874 | 3300009098 | Ga0105245_10973459 | Ga0105245_109734592 | 131 |
| 875 | 3300009098 | Ga0105245_12137730 | Ga0105245_121377301 | 131 |
| 876 | 3300009101 | Ga0105247_10117961 | Ga0105247_101179614 | 131 |
| 877 | 3300009101 | Ga0105247_10250972 | Ga0105247_102509723 | 131 |
| 878 | 3300009147 | Ga0114129_10778086 | Ga0114129_107780862 | 131 |
| 879 | 3300009148 | Ga0105243_10001789 | Ga0105243_1000178917 | 131 |
| 880 | 3300009148 | Ga0105243_10177569 | Ga0105243_101775692 | 131 |
| 881 | 3300009148 | Ga0105243_10194189 | Ga0105243_101941893 | 131 |
| 882 | 3300009148 | Ga0105243_10230579 | Ga0105243_102305792 | 131 |
| 883 | 3300009148 | Ga0105243_10387979 | Ga0105243_103879792 | 131 |
| 884 | 3300009148 | Ga0105243_10913307 | Ga0105243_109133071 | 131 |
| 885 | 3300009148 | Ga0105243_11520960 | Ga0105243_115209601 | 131 |
| 886 | 3300009148 | Ga0105243_11762942 | Ga0105243_117629422 | 131 |
| 887 | 3300009174 | Ga0105241_10082907 | Ga0105241_100829075 | 131 |
| 888 | 3300009176 | Ga0105242_10059064 | Ga0105242_100590646 | 131 |
| 889 | 3300009176 | Ga0105242_10090242 | Ga0105242_100902426 | 131 |
| 890 | 3300009176 | Ga0105242_12014288 | Ga0105242_120142882 | 131 |
| 891 | 3300009177 | Ga0105248_10028458 | Ga0105248_1002845813 | 131 |
| 892 | 3300009177 | Ga0105248_10047589 | Ga0105248_100475892 | 131 |
| 893 | 3300009177 | Ga0105248_10208334 | Ga0105248_102083342 | 131 |
| 894 | 3300009177 | Ga0105248_10511830 | Ga0105248_105118302 | 131 |
| 895 | 3300009177 | Ga0105248_10531205 | Ga0105248_105312051 | 131 |
| 896 | 3300009177 | Ga0105248_10542893 | Ga0105248_105428932 | 131 |
| 897 | 3300009177 | Ga0105248_11419336 | Ga0105248_114193361 | 131 |
| 898 | 3300009177 | Ga0105248_12022369 | Ga0105248_120223692 | 131 |
| 899 | 3300009545 | Ga0105237_10020609 | Ga0105237_100206093 | 131 |
| 900 | 3300009545 | Ga0105237_10393453 | Ga0105237_103934533 | 131 |
| 901 | 3300009545 | Ga0105237_12755999 | Ga0105237_127559991 | 131 |
| 902 | 3300009551 | Ga0105238_10064333 | Ga0105238_100643337 | 131 |
| 903 | 3300009551 | Ga0105238_10951806 | Ga0105238_109518062 | 131 |
| 904 | 3300009551 | Ga0105238_11583629 | Ga0105238_115836292 | 131 |
| 905 | 3300009553 | Ga0105249_10309743 | Ga0105249_103097432 | 131 |
| 906 | 3300009553 | Ga0105249_10484018 | Ga0105249_104840182 | 131 |
| 907 | 3300009553 | Ga0105249_10993164 | Ga0105249_109931642 | 131 |
| 908 | 3300010375 | Ga0105239_10444502 | Ga0105239_104445023 | 131 |
| 909 | 3300010375 | Ga0105239_10557327 | Ga0105239_105573271 | 131 |
| 910 | 3300011119 | Ga0105246_10452402 | Ga0105246_104524023 | 131 |
| 911 | 3300011119 | Ga0105246_10873656 | Ga0105246_108736562 | 131 |
| 912 | 3300011119 | Ga0105246_10919730 | Ga0105246_109197302 | 131 |
| 913 | 3300011119 | Ga0105246_10963508 | Ga0105246_109635082 | 131 |
| 914 | 3300012475 | Ga0157317_1014804 | Ga0157317_10148041 | 131 |
| 915 | 3300012478 | Ga0157328_1000557 | Ga0157328_10005573 | 131 |
| 916 | 3300012482 | Ga0157318_1012036 | Ga0157318_10120362 | 131 |
| 917 | 3300012494 | Ga0157341_1001034 | Ga0157341_10010343 | 131 |
| 918 | 3300012498 | Ga0157345_1013061 | Ga0157345_10130612 | 131 |
| 919 | 3300012500 | Ga0157314_1004276 | Ga0157314_10042762 | 131 |
| 920 | 3300012503 | Ga0157313_1006133 | Ga0157313_10061332 | 131 |
| 921 | 3300012507 | Ga0157342_1044135 | Ga0157342_10441352 | 131 |
| 922 | 3300012508 | Ga0157315_1018239 | Ga0157315_10182392 | 131 |
| 923 | 3300012512 | Ga0157327_1001789 | Ga0157327_10017892 | 131 |
| 924 | 3300013100 | Ga0157373_10040286 | Ga0157373_100402865 | 131 |
| 925 | 3300013100 | Ga0157373_10230096 | Ga0157373_102300963 | 131 |
| 926 | 3300013104 | Ga0157370_10299273 | Ga0157370_102992733 | 131 |
| 927 | 3300013104 | Ga0157370_11085771 | Ga0157370_110857712 | 131 |
| 928 | 3300013105 | Ga0157369_10115967 | Ga0157369_101159674 | 131 |
| 929 | 3300013105 | Ga0157369_10254222 | Ga0157369_102542222 | 131 |
| 930 | 3300013105 | Ga0157369_11576446 | Ga0157369_115764462 | 131 |
| 931 | 3300013296 | Ga0157374_10009298 | Ga0157374_100092986 | 131 |
| 932 | 3300013296 | Ga0157374_10039033 | Ga0157374_1003903310 | 131 |
| 933 | 3300013296 | Ga0157374_10093529 | Ga0157374_100935294 | 131 |
| 934 | 3300013296 | Ga0157374_10183964 | Ga0157374_101839643 | 131 |
| 935 | 3300013296 | Ga0157374_10261841 | Ga0157374_102618411 | 131 |
| 936 | 3300013296 | Ga0157374_10684056 | Ga0157374_106840562 | 131 |
| 937 | 3300013297 | Ga0157378_10008661 | Ga0157378_100086616 | 131 |
| 938 | 3300013297 | Ga0157378_10248653 | Ga0157378_102486534 | 131 |
| 939 | 3300013297 | Ga0157378_10328899 | Ga0157378_103288992 | 131 |
| 940 | 3300013297 | Ga0157378_10415154 | Ga0157378_104151543 | 131 |
| 941 | 3300013297 | Ga0157378_10458589 | Ga0157378_104585892 | 131 |
| 942 | 3300013297 | Ga0157378_10477084 | Ga0157378_104770842 | 131 |
| 943 | 3300013297 | Ga0157378_10478068 | Ga0157378_104780683 | 131 |
| 944 | 3300013297 | Ga0157378_12237547 | Ga0157378_122375471 | 131 |
| 945 | 3300013306 | Ga0163162_10004148 | Ga0163162_1000414816 | 131 |
| 946 | 3300013306 | Ga0163162_10033165 | Ga0163162_100331656 | 131 |
| 947 | 3300013306 | Ga0163162_10211873 | Ga0163162_102118735 | 131 |
| 948 | 3300013306 | Ga0163162_10241802 | Ga0163162_102418023 | 131 |
| 949 | 3300013306 | Ga0163162_10424477 | Ga0163162_104244773 | 131 |
| 950 | 3300013306 | Ga0163162_10491825 | Ga0163162_104918251 | 131 |
| 951 | 3300013306 | Ga0163162_10646134 | Ga0163162_106461342 | 131 |
| 952 | 3300013306 | Ga0163162_11021846 | Ga0163162_110218462 | 131 |
| 953 | 3300013307 | Ga0157372_10023087 | Ga0157372_100230871 | 131 |
| 954 | 3300013307 | Ga0157372_10549579 | Ga0157372_105495792 | 131 |
| 955 | 3300013307 | Ga0157372_11041560 | Ga0157372_110415603 | 131 |
| 956 | 3300013308 | Ga0157375_10026295 | Ga0157375_100262958 | 131 |
| 957 | 3300013308 | Ga0157375_10041626 | Ga0157375_100416267 | 131 |
| 958 | 3300013308 | Ga0157375_10151438 | Ga0157375_101514384 | 131 |
| 959 | 3300013308 | Ga0157375_10239233 | Ga0157375_102392334 | 131 |
| 960 | 3300013308 | Ga0157375_10240286 | Ga0157375_102402862 | 131 |
| 961 | 3300013308 | Ga0157375_10250739 | Ga0157375_102507393 | 131 |
| 962 | 3300013308 | Ga0157375_10493225 | Ga0157375_104932253 | 131 |
| 963 | 3300013308 | Ga0157375_10545902 | Ga0157375_105459023 | 131 |
| 964 | 3300013308 | Ga0157375_11614891 | Ga0157375_116148911 | 131 |
| 965 | 3300014325 | Ga0163163_10098438 | Ga0163163_100984384 | 131 |
| 966 | 3300014325 | Ga0163163_10176222 | Ga0163163_101762224 | 131 |
| 967 | 3300014325 | Ga0163163_10404151 | Ga0163163_104041512 | 131 |
| 968 | 3300014325 | Ga0163163_10652447 | Ga0163163_106524472 | 131 |
| 969 | 3300014325 | Ga0163163_10733157 | Ga0163163_107331571 | 131 |
| 970 | 3300014325 | Ga0163163_10975385 | Ga0163163_109753852 | 131 |
| 971 | 3300014326 | Ga0157380_10205210 | Ga0157380_102052105 | 131 |
| 972 | 3300014326 | Ga0157380_10220567 | Ga0157380_102205674 | 131 |
| 973 | 3300014326 | Ga0157380_10534216 | Ga0157380_105342163 | 131 |
| 974 | 3300014326 | Ga0157380_11328546 | Ga0157380_113285462 | 131 |
| 975 | 3300014497 | Ga0182008_10034449 | Ga0182008_100344495 | 131 |
| 976 | 3300014497 | Ga0182008_10334392 | Ga0182008_103343922 | 131 |
| 977 | 3300014745 | Ga0157377_10000368 | Ga0157377_1000036816 | 131 |
| 978 | 3300014745 | Ga0157377_10396808 | Ga0157377_103968081 | 131 |
| 979 | 3300014968 | Ga0157379_10037733 | Ga0157379_100377332 | 131 |
| 980 | 3300014968 | Ga0157379_10040412 | Ga0157379_100404126 | 131 |
| 981 | 3300014968 | Ga0157379_10061342 | Ga0157379_100613426 | 131 |
| 982 | 3300014968 | Ga0157379_10090060 | Ga0157379_100900604 | 131 |
| 983 | 3300014968 | Ga0157379_10251368 | Ga0157379_102513683 | 131 |
| 984 | 3300014968 | Ga0157379_10728786 | Ga0157379_107287862 | 131 |
| 985 | 3300014968 | Ga0157379_10958172 | Ga0157379_109581721 | 131 |
| 986 | 3300014968 | Ga0157379_11369269 | Ga0157379_113692692 | 131 |
| 987 | 3300014968 | Ga0157379_12031019 | Ga0157379_120310191 | 131 |
| 988 | 3300014969 | Ga0157376_10085443 | Ga0157376_100854433 | 131 |
| 989 | 3300014969 | Ga0157376_10957460 | Ga0157376_109574602 | 131 |
| 990 | 3300014969 | Ga0157376_10983337 | Ga0157376_109833371 | 131 |
| 991 | 3300014969 | Ga0157376_11269830 | Ga0157376_112698302 | 131 |
| 992 | 3300014969 | Ga0157376_13087901 | Ga0157376_130879011 | 131 |
| 993 | 3300015262 | Ga0182007_10061846 | Ga0182007_100618462 | 131 |
| 994 | 3300017792 | Ga0163161_10009049 | Ga0163161_1000904911 | 131 |
| 995 | 3300017792 | Ga0163161_10021239 | Ga0163161_100212396 | 131 |
| 996 | 3300017792 | Ga0163161_10042621 | Ga0163161_100426217 | 131 |
| 997 | 3300017792 | Ga0163161_10057420 | Ga0163161_100574203 | 131 |
| 998 | 3300017792 | Ga0163161_10378130 | Ga0163161_103781301 | 131 |
| 999 | 3300017792 | Ga0163161_11431780 | Ga0163161_114317802 | 131 |
| 1000 | 3300020082 | Ga0206353_11953414 | Ga0206353_119534142 | 131 |
| 1001 | 3300021361 | Ga0213872_10000672 | Ga0213872_1000067217 | 131 |
| 1002 | 3300021377 | Ga0213874_10021138 | Ga0213874_100211381 | 131 |
| 1003 | 3300021377 | Ga0213874_10078842 | Ga0213874_100788422 | 131 |
| 1004 | 3300025245 | Ga0207425_1000680 | Ga0207425_100068013 | 131 |
| 1005 | 3300025258 | Ga0209129_1000158 | Ga0209129_100015847 | 131 |
| 1006 | 3300025273 | Ga0209673_1004093 | Ga0209673_10040935 | 131 |
| 1007 | 3300025273 | Ga0209673_1032334 | Ga0209673_10323342 | 131 |
| 1008 | 3300025290 | Ga0207673_1016945 | Ga0207673_10169452 | 131 |
| 1009 | 3300025295 | Ga0209564_1000282 | Ga0209564_100028247 | 131 |
| 1010 | 3300025297 | Ga0209758_1000910 | Ga0209758_10009108 | 131 |
| 1011 | 3300025297 | Ga0209758_1011080 | Ga0209758_10110804 | 131 |
| 1012 | 3300025298 | Ga0209050_1000223 | Ga0209050_100022370 | 131 |
| 1013 | 3300025299 | Ga0209256_1009680 | Ga0209256_10096806 | 131 |
| 1014 | 3300025303 | Ga0209051_1018074 | Ga0209051_10180743 | 131 |
| 1015 | 3300025315 | Ga0207697_10011122 | Ga0207697_100111227 | 131 |
| 1016 | 3300025315 | Ga0207697_10027047 | Ga0207697_100270472 | 131 |
| 1017 | 3300025315 | Ga0207697_10029574 | Ga0207697_100295743 | 131 |
| 1018 | 3300025321 | Ga0207656_10100216 | Ga0207656_101002163 | 131 |
| 1019 | 3300025321 | Ga0207656_10182284 | Ga0207656_101822843 | 131 |
| 1020 | 3300025735 | Ga0207713_1023386 | Ga0207713_10233866 | 131 |
| 1021 | 3300025893 | Ga0207682_10002147 | Ga0207682_100021476 | 131 |
| 1022 | 3300025893 | Ga0207682_10021887 | Ga0207682_100218873 | 131 |
| 1023 | 3300025893 | Ga0207682_10077687 | Ga0207682_100776873 | 131 |
| 1024 | 3300025893 | Ga0207682_10277013 | Ga0207682_102770131 | 131 |
| 1025 | 3300025893 | Ga0207682_10432489 | Ga0207682_104324891 | 131 |
| 1026 | 3300025898 | Ga0207692_10217960 | Ga0207692_102179602 | 131 |
| 1027 | 3300025899 | Ga0207642_10092854 | Ga0207642_100928543 | 131 |
| 1028 | 3300025899 | Ga0207642_10108364 | Ga0207642_101083643 | 131 |
| 1029 | 3300025899 | Ga0207642_10492183 | Ga0207642_104921832 | 131 |
| 1030 | 3300025899 | Ga0207642_11028319 | Ga0207642_110283191 | 131 |
| 1031 | 3300025900 | Ga0207710_10306473 | Ga0207710_103064732 | 131 |
| 1032 | 3300025901 | Ga0207688_10037622 | Ga0207688_100376222 | 131 |
| 1033 | 3300025901 | Ga0207688_10063302 | Ga0207688_100633024 | 131 |
| 1034 | 3300025901 | Ga0207688_10077775 | Ga0207688_100777752 | 131 |
| 1035 | 3300025901 | Ga0207688_10144333 | Ga0207688_101443331 | 131 |
| 1036 | 3300025901 | Ga0207688_10231679 | Ga0207688_102316793 | 131 |
| 1037 | 3300025903 | Ga0207680_10187572 | Ga0207680_101875723 | 131 |
| 1038 | 3300025903 | Ga0207680_10257091 | Ga0207680_102570913 | 131 |
| 1039 | 3300025903 | Ga0207680_10353603 | Ga0207680_103536031 | 131 |
| 1040 | 3300025903 | Ga0207680_10645731 | Ga0207680_106457312 | 131 |
| 1041 | 3300025903 | Ga0207680_10957317 | Ga0207680_109573171 | 131 |
| 1042 | 3300025905 | Ga0207685_10158287 | Ga0207685_101582872 | 131 |
| 1043 | 3300025905 | Ga0207685_10675810 | Ga0207685_106758102 | 131 |
| 1044 | 3300025907 | Ga0207645_10009972 | Ga0207645_100099729 | 131 |
| 1045 | 3300025907 | Ga0207645_10012543 | Ga0207645_100125438 | 131 |
| 1046 | 3300025907 | Ga0207645_10027678 | Ga0207645_100276785 | 131 |
| 1047 | 3300025907 | Ga0207645_10047232 | Ga0207645_100472324 | 131 |
| 1048 | 3300025907 | Ga0207645_10048474 | Ga0207645_100484745 | 131 |
| 1049 | 3300025907 | Ga0207645_10086402 | Ga0207645_100864023 | 131 |
| 1050 | 3300025907 | Ga0207645_10139657 | Ga0207645_101396572 | 131 |
| 1051 | 3300025907 | Ga0207645_10301667 | Ga0207645_103016672 | 131 |
| 1052 | 3300025907 | Ga0207645_10880985 | Ga0207645_108809851 | 131 |
| 1053 | 3300025908 | Ga0207643_10070432 | Ga0207643_100704324 | 131 |
| 1054 | 3300025908 | Ga0207643_10697330 | Ga0207643_106973302 | 131 |
| 1055 | 3300025908 | Ga0207643_11141960 | Ga0207643_111419601 | 131 |
| 1056 | 3300025909 | Ga0207705_10812019 | Ga0207705_108120192 | 131 |
| 1057 | 3300025909 | Ga0207705_11234190 | Ga0207705_112341901 | 131 |
| 1058 | 3300025909 | Ga0207705_11441062 | Ga0207705_114410621 | 131 |
| 1059 | 3300025910 | Ga0207684_10500490 | Ga0207684_105004902 | 131 |
| 1060 | 3300025910 | Ga0207684_10803308 | Ga0207684_108033082 | 131 |
| 1061 | 3300025911 | Ga0207654_10442697 | Ga0207654_104426971 | 131 |
| 1062 | 3300025914 | Ga0207671_10730804 | Ga0207671_107308042 | 131 |
| 1063 | 3300025915 | Ga0207693_10536869 | Ga0207693_105368691 | 131 |
| 1064 | 3300025916 | Ga0207663_10369763 | Ga0207663_103697633 | 131 |
| 1065 | 3300025917 | Ga0207660_10046145 | Ga0207660_100461453 | 131 |
| 1066 | 3300025918 | Ga0207662_10034330 | Ga0207662_100343305 | 131 |
| 1067 | 3300025918 | Ga0207662_10036401 | Ga0207662_100364014 | 131 |
| 1068 | 3300025918 | Ga0207662_10097784 | Ga0207662_100977843 | 131 |
| 1069 | 3300025918 | Ga0207662_10201054 | Ga0207662_102010542 | 131 |
| 1070 | 3300025919 | Ga0207657_10092779 | Ga0207657_100927794 | 131 |
| 1071 | 3300025919 | Ga0207657_10218405 | Ga0207657_102184053 | 131 |
| 1072 | 3300025920 | Ga0207649_10004699 | Ga0207649_100046993 | 131 |
| 1073 | 3300025920 | Ga0207649_10183146 | Ga0207649_101831462 | 131 |
| 1074 | 3300025921 | Ga0207652_10002940 | Ga0207652_1000294012 | 131 |
| 1075 | 3300025921 | Ga0207652_11225289 | Ga0207652_112252891 | 131 |
| 1076 | 3300025923 | Ga0207681_10005925 | Ga0207681_100059255 | 131 |
| 1077 | 3300025923 | Ga0207681_10021332 | Ga0207681_100213327 | 131 |
| 1078 | 3300025923 | Ga0207681_10041280 | Ga0207681_100412804 | 131 |
| 1079 | 3300025923 | Ga0207681_10071603 | Ga0207681_100716034 | 131 |
| 1080 | 3300025923 | Ga0207681_10111387 | Ga0207681_101113872 | 131 |
| 1081 | 3300025923 | Ga0207681_10901391 | Ga0207681_109013911 | 131 |
| 1082 | 3300025924 | Ga0207694_10034844 | Ga0207694_100348443 | 131 |
| 1083 | 3300025924 | Ga0207694_10452972 | Ga0207694_104529723 | 131 |
| 1084 | 3300025924 | Ga0207694_10505280 | Ga0207694_105052802 | 131 |
| 1085 | 3300025924 | Ga0207694_10688670 | Ga0207694_106886702 | 131 |
| 1086 | 3300025925 | Ga0207650_10002454 | Ga0207650_1000245418 | 131 |
| 1087 | 3300025925 | Ga0207650_10022053 | Ga0207650_100220534 | 131 |
| 1088 | 3300025925 | Ga0207650_10054455 | Ga0207650_100544554 | 131 |
| 1089 | 3300025925 | Ga0207650_10387104 | Ga0207650_103871042 | 131 |
| 1090 | 3300025925 | Ga0207650_10640715 | Ga0207650_106407152 | 131 |
| 1091 | 3300025925 | Ga0207650_10727506 | Ga0207650_107275062 | 131 |
| 1092 | 3300025926 | Ga0207659_10003025 | Ga0207659_100030254 | 131 |
| 1093 | 3300025926 | Ga0207659_10052760 | Ga0207659_100527603 | 131 |
| 1094 | 3300025926 | Ga0207659_10056531 | Ga0207659_100565313 | 131 |
| 1095 | 3300025926 | Ga0207659_10061691 | Ga0207659_100616918 | 131 |
| 1096 | 3300025926 | Ga0207659_10142255 | Ga0207659_101422554 | 131 |
| 1097 | 3300025926 | Ga0207659_11013374 | Ga0207659_110133742 | 131 |
| 1098 | 3300025927 | Ga0207687_10108511 | Ga0207687_101085113 | 131 |
| 1099 | 3300025927 | Ga0207687_10753634 | Ga0207687_107536342 | 131 |
| 1100 | 3300025931 | Ga0207644_10027492 | Ga0207644_100274927 | 131 |
| 1101 | 3300025931 | Ga0207644_10118657 | Ga0207644_101186574 | 131 |
| 1102 | 3300025931 | Ga0207644_10151897 | Ga0207644_101518972 | 131 |
| 1103 | 3300025931 | Ga0207644_10184530 | Ga0207644_101845301 | 131 |
| 1104 | 3300025931 | Ga0207644_10256867 | Ga0207644_102568672 | 131 |
| 1105 | 3300025931 | Ga0207644_10258810 | Ga0207644_102588103 | 131 |
| 1106 | 3300025931 | Ga0207644_10388082 | Ga0207644_103880822 | 131 |
| 1107 | 3300025931 | Ga0207644_10639011 | Ga0207644_106390111 | 131 |
| 1108 | 3300025931 | Ga0207644_11256548 | Ga0207644_112565481 | 131 |
| 1109 | 3300025932 | Ga0207690_10056794 | Ga0207690_100567943 | 131 |
| 1110 | 3300025932 | Ga0207690_10791310 | Ga0207690_107913101 | 131 |
| 1111 | 3300025932 | Ga0207690_11306269 | Ga0207690_113062692 | 131 |
| 1112 | 3300025933 | Ga0207706_10035361 | Ga0207706_100353612 | 131 |
| 1113 | 3300025933 | Ga0207706_10079225 | Ga0207706_100792254 | 131 |
| 1114 | 3300025933 | Ga0207706_10375437 | Ga0207706_103754372 | 131 |
| 1115 | 3300025933 | Ga0207706_10595316 | Ga0207706_105953161 | 131 |
| 1116 | 3300025933 | Ga0207706_10597721 | Ga0207706_105977212 | 131 |
| 1117 | 3300025933 | Ga0207706_11166811 | Ga0207706_111668111 | 131 |
| 1118 | 3300025934 | Ga0207686_10048318 | Ga0207686_100483182 | 131 |
| 1119 | 3300025934 | Ga0207686_10050824 | Ga0207686_100508246 | 131 |
| 1120 | 3300025934 | Ga0207686_10072816 | Ga0207686_100728163 | 131 |
| 1121 | 3300025934 | Ga0207686_10255208 | Ga0207686_102552083 | 131 |
| 1122 | 3300025935 | Ga0207709_10001005 | Ga0207709_1000100519 | 131 |
| 1123 | 3300025935 | Ga0207709_10020689 | Ga0207709_100206893 | 131 |
| 1124 | 3300025935 | Ga0207709_10146045 | Ga0207709_101460454 | 131 |
| 1125 | 3300025935 | Ga0207709_10431056 | Ga0207709_104310561 | 131 |
| 1126 | 3300025936 | Ga0207670_10450600 | Ga0207670_104506002 | 131 |
| 1127 | 3300025936 | Ga0207670_11438900 | Ga0207670_114389001 | 131 |
| 1128 | 3300025936 | Ga0207670_11564474 | Ga0207670_115644742 | 131 |
| 1129 | 3300025937 | Ga0207669_10027395 | Ga0207669_100273953 | 131 |
| 1130 | 3300025937 | Ga0207669_10068174 | Ga0207669_100681744 | 131 |
| 1131 | 3300025937 | Ga0207669_10093241 | Ga0207669_100932414 | 131 |
| 1132 | 3300025937 | Ga0207669_10124757 | Ga0207669_101247574 | 131 |
| 1133 | 3300025937 | Ga0207669_10367135 | Ga0207669_103671352 | 131 |
| 1134 | 3300025937 | Ga0207669_10527251 | Ga0207669_105272512 | 131 |
| 1135 | 3300025937 | Ga0207669_10835859 | Ga0207669_108358591 | 131 |
| 1136 | 3300025937 | Ga0207669_11153017 | Ga0207669_111530172 | 131 |
| 1137 | 3300025937 | Ga0207669_11346721 | Ga0207669_113467212 | 131 |
| 1138 | 3300025938 | Ga0207704_10474258 | Ga0207704_104742581 | 131 |
| 1139 | 3300025938 | Ga0207704_10660232 | Ga0207704_106602321 | 131 |
| 1140 | 3300025938 | Ga0207704_11151269 | Ga0207704_111512692 | 131 |
| 1141 | 3300025939 | Ga0207665_10131977 | Ga0207665_101319773 | 131 |
| 1142 | 3300025939 | Ga0207665_10452521 | Ga0207665_104525212 | 131 |
| 1143 | 3300025940 | Ga0207691_10002550 | Ga0207691_1000255014 | 131 |
| 1144 | 3300025940 | Ga0207691_10071477 | Ga0207691_100714775 | 131 |
| 1145 | 3300025940 | Ga0207691_10104939 | Ga0207691_101049392 | 131 |
| 1146 | 3300025940 | Ga0207691_10126451 | Ga0207691_101264514 | 131 |
| 1147 | 3300025940 | Ga0207691_10214431 | Ga0207691_102144313 | 131 |
| 1148 | 3300025940 | Ga0207691_10216133 | Ga0207691_102161332 | 131 |
| 1149 | 3300025940 | Ga0207691_10242604 | Ga0207691_102426042 | 131 |
| 1150 | 3300025940 | Ga0207691_10821521 | Ga0207691_108215211 | 131 |
| 1151 | 3300025940 | Ga0207691_11185143 | Ga0207691_111851431 | 131 |
| 1152 | 3300025941 | Ga0207711_10023140 | Ga0207711_100231404 | 131 |
| 1153 | 3300025941 | Ga0207711_10072285 | Ga0207711_100722854 | 131 |
| 1154 | 3300025941 | Ga0207711_10471526 | Ga0207711_104715262 | 131 |
| 1155 | 3300025941 | Ga0207711_10950482 | Ga0207711_109504822 | 131 |
| 1156 | 3300025941 | Ga0207711_11309585 | Ga0207711_113095852 | 131 |
| 1157 | 3300025942 | Ga0207689_10033146 | Ga0207689_100331467 | 131 |
| 1158 | 3300025942 | Ga0207689_10038004 | Ga0207689_100380044 | 131 |
| 1159 | 3300025942 | Ga0207689_10117050 | Ga0207689_101170504 | 131 |
| 1160 | 3300025942 | Ga0207689_10127570 | Ga0207689_101275702 | 131 |
| 1161 | 3300025942 | Ga0207689_10232116 | Ga0207689_102321162 | 131 |
| 1162 | 3300025942 | Ga0207689_10684752 | Ga0207689_106847521 | 131 |
| 1163 | 3300025942 | Ga0207689_10711450 | Ga0207689_107114502 | 131 |
| 1164 | 3300025942 | Ga0207689_10764762 | Ga0207689_107647622 | 131 |
| 1165 | 3300025942 | Ga0207689_10776336 | Ga0207689_107763362 | 131 |
| 1166 | 3300025942 | Ga0207689_11600848 | Ga0207689_116008481 | 131 |
| 1167 | 3300025944 | Ga0207661_10026944 | Ga0207661_100269442 | 131 |
| 1168 | 3300025945 | Ga0207679_10016048 | Ga0207679_100160487 | 131 |
| 1169 | 3300025945 | Ga0207679_10127063 | Ga0207679_101270632 | 131 |
| 1170 | 3300025945 | Ga0207679_10449730 | Ga0207679_104497302 | 131 |
| 1171 | 3300025945 | Ga0207679_10953006 | Ga0207679_109530061 | 131 |
| 1172 | 3300025945 | Ga0207679_11307681 | Ga0207679_113076811 | 131 |
| 1173 | 3300025949 | Ga0207667_10188077 | Ga0207667_101880774 | 131 |
| 1174 | 3300025960 | Ga0207651_10004839 | Ga0207651_1000483913 | 131 |
| 1175 | 3300025960 | Ga0207651_10043195 | Ga0207651_100431953 | 131 |
| 1176 | 3300025960 | Ga0207651_10049602 | Ga0207651_100496025 | 131 |
| 1177 | 3300025960 | Ga0207651_10063480 | Ga0207651_100634804 | 131 |
| 1178 | 3300025960 | Ga0207651_10092035 | Ga0207651_100920355 | 131 |
| 1179 | 3300025960 | Ga0207651_10274919 | Ga0207651_102749192 | 131 |
| 1180 | 3300025960 | Ga0207651_10307666 | Ga0207651_103076662 | 131 |
| 1181 | 3300025960 | Ga0207651_10352293 | Ga0207651_103522932 | 131 |
| 1182 | 3300025961 | Ga0207712_10040645 | Ga0207712_100406455 | 131 |
| 1183 | 3300025961 | Ga0207712_10063392 | Ga0207712_100633925 | 131 |
| 1184 | 3300025961 | Ga0207712_10258983 | Ga0207712_102589832 | 131 |
| 1185 | 3300025961 | Ga0207712_10976782 | Ga0207712_109767822 | 131 |
| 1186 | 3300025972 | Ga0207668_10008000 | Ga0207668_100080004 | 131 |
| 1187 | 3300025972 | Ga0207668_10053760 | Ga0207668_100537601 | 131 |
| 1188 | 3300025972 | Ga0207668_10264120 | Ga0207668_102641203 | 131 |
| 1189 | 3300025972 | Ga0207668_10332527 | Ga0207668_103325272 | 131 |
| 1190 | 3300025972 | Ga0207668_10498202 | Ga0207668_104982021 | 131 |
| 1191 | 3300025981 | Ga0207640_10014813 | Ga0207640_100148133 | 131 |
| 1192 | 3300025981 | Ga0207640_10146361 | Ga0207640_101463612 | 131 |
| 1193 | 3300025981 | Ga0207640_10361518 | Ga0207640_103615182 | 131 |
| 1194 | 3300025981 | Ga0207640_10739392 | Ga0207640_107393921 | 131 |
| 1195 | 3300025981 | Ga0207640_11342870 | Ga0207640_113428702 | 131 |
| 1196 | 3300025981 | Ga0207640_11422139 | Ga0207640_114221392 | 131 |
| 1197 | 3300025986 | Ga0207658_10002481 | Ga0207658_100024817 | 131 |
| 1198 | 3300025986 | Ga0207658_10019932 | Ga0207658_100199326 | 131 |
| 1199 | 3300025986 | Ga0207658_10059878 | Ga0207658_100598785 | 131 |
| 1200 | 3300025986 | Ga0207658_10174279 | Ga0207658_101742794 | 131 |
| 1201 | 3300025986 | Ga0207658_10204295 | Ga0207658_102042951 | 131 |
| 1202 | 3300025986 | Ga0207658_10253878 | Ga0207658_102538782 | 131 |
| 1203 | 3300025986 | Ga0207658_10823380 | Ga0207658_108233802 | 131 |
| 1204 | 3300025986 | Ga0207658_11440281 | Ga0207658_114402811 | 131 |
| 1205 | 3300026023 | Ga0207677_10222318 | Ga0207677_102223184 | 131 |
| 1206 | 3300026023 | Ga0207677_10493235 | Ga0207677_104932351 | 131 |
| 1207 | 3300026023 | Ga0207677_10597666 | Ga0207677_105976662 | 131 |
| 1208 | 3300026023 | Ga0207677_10762614 | Ga0207677_107626142 | 131 |
| 1209 | 3300026023 | Ga0207677_11440248 | Ga0207677_114402482 | 131 |
| 1210 | 3300026023 | Ga0207677_11845572 | Ga0207677_118455722 | 131 |
| 1211 | 3300026035 | Ga0207703_10002613 | Ga0207703_100026132 | 131 |
| 1212 | 3300026035 | Ga0207703_10027342 | Ga0207703_100273427 | 131 |
| 1213 | 3300026035 | Ga0207703_10139551 | Ga0207703_101395514 | 131 |
| 1214 | 3300026035 | Ga0207703_10590706 | Ga0207703_105907062 | 131 |
| 1215 | 3300026035 | Ga0207703_11346177 | Ga0207703_113461772 | 131 |
| 1216 | 3300026041 | Ga0207639_10460001 | Ga0207639_104600013 | 131 |
| 1217 | 3300026041 | Ga0207639_10601595 | Ga0207639_106015951 | 131 |
| 1218 | 3300026067 | Ga0207678_10008286 | Ga0207678_1000828617 | 131 |
| 1219 | 3300026067 | Ga0207678_10090610 | Ga0207678_100906102 | 131 |
| 1220 | 3300026067 | Ga0207678_10099481 | Ga0207678_100994814 | 131 |
| 1221 | 3300026067 | Ga0207678_10230487 | Ga0207678_102304871 | 131 |
| 1222 | 3300026067 | Ga0207678_10696626 | Ga0207678_106966262 | 131 |
| 1223 | 3300026067 | Ga0207678_10876259 | Ga0207678_108762592 | 131 |
| 1224 | 3300026067 | Ga0207678_11995843 | Ga0207678_119958431 | 131 |
| 1225 | 3300026075 | Ga0207708_10036414 | Ga0207708_100364145 | 131 |
| 1226 | 3300026075 | Ga0207708_10154972 | Ga0207708_101549724 | 131 |
| 1227 | 3300026075 | Ga0207708_10168085 | Ga0207708_101680853 | 131 |
| 1228 | 3300026075 | Ga0207708_10175723 | Ga0207708_101757233 | 131 |
| 1229 | 3300026078 | Ga0207702_10004993 | Ga0207702_1000499315 | 131 |
| 1230 | 3300026078 | Ga0207702_10150760 | Ga0207702_101507603 | 131 |
| 1231 | 3300026078 | Ga0207702_10429607 | Ga0207702_104296071 | 131 |
| 1232 | 3300026078 | Ga0207702_11220565 | Ga0207702_112205651 | 131 |
| 1233 | 3300026088 | Ga0207641_10007438 | Ga0207641_100074387 | 131 |
| 1234 | 3300026088 | Ga0207641_10028453 | Ga0207641_100284532 | 131 |
| 1235 | 3300026088 | Ga0207641_10106203 | Ga0207641_101062035 | 131 |
| 1236 | 3300026088 | Ga0207641_10164506 | Ga0207641_101645062 | 131 |
| 1237 | 3300026088 | Ga0207641_10524581 | Ga0207641_105245812 | 131 |
| 1238 | 3300026088 | Ga0207641_10751729 | Ga0207641_107517291 | 131 |
| 1239 | 3300026088 | Ga0207641_10850293 | Ga0207641_108502932 | 131 |
| 1240 | 3300026088 | Ga0207641_10953814 | Ga0207641_109538142 | 131 |
| 1241 | 3300026088 | Ga0207641_11293854 | Ga0207641_112938541 | 131 |
| 1242 | 3300026089 | Ga0207648_10002176 | Ga0207648_1000217620 | 131 |
| 1243 | 3300026089 | Ga0207648_10005939 | Ga0207648_1000593915 | 131 |
| 1244 | 3300026089 | Ga0207648_10015751 | Ga0207648_1001575112 | 131 |
| 1245 | 3300026089 | Ga0207648_10084574 | Ga0207648_100845741 | 131 |
| 1246 | 3300026089 | Ga0207648_10087281 | Ga0207648_100872816 | 131 |
| 1247 | 3300026089 | Ga0207648_10097294 | Ga0207648_100972944 | 131 |
| 1248 | 3300026089 | Ga0207648_10159685 | Ga0207648_101596853 | 131 |
| 1249 | 3300026089 | Ga0207648_10200666 | Ga0207648_102006664 | 131 |
| 1250 | 3300026089 | Ga0207648_10379894 | Ga0207648_103798943 | 131 |
| 1251 | 3300026089 | Ga0207648_10533699 | Ga0207648_105336992 | 131 |
| 1252 | 3300026089 | Ga0207648_10766947 | Ga0207648_107669471 | 131 |
| 1253 | 3300026095 | Ga0207676_10005874 | Ga0207676_100058743 | 131 |
| 1254 | 3300026095 | Ga0207676_10038749 | Ga0207676_100387499 | 131 |
| 1255 | 3300026095 | Ga0207676_10083692 | Ga0207676_100836926 | 131 |
| 1256 | 3300026095 | Ga0207676_10095279 | Ga0207676_100952792 | 131 |
| 1257 | 3300026095 | Ga0207676_10467768 | Ga0207676_104677682 | 131 |
| 1258 | 3300026095 | Ga0207676_10680064 | Ga0207676_106800642 | 131 |
| 1259 | 3300026095 | Ga0207676_11418800 | Ga0207676_114188002 | 131 |
| 1260 | 3300026116 | Ga0207674_10158756 | Ga0207674_101587565 | 131 |
| 1261 | 3300026116 | Ga0207674_10171993 | Ga0207674_101719933 | 131 |
| 1262 | 3300026116 | Ga0207674_10522615 | Ga0207674_105226153 | 131 |
| 1263 | 3300026118 | Ga0207675_100006663 | Ga0207675_10000666313 | 131 |
| 1264 | 3300026118 | Ga0207675_100166548 | Ga0207675_1001665485 | 131 |
| 1265 | 3300026118 | Ga0207675_100255531 | Ga0207675_1002555313 | 131 |
| 1266 | 3300026118 | Ga0207675_100263048 | Ga0207675_1002630481 | 131 |
| 1267 | 3300026118 | Ga0207675_100264070 | Ga0207675_1002640704 | 131 |
| 1268 | 3300026118 | Ga0207675_100314320 | Ga0207675_1003143202 | 131 |
| 1269 | 3300026118 | Ga0207675_100373676 | Ga0207675_1003736762 | 131 |
| 1270 | 3300026118 | Ga0207675_100375270 | Ga0207675_1003752702 | 131 |
| 1271 | 3300026118 | Ga0207675_100537098 | Ga0207675_1005370982 | 131 |
| 1272 | 3300026118 | Ga0207675_100632434 | Ga0207675_1006324342 | 131 |
| 1273 | 3300026118 | Ga0207675_101729437 | Ga0207675_1017294371 | 131 |
| 1274 | 3300026121 | Ga0207683_10005923 | Ga0207683_100059237 | 131 |
| 1275 | 3300026121 | Ga0207683_10141534 | Ga0207683_101415344 | 131 |
| 1276 | 3300026121 | Ga0207683_10166036 | Ga0207683_101660362 | 131 |
| 1277 | 3300026121 | Ga0207683_10228474 | Ga0207683_102284742 | 131 |
| 1278 | 3300026121 | Ga0207683_10276638 | Ga0207683_102766381 | 131 |
| 1279 | 3300026121 | Ga0207683_10664863 | Ga0207683_106648631 | 131 |
| 1280 | 3300026142 | Ga0207698_10137421 | Ga0207698_101374212 | 131 |
| 1281 | 3300026142 | Ga0207698_10171946 | Ga0207698_101719462 | 131 |
| 1282 | 3300026142 | Ga0207698_10790579 | Ga0207698_107905792 | 131 |
| 1283 | 3300026142 | Ga0207698_11099288 | Ga0207698_110992882 | 131 |
| 1284 | 3300026142 | Ga0207698_11280264 | Ga0207698_112802642 | 131 |
| 1285 | 3300027364 | Ga0209967_1053814 | Ga0209967_10538142 | 131 |
| 1286 | 3300027552 | Ga0209982_1051954 | Ga0209982_10519542 | 131 |
| 1287 | 3300027614 | Ga0209970_1026685 | Ga0209970_10266852 | 131 |
| 1288 | 3300027666 | Ga0209282_1000032 | Ga0209282_1000032148 | 131 |
| 1289 | 3300027866 | Ga0209813_10158999 | Ga0209813_101589992 | 131 |
| 1290 | 3300027876 | Ga0209974_10000149 | Ga0209974_1000014918 | 131 |
| 1291 | 3300027907 | Ga0207428_10002412 | Ga0207428_1000241214 | 131 |
| 1292 | 3300027907 | Ga0207428_10148534 | Ga0207428_101485344 | 131 |
| 1293 | 3300027907 | Ga0207428_10525240 | Ga0207428_105252402 | 131 |
| 1294 | 3300027907 | Ga0207428_11140572 | Ga0207428_111405721 | 131 |
| 1295 | 3300027907 | Ga0207428_11245660 | Ga0207428_112456601 | 131 |
| 1296 | 3300028379 | Ga0268266_10013518 | Ga0268266_1001351810 | 131 |
| 1297 | 3300028379 | Ga0268266_10165713 | Ga0268266_101657132 | 131 |
| 1298 | 3300028379 | Ga0268266_10248383 | Ga0268266_102483832 | 131 |
| 1299 | 3300028379 | Ga0268266_10427489 | Ga0268266_104274893 | 131 |
| 1300 | 3300028379 | Ga0268266_11187049 | Ga0268266_111870492 | 131 |
| 1301 | 3300028379 | Ga0268266_11880327 | Ga0268266_118803272 | 131 |
| 1302 | 3300028380 | Ga0268265_10048765 | Ga0268265_100487655 | 131 |
| 1303 | 3300028380 | Ga0268265_10076755 | Ga0268265_100767553 | 131 |
| 1304 | 3300028380 | Ga0268265_10144177 | Ga0268265_101441774 | 131 |
| 1305 | 3300028380 | Ga0268265_10186906 | Ga0268265_101869064 | 131 |
| 1306 | 3300028380 | Ga0268265_10241678 | Ga0268265_102416781 | 131 |
| 1307 | 3300028380 | Ga0268265_11552378 | Ga0268265_115523782 | 131 |
| 1308 | 3300028381 | Ga0268264_10002070 | Ga0268264_1000207020 | 131 |
| 1309 | 3300028381 | Ga0268264_10002318 | Ga0268264_1000231818 | 131 |
| 1310 | 3300028381 | Ga0268264_10053634 | Ga0268264_100536343 | 131 |
| 1311 | 3300028381 | Ga0268264_10085143 | Ga0268264_100851438 | 131 |
| 1312 | 3300028381 | Ga0268264_10510540 | Ga0268264_105105402 | 131 |
| 1313 | 3300028381 | Ga0268264_10944666 | Ga0268264_109446662 | 131 |
| 1314 | 3300028381 | Ga0268264_11441364 | Ga0268264_114413642 | 131 |
| 1315 | 3300028381 | Ga0268264_11726741 | Ga0268264_117267411 | 131 |
| 1316 | 3300028573 | Ga0265334_10000005 | Ga0265334_10000005203 | 131 |
| 1317 | 3300028666 | Ga0265336_10000618 | Ga0265336_1000061817 | 131 |
| 1318 | 3300028786 | Ga0307517_10014561 | Ga0307517_100145618 | 131 |
| 1319 | 3300028786 | Ga0307517_10110559 | Ga0307517_101105591 | 131 |
| 1320 | 3300028794 | Ga0307515_10002443 | Ga0307515_100024436 | 131 |
| 1321 | 3300028794 | Ga0307515_10053115 | Ga0307515_100531156 | 131 |
| 1322 | 3300028794 | Ga0307515_10186828 | Ga0307515_101868283 | 131 |
| 1323 | 3300028794 | Ga0307515_10541499 | Ga0307515_105414992 | 131 |
| 1324 | 3300028794 | Ga0307515_10675781 | Ga0307515_106757812 | 131 |
| 1325 | 3300028800 | Ga0265338_10116506 | Ga0265338_101165065 | 131 |
| 1326 | 3300029957 | Ga0265324_10000002 | Ga0265324_1000000280 | 131 |
| 1327 | 3300029957 | Ga0265324_10000500 | Ga0265324_1000050029 | 131 |
| 1328 | 3300029957 | Ga0265324_10050377 | Ga0265324_100503773 | 131 |
| 1329 | 3300030521 | Ga0307511_10232578 | Ga0307511_102325781 | 131 |
| 1330 | 3300030522 | Ga0307512_10045873 | Ga0307512_100458737 | 131 |
| 1331 | 3300030522 | Ga0307512_10091067 | Ga0307512_100910673 | 131 |
| 1332 | 3300030522 | Ga0307512_10098413 | Ga0307512_100984132 | 131 |
| 1333 | 3300031238 | Ga0265332_10000030 | Ga0265332_1000003035 | 131 |
| 1334 | 3300031239 | Ga0265328_10000007 | Ga0265328_1000000785 | 131 |
| 1335 | 3300031241 | Ga0265325_10001662 | Ga0265325_100016626 | 131 |
| 1336 | 3300031241 | Ga0265325_10008599 | Ga0265325_1000859911 | 131 |
| 1337 | 3300031250 | Ga0265331_10070855 | Ga0265331_100708554 | 131 |
| 1338 | 3300031250 | Ga0265331_10140817 | Ga0265331_101408173 | 131 |
| 1339 | 3300031344 | Ga0265316_10163987 | Ga0265316_101639872 | 131 |
| 1340 | 3300031344 | Ga0265316_10446833 | Ga0265316_104468332 | 131 |
| 1341 | 3300031456 | Ga0307513_10007825 | Ga0307513_100078257 | 131 |
| 1342 | 3300031456 | Ga0307513_10019109 | Ga0307513_1001910914 | 131 |
| 1343 | 3300031456 | Ga0307513_10034953 | Ga0307513_100349532 | 131 |
| 1344 | 3300031456 | Ga0307513_10058418 | Ga0307513_100584189 | 131 |
| 1345 | 3300031456 | Ga0307513_10063852 | Ga0307513_100638525 | 131 |
| 1346 | 3300031456 | Ga0307513_10097095 | Ga0307513_100970952 | 131 |
| 1347 | 3300031456 | Ga0307513_10184235 | Ga0307513_101842352 | 131 |
| 1348 | 3300031456 | Ga0307513_10262845 | Ga0307513_102628451 | 131 |
| 1349 | 3300031456 | Ga0307513_10418258 | Ga0307513_104182583 | 131 |
| 1350 | 3300031507 | Ga0307509_10000050 | Ga0307509_1000005060 | 131 |
| 1351 | 3300031507 | Ga0307509_10003616 | Ga0307509_1000361628 | 131 |
| 1352 | 3300031507 | Ga0307509_10091388 | Ga0307509_100913881 | 131 |
| 1353 | 3300031507 | Ga0307509_10111735 | Ga0307509_101117354 | 131 |
| 1354 | 3300031507 | Ga0307509_10141229 | Ga0307509_101412293 | 131 |
| 1355 | 3300031507 | Ga0307509_10147814 | Ga0307509_101478142 | 131 |
| 1356 | 3300031507 | Ga0307509_10504506 | Ga0307509_105045062 | 131 |
| 1357 | 3300031548 | Ga0307408_100178067 | Ga0307408_1001780673 | 131 |
| 1358 | 3300031548 | Ga0307408_100186366 | Ga0307408_1001863664 | 131 |
| 1359 | 3300031548 | Ga0307408_100193528 | Ga0307408_1001935282 | 131 |
| 1360 | 3300031548 | Ga0307408_100260880 | Ga0307408_1002608803 | 131 |
| 1361 | 3300031548 | Ga0307408_100469453 | Ga0307408_1004694532 | 131 |
| 1362 | 3300031548 | Ga0307408_100492733 | Ga0307408_1004927332 | 131 |
| 1363 | 3300031548 | Ga0307408_102277064 | Ga0307408_1022770641 | 131 |
| 1364 | 3300031595 | Ga0265313_10000014 | Ga0265313_10000014137 | 131 |
| 1365 | 3300031616 | Ga0307508_10000392 | Ga0307508_1000039242 | 131 |
| 1366 | 3300031616 | Ga0307508_10407074 | Ga0307508_104070742 | 131 |
| 1367 | 3300031616 | Ga0307508_10537503 | Ga0307508_105375032 | 131 |
| 1368 | 3300031649 | Ga0307514_10034392 | Ga0307514_100343927 | 131 |
| 1369 | 3300031649 | Ga0307514_10104256 | Ga0307514_101042564 | 131 |
| 1370 | 3300031649 | Ga0307514_10178976 | Ga0307514_101789762 | 131 |
| 1371 | 3300031649 | Ga0307514_10181649 | Ga0307514_101816491 | 131 |
| 1372 | 3300031649 | Ga0307514_10213346 | Ga0307514_102133463 | 131 |
| 1373 | 3300031665 | Ga0316575_10108836 | Ga0316575_101088361 | 131 |
| 1374 | 3300031711 | Ga0265314_10001521 | Ga0265314_1000152117 | 131 |
| 1375 | 3300031711 | Ga0265314_10075432 | Ga0265314_100754323 | 131 |
| 1376 | 3300031730 | Ga0307516_10011689 | Ga0307516_1001168918 | 131 |
| 1377 | 3300031730 | Ga0307516_10019197 | Ga0307516_1001919712 | 131 |
| 1378 | 3300031730 | Ga0307516_10397791 | Ga0307516_103977912 | 131 |
| 1379 | 3300031731 | Ga0307405_10005729 | Ga0307405_100057292 | 131 |
| 1380 | 3300031731 | Ga0307405_10012091 | Ga0307405_100120916 | 131 |
| 1381 | 3300031731 | Ga0307405_10046436 | Ga0307405_100464364 | 131 |
| 1382 | 3300031731 | Ga0307405_10155277 | Ga0307405_101552773 | 131 |
| 1383 | 3300031731 | Ga0307405_10823826 | Ga0307405_108238262 | 131 |
| 1384 | 3300031731 | Ga0307405_11140977 | Ga0307405_111409772 | 131 |
| 1385 | 3300031731 | Ga0307405_12096718 | Ga0307405_120967181 | 131 |
| 1386 | 3300031824 | Ga0307413_10001429 | Ga0307413_1000142915 | 131 |
| 1387 | 3300031824 | Ga0307413_10032313 | Ga0307413_100323134 | 131 |
| 1388 | 3300031824 | Ga0307413_10035769 | Ga0307413_100357693 | 131 |
| 1389 | 3300031824 | Ga0307413_10206648 | Ga0307413_102066483 | 131 |
| 1390 | 3300031824 | Ga0307413_10641796 | Ga0307413_106417962 | 131 |
| 1391 | 3300031824 | Ga0307413_10747659 | Ga0307413_107476592 | 131 |
| 1392 | 3300031852 | Ga0307410_10002645 | Ga0307410_1000264514 | 131 |
| 1393 | 3300031852 | Ga0307410_10006977 | Ga0307410_100069772 | 131 |
| 1394 | 3300031852 | Ga0307410_10073323 | Ga0307410_100733234 | 131 |
| 1395 | 3300031852 | Ga0307410_10531987 | Ga0307410_105319871 | 131 |
| 1396 | 3300031852 | Ga0307410_10762095 | Ga0307410_107620951 | 131 |
| 1397 | 3300031852 | Ga0307410_10916788 | Ga0307410_109167882 | 131 |
| 1398 | 3300031901 | Ga0307406_10004866 | Ga0307406_100048669 | 131 |
| 1399 | 3300031901 | Ga0307406_10054966 | Ga0307406_100549666 | 131 |
| 1400 | 3300031901 | Ga0307406_10163268 | Ga0307406_101632682 | 131 |
| 1401 | 3300031901 | Ga0307406_10214883 | Ga0307406_102148832 | 131 |
| 1402 | 3300031903 | Ga0307407_10006994 | Ga0307407_1000699410 | 131 |
| 1403 | 3300031903 | Ga0307407_10007323 | Ga0307407_100073232 | 131 |
| 1404 | 3300031903 | Ga0307407_10061462 | Ga0307407_100614624 | 131 |
| 1405 | 3300031903 | Ga0307407_10323671 | Ga0307407_103236712 | 131 |
| 1406 | 3300031903 | Ga0307407_11399922 | Ga0307407_113999221 | 131 |
| 1407 | 3300031911 | Ga0307412_10011559 | Ga0307412_100115593 | 131 |
| 1408 | 3300031911 | Ga0307412_10074922 | Ga0307412_100749223 | 131 |
| 1409 | 3300031911 | Ga0307412_10094847 | Ga0307412_100948472 | 131 |
| 1410 | 3300031911 | Ga0307412_10263875 | Ga0307412_102638753 | 131 |
| 1411 | 3300031911 | Ga0307412_10275217 | Ga0307412_102752172 | 131 |
| 1412 | 3300031911 | Ga0307412_10300299 | Ga0307412_103002993 | 131 |
| 1413 | 3300031911 | Ga0307412_10819269 | Ga0307412_108192691 | 131 |
| 1414 | 3300031911 | Ga0307412_12037627 | Ga0307412_120376271 | 131 |
| 1415 | 3300031995 | Ga0307409_100000577 | Ga0307409_10000057722 | 131 |
| 1416 | 3300031995 | Ga0307409_100018987 | Ga0307409_1000189875 | 131 |
| 1417 | 3300031995 | Ga0307409_100034200 | Ga0307409_1000342001 | 131 |
| 1418 | 3300031995 | Ga0307409_100072562 | Ga0307409_1000725622 | 131 |
| 1419 | 3300031995 | Ga0307409_100686881 | Ga0307409_1006868812 | 131 |
| 1420 | 3300032002 | Ga0307416_100028404 | Ga0307416_1000284047 | 131 |
| 1421 | 3300032002 | Ga0307416_100043561 | Ga0307416_1000435614 | 131 |
| 1422 | 3300032002 | Ga0307416_100550299 | Ga0307416_1005502992 | 131 |
| 1423 | 3300032002 | Ga0307416_100764931 | Ga0307416_1007649312 | 131 |
| 1424 | 3300032002 | Ga0307416_101030487 | Ga0307416_1010304872 | 131 |
| 1425 | 3300032002 | Ga0307416_101105132 | Ga0307416_1011051322 | 131 |
| 1426 | 3300032002 | Ga0307416_101119617 | Ga0307416_1011196172 | 131 |
| 1427 | 3300032002 | Ga0307416_101230578 | Ga0307416_1012305782 | 131 |
| 1428 | 3300032004 | Ga0307414_10358891 | Ga0307414_103588912 | 131 |
| 1429 | 3300032004 | Ga0307414_10678899 | Ga0307414_106788992 | 131 |
| 1430 | 3300032005 | Ga0307411_10001998 | Ga0307411_1000199814 | 131 |
| 1431 | 3300032005 | Ga0307411_10034772 | Ga0307411_100347726 | 131 |
| 1432 | 3300032005 | Ga0307411_10249959 | Ga0307411_102499592 | 131 |
| 1433 | 3300032005 | Ga0307411_10330148 | Ga0307411_103301481 | 131 |
| 1434 | 3300032005 | Ga0307411_10354795 | Ga0307411_103547952 | 131 |
| 1435 | 3300032005 | Ga0307411_10427072 | Ga0307411_104270722 | 131 |
| 1436 | 3300032005 | Ga0307411_10540746 | Ga0307411_105407462 | 131 |
| 1437 | 3300032005 | Ga0307411_10603921 | Ga0307411_106039212 | 131 |
| 1438 | 3300032005 | Ga0307411_10655015 | Ga0307411_106550152 | 131 |
| 1439 | 3300032005 | Ga0307411_11130764 | Ga0307411_111307641 | 131 |
| 1440 | 3300032005 | Ga0307411_12146570 | Ga0307411_121465701 | 131 |
| 1441 | 3300032126 | Ga0307415_100034663 | Ga0307415_1000346634 | 131 |
| 1442 | 3300032126 | Ga0307415_100039097 | Ga0307415_1000390976 | 131 |
| 1443 | 3300032126 | Ga0307415_100210379 | Ga0307415_1002103793 | 131 |
| 1444 | 3300032126 | Ga0307415_100239312 | Ga0307415_1002393123 | 131 |
| 1445 | 3300032126 | Ga0307415_100278380 | Ga0307415_1002783803 | 131 |
| 1446 | 3300032126 | Ga0307415_100482114 | Ga0307415_1004821142 | 131 |
| 1447 | 3300032126 | Ga0307415_101335212 | Ga0307415_1013352122 | 131 |
| 1448 | 3300032133 | Ga0316583_10161702 | Ga0316583_101617022 | 131 |
| 1449 | 3300032168 | Ga0316593_10040336 | Ga0316593_100403363 | 131 |
| 1450 | 3300032168 | Ga0316593_10198099 | Ga0316593_101980991 | 131 |
| 1451 | 3300033179 | Ga0307507_10087876 | Ga0307507_100878762 | 131 |
| 1452 | 3300033179 | Ga0307507_10154935 | Ga0307507_101549353 | 131 |
| 1453 | 3300033180 | Ga0307510_10168701 | Ga0307510_101687013 | 131 |
| 1454 | 3300033180 | Ga0307510_10170741 | Ga0307510_101707412 | 131 |
| 1455 | 3300033180 | Ga0307510_10523931 | Ga0307510_105239312 | 131 |
| 1456 | 3300033541 | Ga0316596_1229670 | Ga0316596_12296701 | 131 |
| 1457 | 3300035083 | Ga0373926_0022611 | Ga0373926_0022611_1078_1473 | 131 |
| 1458 | 3300035083 | Ga0373926_0079568 | Ga0373926_0079568_366_761 | 131 |
| 1459 | 3300035084 | Ga0373928_0014100 | Ga0373928_0014100_667_1062 | 131 |
| 1460 | 3300035084 | Ga0373928_0246433 | Ga0373928_0246433_65_460 | 131 |
| 1461 | 3300035086 | Ga0373934_0243828 | Ga0373934_0243828_265_660 | 131 |
| 1462 | 3300035088 | Ga0373940_0013603 | Ga0373940_0013603_1335_1730 | 131 |
| 1463 | 3300035089 | Ga0373944_0026001 | Ga0373944_0026001_121_516 | 131 |
| 1464 | 3300035089 | Ga0373944_0122902 | Ga0373944_0122902_287_682 | 131 |
| 1465 | 3300035089 | Ga0373944_0136517 | Ga0373944_0136517_331_726 | 131 |
| 1466 | 3300035091 | Ga0373951_0036869 | Ga0373951_0036869_233_628 | 131 |
| 1467 | 3300035092 | Ga0373952_0009457 | Ga0373952_0009457_1393_1788 | 131 |
| 1468 | 3300035111 | Ga0373923_0117766 | Ga0373923_0117766_512_907 | 131 |
| 1469 | 3300035112 | Ga0373932_0064786 | Ga0373932_0064786_550_945 | 131 |
| 1470 | 3300035114 | Ga0373939_0101011 | Ga0373939_0101011_327_722 | 131 |
| 1471 | 3300035115 | Ga0373941_0291295 | Ga0373941_0291295_82_477 | 131 |
| 1472 | 3300035117 | Ga0373953_0042168 | Ga0373953_0042168_1239_1634 | 131 |
| 1473 | 3300035117 | Ga0373953_0334618 | Ga0373953_0334618_190_585 | 131 |
| 1474 | 3300035118 | Ga0373954_0124223 | Ga0373954_0124223_141_536 | 131 |
| 1475 | 3300035119 | Ga0373956_0085842 | Ga0373956_0085842_137_532 | 131 |
| 1476 | 3300035119 | Ga0373956_0136201 | Ga0373956_0136201_534_929 | 131 |
| 1477 | 3300035119 | Ga0373956_0441351 | Ga0373956_0441351_202_597 | 131 |
| 1478 | 3300035120 | Ga0373957_0044948 | Ga0373957_0044948_787_1182 | 131 |
| 1479 | 3300035120 | Ga0373957_0070420 | Ga0373957_0070420_587_982 | 131 |
| 1480 | 3300035170 | Ga0373943_0250809 | Ga0373943_0250809_372_767 | 131 |
| 1481 | 3300035170 | Ga0373943_0421698 | Ga0373943_0421698_106_501 | 131 |
| 1482 | 3300035171 | Ga0373946_0057466 | Ga0373946_0057466_857_1252 | 131 |
| 1483 | 3300035171 | Ga0373946_0150156 | Ga0373946_0150156_35_430 | 131 |
| 1484 | 3300035171 | Ga0373946_0167214 | Ga0373946_0167214_95_490 | 131 |
| 1485 | 3300035172 | Ga0373955_0018160 | Ga0373955_0018160_1750_2145 | 131 |
| 1486 | 3300035172 | Ga0373955_0081524 | Ga0373955_0081524_81_476 | 131 |
| 1487 | 3300035172 | Ga0373955_0092432 | Ga0373955_0092432_462_857 | 131 |
| 1488 | 3300035172 | Ga0373955_0292723 | Ga0373955_0292723_277_672 | 131 |
| 1489 | 3300035207 | Ga0373942_0133951 | Ga0373942_0133951_28_423 | 131 |
| 1490 | 3300035242 | Ga0373962_0139983 | Ga0373962_0139983_329_724 | 131 |
| 1491 | 3300035398 | Ga0316574_0285455 | Ga0316574_0285455_312_707 | 131 |
| 1492 | 3300035410 | Ga0373924_0102911 | Ga0373924_0102911_253_648 | 131 |
| 1493 | 3300035410 | Ga0373924_0247167 | Ga0373924_0247167_380_775 | 131 |
| 1494 | 3300035691 | Ga0373931_0008660 | Ga0373931_0008660_1432_1827 | 131 |
| 1495 | 3300035691 | Ga0373931_0446973 | Ga0373931_0446973_294_689 | 131 |
| 1496 | 3300035691 | Ga0373931_0606530 | Ga0373931_0606530_48_443 | 131 |
| 1497 | 3300035692 | Ga0373935_0013375 | Ga0373935_0013375_4194_4589 | 131 |
| 1498 | 3300035692 | Ga0373935_1117509 | Ga0373935_1117509_145_540 | 131 |
| 1499 | 3300035695 | Ga0373927_0074508 | Ga0373927_0074508_167_562 | 131 |
| 1500 | 3300035695 | Ga0373927_0306888 | Ga0373927_0306888_539_934 | 131 |
| 1501 | 3300035695 | Ga0373927_0421769 | Ga0373927_0421769_391_786 | 131 |
| 1502 | 3300035724 | Ga0373933_0864838 | Ga0373933_0864838_168_563 | 131 |
| 1503 | 3300035725 | Ga0373947_0114560 | Ga0373947_0114560_1189_1584 | 131 |
| 1504 | 3300036401 | Ga0373937_0120811 | Ga0373937_0120811_1291_1686 | 131 |
| 1505 | 3300036401 | Ga0373937_0488619 | Ga0373937_0488619_203_598 | 131 |
| 1506 | 3300037068 | Ga0373925_0089907 | Ga0373925_0089907_676_1071 | 131 |
| 1507 | 3300037068 | Ga0373925_0375274 | Ga0373925_0375274_264_659 | 131 |
| 1508 | 3300037068 | Ga0373925_0466364 | Ga0373925_0466364_547_942 | 131 |
| 1509 | 3300037068 | Ga0373925_0747219 | Ga0373925_0747219_16_411 | 131 |
| 1510 | 3300037471 | Ga0395905_0038305 | Ga0395905_0038305_1797_2192 | 131 |
| 1511 | 3300039062 | Ga0400483_226967 | Ga0400483_226967_53_448 | 131 |
| 1512 | 3300039437 | Ga0436365_0772335 | Ga0436365_0772335_298_693 | 131 |
| 1513 | 3300039450 | Ga0436363_0160364 | Ga0436363_0160364_444_839 | 131 |
| 1514 | 3300039450 | Ga0436363_1530821 | Ga0436363_1530821_2268_2663 | 131 |
| 1515 | 3300039450 | Ga0436363_1604646 | Ga0436363_1604646_119_514 | 131 |
| 1516 | 3300041406 | Ga0439439_0093230 | Ga0439439_0093230_170_565 | 131 |
| 1517 | 3300041413 | Ga0439465_0154212 | Ga0439465_0154212_317_712 | 131 |
| 1518 | 3300041441 | Ga0451787_578519 | Ga0451787_578519_62_457 | 131 |
| 1519 | 3300041441 | Ga0451787_682059 | Ga0451787_682059_521_916 | 131 |
| 1520 | 3300041443 | Ga0451789_0604896 | Ga0451789_0604896_255_650 | 131 |
| 1521 | 3300041443 | Ga0451789_0701085 | Ga0451789_0701085_101_496 | 131 |
| 1522 | 3300041443 | Ga0451789_0781745 | Ga0451789_0781745_785_1180 | 131 |
| 1523 | 3300041443 | Ga0451789_0965253 | Ga0451789_0965253_1622_2017 | 131 |
| 1524 | 3300041443 | Ga0451789_1079498 | Ga0451789_1079498_323_718 | 131 |
| 1525 | 3300041444 | Ga0451790_47197 | Ga0451790_47197_571_966 | 131 |
| 1526 | 3300041446 | Ga0451794_03533 | Ga0451794_03533_13_408 | 131 |
| 1527 | 3300041446 | Ga0451794_20639 | Ga0451794_20639_101_496 | 131 |
| 1528 | 3300041446 | Ga0451794_21291 | Ga0451794_21291_272_667 | 131 |
| 1529 | 3300041452 | Ga0451793_0424511 | Ga0451793_0424511_498_893 | 131 |
| 1530 | 3300041452 | Ga0451793_0637995 | Ga0451793_0637995_1215_1610 | 131 |
| 1531 | 3300041452 | Ga0451793_1338571 | Ga0451793_1338571_420_815 | 131 |
| 1532 | 3300041453 | Ga0451797_0593740 | Ga0451797_0593740_502_897 | 131 |
| 1533 | 3300041453 | Ga0451797_0784698 | Ga0451797_0784698_36_431 | 131 |
| 1534 | 3300041454 | Ga0451799_28190 | Ga0451799_28190_66_461 | 131 |
| 1535 | 3300041454 | Ga0451799_32497 | Ga0451799_32497_81_476 | 131 |
| 1536 | 3300041455 | Ga0451801_26122 | Ga0451801_26122_530_925 | 131 |
| 1537 | 3300041456 | Ga0451795_0013989 | Ga0451795_0013989_49_444 | 131 |
| 1538 | 3300041458 | Ga0451798_0518391 | Ga0451798_0518391_164_559 | 131 |
| 1539 | 3300041459 | Ga0451800_0475520 | Ga0451800_0475520_704_1099 | 131 |
| 1540 | 3300041459 | Ga0451800_1232355 | Ga0451800_1232355_1323_1718 | 131 |
| 1541 | 3300041461 | Ga0451805_010137 | Ga0451805_010137_685_1080 | 131 |
| 1542 | 3300041461 | Ga0451805_039282 | Ga0451805_039282_521_916 | 131 |
| 1543 | 3300041463 | Ga0451804_0197986 | Ga0451804_0197986_104_499 | 131 |
| 1544 | 3300041463 | Ga0451804_0350671 | Ga0451804_0350671_2843_3238 | 131 |
| 1545 | 3300041463 | Ga0451804_0672156 | Ga0451804_0672156_71_466 | 131 |
| 1546 | 3300041463 | Ga0451804_0722325 | Ga0451804_0722325_113_508 | 131 |
| 1547 | 3300041486 | Ga0451807_0646883 | Ga0451807_0646883_1051_1446 | 131 |
| 1548 | 3300041486 | Ga0451807_0837307 | Ga0451807_0837307_108_503 | 131 |
| 1549 | 3300041486 | Ga0451807_0984280 | Ga0451807_0984280_194_589 | 131 |
| 1550 | 3300041486 | Ga0451807_1506488 | Ga0451807_1506488_83_478 | 131 |
| 1551 | 3300041491 | Ga0451833_0205751 | Ga0451833_0205751_71_466 | 131 |
| 1552 | 3300041498 | Ga0451841_0230757 | Ga0451841_0230757_15_410 | 131 |
| 1553 | 3300041498 | Ga0451841_0455622 | Ga0451841_0455622_146_541 | 131 |
| 1554 | 3300041505 | Ga0451849_1485536 | Ga0451849_1485536_151_546 | 131 |
| 1555 | 3300041506 | Ga0451850_07380 | Ga0451850_07380_216_611 | 131 |
| 1556 | 3300041511 | Ga0451855_0043459 | Ga0451855_0043459_942_1337 | 131 |
| 1557 | 3300041512 | Ga0451853_0694569 | Ga0451853_0694569_242_637 | 131 |
| 1558 | 3300041512 | Ga0451853_1066481 | Ga0451853_1066481_483_878 | 131 |
| 1559 | 3300041512 | Ga0451853_1718278 | Ga0451853_1718278_292_687 | 131 |
| 1560 | 3300041512 | Ga0451853_2708289 | Ga0451853_2708289_18_413 | 131 |
| 1561 | 3300041512 | Ga0451853_4042749 | Ga0451853_4042749_1042_1437 | 131 |
| 1562 | 3300041916 | Ga0452271_65294 | Ga0452271_65294_165_560 | 131 |
| 1563 | 3300042015 | Ga0439462_0063869 | Ga0439462_0063869_37_432 | 131 |
| 1564 | 3300042118 | Ga0450914_006348 | Ga0450914_006348_184_579 | 131 |
| 1565 | 3300042125 | Ga0450923_163606 | Ga0450923_163606_99_494 | 131 |
| 1566 | 3300042126 | Ga0450888_076627 | Ga0450888_076627_39_434 | 131 |
| 1567 | 3300042134 | Ga0450898_151038 | Ga0450898_151038_97_492 | 131 |
| 1568 | 3300042145 | Ga0450906_073666 | Ga0450906_073666_99_494 | 131 |
| 1569 | 3300042157 | Ga0439458_0062075 | Ga0439458_0062075_284_679 | 131 |
| 1570 | 3300042437 | Ga0439444_0186821 | Ga0439444_0186821_59_454 | 131 |
| 1571 | 3300042439 | Ga0439464_0163579 | Ga0439464_0163579_101_496 | 131 |
| 1572 | 3300042530 | Ga0450916_028444 | Ga0450916_028444_101_496 | 131 |
| 1573 | 3300042531 | Ga0450918_106598 | Ga0450918_106598_55_450 | 131 |
| 1574 | 3300042532 | Ga0450893_0079748 | Ga0450893_0079748_95_490 | 131 |
| 1575 | 3300042876 | Ga0451577_0000013 | Ga0451577_0000013_421990_422385 | 131 |
| 1576 | 3300042876 | Ga0451577_0027488 | Ga0451577_0027488_3625_4020 | 131 |
| 1577 | 3300042876 | Ga0451577_0221004 | Ga0451577_0221004_1067_1462 | 131 |
| 1578 | 3300042876 | Ga0451577_0909734 | Ga0451577_0909734_338_733 | 131 |
| 1579 | 3300044673 | Ga0453683_0000059 | Ga0453683_0000059_58459_58854 | 131 |
| 1580 | 3300044694 | Ga0466963_0155056 | Ga0466963_0155056_679_1074 | 131 |
| 1581 | 3300044712 | Ga0453684_0000585 | Ga0453684_0000585_6948_7343 | 131 |
| 1582 | 3300044712 | Ga0453684_0077473 | Ga0453684_0077473_472_867 | 131 |
| 1583 | 3300044712 | Ga0453684_0261576 | Ga0453684_0261576_525_920 | 131 |
| 1584 | 3300044712 | Ga0453684_0340103 | Ga0453684_0340103_554_949 | 131 |
| 1585 | 3300045051 | Ga0451576_0000018 | Ga0451576_0000018_128305_128700 | 131 |
| 1586 | 3300045051 | Ga0451576_0000909 | Ga0451576_0000909_48427_48822 | 131 |
| 1587 | 3300045051 | Ga0451576_0079035 | Ga0451576_0079035_2246_2641 | 131 |
| 1588 | 3300045051 | Ga0451576_0131416 | Ga0451576_0131416_508_903 | 131 |
| 1589 | 3300045051 | Ga0451576_0168870 | Ga0451576_0168870_1494_1889 | 131 |
| 1590 | 3300045051 | Ga0451576_1144103 | Ga0451576_1144103_321_716 | 131 |
| 1591 | 3300045051 | Ga0451576_1160016 | Ga0451576_1160016_385_780 | 131 |
| 1592 | 3300046452 | Ga0495617_066779 | Ga0495617_066779_70_465 | 131 |
| 1593 | 3300046454 | Ga0495592_0000203 | Ga0495592_0000203_42371_42766 | 131 |
| 1594 | 3300046455 | Ga0495603_0167391 | Ga0495603_0167391_166_561 | 131 |
| 1595 | 3300046457 | Ga0495590_0076553 | Ga0495590_0076553_604_999 | 131 |
| 1596 | 3300046457 | Ga0495590_0128399 | Ga0495590_0128399_196_591 | 131 |
| 1597 | 3300046457 | Ga0495590_0406464 | Ga0495590_0406464_41_436 | 131 |
| 1598 | 3300046460 | Ga0495638_0020600 | Ga0495638_0020600_3249_3644 | 131 |
| 1599 | 3300046460 | Ga0495638_0023580 | Ga0495638_0023580_396_791 | 131 |
| 1600 | 3300046460 | Ga0495638_0131647 | Ga0495638_0131647_462_857 | 131 |
| 1601 | 3300046460 | Ga0495638_0162714 | Ga0495638_0162714_552_947 | 131 |
| 1602 | 3300046461 | Ga0495641_0101699 | Ga0495641_0101699_353_748 | 131 |
| 1603 | 3300046462 | Ga0495651_0800123 | Ga0495651_0800123_33_428 | 131 |
| 1604 | 3300046472 | Ga0495580_0265795 | Ga0495580_0265795_508_903 | 131 |
| 1605 | 3300046473 | Ga0495582_0285985 | Ga0495582_0285985_363_758 | 131 |
| 1606 | 3300046473 | Ga0495582_0385106 | Ga0495582_0385106_160_555 | 131 |
| 1607 | 3300046474 | Ga0495605_0242295 | Ga0495605_0242295_79_474 | 131 |
| 1608 | 3300046475 | Ga0495639_0485717 | Ga0495639_0485717_170_565 | 131 |
| 1609 | 3300046477 | Ga0495664_0693486 | Ga0495664_0693486_194_589 | 131 |
| 1610 | 3300046492 | Ga0495585_0124260 | Ga0495585_0124260_214_609 | 131 |
| 1611 | 3300046500 | Ga0495596_0334463 | Ga0495596_0334463_35_430 | 131 |
| 1612 | 3300046506 | Ga0495583_0124309 | Ga0495583_0124309_184_579 | 131 |
| 1613 | 3300046511 | Ga0495608_0636945 | Ga0495608_0636945_59_454 | 131 |
| 1614 | 3300046511 | Ga0495608_0684824 | Ga0495608_0684824_55_450 | 131 |
| 1615 | 3300046512 | Ga0495610_0007369 | Ga0495610_0007369_2194_2589 | 131 |
| 1616 | 3300046512 | Ga0495610_0025318 | Ga0495610_0025318_2404_2799 | 131 |
| 1617 | 3300046512 | Ga0495610_0096636 | Ga0495610_0096636_846_1241 | 131 |
| 1618 | 3300046512 | Ga0495610_0152175 | Ga0495610_0152175_345_740 | 131 |
| 1619 | 3300046513 | Ga0495616_0006494 | Ga0495616_0006494_2217_2612 | 131 |
| 1620 | 3300046513 | Ga0495616_0074407 | Ga0495616_0074407_1091_1486 | 131 |
| 1621 | 3300046514 | Ga0495618_0210570 | Ga0495618_0210570_621_1016 | 131 |
| 1622 | 3300046514 | Ga0495618_0263098 | Ga0495618_0263098_251_646 | 131 |
| 1623 | 3300046514 | Ga0495618_0632815 | Ga0495618_0632815_190_585 | 131 |
| 1624 | 3300046515 | Ga0495620_0021563 | Ga0495620_0021563_513_908 | 131 |
| 1625 | 3300046515 | Ga0495620_0083017 | Ga0495620_0083017_313_708 | 131 |
| 1626 | 3300046515 | Ga0495620_0096514 | Ga0495620_0096514_287_682 | 131 |
| 1627 | 3300046517 | Ga0495630_0126006 | Ga0495630_0126006_1127_1522 | 131 |
| 1628 | 3300046518 | Ga0495631_0022122 | Ga0495631_0022122_1215_1610 | 131 |
| 1629 | 3300046519 | Ga0495632_0065630 | Ga0495632_0065630_789_1184 | 131 |
| 1630 | 3300046519 | Ga0495632_0113435 | Ga0495632_0113435_459_854 | 131 |
| 1631 | 3300046522 | Ga0495643_0019121 | Ga0495643_0019121_3228_3623 | 131 |
| 1632 | 3300046522 | Ga0495643_0474258 | Ga0495643_0474258_78_473 | 131 |
| 1633 | 3300046524 | Ga0495648_0357937 | Ga0495648_0357937_19_414 | 131 |
| 1634 | 3300046525 | Ga0495663_0091107 | Ga0495663_0091107_373_768 | 131 |
| 1635 | 3300046525 | Ga0495663_0161528 | Ga0495663_0161528_239_634 | 131 |
| 1636 | 3300046528 | Ga0495642_0053512 | Ga0495642_0053512_782_1177 | 131 |
| 1637 | 3300046530 | Ga0495654_0056414 | Ga0495654_0056414_657_1052 | 131 |
| 1638 | 3300046530 | Ga0495654_0208764 | Ga0495654_0208764_157_552 | 131 |
| 1639 | 3300046530 | Ga0495654_0283869 | Ga0495654_0283869_137_532 | 131 |
| 1640 | 3300046533 | Ga0495640_0425133 | Ga0495640_0425133_207_602 | 131 |
| 1641 | 3300046535 | Ga0495586_0061618 | Ga0495586_0061618_1354_1749 | 131 |
| 1642 | 3300046536 | Ga0495587_0270149 | Ga0495587_0270149_159_554 | 131 |
| 1643 | 3300046536 | Ga0495587_0440001 | Ga0495587_0440001_34_429 | 131 |
| 1644 | 3300046539 | Ga0495621_0352693 | Ga0495621_0352693_206_601 | 131 |
| 1645 | 3300046542 | Ga0495597_0092274 | Ga0495597_0092274_715_1110 | 131 |
| 1646 | 3300046543 | Ga0495645_0034282 | Ga0495645_0034282_2220_2615 | 131 |
| 1647 | 3300046543 | Ga0495645_0098975 | Ga0495645_0098975_563_958 | 131 |
| 1648 | 3300046557 | Ga0495622_0022381 | Ga0495622_0022381_1965_2360 | 131 |
| 1649 | 3300046558 | Ga0495633_0048161 | Ga0495633_0048161_231_626 | 131 |
| 1650 | 3300046558 | Ga0495633_0120456 | Ga0495633_0120456_341_736 | 131 |
| 1651 | 3300046558 | Ga0495633_0191697 | Ga0495633_0191697_211_606 | 131 |
| 1652 | 3300046558 | Ga0495633_0282068 | Ga0495633_0282068_293_688 | 131 |
| 1653 | 3300046559 | Ga0495667_0115936 | Ga0495667_0115936_713_1108 | 131 |
| 1654 | 3300046559 | Ga0495667_0295543 | Ga0495667_0295543_199_594 | 131 |
| 1655 | 3300046616 | Ga0495668_0179895 | Ga0495668_0179895_150_545 | 131 |
| 1656 | 3300046616 | Ga0495668_0435670 | Ga0495668_0435670_167_562 | 131 |
| 1657 | 3300046642 | Ga0495634_0205692 | Ga0495634_0205692_707_1102 | 131 |
| 1658 | 3300046642 | Ga0495634_0227438 | Ga0495634_0227438_501_896 | 131 |
| 1659 | 3300046648 | Ga0495611_0033426 | Ga0495611_0033426_1076_1471 | 131 |
| 1660 | 3300046648 | Ga0495611_0137743 | Ga0495611_0137743_165_560 | 131 |
| 1661 | 3300046660 | Ga0495625_0006868 | Ga0495625_0006868_3808_4203 | 131 |
| 1662 | 3300046660 | Ga0495625_0039878 | Ga0495625_0039878_1462_1857 | 131 |
| 1663 | 3300046660 | Ga0495625_0340532 | Ga0495625_0340532_442_837 | 131 |
| 1664 | 3300046663 | Ga0495635_0542978 | Ga0495635_0542978_308_703 | 131 |
| 1665 | 3300046663 | Ga0495635_0818213 | Ga0495635_0818213_166_561 | 131 |
| 1666 | 3300046664 | Ga0495659_0077302 | Ga0495659_0077302_115_510 | 131 |
| 1667 | 3300046664 | Ga0495659_0084804 | Ga0495659_0084804_103_498 | 131 |
| 1668 | 3300046675 | Ga0495657_0099043 | Ga0495657_0099043_1051_1446 | 131 |
| 1669 | 3300046679 | Ga0495623_0189415 | Ga0495623_0189415_220_615 | 131 |
| 1670 | 3300046680 | Ga0495646_0061137 | Ga0495646_0061137_1552_1947 | 131 |
| 1671 | 3300046681 | Ga0495647_0085698 | Ga0495647_0085698_323_718 | 131 |
| 1672 | 3300046681 | Ga0495647_0090860 | Ga0495647_0090860_527_922 | 131 |
| 1673 | 3300046681 | Ga0495647_0124789 | Ga0495647_0124789_559_954 | 131 |
| 1674 | 3300046681 | Ga0495647_0125943 | Ga0495647_0125943_182_577 | 131 |
| 1675 | 3300046681 | Ga0495647_0134919 | Ga0495647_0134919_477_872 | 131 |
| 1676 | 3300046683 | Ga0495658_0085813 | Ga0495658_0085813_1043_1438 | 131 |
| 1677 | 3300046683 | Ga0495658_0097472 | Ga0495658_0097472_272_667 | 131 |
| 1678 | 3300046683 | Ga0495658_0105468 | Ga0495658_0105468_639_1034 | 131 |
| 1679 | 3300046683 | Ga0495658_0223594 | Ga0495658_0223594_508_903 | 131 |
| 1680 | 3300046683 | Ga0495658_0455195 | Ga0495658_0455195_342_737 | 131 |
| 1681 | 3300046684 | Ga0495669_0084855 | Ga0495669_0084855_532_927 | 131 |
| 1682 | 3300046684 | Ga0495669_0103028 | Ga0495669_0103028_167_562 | 131 |
| 1683 | 3300046684 | Ga0495669_0321926 | Ga0495669_0321926_279_674 | 131 |
| 1684 | 3300046689 | Ga0495613_0091108 | Ga0495613_0091108_1010_1405 | 131 |
| 1685 | 3300046689 | Ga0495613_0120251 | Ga0495613_0120251_1461_1856 | 131 |
| 1686 | 3300046691 | Ga0495670_0042455 | Ga0495670_0042455_649_1044 | 131 |
| 1687 | 3300046691 | Ga0495670_0424075 | Ga0495670_0424075_199_594 | 131 |
| 1688 | 3300046692 | Ga0495671_0198265 | Ga0495671_0198265_237_632 | 131 |
| 1689 | 3300046692 | Ga0495671_0295587 | Ga0495671_0295587_368_763 | 131 |
| 1690 | 3300046692 | Ga0495671_0429974 | Ga0495671_0429974_159_554 | 131 |
| 1691 | 3300046694 | Ga0495649_0225215 | Ga0495649_0225215_242_637 | 131 |
| 1692 | 3300046694 | Ga0495649_0406068 | Ga0495649_0406068_10_405 | 131 |
| 1693 | 3300046694 | Ga0495649_0444741 | Ga0495649_0444741_169_564 | 131 |
| 1694 | 3300046809 | Ga0495600_0284384 | Ga0495600_0284384_590_985 | 131 |
| 1695 | 3300046810 | Ga0495660_0355899 | Ga0495660_0355899_219_614 | 131 |
| 1696 | 3300047317 | Ga0495604_0435394 | Ga0495604_0435394_309_704 | 131 |
| 1697 | 3300047317 | Ga0495604_0893880 | Ga0495604_0893880_150_545 | 131 |
| 1698 | 3300047321 | Ga0495676_0010234 | Ga0495676_0010234_6101_6496 | 131 |
| 1699 | 3300047321 | Ga0495676_0140426 | Ga0495676_0140426_1096_1491 | 131 |
| 1700 | 3300047322 | Ga0495680_0062566 | Ga0495680_0062566_642_1037 | 131 |
| 1701 | 3300047322 | Ga0495680_0916563 | Ga0495680_0916563_80_475 | 131 |
| 1702 | 3300047446 | Ga0495679_076308 | Ga0495679_076308_203_598 | 131 |
| 1703 | 3300047447 | Ga0495685_088317 | Ga0495685_088317_95_490 | 131 |
| 1704 | 3300047469 | Ga0495673_0135384 | Ga0495673_0135384_40_435 | 131 |
| 1705 | 3300047469 | Ga0495673_0182094 | Ga0495673_0182094_289_684 | 131 |
| 1706 | 3300047470 | Ga0495681_0051412 | Ga0495681_0051412_204_599 | 131 |
| 1707 | 3300047470 | Ga0495681_0191002 | Ga0495681_0191002_257_652 | 131 |
| 1708 | 3300047472 | Ga0495686_0039632 | Ga0495686_0039632_271_666 | 131 |
| 1709 | 3300047472 | Ga0495686_0054615 | Ga0495686_0054615_1940_2335 | 131 |
| 1710 | 3300047472 | Ga0495686_0066900 | Ga0495686_0066900_1215_1610 | 131 |
| 1711 | 3300047472 | Ga0495686_0195418 | Ga0495686_0195418_175_570 | 131 |
| 1712 | 3300047472 | Ga0495686_0580565 | Ga0495686_0580565_166_561 | 131 |
| 1713 | 3300047673 | Ga0495593_0038039 | Ga0495593_0038039_1094_1489 | 131 |
| 1714 | 3300048089 | Ga0495614_0095045 | Ga0495614_0095045_418_813 | 131 |
| 1715 | 3300048091 | Ga0495626_0074338 | Ga0495626_0074338_411_806 | 131 |
| 1716 | 3300048091 | Ga0495626_0131805 | Ga0495626_0131805_74_469 | 131 |
| 1717 | 3300048091 | Ga0495626_0154700 | Ga0495626_0154700_386_781 | 131 |
| 1718 | 3300048903 | Ga0496100_0447306 | Ga0496100_0447306_44_439 | 131 |
| 1719 | 3300048903 | Ga0496100_1019883 | Ga0496100_1019883_182_577 | 131 |
| 1720 | 3300048904 | Ga0496101_0633712 | Ga0496101_0633712_371_766 | 131 |
| 1721 | 3300048905 | Ga0496102_0060302 | Ga0496102_0060302_437_832 | 131 |
| 1722 | 3300048905 | Ga0496102_0536484 | Ga0496102_0536484_572_967 | 131 |
| 1723 | 3300048905 | Ga0496102_0704384 | Ga0496102_0704384_352_747 | 131 |
| 1724 | 3300048907 | Ga0496104_0327787 | Ga0496104_0327787_352_747 | 131 |
| 1725 | 3300048908 | Ga0496105_0289103 | Ga0496105_0289103_385_780 | 131 |
| 1726 | 3300048908 | Ga0496105_0693498 | Ga0496105_0693498_204_599 | 131 |
| 1727 | 3300048909 | Ga0496106_0275442 | Ga0496106_0275442_348_743 | 131 |
| 1728 | 3300048909 | Ga0496106_1586289 | Ga0496106_1586289_18_413 | 131 |
| 1729 | 3300048911 | Ga0496108_0005999 | Ga0496108_0005999_7358_7753 | 131 |
| 1730 | 3300048911 | Ga0496108_0097580 | Ga0496108_0097580_1045_1440 | 131 |
| 1731 | 3300048911 | Ga0496108_0309768 | Ga0496108_0309768_936_1331 | 131 |
| 1732 | 3300048912 | Ga0496109_0259357 | Ga0496109_0259357_682_1077 | 131 |
| 1733 | 3300048912 | Ga0496109_0267867 | Ga0496109_0267867_706_1101 | 131 |
| 1734 | 3300048912 | Ga0496109_0618045 | Ga0496109_0618045_38_433 | 131 |
| 1735 | 3300048912 | Ga0496109_1217504 | Ga0496109_1217504_98_493 | 131 |
| 1736 | 3300048914 | Ga0496111_0558089 | Ga0496111_0558089_326_721 | 131 |
| 1737 | 3300048915 | Ga0496112_0462843 | Ga0496112_0462843_187_582 | 131 |
| 1738 | 3300048915 | Ga0496112_0475015 | Ga0496112_0475015_736_1131 | 131 |
| 1739 | 3300048916 | Ga0496113_0211725 | Ga0496113_0211725_847_1242 | 131 |
| 1740 | 3300048916 | Ga0496113_0215057 | Ga0496113_0215057_164_559 | 131 |
| 1741 | 3300048916 | Ga0496113_0885539 | Ga0496113_0885539_112_507 | 131 |
| 1742 | 3300048917 | Ga0496114_0009046 | Ga0496114_0009046_5567_5962 | 131 |
| 1743 | 3300048917 | Ga0496114_0430906 | Ga0496114_0430906_449_844 | 131 |
| 1744 | 3300048917 | Ga0496114_0574004 | Ga0496114_0574004_226_621 | 131 |
| 1745 | 3300048918 | Ga0496115_0030230 | Ga0496115_0030230_2772_3167 | 131 |
| 1746 | 3300049127 | Ga0501306_001000 | Ga0501306_001000_1996_2391 | 131 |
| 1747 | 3300049128 | Ga0501308_004862 | Ga0501308_004862_406_801 | 131 |
| 1748 | 3300049128 | Ga0501308_015871 | Ga0501308_015871_254_649 | 131 |
| 1749 | 3300049129 | Ga0501309_018080 | Ga0501309_018080_177_572 | 131 |
| 1750 | 3300049130 | Ga0501310_005085 | Ga0501310_005085_251_646 | 131 |
| 1751 | 3300049130 | Ga0501310_011089 | Ga0501310_011089_358_753 | 131 |
| 1752 | 3300049130 | Ga0501310_011540 | Ga0501310_011540_428_823 | 131 |
| 1753 | 3300049160 | Ga0501304_001736 | Ga0501304_001736_26_421 | 131 |
| 1754 | 3300049161 | Ga0501305_000819 | Ga0501305_000819_41_436 | 131 |
| 1755 | 3300049161 | Ga0501305_005417 | Ga0501305_005417_1113_1508 | 131 |
| 1756 | 3300049161 | Ga0501305_010469 | Ga0501305_010469_531_926 | 131 |
| 1757 | 3300049161 | Ga0501305_038350 | Ga0501305_038350_129_524 | 131 |
| 1758 | 3300049162 | Ga0501307_000963 | Ga0501307_000963_179_574 | 131 |
| 1759 | 3300049162 | Ga0501307_025529 | Ga0501307_025529_213_608 | 131 |
| 1760 | 3300049162 | Ga0501307_068984 | Ga0501307_068984_85_480 | 131 |
| 1761 | 3300049460 | Ga0495682_0049136 | Ga0495682_0049136_794_1189 | 131 |
| 1762 | 3300049515 | Ga0501292_046069 | Ga0501292_046069_210_614 | 131 |
| 1763 | 3300049522 | Ga0501299_044313 | Ga0501299_044313_151_555 | 131 |
| 1764 | 3300049527 | Ga0501311_027374 | Ga0501311_027374_336_731 | 131 |
| 1765 | 3300049528 | Ga0501312_020297 | Ga0501312_020297_74_469 | 131 |
| 1766 | 3300049528 | Ga0501312_025631 | Ga0501312_025631_428_823 | 131 |
| 1767 | 3300049533 | Ga0501317_020404 | Ga0501317_020404_452_847 | 131 |
| 1768 | 3300049533 | Ga0501317_049831 | Ga0501317_049831_248_643 | 131 |
| 1769 | 3300049539 | Ga0501323_006346 | Ga0501323_006346_416_811 | 131 |
| 1770 | 3300049539 | Ga0501323_011600 | Ga0501323_011600_113_508 | 131 |
| 1771 | 3300049568 | Ga0501031_0414151 | Ga0501031_0414151_81_476 | 131 |
| 1772 | 3300049569 | Ga0501032_0525586 | Ga0501032_0525586_62_457 | 131 |
| 1773 | 3300049570 | Ga0501033_0049659 | Ga0501033_0049659_1429_1824 | 131 |
| 1774 | 3300049570 | Ga0501033_0106171 | Ga0501033_0106171_1588_1983 | 131 |
| 1775 | 3300049570 | Ga0501033_0713753 | Ga0501033_0713753_119_514 | 131 |
| 1776 | 3300049572 | Ga0501036_0023621 | Ga0501036_0023621_1431_1826 | 131 |
| 1777 | 3300049572 | Ga0501036_0041349 | Ga0501036_0041349_1854_2249 | 131 |
| 1778 | 3300049572 | Ga0501036_0048255 | Ga0501036_0048255_2444_2839 | 131 |
| 1779 | 3300049572 | Ga0501036_0061179 | Ga0501036_0061179_2722_3117 | 131 |
| 1780 | 3300049572 | Ga0501036_0533062 | Ga0501036_0533062_341_736 | 131 |
| 1781 | 3300049573 | Ga0501037_0067017 | Ga0501037_0067017_1806_2201 | 131 |
| 1782 | 3300049573 | Ga0501037_0071416 | Ga0501037_0071416_361_756 | 131 |
| 1783 | 3300049573 | Ga0501037_0146633 | Ga0501037_0146633_713_1108 | 131 |
| 1784 | 3300049574 | Ga0501038_0015092 | Ga0501038_0015092_3017_3412 | 131 |
| 1785 | 3300049575 | Ga0501039_0021546 | Ga0501039_0021546_3799_4194 | 131 |
| 1786 | 3300049575 | Ga0501039_0115981 | Ga0501039_0115981_1199_1594 | 131 |
| 1787 | 3300049575 | Ga0501039_0428377 | Ga0501039_0428377_86_481 | 131 |
| 1788 | 3300049575 | Ga0501039_0702981 | Ga0501039_0702981_334_729 | 131 |
| 1789 | 3300049576 | Ga0501040_0008066 | Ga0501040_0008066_5172_5567 | 131 |
| 1790 | 3300049576 | Ga0501040_0970565 | Ga0501040_0970565_124_519 | 131 |
| 1791 | 3300049577 | Ga0501041_0001598 | Ga0501041_0001598_2656_3051 | 131 |
| 1792 | 3300049577 | Ga0501041_0119305 | Ga0501041_0119305_706_1101 | 131 |
| 1793 | 3300049577 | Ga0501041_0315177 | Ga0501041_0315177_253_648 | 131 |
| 1794 | 3300049577 | Ga0501041_0665193 | Ga0501041_0665193_198_593 | 131 |
| 1795 | 3300049577 | Ga0501041_0775507 | Ga0501041_0775507_65_460 | 131 |
| 1796 | 3300049578 | Ga0501042_0001373 | Ga0501042_0001373_6357_6752 | 131 |
| 1797 | 3300049578 | Ga0501042_0158721 | Ga0501042_0158721_484_879 | 131 |
| 1798 | 3300049578 | Ga0501042_0741520 | Ga0501042_0741520_255_650 | 131 |
| 1799 | 3300049579 | Ga0501043_0000090 | Ga0501043_0000090_72885_73280 | 131 |
| 1800 | 3300049579 | Ga0501043_0542364 | Ga0501043_0542364_436_831 | 131 |
| 1801 | 3300049580 | Ga0501046_0000126 | Ga0501046_0000126_72883_73278 | 131 |
| 1802 | 3300049580 | Ga0501046_0015243 | Ga0501046_0015243_3336_3731 | 131 |
| 1803 | 3300049580 | Ga0501046_0105554 | Ga0501046_0105554_1141_1536 | 131 |
| 1804 | 3300049580 | Ga0501046_0179631 | Ga0501046_0179631_539_934 | 131 |
| 1805 | 3300049581 | Ga0501047_0000160 | Ga0501047_0000160_8057_8452 | 131 |
| 1806 | 3300049581 | Ga0501047_0364875 | Ga0501047_0364875_806_1201 | 131 |
| 1807 | 3300049582 | Ga0501048_0003429 | Ga0501048_0003429_10614_11009 | 131 |
| 1808 | 3300049582 | Ga0501048_0009558 | Ga0501048_0009558_1541_1936 | 131 |
| 1809 | 3300049582 | Ga0501048_0282946 | Ga0501048_0282946_149_544 | 131 |
| 1810 | 3300049582 | Ga0501048_0590393 | Ga0501048_0590393_64_459 | 131 |
| 1811 | 3300049583 | Ga0501067_0031483 | Ga0501067_0031483_2084_2479 | 131 |
| 1812 | 3300049583 | Ga0501067_0424614 | Ga0501067_0424614_29_424 | 131 |
| 1813 | 3300049583 | Ga0501067_0472701 | Ga0501067_0472701_111_506 | 131 |
| 1814 | 3300049584 | Ga0501068_0001465 | Ga0501068_0001465_6183_6578 | 131 |
| 1815 | 3300049584 | Ga0501068_0026867 | Ga0501068_0026867_2973_3368 | 131 |
| 1816 | 3300049584 | Ga0501068_0041518 | Ga0501068_0041518_1816_2211 | 131 |
| 1817 | 3300049584 | Ga0501068_0525903 | Ga0501068_0525903_273_668 | 131 |
| 1818 | 3300049585 | Ga0501069_0333741 | Ga0501069_0333741_309_704 | 131 |
| 1819 | 3300049586 | Ga0501070_0044235 | Ga0501070_0044235_2021_2416 | 131 |
| 1820 | 3300049586 | Ga0501070_0169408 | Ga0501070_0169408_54_449 | 131 |
| 1821 | 3300049587 | Ga0501071_0024289 | Ga0501071_0024289_812_1207 | 131 |
| 1822 | 3300049587 | Ga0501071_0102836 | Ga0501071_0102836_426_821 | 131 |
| 1823 | 3300049587 | Ga0501071_0144858 | Ga0501071_0144858_553_948 | 131 |
| 1824 | 3300049587 | Ga0501071_0259097 | Ga0501071_0259097_22_417 | 131 |
| 1825 | 3300049588 | Ga0501072_0025385 | Ga0501072_0025385_3605_4000 | 131 |
| 1826 | 3300049588 | Ga0501072_0063312 | Ga0501072_0063312_870_1265 | 131 |
| 1827 | 3300049588 | Ga0501072_0101863 | Ga0501072_0101863_1788_2183 | 131 |
| 1828 | 3300049588 | Ga0501072_0140535 | Ga0501072_0140535_1418_1813 | 131 |
| 1829 | 3300049588 | Ga0501072_0327339 | Ga0501072_0327339_727_1122 | 131 |
| 1830 | 3300049588 | Ga0501072_0513025 | Ga0501072_0513025_495_890 | 131 |
| 1831 | 3300049589 | Ga0501073_0000525 | Ga0501073_0000525_8700_9095 | 131 |
| 1832 | 3300049589 | Ga0501073_0216221 | Ga0501073_0216221_174_569 | 131 |
| 1833 | 3300049590 | Ga0501074_0001124 | Ga0501074_0001124_13966_14361 | 131 |
| 1834 | 3300049590 | Ga0501074_0018349 | Ga0501074_0018349_1743_2138 | 131 |
| 1835 | 3300049590 | Ga0501074_0089815 | Ga0501074_0089815_326_721 | 131 |
| 1836 | 3300049591 | Ga0501075_0015597 | Ga0501075_0015597_3274_3669 | 131 |
| 1837 | 3300049591 | Ga0501075_0231797 | Ga0501075_0231797_99_494 | 131 |
| 1838 | 3300049591 | Ga0501075_0484848 | Ga0501075_0484848_87_482 | 131 |
| 1839 | 3300049592 | Ga0501076_0004639 | Ga0501076_0004639_5453_5848 | 131 |
| 1840 | 3300049592 | Ga0501076_0022764 | Ga0501076_0022764_756_1151 | 131 |
| 1841 | 3300049592 | Ga0501076_0028505 | Ga0501076_0028505_2965_3360 | 131 |
| 1842 | 3300049592 | Ga0501076_0046380 | Ga0501076_0046380_2309_2704 | 131 |
| 1843 | 3300049593 | Ga0501077_0002875 | Ga0501077_0002875_2500_2895 | 131 |
| 1844 | 3300049593 | Ga0501077_0007629 | Ga0501077_0007629_3057_3452 | 131 |
| 1845 | 3300049593 | Ga0501077_0029086 | Ga0501077_0029086_706_1101 | 131 |
| 1846 | 3300049593 | Ga0501077_0049998 | Ga0501077_0049998_126_521 | 131 |
| 1847 | 3300049593 | Ga0501077_0059648 | Ga0501077_0059648_335_730 | 131 |
| 1848 | 3300049650 | Ga0501199_034729 | Ga0501199_034729_85_489 | 131 |
| 1849 | 3300049662 | Ga0501222_041246 | Ga0501222_041246_216_611 | 131 |
| 1850 | 3300049666 | Ga0501228_000607 | Ga0501228_000607_116_523 | 131 |
| 1851 | 3300049672 | Ga0501239_055810 | Ga0501239_055810_90_485 | 131 |
| 1852 | 3300049674 | Ga0501242_069704 | Ga0501242_069704_82_477 | 131 |
| 1853 | 3300049703 | Ga0501219_009206 | Ga0501219_009206_53_448 | 131 |
| 1854 | 3300049707 | Ga0501234_053845 | Ga0501234_053845_18_422 | 131 |
| 1855 | 3300049741 | Ga0501079_0004772 | Ga0501079_0004772_1598_1993 | 131 |
| 1856 | 3300049741 | Ga0501079_0006996 | Ga0501079_0006996_1080_1475 | 131 |
| 1857 | 3300049741 | Ga0501079_0431909 | Ga0501079_0431909_160_555 | 131 |
| 1858 | 3300049741 | Ga0501079_1077032 | Ga0501079_1077032_45_440 | 131 |
| 1859 | 3300049741 | Ga0501079_1097558 | Ga0501079_1097558_94_489 | 131 |
| 1860 | 3300049742 | Ga0501080_0001373 | Ga0501080_0001373_7995_8390 | 131 |
| 1861 | 3300049742 | Ga0501080_0011395 | Ga0501080_0011395_519_914 | 131 |
| 1862 | 3300049742 | Ga0501080_0028144 | Ga0501080_0028144_2925_3320 | 131 |
| 1863 | 3300049742 | Ga0501080_0794587 | Ga0501080_0794587_77_472 | 131 |
| 1864 | 3300049742 | Ga0501080_1256064 | Ga0501080_1256064_196_591 | 131 |
| 1865 | 3300049743 | Ga0501081_0006719 | Ga0501081_0006719_4341_4736 | 131 |
| 1866 | 3300049743 | Ga0501081_0018126 | Ga0501081_0018126_706_1101 | 131 |
| 1867 | 3300049743 | Ga0501081_0332797 | Ga0501081_0332797_77_472 | 131 |
| 1868 | 3300049743 | Ga0501081_1326275 | Ga0501081_1326275_100_495 | 131 |
| 1869 | 3300049744 | Ga0501083_0004501 | Ga0501083_0004501_3269_3664 | 131 |
| 1870 | 3300049744 | Ga0501083_0032077 | Ga0501083_0032077_1539_1934 | 131 |
| 1871 | 3300049744 | Ga0501083_0079781 | Ga0501083_0079781_456_851 | 131 |
| 1872 | 3300049776 | Ga0501280_000425 | Ga0501280_000425_6734_7129 | 131 |
| 1873 | 3300049822 | Ga0501035_0180906 | Ga0501035_0180906_239_634 | 131 |
| 1874 | 3300049822 | Ga0501035_0729904 | Ga0501035_0729904_48_443 | 131 |
| 1875 | 3300049823 | Ga0501044_0057237 | Ga0501044_0057237_2191_2586 | 131 |
| 1876 | 3300049823 | Ga0501044_0344411 | Ga0501044_0344411_352_747 | 131 |
| 1877 | 3300049823 | Ga0501044_0644482 | Ga0501044_0644482_10_405 | 131 |
| 1878 | 3300049823 | Ga0501044_0934012 | Ga0501044_0934012_326_721 | 131 |
| 1879 | 3300049824 | Ga0501045_0000882 | Ga0501045_0000882_2538_2933 | 131 |
| 1880 | 3300049824 | Ga0501045_0008747 | Ga0501045_0008747_3688_4083 | 131 |
| 1881 | 3300049824 | Ga0501045_0084307 | Ga0501045_0084307_892_1287 | 131 |
| 1882 | 3300049824 | Ga0501045_0089934 | Ga0501045_0089934_1758_2153 | 131 |
| 1883 | 3300050489 | nmdc:mga03683_18745_c1 | nmdc:mga03683_18745_c1_1425_1820 | 131 |
| 1884 | 3300050489 | nmdc:mga03683_330406_c1 | nmdc:mga03683_330406_c1_270_665 | 131 |
| 1885 | 3300050490 | nmdc:mga03n38_4851_c1 | nmdc:mga03n38_4851_c1_2343_2738 | 131 |
| 1886 | 3300050490 | nmdc:mga03n38_660515_c1 | nmdc:mga03n38_660515_c1_31_426 | 131 |
| 1887 | 3300050491 | nmdc:mga00v17_103467_c1 | nmdc:mga00v17_103467_c1_51_446 | 131 |
| 1888 | 3300050491 | nmdc:mga00v17_53813_c1 | nmdc:mga00v17_53813_c1_828_1223 | 131 |
| 1889 | 3300050491 | nmdc:mga00v17_803227_c1 | nmdc:mga00v17_803227_c1_56_451 | 131 |
| 1890 | 3300050493 | nmdc:mga0k408_1021_c1 | nmdc:mga0k408_1021_c1_9151_9546 | 131 |
| 1891 | 3300050493 | nmdc:mga0k408_109049_c1 | nmdc:mga0k408_109049_c1_190_585 | 131 |
| 1892 | 3300050493 | nmdc:mga0k408_12806_c1 | nmdc:mga0k408_12806_c1_2388_2783 | 131 |
| 1893 | 3300050493 | nmdc:mga0k408_137955_c1 | nmdc:mga0k408_137955_c1_965_1360 | 131 |
| 1894 | 3300050493 | nmdc:mga0k408_149455_c1 | nmdc:mga0k408_149455_c1_479_874 | 131 |
| 1895 | 3300050493 | nmdc:mga0k408_153215_c1 | nmdc:mga0k408_153215_c1_13_408 | 131 |
| 1896 | 3300050493 | nmdc:mga0k408_17814_c1 | nmdc:mga0k408_17814_c1_2952_3347 | 131 |
| 1897 | 3300050493 | nmdc:mga0k408_205529_c1 | nmdc:mga0k408_205529_c1_652_1047 | 131 |
| 1898 | 3300050493 | nmdc:mga0k408_210024_c1 | nmdc:mga0k408_210024_c1_632_1027 | 131 |
| 1899 | 3300050493 | nmdc:mga0k408_219_c1 | nmdc:mga0k408_219_c1_8152_8547 | 131 |
| 1900 | 3300050493 | nmdc:mga0k408_23422_c1 | nmdc:mga0k408_23422_c1_2118_2513 | 131 |
| 1901 | 3300050493 | nmdc:mga0k408_23786_c1 | nmdc:mga0k408_23786_c1_1144_1539 | 131 |
| 1902 | 3300050493 | nmdc:mga0k408_28249_c1 | nmdc:mga0k408_28249_c1_561_956 | 131 |
| 1903 | 3300050493 | nmdc:mga0k408_283141_c1 | nmdc:mga0k408_283141_c1_381_776 | 131 |
| 1904 | 3300050493 | nmdc:mga0k408_318491_c1 | nmdc:mga0k408_318491_c1_467_862 | 131 |
| 1905 | 3300050493 | nmdc:mga0k408_46982_c1 | nmdc:mga0k408_46982_c1_895_1290 | 131 |
| 1906 | 3300050493 | nmdc:mga0k408_49108_c1 | nmdc:mga0k408_49108_c1_701_1096 | 131 |
| 1907 | 3300050493 | nmdc:mga0k408_59396_c1 | nmdc:mga0k408_59396_c1_1541_1936 | 131 |
| 1908 | 3300050493 | nmdc:mga0k408_61835_c1 | nmdc:mga0k408_61835_c1_1682_2077 | 131 |
| 1909 | 3300050494 | nmdc:mga06z11_229350_c1 | nmdc:mga06z11_229350_c1_57_452 | 131 |
| 1910 | 3300050494 | nmdc:mga06z11_267106_c1 | nmdc:mga06z11_267106_c1_596_991 | 131 |
| 1911 | 3300050494 | nmdc:mga06z11_3023_c1 | nmdc:mga06z11_3023_c1_2887_3282 | 131 |
| 1912 | 3300050494 | nmdc:mga06z11_31530_c1 | nmdc:mga06z11_31530_c1_480_875 | 131 |
| 1913 | 3300050495 | nmdc:mga04h51_184316_c1 | nmdc:mga04h51_184316_c1_244_639 | 131 |
| 1914 | 3300050496 | nmdc:mga07m45_196968_c1 | nmdc:mga07m45_196968_c1_205_600 | 131 |
| 1915 | 3300050496 | nmdc:mga07m45_20386_c1 | nmdc:mga07m45_20386_c1_3171_3566 | 131 |
| 1916 | 3300050496 | nmdc:mga07m45_359059_c1 | nmdc:mga07m45_359059_c1_36_431 | 131 |
| 1917 | 3300050496 | nmdc:mga07m45_521105_c1 | nmdc:mga07m45_521105_c1_251_646 | 131 |
| 1918 | 3300050496 | nmdc:mga07m45_74068_c1 | nmdc:mga07m45_74068_c1_1042_1437 | 131 |
| 1919 | 3300050496 | nmdc:mga07m45_905430_c1 | nmdc:mga07m45_905430_c1_76_471 | 131 |
| 1920 | 3300050507 | nmdc:mga05p37_1575417_c1 | nmdc:mga05p37_1575417_c1_111_506 | 131 |
| 1921 | 3300050508 | nmdc:mga09592_38477_c1 | nmdc:mga09592_38477_c1_298_693 | 131 |
| 1922 | 3300050508 | nmdc:mga09592_533821_c1 | nmdc:mga09592_533821_c1_223_618 | 131 |
| 1923 | 3300050509 | nmdc:mga0qj67_50093_c1 | nmdc:mga0qj67_50093_c1_204_599 | 131 |
| 1924 | 3300050509 | nmdc:mga0qj67_662317_c1 | nmdc:mga0qj67_662317_c1_146_541 | 131 |
| 1925 | 3300050511 | nmdc:mga08y16_1296713_c1 | nmdc:mga08y16_1296713_c1_32_427 | 131 |
| 1926 | 3300050511 | nmdc:mga08y16_208685_c1 | nmdc:mga08y16_208685_c1_308_703 | 131 |
| 1927 | 3300050511 | nmdc:mga08y16_397291_c1 | nmdc:mga08y16_397291_c1_653_1048 | 131 |
| 1928 | 3300050511 | nmdc:mga08y16_485070_c1 | nmdc:mga08y16_485070_c1_606_1001 | 131 |
| 1929 | 3300050511 | nmdc:mga08y16_731543_c1 | nmdc:mga08y16_731543_c1_172_567 | 131 |
| 1930 | 3300050512 | nmdc:mga0n895_1599570_c1 | nmdc:mga0n895_1599570_c1_198_593 | 131 |
| 1931 | 3300050513 | nmdc:mga0rr50_369987_c1 | nmdc:mga0rr50_369987_c1_199_594 | 131 |
| 1932 | 3300050513 | nmdc:mga0rr50_423398_c1 | nmdc:mga0rr50_423398_c1_444_839 | 131 |
| 1933 | 3300053077 | Ga0495601_0338822 | Ga0495601_0338822_394_789 | 131 |
| 1934 | 3300053077 | Ga0495601_0761682 | Ga0495601_0761682_73_468 | 131 |
| 1935 | 3300053078 | Ga0495612_0100041 | Ga0495612_0100041_403_798 | 131 |
| 1936 | 3300053078 | Ga0495612_0132131 | Ga0495612_0132131_259_654 | 131 |
| 1937 | 3300053080 | Ga0500635_0116347 | Ga0500635_0116347_432_827 | 131 |
| 1938 | 3300053083 | Ga0495655_0027539 | Ga0495655_0027539_572_967 | 131 |
| 1939 | 3300053083 | Ga0495655_0252931 | Ga0495655_0252931_177_572 | 131 |
| 1940 | 3300053084 | Ga0495595_0249086 | Ga0495595_0249086_381_776 | 131 |
| 1941 | 3300053084 | Ga0495595_0329422 | Ga0495595_0329422_17_412 | 131 |
| 1942 | 3300053084 | Ga0495595_0730298 | Ga0495595_0730298_101_496 | 131 |
| 1943 | 3300053085 | Ga0495619_0076699 | Ga0495619_0076699_1517_1912 | 131 |
| 1944 | 3300053085 | Ga0495619_0264261 | Ga0495619_0264261_454_849 | 131 |
| 1945 | 3300053086 | Ga0500578_0000292 | Ga0500578_0000292_61101_61496 | 131 |
| 1946 | 3300053086 | Ga0500578_0079895 | Ga0500578_0079895_1204_1599 | 131 |
| 1947 | 3300053087 | Ga0500643_048658 | Ga0500643_048658_415_810 | 131 |
| 1948 | 3300053088 | Ga0500644_0003475 | Ga0500644_0003475_2330_2725 | 131 |
| 1949 | 3300053088 | Ga0500644_0024450 | Ga0500644_0024450_1405_1800 | 131 |
| 1950 | 3300053090 | Ga0500646_0014216 | Ga0500646_0014216_901_1296 | 131 |
| 1951 | 3300053090 | Ga0500646_0053402 | Ga0500646_0053402_451_846 | 131 |
| 1952 | 3300053090 | Ga0500646_0333222 | Ga0500646_0333222_57_452 | 131 |
| 1953 | 3300053093 | Ga0500651_0000274 | Ga0500651_0000274_13717_14112 | 131 |
| 1954 | 3300053093 | Ga0500651_0169517 | Ga0500651_0169517_605_1000 | 131 |
| 1955 | 3300053094 | Ga0500566_0399313 | Ga0500566_0399313_35_430 | 131 |
| 1956 | 3300053096 | Ga0500641_0352164 | Ga0500641_0352164_174_569 | 131 |
| 1957 | 3300053097 | Ga0500648_382663 | Ga0500648_382663_142_537 | 131 |
| 1958 | 3300053098 | Ga0500650_0150156 | Ga0500650_0150156_594_989 | 131 |
| 1959 | 3300053108 | Ga0500562_019007 | Ga0500562_019007_715_1110 | 131 |
| 1960 | 3300053108 | Ga0500562_081775 | Ga0500562_081775_19_414 | 131 |
| 1961 | 3300053109 | Ga0500569_001743 | Ga0500569_001743_3591_3986 | 131 |
| 1962 | 3300053117 | Ga0500593_000235 | Ga0500593_000235_16778_17173 | 131 |
| 1963 | 3300053117 | Ga0500593_079766 | Ga0500593_079766_393_788 | 131 |
| 1964 | 3300053118 | Ga0500594_0013014 | Ga0500594_0013014_863_1258 | 131 |
| 1965 | 3300053121 | Ga0500607_155896 | Ga0500607_155896_572_967 | 131 |
| 1966 | 3300053129 | Ga0500628_006199 | Ga0500628_006199_880_1275 | 131 |
| 1967 | 3300053129 | Ga0500628_019518 | Ga0500628_019518_14_409 | 131 |
| 1968 | 3300053130 | Ga0500642_0002530 | Ga0500642_0002530_134_529 | 131 |
| 1969 | 3300053131 | Ga0500652_000400 | Ga0500652_000400_9149_9544 | 131 |
| 1970 | 3300053131 | Ga0500652_069558 | Ga0500652_069558_35_430 | 131 |
| 1971 | 3300053134 | Ga0500658_0190721 | Ga0500658_0190721_79_474 | 131 |
| 1972 | 3300053136 | Ga0500559_0000097 | Ga0500559_0000097_238_633 | 131 |
| 1973 | 3300053138 | Ga0500564_150120 | Ga0500564_150120_112_507 | 131 |
| 1974 | 3300053139 | Ga0500568_0013644 | Ga0500568_0013644_3162_3557 | 131 |
| 1975 | 3300053139 | Ga0500568_0015583 | Ga0500568_0015583_2454_2849 | 131 |
| 1976 | 3300053139 | Ga0500568_0079576 | Ga0500568_0079576_367_762 | 131 |
| 1977 | 3300053142 | Ga0500577_0017376 | Ga0500577_0017376_1308_1703 | 131 |
| 1978 | 3300053143 | Ga0500579_268554 | Ga0500579_268554_40_435 | 131 |
| 1979 | 3300053146 | Ga0500588_0096304 | Ga0500588_0096304_418_813 | 131 |
| 1980 | 3300053147 | Ga0500589_225266 | Ga0500589_225266_82_477 | 131 |
| 1981 | 3300053151 | Ga0500604_0178893 | Ga0500604_0178893_18_413 | 131 |
| 1982 | 3300053153 | Ga0500616_0096791 | Ga0500616_0096791_431_826 | 131 |
| 1983 | 3300053154 | Ga0500619_000012 | Ga0500619_000012_49219_49614 | 131 |
| 1984 | 3300053154 | Ga0500619_259909 | Ga0500619_259909_59_454 | 131 |
| 1985 | 3300053155 | Ga0500620_057705 | Ga0500620_057705_705_1100 | 131 |
| 1986 | 3300053156 | Ga0500622_0000198 | Ga0500622_0000198_36586_36981 | 131 |
| 1987 | 3300053156 | Ga0500622_0000978 | Ga0500622_0000978_3798_4193 | 131 |
| 1988 | 3300053162 | Ga0500638_200485 | Ga0500638_200485_97_492 | 131 |
| 1989 | 3300053177 | Ga0500636_0125261 | Ga0500636_0125261_541_936 | 131 |
| 1990 | 3300053724 | Ga0500570_133500 | Ga0500570_133500_58_453 | 131 |
| 1991 | 3300053730 | Ga0500645_030754 | Ga0500645_030754_165_560 | 131 |
| 1992 | 3300053739 | Ga0500587_000541 | Ga0500587_000541_3267_3662 | 131 |
| 1993 | 3300053739 | Ga0500587_006132 | Ga0500587_006132_644_1039 | 131 |
| 1994 | 3300054114 | Ga0501084_0008704 | Ga0501084_0008704_919_1314 | 131 |
| 1995 | 3300054114 | Ga0501084_0022568 | Ga0501084_0022568_3238_3633 | 131 |
| 1996 | 3300054114 | Ga0501084_0144399 | Ga0501084_0144399_779_1174 | 131 |
| 1997 | 3300054114 | Ga0501084_0502704 | Ga0501084_0502704_290_685 | 131 |
| 1998 | 3300054114 | Ga0501084_0638875 | Ga0501084_0638875_264_659 | 131 |
| 1999 | 3300054114 | Ga0501084_0874625 | Ga0501084_0874625_299_694 | 131 |
| 2000 | 3300059424 | Ga0590075_024840 | Ga0590075_024840_756_1151 | 131 |
| 2001 | 3300060353 | Ga0501082_0004231 | Ga0501082_0004231_9776_10171 | 131 |
| 2002 | 3300060353 | Ga0501082_0043889 | Ga0501082_0043889_2968_3363 | 131 |
| 2003 | 3300060353 | Ga0501082_0087089 | Ga0501082_0087089_1117_1512 | 131 |
| 2004 | 3300061734 | Ga0530510_0006785 | Ga0530510_0006785_7291_7686 | 131 |
| 2005 | 3300061734 | Ga0530510_0007174 | Ga0530510_0007174_3985_4380 | 131 |
| 2006 | 3300061734 | Ga0530510_0119058 | Ga0530510_0119058_1378_1773 | 131 |
| 2007 | 3300061734 | Ga0530510_0170978 | Ga0530510_0170978_635_1030 | 131 |
| 2008 | 3300061734 | Ga0530510_0195752 | Ga0530510_0195752_290_685 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pdb-assembly1.cif.gz_A | crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer | 0.9845 | 4 | 131 |
| 7m4u-assembly1.cif.gz_h | a. baumannii ribosome-eravacycline complex: 30s | 0.9819 | 2 | 131 |
| 7unu-assembly1.cif.gz_h | pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) | 0.9762 | 2 | 131 |
| 7m4u-assembly1.cif.gz_h | a. baumannii ribosome-eravacycline complex: 30s | 0.9745 | 2 | 131 |
| 7nhn-assembly1.cif.gz_i | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9734 | 3 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9796 | 74 | 131 | 3.30.1490.10 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9746 | 74 | 131 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9634 | 74 | 131 | 3.30.1490.10 |
| 4pdbA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.9632 | 4 | 73 | 3.30.1370.30 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9586 | 74 | 131 | 3.30.1490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351BDG7-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 1.003 | 62 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A352KI84-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 1.001 | 62 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A435JWK2-F1-model_v4 | deleted | 1 | 62 | 131 |
|
| AF-A0A1Q6ZZ57-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9998 | 64 | 131 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1V6DPD0-F1-model_v4 | deleted | 0.9978 | 64 | 131 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar