F496250

General Info

Members Datasets Scaffolds Average Seq Length
2008 720 1939 130

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0473085|Ga0453684_0473085_381_818
Length 145
Sequence VLKKARGNLIKFCLSMTTDTLGDSLARIRNAIMRKQKQVELQKSRMVAEVCRILQENKFIKEFDIKDDARVINVTLNYEDGESSKLVSSLQRVSKPGLRIYRGYKELRPVLNGYGIAIISTPKGVMSDRDARKNKVGGELLCEIY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
6 2547132512 Azospira oryzae 6a3 Isolate Unclassified
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
16 2643221585 Pelomonas sp. Root662 Isolate Unclassified
17 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
18 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
19 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
20 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
21 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
22 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
23 2643221656 Pelomonas sp. Root405 Isolate Unclassified
24 2643221658 Variovorax sp. Root411 Isolate Unclassified
25 2643221660 Methylibium sp. Root1272 Isolate Unclassified
26 2643221672 Variovorax sp. Root434 Isolate Unclassified
27 2643221683 Variovorax sp. Root473 Isolate Unclassified
28 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541307 Variovorax sp. GV008 Isolate Unclassified
31 2738541337 Pelomonas sp. BT06 Isolate Unclassified
32 2738543013 Variovorax sp. BT01 Isolate Unclassified
33 2738543019 Variovorax sp. GV040 Isolate Unclassified
34 2818991446 Variovorax sp. 1180 Isolate Unclassified
35 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
36 2831864461 Roseateles noduli HZ7 Isolate Nodule
37 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
38 2842677519 Variovorax sp. R-72495 Isolate Unclassified
39 2842733646 Variovorax sp. R-72446 Isolate Unclassified
40 2842747753 Variovorax sp. R-72060 Isolate Unclassified
41 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
42 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
43 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
44 2847085930 Erwinia persicina B64 Isolate Bulb
45 2885198086 Variovorax sp. 679 Isolate Unclassified
46 2885211737 Variovorax sp. 553 Isolate Unclassified
47 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
48 2899924645 Variovorax sp. 369 Isolate Unclassified
49 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
50 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
51 2904456579 Variovorax sp. 2002 Isolate Unclassified
52 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
53 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
54 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
55 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
56 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
57 2928037797 Variovorax sp. 1126 Isolate Unclassified
58 2928044640 Variovorax sp. 1128 Isolate Unclassified
59 2928051484 Variovorax sp. 1133 Isolate Unclassified
60 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
61 2928070936 Variovorax gossypii 1167 Isolate Unclassified
62 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
63 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
64 2929520902 Variovorax beijingensis 502 Isolate Unclassified
65 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
66 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
67 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
68 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
69 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
70 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
71 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
72 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
73 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
74 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
75 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
76 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
77 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
78 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
79 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
80 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
81 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
82 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
83 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
84 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
87 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
88 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
89 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
90 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
91 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
92 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
93 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
94 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
95 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
96 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
97 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
99 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
100 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
101 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
103 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
104 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
105 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
106 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
108 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
109 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
110 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
111 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
112 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
113 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
114 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
115 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
116 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
117 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
118 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
121 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
122 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
123 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
124 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
125 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
126 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
127 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
128 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
129 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
130 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
131 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
132 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
133 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
134 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
135 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
136 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
137 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
138 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
139 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
140 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
141 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
147 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
148 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
149 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
150 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
154 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
155 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
156 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
157 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
158 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
159 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
160 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
161 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
164 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
165 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
166 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
167 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
168 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
169 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
170 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
171 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
172 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
173 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
174 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
175 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
176 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
177 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
178 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
179 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
180 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
181 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
182 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
183 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
184 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
185 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
186 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
187 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
188 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
189 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
190 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
191 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
192 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
193 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
194 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
195 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
196 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
197 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
198 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
199 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
200 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
201 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
202 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
203 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
204 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
207 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
208 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
209 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
210 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
211 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
212 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
213 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
214 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
215 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
216 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
217 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
218 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
219 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
220 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
221 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
222 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
223 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
224 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
225 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
226 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
227 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
228 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
229 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
230 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
231 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
232 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
233 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
234 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
235 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
236 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
237 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
238 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
239 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
240 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
241 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
242 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
243 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
244 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
245 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
246 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
247 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
248 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
249 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
250 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
251 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
253 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
255 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
324 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
325 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
331 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
332 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
333 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
334 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
335 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
336 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
337 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
338 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
339 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
340 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
341 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
342 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
343 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
344 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
345 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
346 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
347 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
348 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
349 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
350 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
351 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
352 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
353 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
354 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
355 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
356 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
357 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
358 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
359 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
360 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
361 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
362 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
363 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
364 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
365 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
366 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
368 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
369 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
372 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
373 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
374 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
375 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
376 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
377 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
378 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
379 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
380 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
381 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
382 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
383 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
384 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
385 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
386 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
387 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
388 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
389 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
390 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
391 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
392 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
393 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
394 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
395 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
396 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
397 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
398 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
399 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
400 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
401 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
402 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
403 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
404 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
405 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
406 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
407 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
408 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
409 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
410 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
411 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
412 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
413 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
414 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
415 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
416 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
417 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
418 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
419 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
420 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
421 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
422 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
423 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
424 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
425 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
426 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
427 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
428 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
429 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
430 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
431 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
432 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
433 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
434 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
435 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
436 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
437 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
438 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
439 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
440 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
441 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
442 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
443 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
444 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
445 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
446 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
447 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
448 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
449 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
450 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
451 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
452 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
453 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
454 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
455 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
456 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
457 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
458 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
459 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
460 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
461 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
462 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
463 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
464 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
465 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
466 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
467 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
468 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
469 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
470 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
471 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
472 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
473 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
474 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
475 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
476 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
477 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
478 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
479 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
480 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
481 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
482 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
483 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
484 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
485 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
486 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
487 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
488 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
489 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
490 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
491 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
492 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
493 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
494 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
495 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
496 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
497 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
498 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
499 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
500 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
501 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
502 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
503 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
504 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
505 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
506 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
507 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
508 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
509 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
510 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
511 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
512 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
513 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
514 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
515 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
516 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
517 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
518 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
519 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
520 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
521 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
522 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
523 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
524 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
525 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
526 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
527 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
528 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
529 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
530 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
531 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
532 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
533 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
534 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
535 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
536 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
537 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
538 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
539 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
540 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
541 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
542 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
543 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
544 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
545 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
546 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
547 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
548 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
549 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
550 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
551 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
552 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
553 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
554 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
555 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
556 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
557 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
558 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
559 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
560 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
561 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
562 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
563 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
564 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
565 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
566 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
567 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
568 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
569 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
570 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
571 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
572 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
573 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
574 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
575 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
576 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
577 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
578 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
579 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
580 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
581 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
582 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
583 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
584 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
585 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
586 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
594 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
595 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
596 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
597 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
598 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
611 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
612 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
613 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
614 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
615 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
622 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
623 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
624 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
625 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
626 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
627 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
628 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
629 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
630 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
631 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
632 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
633 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
634 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
635 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
636 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
637 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
638 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
639 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
640 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
641 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
642 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
643 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
644 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
645 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
646 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
647 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
648 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
649 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
650 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
652 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
653 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
654 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
655 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
656 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
657 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
658 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
659 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
660 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
661 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
662 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
663 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
664 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
665 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
666 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
667 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
668 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
669 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
670 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
671 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
672 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
673 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
674 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
675 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
676 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
677 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
678 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
679 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
680 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
681 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
682 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
683 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
684 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
685 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
686 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
687 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
688 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
689 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
690 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
691 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
692 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
693 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
694 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
695 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
696 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
697 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
698 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
699 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
700 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
701 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
702 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
703 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
704 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
705 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
706 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
707 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
708 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
709 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
710 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
711 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
712 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
713 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
714 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
715 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
716 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
717 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
718 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
719 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
720 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.43
Metatranscriptomes 4.13
Isolates 3.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.05
Endosphere 9.26
Nodule 0.35
Rhizoplane 4.83
Rhizosphere 79.33
Stem 0
Stem Tuber 0
Unclassified 6.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1228071 2162886007 Bacteria 838
2 LJNas_1015535 3300000546 Bacteria 811
3 JGI24752J21851_1044283 3300001976 Bacteria 599
4 JGI24747J21853_1009316 3300001978 Bacteria 969
5 JGI24739J22299_10006228 3300001989 Bacteria 4506
6 JGI24750J21931_1030210 3300002070 Bacteria 792
7 JGI24744J21845_10066100 3300002077 Bacteria 660
8 JGI24035J26624_1018097 3300002126 Bacteria 732
9 JGI24033J26618_1051580 3300002155 Bacteria 591
10 JGI24742J22300_10015246 3300002244 Bacteria 1293
11 JGI25158J39367_1016229 3300002739 Bacteria 943
12 JGI25152J39213_1001073 3300002773 Bacteria 12895
13 JGI25150J39212_1003907 3300002774 Bacteria 3415
14 JGI25159J45721_1048433 3300002987 Bacteria 590
15 Ga0006778J45830_1009213 3300003162 Bacteria 15395
16 Ga0006759J45824_1029126 3300003163 Bacteria 2169
17 Ga0006759J45824_1064290 3300003163 Bacteria 1084
18 JGI25153J46596_10007740 3300003215 Bacteria 5229
19 JGI25153J46596_10008637 3300003215 Bacteria 4845
20 Ga0006758J48902_1016024 3300003300 Bacteria 1731
21 Ga0006770J48903_1001899 3300003305 Bacteria 11120
22 Ga0006777J48905_1014855 3300003308 Bacteria 5027
23 Ga0006777J48905_1103387 3300003308 Bacteria 751
24 rootH2_10169529 3300003320 Bacteria 5511
25 rootL2_10001301 3300003322 Bacteria 6102
26 JGI26128J50194_1000191 3300003347 Bacteria 2835
27 JGI26138J51218_106156 3300003504 Bacteria 554
28 Ga0007427J51700_118227 3300003559 Bacteria 1005
29 Ga0007409J51694_1045076 3300003575 Bacteria 738
30 Ga0007409J51694_1147697 3300003575 Bacteria 560
31 Ga0007416J51690_1051124 3300003577 Bacteria 2960
32 Ga0007429J51699_1075853 3300003579 Bacteria 689
33 Ga0032354_1038952 3300003693 Bacteria 2112
34 Ga0032354_1072421 3300003693 Bacteria 2730
35 Ga0032354_1076006 3300003693 Bacteria 606
36 Ga0055539_1013170 3300003752 Bacteria 1014
37 Ga0055526_1000791 3300003771 Bacteria 23567
38 Ga0055530_10019398 3300003791 Bacteria 2061
39 Ga0058862_10046561 3300004803 Bacteria 3584
40 Ga0065165_1001259 3300005262 Bacteria 28658
41 Ga0065714_10138237 3300005288 Bacteria 1192
42 Ga0065704_10187738 3300005289 Bacteria 1204
43 Ga0065712_10080555 3300005290 Bacteria 3093
44 Ga0065712_10107042 3300005290 Bacteria 1904
45 Ga0065712_10788760 3300005290 Bacteria 516
46 Ga0065715_10005249 3300005293 Bacteria 3239
47 Ga0065715_10024824 3300005293 Bacteria 1256
48 Ga0065715_10636148 3300005293 Bacteria 687
49 Ga0065707_10401468 3300005295 Bacteria 852
50 Ga0070658_10152764 3300005327 Bacteria 1933
51 Ga0070658_10160545 3300005327 Bacteria 1885
52 Ga0070658_10646415 3300005327 Bacteria 917
53 Ga0070658_10996892 3300005327 Bacteria 729
54 Ga0070676_10002282 3300005328 Bacteria 9791
55 Ga0070676_10021276 3300005328 Bacteria 3630
56 Ga0070676_10052224 3300005328 Bacteria 2403
57 Ga0070676_10078497 3300005328 Bacteria 1997
58 Ga0070676_10294672 3300005328 Bacteria 1097
59 Ga0070676_10334482 3300005328 Bacteria 1036
60 Ga0070676_10684369 3300005328 Bacteria 747
61 Ga0070676_11223034 3300005328 Bacteria 571
62 Ga0070683_100315172 3300005329 Bacteria 1488
63 Ga0070683_100470633 3300005329 Bacteria 1200
64 Ga0070683_101311876 3300005329 Bacteria 696
65 Ga0070690_100006927 3300005330 Bacteria 6450
66 Ga0070690_100231854 3300005330 Bacteria 1298
67 Ga0070690_101044094 3300005330 Bacteria 646
68 Ga0070690_101437765 3300005330 Bacteria 556
69 Ga0070670_100023628 3300005331 Bacteria 5290
70 Ga0070670_100054237 3300005331 Bacteria 3441
71 Ga0070670_100064589 3300005331 Bacteria 3140
72 Ga0070670_100065507 3300005331 Bacteria 3117
73 Ga0070670_100183537 3300005331 Bacteria 1816
74 Ga0070670_100305986 3300005331 Bacteria 1391
75 Ga0070670_100436330 3300005331 Bacteria 1159
76 Ga0070670_101289446 3300005331 Bacteria 668
77 Ga0070677_10126334 3300005333 Bacteria 1161
78 Ga0070677_10384582 3300005333 Bacteria 736
79 Ga0070677_10614212 3300005333 Bacteria 603
80 Ga0068869_100077114 3300005334 Bacteria 2478
81 Ga0068869_100146255 3300005334 Bacteria 1829
82 Ga0068869_100263074 3300005334 Bacteria 1381
83 Ga0068869_100284560 3300005334 Bacteria 1330
84 Ga0068869_100900370 3300005334 Bacteria 766
85 Ga0070666_10221816 3300005335 Bacteria 1334
86 Ga0070666_10235916 3300005335 Bacteria 1293
87 Ga0070666_10239237 3300005335 Bacteria 1283
88 Ga0070666_10589561 3300005335 Bacteria 811
89 Ga0070680_100032809 3300005336 Bacteria 4180
90 Ga0070682_100031523 3300005337 Bacteria 3206
91 Ga0070682_100057764 3300005337 Bacteria 2445
92 Ga0070682_100093827 3300005337 Bacteria 1968
93 Ga0070682_100149406 3300005337 Bacteria 1601
94 Ga0070682_100351164 3300005337 Bacteria 1099
95 Ga0070682_100881295 3300005337 Bacteria 734
96 Ga0068868_100133352 3300005338 Bacteria 2034
97 Ga0068868_100211639 3300005338 Bacteria 1620
98 Ga0068868_100449603 3300005338 Bacteria 1120
99 Ga0068868_100578715 3300005338 Bacteria 992
100 Ga0068868_100797352 3300005338 Bacteria 852
101 Ga0068868_100874744 3300005338 Bacteria 815
102 Ga0068868_102073964 3300005338 Bacteria 540
103 Ga0068868_102090024 3300005338 Bacteria 538
104 Ga0070660_100467133 3300005339 Bacteria 1048
105 Ga0070660_100475236 3300005339 Bacteria 1038
106 Ga0070660_100572021 3300005339 Bacteria 943
107 Ga0070660_101051513 3300005339 Bacteria 688
108 Ga0070660_101233271 3300005339 Bacteria 634
109 Ga0070689_100015417 3300005340 Bacteria 5572
110 Ga0070689_100546341 3300005340 Bacteria 998
111 Ga0070689_100756953 3300005340 Bacteria 852
112 Ga0070689_100903169 3300005340 Bacteria 782
113 Ga0070691_10071558 3300005341 Bacteria 1684
114 Ga0070687_100132497 3300005343 Bacteria 1441
115 Ga0070687_100201346 3300005343 Bacteria 1206
116 Ga0070661_100092952 3300005344 Bacteria 2235
117 Ga0070661_100105291 3300005344 Bacteria 2102
118 Ga0070661_100476134 3300005344 Bacteria 996
119 Ga0070661_100979681 3300005344 Bacteria 701
120 Ga0070668_100072291 3300005347 Bacteria 2687
121 Ga0070668_100277179 3300005347 Bacteria 1399
122 Ga0070668_100603159 3300005347 Bacteria 961
123 Ga0070668_100707992 3300005347 Bacteria 888
124 Ga0070669_100017536 3300005353 Bacteria 5107
125 Ga0070669_100031250 3300005353 Bacteria 3846
126 Ga0070669_100306076 3300005353 Bacteria 1279
127 Ga0070669_100685263 3300005353 Bacteria 864
128 Ga0070675_100044665 3300005354 Bacteria 3623
129 Ga0070675_100107037 3300005354 Bacteria 2361
130 Ga0070675_100124843 3300005354 Bacteria 2189
131 Ga0070675_100131492 3300005354 Bacteria 2133
132 Ga0070675_100137403 3300005354 Bacteria 2087
133 Ga0070675_100188013 3300005354 Bacteria 1788
134 Ga0070675_100347697 3300005354 Bacteria 1314
135 Ga0070675_100413240 3300005354 Bacteria 1205
136 Ga0070671_100019537 3300005355 Bacteria 5516
137 Ga0070671_100085884 3300005355 Bacteria 2632
138 Ga0070671_100133178 3300005355 Bacteria 2094
139 Ga0070671_100189988 3300005355 Bacteria 1740
140 Ga0070671_100383911 3300005355 Bacteria 1201
141 Ga0070671_100963231 3300005355 Bacteria 747
142 Ga0070674_100039880 3300005356 Bacteria 3174
143 Ga0070674_100056124 3300005356 Bacteria 2730
144 Ga0070674_100096649 3300005356 Bacteria 2144
145 Ga0070674_100310754 3300005356 Bacteria 1260
146 Ga0070674_100364718 3300005356 Bacteria 1171
147 Ga0070674_100399417 3300005356 Bacteria 1123
148 Ga0070674_100667031 3300005356 Bacteria 885
149 Ga0070674_100687011 3300005356 Bacteria 874
150 Ga0070674_100854573 3300005356 Bacteria 789
151 Ga0070674_101003197 3300005356 Bacteria 733
152 Ga0070674_101903081 3300005356 Bacteria 540
153 Ga0070673_100015167 3300005364 Bacteria 5401
154 Ga0070673_100034303 3300005364 Bacteria 3838
155 Ga0070673_100092283 3300005364 Bacteria 2476
156 Ga0070673_100192497 3300005364 Bacteria 1752
157 Ga0070673_100341751 3300005364 Bacteria 1326
158 Ga0070673_100682053 3300005364 Bacteria 942
159 Ga0070688_100100587 3300005365 Bacteria 1905
160 Ga0070688_100304757 3300005365 Bacteria 1152
161 Ga0070688_100375525 3300005365 Bacteria 1047
162 Ga0070659_100250633 3300005366 Bacteria 1467
163 Ga0070659_100378036 3300005366 Bacteria 1193
164 Ga0070659_100428407 3300005366 Bacteria 1120
165 Ga0070659_100865268 3300005366 Bacteria 788
166 Ga0070659_101257943 3300005366 Bacteria 655
167 Ga0070659_101322051 3300005366 Bacteria 639
168 Ga0070659_101646251 3300005366 Bacteria 573
169 Ga0070667_100022362 3300005367 Bacteria 5245
170 Ga0070667_100083378 3300005367 Bacteria 2738
171 Ga0070667_100129962 3300005367 Bacteria 2197
172 Ga0070667_100158747 3300005367 Bacteria 1990
173 Ga0070667_100191574 3300005367 Bacteria 1811
174 Ga0070667_100204785 3300005367 Bacteria 1752
175 Ga0070667_100231002 3300005367 Bacteria 1649
176 Ga0070709_10079106 3300005434 Bacteria 2141
177 Ga0070709_10501440 3300005434 Bacteria 922
178 Ga0070709_11202713 3300005434 Bacteria 609
179 Ga0070714_100019666 3300005435 Bacteria 5505
180 Ga0070713_100092760 3300005436 Bacteria 2601
181 Ga0070710_10297749 3300005437 Bacteria 1052
182 Ga0070701_10012276 3300005438 Bacteria 3858
183 Ga0070701_10134721 3300005438 Bacteria 1407
184 Ga0070701_10711485 3300005438 Bacteria 677
185 Ga0070711_101263279 3300005439 Bacteria 640
186 Ga0070705_101369690 3300005440 Bacteria 589
187 Ga0070700_100111081 3300005441 Bacteria 1822
188 Ga0070700_100185857 3300005441 Bacteria 1449
189 Ga0070700_100203545 3300005441 Bacteria 1392
190 Ga0070700_100366844 3300005441 Bacteria 1072
191 Ga0070700_100575157 3300005441 Bacteria 879
192 Ga0070694_100354195 3300005444 Bacteria 1138
193 Ga0070694_100435416 3300005444 Bacteria 1032
194 Ga0070694_101210701 3300005444 Bacteria 633
195 Ga0070663_100003492 3300005455 Bacteria 9070
196 Ga0070663_100383305 3300005455 Bacteria 1145
197 Ga0070663_100460622 3300005455 Bacteria 1050
198 Ga0070663_101254864 3300005455 Bacteria 653
199 Ga0070663_101578771 3300005455 Bacteria 585
200 Ga0070678_100082508 3300005456 Bacteria 2441
201 Ga0070678_100104114 3300005456 Bacteria 2206
202 Ga0070678_100137945 3300005456 Bacteria 1947
203 Ga0070678_100500637 3300005456 Bacteria 1072
204 Ga0070678_100776147 3300005456 Bacteria 868
205 Ga0070678_100914938 3300005456 Bacteria 802
206 Ga0070662_100051713 3300005457 Bacteria 2968
207 Ga0070662_100193386 3300005457 Bacteria 1610
208 Ga0070662_100613806 3300005457 Bacteria 915
209 Ga0070662_100782507 3300005457 Bacteria 810
210 Ga0070681_10088377 3300005458 Bacteria 3051
211 Ga0068867_100000552 3300005459 Bacteria 24723
212 Ga0068867_100002598 3300005459 Bacteria 12737
213 Ga0068867_100011425 3300005459 Bacteria 6266
214 Ga0068867_100064867 3300005459 Bacteria 2716
215 Ga0068867_100069225 3300005459 Bacteria 2635
216 Ga0068867_100087646 3300005459 Bacteria 2357
217 Ga0068867_100276422 3300005459 Bacteria 1375
218 Ga0068867_100284808 3300005459 Bacteria 1356
219 Ga0068867_100292499 3300005459 Bacteria 1340
220 Ga0068867_100336428 3300005459 Bacteria 1255
221 Ga0068867_100582762 3300005459 Bacteria 973
222 Ga0068867_100695754 3300005459 Bacteria 896
223 Ga0070685_10075272 3300005466 Bacteria 2010
224 Ga0070685_10101298 3300005466 Bacteria 1759
225 Ga0070685_10394830 3300005466 Bacteria 957
226 Ga0070685_10423778 3300005466 Bacteria 927
227 Ga0070685_10454733 3300005466 Bacteria 898
228 Ga0070706_101474223 3300005467 Bacteria 622
229 Ga0070707_100905496 3300005468 Bacteria 847
230 Ga0070699_101072406 3300005518 Bacteria 739
231 Ga0070679_100007565 3300005530 Bacteria 10160
232 Ga0070679_101164604 3300005530 Bacteria 716
233 Ga0070684_100178663 3300005535 Bacteria 1929
234 Ga0070684_100247020 3300005535 Bacteria 1631
235 Ga0070697_100735690 3300005536 Bacteria 871
236 Ga0068853_100320550 3300005539 Bacteria 1437
237 Ga0068853_100330775 3300005539 Bacteria 1414
238 Ga0068853_100868330 3300005539 Bacteria 866
239 Ga0068853_100880616 3300005539 Bacteria 859
240 Ga0068853_100930104 3300005539 Bacteria 836
241 Ga0068853_101141703 3300005539 Bacteria 752
242 Ga0070672_100006187 3300005543 Bacteria 8016
243 Ga0070672_100010859 3300005543 Bacteria 6333
244 Ga0070672_100044598 3300005543 Bacteria 3426
245 Ga0070672_100198587 3300005543 Bacteria 1677
246 Ga0070672_100378493 3300005543 Bacteria 1210
247 Ga0070672_100571956 3300005543 Bacteria 983
248 Ga0070672_100747572 3300005543 Bacteria 858
249 Ga0070672_101096081 3300005543 Bacteria 707
250 Ga0070672_101600140 3300005543 Bacteria 584
251 Ga0070672_101794085 3300005543 Bacteria 551
252 Ga0070686_100304762 3300005544 Bacteria 1182
253 Ga0070686_100621476 3300005544 Bacteria 853
254 Ga0070695_100207075 3300005545 Bacteria 1405
255 Ga0070695_100315217 3300005545 Bacteria 1161
256 Ga0070696_100094917 3300005546 Bacteria 2129
257 Ga0070693_100023342 3300005547 Bacteria 3305
258 Ga0070693_100069686 3300005547 Bacteria 2067
259 Ga0070665_100320840 3300005548 Bacteria 1553
260 Ga0070665_100373744 3300005548 Bacteria 1432
261 Ga0070665_100468764 3300005548 Bacteria 1270
262 Ga0070665_100552322 3300005548 Bacteria 1164
263 Ga0070665_100751082 3300005548 Bacteria 988
264 Ga0070704_100096958 3300005549 Bacteria 2212
265 Ga0070704_102227173 3300005549 Bacteria 510
266 Ga0068855_100040434 3300005563 Bacteria 5534
267 Ga0068855_100058607 3300005563 Bacteria 4509
268 Ga0068855_100288384 3300005563 Bacteria 1820
269 Ga0068855_100490245 3300005563 Bacteria 1337
270 Ga0070664_100155787 3300005564 Bacteria 2018
271 Ga0070664_100238231 3300005564 Bacteria 1633
272 Ga0070664_100273368 3300005564 Bacteria 1522
273 Ga0070664_100284562 3300005564 Bacteria 1491
274 Ga0070664_100380435 3300005564 Bacteria 1288
275 Ga0070664_102024331 3300005564 Bacteria 546
276 Ga0070664_102082275 3300005564 Bacteria 538
277 Ga0068857_100040688 3300005577 Bacteria 4122
278 Ga0068857_100209439 3300005577 Bacteria 1778
279 Ga0068857_100519076 3300005577 Bacteria 1119
280 Ga0068857_100685991 3300005577 Bacteria 972
281 Ga0068857_100767834 3300005577 Bacteria 919
282 Ga0068857_101282743 3300005577 Bacteria 710
283 Ga0068854_100044785 3300005578 Bacteria 3143
284 Ga0068854_100230274 3300005578 Bacteria 1470
285 Ga0068854_102251975 3300005578 Bacteria 504
286 Ga0068856_100183859 3300005614 Bacteria 2104
287 Ga0068856_100244565 3300005614 Bacteria 1809
288 Ga0068856_100345416 3300005614 Bacteria 1507
289 Ga0068856_101672088 3300005614 Bacteria 649
290 Ga0070702_100403402 3300005615 Bacteria 979
291 Ga0070702_100490995 3300005615 Bacteria 899
292 Ga0070702_100832465 3300005615 Bacteria 716
293 Ga0068852_100102229 3300005616 Bacteria 2589
294 Ga0068852_100307390 3300005616 Bacteria 1536
295 Ga0068852_100315873 3300005616 Bacteria 1516
296 Ga0068852_100651676 3300005616 Bacteria 1060
297 Ga0068852_100824589 3300005616 Bacteria 942
298 Ga0068852_100889233 3300005616 Bacteria 907
299 Ga0068852_101084487 3300005616 Bacteria 821
300 Ga0068859_100047020 3300005617 Bacteria 4334
301 Ga0068859_100130187 3300005617 Bacteria 2587
302 Ga0068859_100627269 3300005617 Bacteria 1167
303 Ga0068859_100701377 3300005617 Bacteria 1103
304 Ga0068859_100794112 3300005617 Bacteria 1034
305 Ga0068859_100993513 3300005617 Bacteria 921
306 Ga0068859_101730399 3300005617 Bacteria 691
307 Ga0068864_100043033 3300005618 Bacteria 3866
308 Ga0068864_100144620 3300005618 Bacteria 2148
309 Ga0068864_100277415 3300005618 Bacteria 1563
310 Ga0068864_100353670 3300005618 Bacteria 1387
311 Ga0068864_101060311 3300005618 Bacteria 805
312 Ga0068864_101644636 3300005618 Bacteria 646
313 Ga0068864_102557003 3300005618 Bacteria 516
314 Ga0068866_10091328 3300005718 Bacteria 1659
315 Ga0068866_10091532 3300005718 Bacteria 1657
316 Ga0068866_10957394 3300005718 Bacteria 606
317 Ga0068861_100004770 3300005719 Bacteria 9115
318 Ga0068861_100016735 3300005719 Bacteria 5194
319 Ga0068861_100021676 3300005719 Bacteria 4620
320 Ga0068861_100170807 3300005719 Bacteria 1802
321 Ga0068861_100174810 3300005719 Bacteria 1783
322 Ga0068861_100885579 3300005719 Bacteria 844
323 Ga0068861_102523344 3300005719 Bacteria 517
324 Ga0068851_10332137 3300005834 Bacteria 881
325 Ga0068870_10164633 3300005840 Bacteria 1318
326 Ga0068870_10224043 3300005840 Bacteria 1152
327 Ga0068870_10231402 3300005840 Bacteria 1136
328 Ga0068870_10523936 3300005840 Bacteria 794
329 Ga0068870_10569048 3300005840 Bacteria 765
330 Ga0068870_10983496 3300005840 Bacteria 601
331 Ga0068870_11243514 3300005840 Bacteria 540
332 Ga0068863_100011076 3300005841 Bacteria 8745
333 Ga0068863_100156589 3300005841 Bacteria 2181
334 Ga0068863_100242760 3300005841 Bacteria 1739
335 Ga0068863_100316460 3300005841 Bacteria 1515
336 Ga0068863_100368482 3300005841 Bacteria 1401
337 Ga0068863_100901362 3300005841 Bacteria 884
338 Ga0068863_101044897 3300005841 Bacteria 820
339 Ga0068858_100008125 3300005842 Bacteria 10091
340 Ga0068858_100194536 3300005842 Bacteria 1916
341 Ga0068858_100477508 3300005842 Bacteria 1203
342 Ga0068860_100008442 3300005843 Bacteria 10260
343 Ga0068860_100048811 3300005843 Bacteria 4034
344 Ga0068860_100065679 3300005843 Bacteria 3445
345 Ga0068860_100074726 3300005843 Bacteria 3223
346 Ga0068860_100125358 3300005843 Bacteria 2461
347 Ga0068860_100210653 3300005843 Bacteria 1885
348 Ga0068860_100214297 3300005843 Bacteria 1868
349 Ga0068860_100234051 3300005843 Bacteria 1785
350 Ga0068860_100722091 3300005843 Bacteria 1007
351 Ga0068862_100009442 3300005844 Bacteria 8069
352 Ga0068862_100098243 3300005844 Bacteria 2557
353 Ga0068862_100103723 3300005844 Bacteria 2490
354 Ga0068862_100137286 3300005844 Bacteria 2168
355 Ga0068862_100145559 3300005844 Bacteria 2106
356 Ga0068862_100471684 3300005844 Bacteria 1186
357 Ga0068862_100722741 3300005844 Bacteria 966
358 Ga0068862_101455220 3300005844 Bacteria 689
359 Ga0081455_10008699 3300005937 Bacteria 10513
360 Ga0081455_10199133 3300005937 Bacteria 1501
361 Ga0075365_10100810 3300006038 Bacteria 1977
362 Ga0075365_10318739 3300006038 Bacteria 1095
363 Ga0075365_10467937 3300006038 Bacteria 890
364 Ga0075368_10058905 3300006042 Bacteria 1536
365 Ga0075368_10064460 3300006042 Bacteria 1471
366 Ga0075368_10064476 3300006042 Bacteria 1471
367 Ga0075363_100005889 3300006048 Bacteria 5519
368 Ga0075363_100049841 3300006048 Bacteria 2230
369 Ga0075363_100204317 3300006048 Bacteria 1129
370 Ga0075363_100312622 3300006048 Bacteria 913
371 Ga0075363_100707422 3300006048 Bacteria 609
372 Ga0075363_100816685 3300006048 Bacteria 568
373 Ga0075364_10032491 3300006051 Bacteria 3355
374 Ga0075364_10038599 3300006051 Bacteria 3094
375 Ga0075364_10134805 3300006051 Bacteria 1658
376 Ga0075364_10564781 3300006051 Bacteria 778
377 Ga0075364_10573168 3300006051 Bacteria 771
378 Ga0075432_10133565 3300006058 Bacteria 942
379 Ga0070715_10079026 3300006163 Bacteria 1489
380 Ga0070715_10111151 3300006163 Bacteria 1293
381 Ga0070716_100069303 3300006173 Bacteria 2066
382 Ga0070716_100521023 3300006173 Bacteria 881
383 Ga0075362_10000222 3300006177 Bacteria 15765
384 Ga0075362_10060918 3300006177 Bacteria 1706
385 Ga0075362_10085974 3300006177 Bacteria 1455
386 Ga0075362_10168463 3300006177 Bacteria 1057
387 Ga0075362_10285808 3300006177 Bacteria 816
388 Ga0075362_10374102 3300006177 Bacteria 716
389 Ga0075362_10474507 3300006177 Bacteria 637
390 Ga0075367_10000855 3300006178 Bacteria 12145
391 Ga0075367_10010768 3300006178 Bacteria 4815
392 Ga0075367_10092185 3300006178 Bacteria 1844
393 Ga0075367_10246017 3300006178 Bacteria 1121
394 Ga0075367_10348297 3300006178 Bacteria 935
395 Ga0075367_10707440 3300006178 Bacteria 641
396 Ga0075369_10005325 3300006186 Bacteria 4797
397 Ga0075369_10110152 3300006186 Bacteria 1241
398 Ga0075369_10215809 3300006186 Bacteria 887
399 Ga0075369_10423981 3300006186 Bacteria 628
400 Ga0075366_10033848 3300006195 Bacteria 3011
401 Ga0075366_10050535 3300006195 Bacteria 2469
402 Ga0075366_10058278 3300006195 Bacteria 2294
403 Ga0075366_10077134 3300006195 Bacteria 1989
404 Ga0075366_10081535 3300006195 Bacteria 1932
405 Ga0075366_10096819 3300006195 Bacteria 1770
406 Ga0075366_10138878 3300006195 Bacteria 1468
407 Ga0075366_10153936 3300006195 Bacteria 1392
408 Ga0075366_10166789 3300006195 Bacteria 1335
409 Ga0075366_10263345 3300006195 Bacteria 1052
410 Ga0075366_10321927 3300006195 Bacteria 947
411 Ga0075366_10328391 3300006195 Bacteria 937
412 Ga0075366_10469892 3300006195 Bacteria 777
413 Ga0075366_10507801 3300006195 Bacteria 745
414 Ga0075366_10965137 3300006195 Bacteria 531
415 Ga0097621_100115517 3300006237 Bacteria 2272
416 Ga0097621_100139427 3300006237 Bacteria 2071
417 Ga0097621_100480099 3300006237 Bacteria 1123
418 Ga0097621_100512914 3300006237 Bacteria 1087
419 Ga0097621_100662626 3300006237 Bacteria 958
420 Ga0097621_100944722 3300006237 Bacteria 805
421 Ga0075370_10001150 3300006353 Bacteria 11110
422 Ga0075370_10023630 3300006353 Bacteria 3387
423 Ga0075370_10064344 3300006353 Bacteria 2091
424 Ga0068871_100126623 3300006358 Bacteria 2162
425 Ga0068871_100221491 3300006358 Bacteria 1639
426 Ga0068871_100408440 3300006358 Bacteria 1210
427 Ga0068871_100453812 3300006358 Bacteria 1149
428 Ga0068871_100540442 3300006358 Bacteria 1054
429 Ga0068871_100982475 3300006358 Bacteria 785
430 Ga0075428_100000808 3300006844 Bacteria 32725
431 Ga0075430_100218759 3300006846 Bacteria 1580
432 Ga0075430_100233239 3300006846 Bacteria 1526
433 Ga0075430_100302039 3300006846 Bacteria 1324
434 Ga0075434_100381290 3300006871 Bacteria 1431
435 Ga0075434_100441455 3300006871 Bacteria 1323
436 Ga0075434_100855539 3300006871 Bacteria 925
437 Ga0075429_100034628 3300006880 Bacteria 4388
438 Ga0075429_100043701 3300006880 Bacteria 3899
439 Ga0075429_100123917 3300006880 Bacteria 2259
440 Ga0068865_100004060 3300006881 Bacteria 8794
441 Ga0068865_100647903 3300006881 Bacteria 897
442 Ga0068865_100882343 3300006881 Bacteria 777
443 Ga0068865_101254167 3300006881 Bacteria 658
444 Ga0075436_100000862 3300006914 Bacteria 20155
445 Ga0097620_100047018 3300006931 Bacteria 4334
446 Ga0097620_100130185 3300006931 Bacteria 2587
447 Ga0097620_100627282 3300006931 Bacteria 1167
448 Ga0097620_100701492 3300006931 Bacteria 1103
449 Ga0097620_100794090 3300006931 Bacteria 1034
450 Ga0097620_100993489 3300006931 Bacteria 921
451 Ga0097620_101730416 3300006931 Bacteria 691
452 Ga0099826_10000024 3300006948 Bacteria 148974
453 Ga0075435_100054923 3300007076 Bacteria 3215
454 Ga0105251_10023641 3300009011 Bacteria 3167
455 Ga0105244_10533668 3300009036 Bacteria 541
456 Ga0105240_10230108 3300009093 Bacteria 2155
457 Ga0105240_10627271 3300009093 Bacteria 1181
458 Ga0105240_11610931 3300009093 Bacteria 679
459 Ga0111539_10002099 3300009094 Bacteria 26631
460 Ga0111539_10529840 3300009094 Bacteria 1372
461 Ga0111539_11140813 3300009094 Bacteria 906
462 Ga0111539_11150091 3300009094 Bacteria 902
463 Ga0111539_11374449 3300009094 Bacteria 819
464 Ga0111539_11423128 3300009094 Bacteria 804
465 Ga0111539_11738195 3300009094 Bacteria 723
466 Ga0111539_12219808 3300009094 Bacteria 637
467 Ga0105245_10300472 3300009098 Bacteria 1575
468 Ga0105245_10397024 3300009098 Bacteria 1377
469 Ga0105245_10973459 3300009098 Bacteria 892
470 Ga0105245_12137730 3300009098 Bacteria 613
471 Ga0105247_10117961 3300009101 Bacteria 1716
472 Ga0105247_10250972 3300009101 Bacteria 1209
473 Ga0114129_10778086 3300009147 Bacteria 1223
474 Ga0114129_10804073 3300009147 Bacteria 1199
475 Ga0105243_10001789 3300009148 Bacteria 18454
476 Ga0105243_10177569 3300009148 Bacteria 1849
477 Ga0105243_10194189 3300009148 Bacteria 1775
478 Ga0105243_10230579 3300009148 Bacteria 1643
479 Ga0105243_10387979 3300009148 Bacteria 1294
480 Ga0105243_10913307 3300009148 Bacteria 874
481 Ga0105243_11520960 3300009148 Bacteria 693
482 Ga0105243_11762942 3300009148 Bacteria 649
483 Ga0105241_10082907 3300009174 Bacteria 2514
484 Ga0105242_10059064 3300009176 Bacteria 3146
485 Ga0105242_10090242 3300009176 Bacteria 2577
486 Ga0105242_12014288 3300009176 Bacteria 620
487 Ga0105248_10028458 3300009177 Bacteria 6225
488 Ga0105248_10047589 3300009177 Bacteria 4810
489 Ga0105248_10208334 3300009177 Bacteria 2203
490 Ga0105248_10511830 3300009177 Bacteria 1353
491 Ga0105248_10531205 3300009177 Bacteria 1327
492 Ga0105248_10542893 3300009177 Bacteria 1311
493 Ga0105248_11419336 3300009177 Bacteria 786
494 Ga0105248_12022369 3300009177 Bacteria 655
495 Ga0105237_10020609 3300009545 Bacteria 6794
496 Ga0105237_10393453 3300009545 Bacteria 1391
497 Ga0105237_12755999 3300009545 Bacteria 503
498 Ga0105238_10064333 3300009551 Bacteria 3668
499 Ga0105238_10951806 3300009551 Bacteria 878
500 Ga0105238_11583629 3300009551 Bacteria 685
501 Ga0105249_10309743 3300009553 Bacteria 1587
502 Ga0105249_10484018 3300009553 Bacteria 1281
503 Ga0105249_10993164 3300009553 Bacteria 908
504 Ga0105239_10444502 3300010375 Bacteria 1470
505 Ga0105239_10557327 3300010375 Unclassified 1305
506 Ga0105239_11816629 3300010375 Bacteria 706
507 Ga0105246_10452402 3300011119 Bacteria 1079
508 Ga0105246_10873656 3300011119 Bacteria 804
509 Ga0105246_10919730 3300011119 Bacteria 786
510 Ga0105246_10963508 3300011119 Bacteria 770
511 Ga0157317_1014804 3300012475 Bacteria 642
512 Ga0157328_1000557 3300012478 Bacteria 1382
513 Ga0157318_1012036 3300012482 Bacteria 662
514 Ga0157341_1001034 3300012494 Bacteria 1580
515 Ga0157345_1013061 3300012498 Bacteria 759
516 Ga0157314_1004276 3300012500 Bacteria 1045
517 Ga0157313_1006133 3300012503 Bacteria 893
518 Ga0157342_1044135 3300012507 Bacteria 606
519 Ga0157315_1018239 3300012508 Bacteria 714
520 Ga0157327_1001789 3300012512 Bacteria 1398
521 Ga0157373_10040286 3300013100 Bacteria 3343
522 Ga0157373_10230096 3300013100 Bacteria 1309
523 Ga0157371_10020143 3300013102 Bacteria 4909
524 Ga0157370_10299273 3300013104 Bacteria 1485
525 Ga0157370_11085771 3300013104 Bacteria 723
526 Ga0157369_10115967 3300013105 Bacteria 2844
527 Ga0157369_10254222 3300013105 Bacteria 1833
528 Ga0157369_11576446 3300013105 Bacteria 668
529 Ga0157374_10009298 3300013296 Bacteria 8429
530 Ga0157374_10039033 3300013296 Bacteria 4368
531 Ga0157374_10093529 3300013296 Bacteria 2871
532 Ga0157374_10183964 3300013296 Bacteria 2042
533 Ga0157374_10261841 3300013296 Bacteria 1703
534 Ga0157374_10684056 3300013296 Bacteria 1038
535 Ga0157378_10008661 3300013297 Bacteria 8856
536 Ga0157378_10248653 3300013297 Bacteria 1701
537 Ga0157378_10328899 3300013297 Bacteria 1487
538 Ga0157378_10415154 3300013297 Bacteria 1329
539 Ga0157378_10458589 3300013297 Bacteria 1266
540 Ga0157378_10477084 3300013297 Bacteria 1242
541 Ga0157378_10478068 3300013297 Bacteria 1241
542 Ga0157378_12237547 3300013297 Bacteria 598
543 Ga0163162_10004148 3300013306 Bacteria 13915
544 Ga0163162_10033165 3300013306 Bacteria 5130
545 Ga0163162_10211873 3300013306 Bacteria 2067
546 Ga0163162_10241802 3300013306 Bacteria 1936
547 Ga0163162_10424477 3300013306 Bacteria 1462
548 Ga0163162_10491825 3300013306 Bacteria 1358
549 Ga0163162_10646134 3300013306 Bacteria 1182
550 Ga0163162_11021846 3300013306 Bacteria 935
551 Ga0157372_10023087 3300013307 Bacteria 6740
552 Ga0157372_10549579 3300013307 Bacteria 1346
553 Ga0157372_11041560 3300013307 Bacteria 947
554 Ga0157375_10026295 3300013308 Bacteria 5420
555 Ga0157375_10041626 3300013308 Bacteria 4438
556 Ga0157375_10054039 3300013308 Bacteria 3954
557 Ga0157375_10151438 3300013308 Bacteria 2455
558 Ga0157375_10225576 3300013308 Bacteria 2033
559 Ga0157375_10239233 3300013308 Bacteria 1975
560 Ga0157375_10240286 3300013308 Bacteria 1971
561 Ga0157375_10250739 3300013308 Bacteria 1931
562 Ga0157375_10493225 3300013308 Bacteria 1389
563 Ga0157375_10545902 3300013308 Bacteria 1321
564 Ga0157375_11614891 3300013308 Bacteria 767
565 Ga0163163_10098438 3300014325 Bacteria 2946
566 Ga0163163_10176222 3300014325 Bacteria 2185
567 Ga0163163_10404151 3300014325 Bacteria 1424
568 Ga0163163_10652447 3300014325 Bacteria 1116
569 Ga0163163_10733157 3300014325 Bacteria 1052
570 Ga0163163_10975385 3300014325 Bacteria 911
571 Ga0157380_10205210 3300014326 Bacteria 1752
572 Ga0157380_10220567 3300014326 Bacteria 1696
573 Ga0157380_10534216 3300014326 Bacteria 1147
574 Ga0157380_11328546 3300014326 Bacteria 767
575 Ga0182008_10034449 3300014497 Bacteria 2538
576 Ga0182008_10334392 3300014497 Bacteria 800
577 Ga0157377_10000368 3300014745 Bacteria 20109
578 Ga0157377_10396808 3300014745 Bacteria 938
579 Ga0157379_10037733 3300014968 Bacteria 4309
580 Ga0157379_10040412 3300014968 Bacteria 4162
581 Ga0157379_10061342 3300014968 Bacteria 3362
582 Ga0157379_10090060 3300014968 Bacteria 2752
583 Ga0157379_10251368 3300014968 Bacteria 1605
584 Ga0157379_10728786 3300014968 Bacteria 932
585 Ga0157379_10958172 3300014968 Bacteria 814
586 Ga0157379_11369269 3300014968 Bacteria 685
587 Ga0157379_12031019 3300014968 Bacteria 569
588 Ga0157376_10085443 3300014969 Bacteria 2719
589 Ga0157376_10957460 3300014969 Bacteria 877
590 Ga0157376_10983337 3300014969 Bacteria 866
591 Ga0157376_11269830 3300014969 Bacteria 766
592 Ga0157376_13087901 3300014969 Bacteria 504
593 Ga0182007_10061846 3300015262 Bacteria 1228
594 Ga0163161_10009049 3300017792 Bacteria 6888
595 Ga0163161_10021239 3300017792 Bacteria 4564
596 Ga0163161_10042621 3300017792 Bacteria 3265
597 Ga0163161_10057420 3300017792 Bacteria 2828
598 Ga0163161_10378130 3300017792 Bacteria 1131
599 Ga0163161_11431780 3300017792 Bacteria 604
600 Ga0206353_11953414 3300020082 Bacteria 794
601 Ga0213872_10000672 3300021361 Bacteria 25868
602 Ga0213874_10021138 3300021377 Bacteria 1791
603 Ga0213874_10078842 3300021377 Bacteria 1064
604 Ga0207425_1000680 3300025245 Bacteria 18554
605 Ga0209129_1000158 3300025258 Bacteria 103711
606 Ga0209673_1004093 3300025273 Bacteria 8026
607 Ga0209673_1032334 3300025273 Bacteria 1613
608 Ga0207673_1016945 3300025290 Bacteria 971
609 Ga0209564_1000282 3300025295 Bacteria 103837
610 Ga0209758_1000910 3300025297 Bacteria 40059
611 Ga0209758_1011080 3300025297 Bacteria 5275
612 Ga0209050_1000223 3300025298 Bacteria 125465
613 Ga0209256_1009680 3300025299 Bacteria 4174
614 Ga0209051_1018074 3300025303 Bacteria 3132
615 Ga0207697_10011122 3300025315 Bacteria 3814
616 Ga0207697_10027047 3300025315 Bacteria 2346
617 Ga0207697_10029574 3300025315 Bacteria 2242
618 Ga0207656_10100216 3300025321 Bacteria 1327
619 Ga0207656_10182284 3300025321 Bacteria 1008
620 Ga0207713_1023386 3300025735 Bacteria 2909
621 Ga0207653_10294067 3300025885 Bacteria 629
622 Ga0207682_10002147 3300025893 Bacteria 8941
623 Ga0207682_10021887 3300025893 Bacteria 2516
624 Ga0207682_10077687 3300025893 Bacteria 1417
625 Ga0207682_10277013 3300025893 Bacteria 784
626 Ga0207682_10432489 3300025893 Bacteria 623
627 Ga0207692_10217960 3300025898 Bacteria 1130
628 Ga0207642_10092854 3300025899 Bacteria 1495
629 Ga0207642_10108364 3300025899 Bacteria 1409
630 Ga0207642_10492183 3300025899 Bacteria 749
631 Ga0207642_11028319 3300025899 Bacteria 531
632 Ga0207710_10306473 3300025900 Bacteria 803
633 Ga0207688_10037622 3300025901 Bacteria 2684
634 Ga0207688_10063302 3300025901 Bacteria 2086
635 Ga0207688_10077775 3300025901 Bacteria 1891
636 Ga0207688_10144333 3300025901 Bacteria 1402
637 Ga0207688_10231679 3300025901 Bacteria 1115
638 Ga0207680_10187572 3300025903 Bacteria 1402
639 Ga0207680_10257091 3300025903 Bacteria 1208
640 Ga0207680_10353603 3300025903 Bacteria 1032
641 Ga0207680_10645731 3300025903 Bacteria 758
642 Ga0207680_10957317 3300025903 Bacteria 613
643 Ga0207685_10158287 3300025905 Bacteria 1032
644 Ga0207685_10675810 3300025905 Bacteria 560
645 Ga0207645_10009972 3300025907 Bacteria 6544
646 Ga0207645_10012543 3300025907 Bacteria 5748
647 Ga0207645_10027678 3300025907 Bacteria 3659
648 Ga0207645_10047232 3300025907 Bacteria 2749
649 Ga0207645_10048474 3300025907 Bacteria 2713
650 Ga0207645_10086402 3300025907 Bacteria 2015
651 Ga0207645_10139657 3300025907 Bacteria 1578
652 Ga0207645_10301667 3300025907 Bacteria 1067
653 Ga0207645_10880985 3300025907 Bacteria 608
654 Ga0207643_10070432 3300025908 Bacteria 2011
655 Ga0207643_10697330 3300025908 Bacteria 656
656 Ga0207643_10876353 3300025908 Bacteria 582
657 Ga0207643_11141960 3300025908 Bacteria 502
658 Ga0207705_10812019 3300025909 Bacteria 726
659 Ga0207705_11234190 3300025909 Bacteria 573
660 Ga0207705_11441062 3300025909 Bacteria 523
661 Ga0207684_10500490 3300025910 Bacteria 1041
662 Ga0207684_10803308 3300025910 Bacteria 795
663 Ga0207654_10442697 3300025911 Bacteria 910
664 Ga0207671_10730804 3300025914 Bacteria 787
665 Ga0207693_10536869 3300025915 Bacteria 912
666 Ga0207663_10369763 3300025916 Bacteria 1090
667 Ga0207660_10046145 3300025917 Bacteria 3073
668 Ga0207662_10034330 3300025918 Bacteria 2960
669 Ga0207662_10036401 3300025918 Bacteria 2876
670 Ga0207662_10097784 3300025918 Bacteria 1815
671 Ga0207662_10201054 3300025918 Bacteria 1290
672 Ga0207657_10092779 3300025919 Bacteria 2516
673 Ga0207657_10109580 3300025919 Bacteria 2282
674 Ga0207657_10218405 3300025919 Bacteria 1528
675 Ga0207649_10004699 3300025920 Bacteria 7389
676 Ga0207649_10183146 3300025920 Bacteria 1467
677 Ga0207652_10002940 3300025921 Bacteria 14249
678 Ga0207652_11225289 3300025921 Bacteria 652
679 Ga0207681_10005925 3300025923 Bacteria 7494
680 Ga0207681_10021332 3300025923 Bacteria 4116
681 Ga0207681_10041280 3300025923 Bacteria 3075
682 Ga0207681_10071603 3300025923 Bacteria 2418
683 Ga0207681_10111387 3300025923 Bacteria 1991
684 Ga0207681_10901391 3300025923 Bacteria 740
685 Ga0207694_10034844 3300025924 Bacteria 3861
686 Ga0207694_10452972 3300025924 Bacteria 1071
687 Ga0207694_10505280 3300025924 Bacteria 1012
688 Ga0207694_10688670 3300025924 Bacteria 862
689 Ga0207650_10002454 3300025925 Bacteria 12900
690 Ga0207650_10022053 3300025925 Bacteria 4507
691 Ga0207650_10054455 3300025925 Bacteria 2967
692 Ga0207650_10387104 3300025925 Bacteria 1155
693 Ga0207650_10640715 3300025925 Bacteria 895
694 Ga0207650_10727506 3300025925 Bacteria 839
695 Ga0207659_10003025 3300025926 Bacteria 10030
696 Ga0207659_10052760 3300025926 Bacteria 2898
697 Ga0207659_10056531 3300025926 Bacteria 2811
698 Ga0207659_10061691 3300025926 Bacteria 2703
699 Ga0207659_10142255 3300025926 Bacteria 1863
700 Ga0207659_11013374 3300025926 Bacteria 714
701 Ga0207687_10108511 3300025927 Bacteria 2055
702 Ga0207687_10753634 3300025927 Bacteria 829
703 Ga0207644_10027492 3300025931 Bacteria 3929
704 Ga0207644_10118657 3300025931 Bacteria 2010
705 Ga0207644_10151897 3300025931 Bacteria 1792
706 Ga0207644_10184530 3300025931 Bacteria 1637
707 Ga0207644_10256867 3300025931 Bacteria 1396
708 Ga0207644_10258810 3300025931 Bacteria 1391
709 Ga0207644_10388082 3300025931 Bacteria 1140
710 Ga0207644_10639011 3300025931 Bacteria 885
711 Ga0207644_11256548 3300025931 Bacteria 622
712 Ga0207690_10056794 3300025932 Bacteria 2642
713 Ga0207690_10791310 3300025932 Bacteria 783
714 Ga0207690_11306269 3300025932 Bacteria 606
715 Ga0207706_10035361 3300025933 Bacteria 4443
716 Ga0207706_10079225 3300025933 Bacteria 2889
717 Ga0207706_10375437 3300025933 Bacteria 1234
718 Ga0207706_10595316 3300025933 Bacteria 950
719 Ga0207706_10597721 3300025933 Bacteria 948
720 Ga0207706_11166811 3300025933 Bacteria 641
721 Ga0207686_10048318 3300025934 Bacteria 2635
722 Ga0207686_10050824 3300025934 Bacteria 2580
723 Ga0207686_10072816 3300025934 Bacteria 2215
724 Ga0207686_10255208 3300025934 Bacteria 1283
725 Ga0207709_10001005 3300025935 Bacteria 20902
726 Ga0207709_10020689 3300025935 Bacteria 3715
727 Ga0207709_10146045 3300025935 Bacteria 1632
728 Ga0207709_10431056 3300025935 Bacteria 1015
729 Ga0207670_10450600 3300025936 Bacteria 1037
730 Ga0207670_11438900 3300025936 Bacteria 585
731 Ga0207670_11564474 3300025936 Bacteria 561
732 Ga0207669_10027395 3300025937 Bacteria 3119
733 Ga0207669_10068174 3300025937 Bacteria 2220
734 Ga0207669_10093241 3300025937 Bacteria 1967
735 Ga0207669_10124757 3300025937 Bacteria 1756
736 Ga0207669_10367135 3300025937 Bacteria 1117
737 Ga0207669_10527251 3300025937 Bacteria 949
738 Ga0207669_10835859 3300025937 Bacteria 765
739 Ga0207669_11153017 3300025937 Bacteria 655
740 Ga0207669_11346721 3300025937 Bacteria 607
741 Ga0207704_10474258 3300025938 Bacteria 1003
742 Ga0207704_10660232 3300025938 Bacteria 862
743 Ga0207704_11151269 3300025938 Bacteria 660
744 Ga0207665_10131977 3300025939 Bacteria 1774
745 Ga0207665_10452521 3300025939 Bacteria 985
746 Ga0207691_10002550 3300025940 Bacteria 17799
747 Ga0207691_10071477 3300025940 Bacteria 3131
748 Ga0207691_10104939 3300025940 Bacteria 2518
749 Ga0207691_10126451 3300025940 Bacteria 2261
750 Ga0207691_10214431 3300025940 Bacteria 1671
751 Ga0207691_10216133 3300025940 Bacteria 1663
752 Ga0207691_10242604 3300025940 Bacteria 1557
753 Ga0207691_10821521 3300025940 Bacteria 780
754 Ga0207691_11185143 3300025940 Bacteria 634
755 Ga0207711_10023140 3300025941 Bacteria 5200
756 Ga0207711_10072285 3300025941 Bacteria 2996
757 Ga0207711_10471526 3300025941 Bacteria 1169
758 Ga0207711_10950482 3300025941 Bacteria 798
759 Ga0207711_11309585 3300025941 Bacteria 667
760 Ga0207689_10033146 3300025942 Bacteria 4292
761 Ga0207689_10038004 3300025942 Bacteria 3989
762 Ga0207689_10117050 3300025942 Bacteria 2191
763 Ga0207689_10127570 3300025942 Bacteria 2092
764 Ga0207689_10232116 3300025942 Bacteria 1525
765 Ga0207689_10684752 3300025942 Bacteria 864
766 Ga0207689_10711450 3300025942 Bacteria 847
767 Ga0207689_10764762 3300025942 Bacteria 815
768 Ga0207689_10776336 3300025942 Bacteria 809
769 Ga0207689_11600848 3300025942 Bacteria 542
770 Ga0207661_10026944 3300025944 Bacteria 4386
771 Ga0207679_10016048 3300025945 Bacteria 4965
772 Ga0207679_10127063 3300025945 Bacteria 2039
773 Ga0207679_10449730 3300025945 Bacteria 1142
774 Ga0207679_10953006 3300025945 Bacteria 786
775 Ga0207679_11307681 3300025945 Bacteria 665
776 Ga0207667_10188077 3300025949 Bacteria 2119
777 Ga0207667_10246512 3300025949 Bacteria 1828
778 Ga0207651_10004839 3300025960 Bacteria 6859
779 Ga0207651_10043195 3300025960 Bacteria 3006
780 Ga0207651_10049602 3300025960 Bacteria 2845
781 Ga0207651_10063480 3300025960 Bacteria 2579
782 Ga0207651_10092035 3300025960 Bacteria 2222
783 Ga0207651_10247449 3300025960 Bacteria 1457
784 Ga0207651_10274919 3300025960 Bacteria 1389
785 Ga0207651_10307666 3300025960 Bacteria 1320
786 Ga0207651_10352293 3300025960 Bacteria 1240
787 Ga0207712_10040645 3300025961 Bacteria 3193
788 Ga0207712_10063392 3300025961 Bacteria 2632
789 Ga0207712_10258983 3300025961 Bacteria 1410
790 Ga0207712_10976782 3300025961 Bacteria 751
791 Ga0207668_10008000 3300025972 Bacteria 6291
792 Ga0207668_10053760 3300025972 Bacteria 2792
793 Ga0207668_10264120 3300025972 Bacteria 1404
794 Ga0207668_10332527 3300025972 Bacteria 1264
795 Ga0207668_10498202 3300025972 Bacteria 1047
796 Ga0207640_10014813 3300025981 Bacteria 4497
797 Ga0207640_10146361 3300025981 Bacteria 1729
798 Ga0207640_10361518 3300025981 Bacteria 1170
799 Ga0207640_10739392 3300025981 Bacteria 847
800 Ga0207640_11342870 3300025981 Bacteria 639
801 Ga0207640_11422139 3300025981 Bacteria 622
802 Ga0207658_10002481 3300025986 Bacteria 13444
803 Ga0207658_10019932 3300025986 Bacteria 4641
804 Ga0207658_10059878 3300025986 Bacteria 2839
805 Ga0207658_10174279 3300025986 Bacteria 1775
806 Ga0207658_10204295 3300025986 Bacteria 1651
807 Ga0207658_10253878 3300025986 Bacteria 1495
808 Ga0207658_10823380 3300025986 Bacteria 843
809 Ga0207658_11440281 3300025986 Bacteria 630
810 Ga0207677_10222318 3300026023 Bacteria 1515
811 Ga0207677_10493235 3300026023 Bacteria 1057
812 Ga0207677_10597666 3300026023 Bacteria 968
813 Ga0207677_10762614 3300026023 Bacteria 863
814 Ga0207677_11440248 3300026023 Bacteria 635
815 Ga0207677_11845572 3300026023 Bacteria 561
816 Ga0207703_10002613 3300026035 Bacteria 15539
817 Ga0207703_10027342 3300026035 Bacteria 4492
818 Ga0207703_10139551 3300026035 Bacteria 2102
819 Ga0207703_10590706 3300026035 Bacteria 1050
820 Ga0207703_11346177 3300026035 Bacteria 687
821 Ga0207639_10460001 3300026041 Bacteria 1157
822 Ga0207639_10601595 3300026041 Bacteria 1014
823 Ga0207678_10008286 3300026067 Bacteria 9159
824 Ga0207678_10090610 3300026067 Bacteria 2613
825 Ga0207678_10099481 3300026067 Bacteria 2484
826 Ga0207678_10230487 3300026067 Bacteria 1586
827 Ga0207678_10696626 3300026067 Bacteria 894
828 Ga0207678_10876259 3300026067 Bacteria 793
829 Ga0207678_11995843 3300026067 Bacteria 505
830 Ga0207708_10036414 3300026075 Bacteria 3746
831 Ga0207708_10154972 3300026075 Bacteria 1806
832 Ga0207708_10168085 3300026075 Bacteria 1735
833 Ga0207708_10175723 3300026075 Bacteria 1698
834 Ga0207702_10004993 3300026078 Bacteria 11656
835 Ga0207702_10150760 3300026078 Bacteria 2115
836 Ga0207702_10429607 3300026078 Bacteria 1278
837 Ga0207702_11220565 3300026078 Bacteria 746
838 Ga0207641_10007438 3300026088 Bacteria 9110
839 Ga0207641_10028453 3300026088 Bacteria 4618
840 Ga0207641_10106203 3300026088 Bacteria 2481
841 Ga0207641_10164506 3300026088 Bacteria 2019
842 Ga0207641_10524581 3300026088 Bacteria 1152
843 Ga0207641_10751729 3300026088 Bacteria 962
844 Ga0207641_10850293 3300026088 Bacteria 904
845 Ga0207641_10953814 3300026088 Bacteria 853
846 Ga0207641_11293854 3300026088 Bacteria 729
847 Ga0207648_10002176 3300026089 Bacteria 21281
848 Ga0207648_10005939 3300026089 Bacteria 12211
849 Ga0207648_10015751 3300026089 Bacteria 6936
850 Ga0207648_10084574 3300026089 Bacteria 2767
851 Ga0207648_10087281 3300026089 Bacteria 2722
852 Ga0207648_10097294 3300026089 Bacteria 2576
853 Ga0207648_10159685 3300026089 Bacteria 1991
854 Ga0207648_10200666 3300026089 Bacteria 1769
855 Ga0207648_10379894 3300026089 Bacteria 1277
856 Ga0207648_10533699 3300026089 Bacteria 1076
857 Ga0207648_10766947 3300026089 Bacteria 896
858 Ga0207676_10005874 3300026095 Bacteria 8668
859 Ga0207676_10038749 3300026095 Bacteria 3640
860 Ga0207676_10083692 3300026095 Bacteria 2599
861 Ga0207676_10095279 3300026095 Bacteria 2454
862 Ga0207676_10467768 3300026095 Bacteria 1192
863 Ga0207676_10680064 3300026095 Bacteria 995
864 Ga0207676_11418800 3300026095 Bacteria 690
865 Ga0207674_10158756 3300026116 Bacteria 2216
866 Ga0207674_10171993 3300026116 Bacteria 2119
867 Ga0207674_10522615 3300026116 Bacteria 1146
868 Ga0207675_100006663 3300026118 Bacteria 10927
869 Ga0207675_100166548 3300026118 Bacteria 2105
870 Ga0207675_100255531 3300026118 Bacteria 1697
871 Ga0207675_100263048 3300026118 Bacteria 1672
872 Ga0207675_100264070 3300026118 Bacteria 1669
873 Ga0207675_100314320 3300026118 Bacteria 1528
874 Ga0207675_100373676 3300026118 Bacteria 1401
875 Ga0207675_100375270 3300026118 Bacteria 1398
876 Ga0207675_100537098 3300026118 Bacteria 1167
877 Ga0207675_100632434 3300026118 Bacteria 1075
878 Ga0207675_101729437 3300026118 Bacteria 645
879 Ga0207683_10005923 3300026121 Bacteria 10474
880 Ga0207683_10141534 3300026121 Bacteria 2168
881 Ga0207683_10166036 3300026121 Bacteria 1997
882 Ga0207683_10228474 3300026121 Bacteria 1697
883 Ga0207683_10276638 3300026121 Bacteria 1534
884 Ga0207683_10664863 3300026121 Bacteria 965
885 Ga0207698_10137421 3300026142 Bacteria 2099
886 Ga0207698_10171946 3300026142 Bacteria 1909
887 Ga0207698_10790579 3300026142 Bacteria 950
888 Ga0207698_11099288 3300026142 Bacteria 808
889 Ga0207698_11280264 3300026142 Bacteria 748
890 Ga0209967_1053814 3300027364 Bacteria 620
891 Ga0209982_1051954 3300027552 Bacteria 661
892 Ga0209970_1026685 3300027614 Bacteria 993
893 Ga0209282_1000032 3300027666 Bacteria 149218
894 Ga0209813_10158999 3300027866 Bacteria 814
895 Ga0209974_10000149 3300027876 Bacteria 21195
896 Ga0207428_10002412 3300027907 Bacteria 18661
897 Ga0207428_10148534 3300027907 Bacteria 1785
898 Ga0207428_10525240 3300027907 Bacteria 858
899 Ga0207428_11140572 3300027907 Bacteria 544
900 Ga0207428_11245660 3300027907 Bacteria 517
901 Ga0268266_10013518 3300028379 Bacteria 7028
902 Ga0268266_10165713 3300028379 Bacteria 2002
903 Ga0268266_10248383 3300028379 Bacteria 1645
904 Ga0268266_10427489 3300028379 Bacteria 1256
905 Ga0268266_11187049 3300028379 Bacteria 738
906 Ga0268266_11880327 3300028379 Bacteria 573
907 Ga0268265_10048765 3300028380 Bacteria 3181
908 Ga0268265_10076755 3300028380 Bacteria 2622
909 Ga0268265_10144177 3300028380 Bacteria 1998
910 Ga0268265_10186906 3300028380 Bacteria 1785
911 Ga0268265_10241678 3300028380 Bacteria 1594
912 Ga0268265_10832986 3300028380 Bacteria 901
913 Ga0268265_11552378 3300028380 Bacteria 666
914 Ga0268264_10002070 3300028381 Bacteria 17906
915 Ga0268264_10002318 3300028381 Bacteria 16843
916 Ga0268264_10053634 3300028381 Bacteria 3364
917 Ga0268264_10085143 3300028381 Bacteria 2713
918 Ga0268264_10510540 3300028381 Bacteria 1174
919 Ga0268264_10944666 3300028381 Bacteria 867
920 Ga0268264_11441364 3300028381 Bacteria 699
921 Ga0268264_11726741 3300028381 Bacteria 636
922 Ga0265334_10000005 3300028573 Bacteria 242590
923 Ga0265336_10000618 3300028666 Bacteria 19547
924 Ga0307517_10014561 3300028786 Bacteria 10553
925 Ga0307517_10110559 3300028786 Bacteria 2094
926 Ga0307515_10002443 3300028794 Bacteria 40478
927 Ga0307515_10053115 3300028794 Bacteria 5987
928 Ga0307515_10186828 3300028794 Bacteria 1998
929 Ga0307515_10541499 3300028794 Bacteria 774
930 Ga0307515_10675781 3300028794 Bacteria 647
931 Ga0265338_10116506 3300028800 Bacteria 2140
932 Ga0265324_10000002 3300029957 Bacteria 382754
933 Ga0265324_10000500 3300029957 Bacteria 27131
934 Ga0265324_10050377 3300029957 Bacteria 1431
935 Ga0307511_10232578 3300030521 Bacteria 910
936 Ga0307512_10045873 3300030522 Bacteria 3571
937 Ga0307512_10091067 3300030522 Bacteria 2123
938 Ga0307512_10098413 3300030522 Bacteria 1996
939 Ga0265330_10024527 3300031235 Bacteria 2735
940 Ga0265332_10000030 3300031238 Bacteria 175141
941 Ga0265332_10001783 3300031238 Bacteria 11615
942 Ga0265328_10000007 3300031239 Bacteria 224310
943 Ga0265328_10020219 3300031239 Bacteria 2551
944 Ga0265325_10001662 3300031241 Bacteria 15453
945 Ga0265325_10008599 3300031241 Bacteria 6014
946 Ga0265325_10057810 3300031241 Bacteria 1977
947 Ga0265331_10000635 3300031250 Bacteria 30467
948 Ga0265331_10070855 3300031250 Bacteria 1631
949 Ga0265331_10140817 3300031250 Bacteria 1097
950 Ga0265327_10031432 3300031251 Bacteria 2983
951 Ga0265316_10021393 3300031344 Bacteria 5478
952 Ga0265316_10163987 3300031344 Bacteria 1661
953 Ga0265316_10446833 3300031344 Bacteria 927
954 Ga0307513_10007825 3300031456 Bacteria 13780
955 Ga0307513_10019109 3300031456 Bacteria 8167
956 Ga0307513_10034953 3300031456 Bacteria 5631
957 Ga0307513_10058418 3300031456 Bacteria 4100
958 Ga0307513_10063852 3300031456 Bacteria 3884
959 Ga0307513_10097095 3300031456 Bacteria 2982
960 Ga0307513_10184235 3300031456 Bacteria 1947
961 Ga0307513_10262845 3300031456 Bacteria 1514
962 Ga0307513_10418258 3300031456 Bacteria 1071
963 Ga0307509_10000050 3300031507 Bacteria 165692
964 Ga0307509_10003616 3300031507 Bacteria 23221
965 Ga0307509_10091388 3300031507 Bacteria 3115
966 Ga0307509_10111735 3300031507 Bacteria 2734
967 Ga0307509_10141229 3300031507 Bacteria 2343
968 Ga0307509_10147814 3300031507 Bacteria 2271
969 Ga0307509_10504506 3300031507 Bacteria 894
970 Ga0307408_100178067 3300031548 Bacteria 1703
971 Ga0307408_100186366 3300031548 Bacteria 1668
972 Ga0307408_100193528 3300031548 Bacteria 1640
973 Ga0307408_100260880 3300031548 Bacteria 1434
974 Ga0307408_100469453 3300031548 Bacteria 1095
975 Ga0307408_100492733 3300031548 Bacteria 1071
976 Ga0307408_100519381 3300031548 Bacteria 1046
977 Ga0307408_102277064 3300031548 Bacteria 524
978 Ga0265313_10000014 3300031595 Bacteria 156295
979 Ga0307508_10000392 3300031616 Bacteria 52650
980 Ga0307508_10407074 3300031616 Bacteria 952
981 Ga0307508_10537503 3300031616 Bacteria 766
982 Ga0307514_10034392 3300031649 Bacteria 4039
983 Ga0307514_10104256 3300031649 Bacteria 2029
984 Ga0307514_10178976 3300031649 Bacteria 1370
985 Ga0307514_10181649 3300031649 Bacteria 1355
986 Ga0307514_10213346 3300031649 Bacteria 1195
987 Ga0316575_10108836 3300031665 Bacteria 1130
988 Ga0265314_10001521 3300031711 Bacteria 25613
989 Ga0265314_10070955 3300031711 Bacteria 2332
990 Ga0265314_10075432 3300031711 Bacteria 2243
991 Ga0307516_10011689 3300031730 Bacteria 9527
992 Ga0307516_10019197 3300031730 Bacteria 7085
993 Ga0307516_10397791 3300031730 Bacteria 1037
994 Ga0307405_10005729 3300031731 Bacteria 6033
995 Ga0307405_10012091 3300031731 Bacteria 4554
996 Ga0307405_10046436 3300031731 Bacteria 2668
997 Ga0307405_10155277 3300031731 Bacteria 1614
998 Ga0307405_10823826 3300031731 Bacteria 779
999 Ga0307405_11140977 3300031731 Bacteria 671
1000 Ga0307405_12096718 3300031731 Bacteria 507
1001 Ga0307413_10001429 3300031824 Bacteria 9034
1002 Ga0307413_10032313 3300031824 Bacteria 2965
1003 Ga0307413_10035769 3300031824 Bacteria 2852
1004 Ga0307413_10206648 3300031824 Bacteria 1422
1005 Ga0307413_10641796 3300031824 Bacteria 874
1006 Ga0307413_10747659 3300031824 Bacteria 817
1007 Ga0307410_10002645 3300031852 Bacteria 8733
1008 Ga0307410_10006977 3300031852 Bacteria 6149
1009 Ga0307410_10073323 3300031852 Bacteria 2380
1010 Ga0307410_10531987 3300031852 Bacteria 971
1011 Ga0307410_10762095 3300031852 Bacteria 820
1012 Ga0307410_10916788 3300031852 Bacteria 751
1013 Ga0307406_10004866 3300031901 Bacteria 7314
1014 Ga0307406_10054966 3300031901 Bacteria 2543
1015 Ga0307406_10163268 3300031901 Bacteria 1604
1016 Ga0307406_10214883 3300031901 Bacteria 1425
1017 Ga0307407_10006994 3300031903 Bacteria 5072
1018 Ga0307407_10007323 3300031903 Bacteria 4990
1019 Ga0307407_10061462 3300031903 Bacteria 2196
1020 Ga0307407_10323671 3300031903 Bacteria 1083
1021 Ga0307407_11399922 3300031903 Bacteria 551
1022 Ga0307412_10011559 3300031911 Bacteria 5119
1023 Ga0307412_10074922 3300031911 Bacteria 2320
1024 Ga0307412_10094847 3300031911 Bacteria 2096
1025 Ga0307412_10263875 3300031911 Bacteria 1344
1026 Ga0307412_10275217 3300031911 Bacteria 1319
1027 Ga0307412_10300299 3300031911 Bacteria 1269
1028 Ga0307412_10537689 3300031911 Bacteria 979
1029 Ga0307412_10819269 3300031911 Bacteria 809
1030 Ga0307412_12037627 3300031911 Bacteria 532
1031 Ga0307409_100000577 3300031995 Bacteria 15970
1032 Ga0307409_100018987 3300031995 Bacteria 4642
1033 Ga0307409_100034200 3300031995 Bacteria 3708
1034 Ga0307409_100072562 3300031995 Bacteria 2742
1035 Ga0307409_100686881 3300031995 Bacteria 1021
1036 Ga0307416_100028404 3300032002 Bacteria 4159
1037 Ga0307416_100043561 3300032002 Bacteria 3515
1038 Ga0307416_100099454 3300032002 Bacteria 2526
1039 Ga0307416_100550299 3300032002 Bacteria 1227
1040 Ga0307416_100764931 3300032002 Bacteria 1059
1041 Ga0307416_101030487 3300032002 Bacteria 926
1042 Ga0307416_101105132 3300032002 Bacteria 897
1043 Ga0307416_101119617 3300032002 Bacteria 892
1044 Ga0307416_101230578 3300032002 Bacteria 854
1045 Ga0307414_10358891 3300032004 Bacteria 1253
1046 Ga0307414_10678899 3300032004 Bacteria 931
1047 Ga0307411_10001998 3300032005 Bacteria 8755
1048 Ga0307411_10034772 3300032005 Bacteria 3139
1049 Ga0307411_10249959 3300032005 Bacteria 1393
1050 Ga0307411_10330148 3300032005 Bacteria 1235
1051 Ga0307411_10354795 3300032005 Bacteria 1197
1052 Ga0307411_10427072 3300032005 Bacteria 1102
1053 Ga0307411_10540746 3300032005 Bacteria 992
1054 Ga0307411_10603921 3300032005 Bacteria 944
1055 Ga0307411_10655015 3300032005 Bacteria 910
1056 Ga0307411_11130764 3300032005 Bacteria 707
1057 Ga0307411_11544693 3300032005 Bacteria 611
1058 Ga0307411_12146570 3300032005 Bacteria 523
1059 Ga0307415_100034663 3300032126 Bacteria 3289
1060 Ga0307415_100039097 3300032126 Bacteria 3132
1061 Ga0307415_100210379 3300032126 Bacteria 1551
1062 Ga0307415_100239312 3300032126 Bacteria 1467
1063 Ga0307415_100278380 3300032126 Bacteria 1374
1064 Ga0307415_100482114 3300032126 Bacteria 1080
1065 Ga0307415_101335212 3300032126 Bacteria 680
1066 Ga0316583_10161702 3300032133 Bacteria 779
1067 Ga0316593_10000520 3300032168 Bacteria 7142
1068 Ga0316593_10040336 3300032168 Bacteria 1551
1069 Ga0316593_10198099 3300032168 Bacteria 742
1070 Ga0307507_10087876 3300033179 Bacteria 2685
1071 Ga0307507_10154935 3300033179 Bacteria 1711
1072 Ga0307510_10168701 3300033180 Bacteria 1771
1073 Ga0307510_10170741 3300033180 Bacteria 1754
1074 Ga0307510_10523931 3300033180 Bacteria 629
1075 Ga0316592_1032584 3300033524 Eukaryota 1137
1076 Ga0316596_1000040 3300033541 Bacteria 13770
1077 Ga0316596_1229670 3300033541 Unclassified 520
1078 Ga0373950_0134707 3300034818 Bacteria 555
1079 Ga0373959_0046903 3300034820 Bacteria 923
1080 Ga0373938_0017777 3300034957 Bacteria 1403
1081 Ga0373926_0022611 3300035083 Bacteria 2181
1082 Ga0373926_0079568 3300035083 Bacteria 1211
1083 Ga0373928_0014100 3300035084 Bacteria 1612
1084 Ga0373928_0246433 3300035084 Bacteria 531
1085 Ga0373929_0098569 3300035085 Bacteria 734
1086 Ga0373934_0243828 3300035086 Bacteria 743
1087 Ga0373940_0013603 3300035088 Bacteria 1973
1088 Ga0373940_0039203 3300035088 Bacteria 1296
1089 Ga0373944_0026001 3300035089 Bacteria 1726
1090 Ga0373944_0037967 3300035089 Bacteria 1478
1091 Ga0373944_0122902 3300035089 Bacteria 896
1092 Ga0373944_0136517 3300035089 Bacteria 856
1093 Ga0373951_0036869 3300035091 Bacteria 1168
1094 Ga0373952_0009457 3300035092 Bacteria 1867
1095 Ga0373923_0051212 3300035111 Bacteria 1732
1096 Ga0373923_0117766 3300035111 Bacteria 1184
1097 Ga0373932_0015015 3300035112 Bacteria 1958
1098 Ga0373932_0032954 3300035112 Bacteria 1452
1099 Ga0373932_0064786 3300035112 Bacteria 1119
1100 Ga0373932_0138381 3300035112 Bacteria 826
1101 Ga0373936_0023106 3300035113 Bacteria 2422
1102 Ga0373939_0042238 3300035114 Bacteria 1378
1103 Ga0373939_0042737 3300035114 Bacteria 1372
1104 Ga0373939_0101011 3300035114 Bacteria 990
1105 Ga0373941_0291295 3300035115 Bacteria 649
1106 Ga0373945_0062010 3300035116 Bacteria 1397
1107 Ga0373953_0042168 3300035117 Bacteria 1818
1108 Ga0373953_0334618 3300035117 Bacteria 663
1109 Ga0373954_0124223 3300035118 Bacteria 1254
1110 Ga0373956_0085842 3300035119 Bacteria 1448
1111 Ga0373956_0136201 3300035119 Bacteria 1152
1112 Ga0373956_0441351 3300035119 Bacteria 621
1113 Ga0373957_0044948 3300035120 Bacteria 1672
1114 Ga0373957_0070420 3300035120 Bacteria 1367
1115 Ga0373960_0019605 3300035121 Bacteria 1779
1116 Ga0373960_0329674 3300035121 Bacteria 574
1117 Ga0373943_0205596 3300035170 Bacteria 1091
1118 Ga0373943_0250809 3300035170 Bacteria 994
1119 Ga0373943_0421698 3300035170 Bacteria 772
1120 Ga0373946_0057466 3300035171 Bacteria 1646
1121 Ga0373946_0150156 3300035171 Bacteria 1086
1122 Ga0373946_0167214 3300035171 Bacteria 1036
1123 Ga0373946_0367014 3300035171 Bacteria 722
1124 Ga0373955_0018160 3300035172 Bacteria 3494
1125 Ga0373955_0063660 3300035172 Bacteria 2042
1126 Ga0373955_0081524 3300035172 Bacteria 1829
1127 Ga0373955_0092432 3300035172 Bacteria 1726
1128 Ga0373955_0292723 3300035172 Bacteria 981
1129 Ga0373955_0809760 3300035172 Bacteria 576
1130 Ga0373942_0133951 3300035207 Bacteria 784
1131 Ga0373962_0036659 3300035242 Bacteria 1366
1132 Ga0373962_0139983 3300035242 Bacteria 785
1133 Ga0316574_0285455 3300035398 Bacteria 1051
1134 Ga0373924_0102911 3300035410 Bacteria 1229
1135 Ga0373924_0247167 3300035410 Bacteria 790
1136 Ga0373931_0001474 3300035691 Bacteria 10131
1137 Ga0373931_0008660 3300035691 Bacteria 4836
1138 Ga0373931_0226087 3300035691 Bacteria 1129
1139 Ga0373931_0446973 3300035691 Bacteria 826
1140 Ga0373931_0606530 3300035691 Bacteria 716
1141 Ga0373935_0013375 3300035692 Bacteria 4951
1142 Ga0373935_1117509 3300035692 Bacteria 587
1143 Ga0373927_0074508 3300035695 Bacteria 2198
1144 Ga0373927_0108327 3300035695 Bacteria 1810
1145 Ga0373927_0296254 3300035695 Bacteria 1064
1146 Ga0373927_0306888 3300035695 Bacteria 1045
1147 Ga0373927_0421769 3300035695 Bacteria 881
1148 Ga0373933_0864838 3300035724 Bacteria 595
1149 Ga0373947_0114560 3300035725 Bacteria 1707
1150 Ga0373947_0185796 3300035725 Bacteria 1355
1151 Ga0373937_0120811 3300036401 Bacteria 2441
1152 Ga0373937_0488619 3300036401 Bacteria 1169
1153 Ga0373937_0990449 3300036401 Bacteria 789
1154 Ga0316582_0054399 3300036647 Bacteria 2548
1155 Ga0316584_0641455 3300036712 Bacteria 733
1156 Ga0373925_0089907 3300037068 Bacteria 2346
1157 Ga0373925_0375274 3300037068 Bacteria 1157
1158 Ga0373925_0466364 3300037068 Bacteria 1035
1159 Ga0373925_0747219 3300037068 Bacteria 806
1160 Ga0395899_0005268 3300037312 Bacteria 10047
1161 Ga0395899_0342891 3300037312 Bacteria 1001
1162 Ga0395900_0000542 3300037418 Bacteria 52856
1163 Ga0395900_0034072 3300037418 Bacteria 5242
1164 Ga0395900_0770671 3300037418 Bacteria 891
1165 Ga0395898_0003063 3300037466 Bacteria 18941
1166 Ga0395905_0038305 3300037471 Bacteria 4498
1167 Ga0395905_0048048 3300037471 Bacteria 3999
1168 Ga0395901_0033769 3300038443 Bacteria 5283
1169 Ga0400484_00617 3300038725 Bacteria 1116
1170 Ga0400490_00437 3300038726 Bacteria 17578
1171 Ga0400491_22688 3300038727 Unclassified 1511
1172 Ga0400488_24943 3300038741 Bacteria 4000
1173 Ga0400483_081993 3300039062 Bacteria 8486
1174 Ga0400483_092373 3300039062 Bacteria 3253
1175 Ga0400483_098932 3300039062 Bacteria 1421
1176 Ga0400483_151841 3300039062 Bacteria 5853
1177 Ga0400483_207547 3300039062 Bacteria 4051
1178 Ga0400483_226967 3300039062 Bacteria 1258
1179 Ga0400483_232923 3300039062 Bacteria 3087
1180 Ga0400483_238884 3300039062 Bacteria 1792
1181 Ga0400483_258389 3300039062 Bacteria 1537
1182 Ga0400487_16155 3300039110 Unclassified 1450
1183 Ga0436365_0023403 3300039437 Bacteria 2605
1184 Ga0436365_0772335 3300039437 Bacteria 850
1185 Ga0436365_1793886 3300039437 Bacteria 521
1186 Ga0436363_0160364 3300039450 Bacteria 878
1187 Ga0436363_1530821 3300039450 Bacteria 2990
1188 Ga0436363_1604646 3300039450 Bacteria 932
1189 Ga0439436_0032700 3300041404 Bacteria 1507
1190 Ga0439439_0093230 3300041406 Bacteria 824
1191 Ga0439461_0013318 3300041410 Bacteria 1551
1192 Ga0439465_0154212 3300041413 Bacteria 822
1193 Ga0451787_578519 3300041441 Bacteria 947
1194 Ga0451787_682059 3300041441 Bacteria 1087
1195 Ga0451789_0604896 3300041443 Bacteria 662
1196 Ga0451789_0701085 3300041443 Bacteria 625
1197 Ga0451789_0781745 3300041443 Bacteria 1292
1198 Ga0451789_0965253 3300041443 Bacteria 2538
1199 Ga0451789_1079498 3300041443 Bacteria 760
1200 Ga0451790_47197 3300041444 Bacteria 1058
1201 Ga0451794_03533 3300041446 Bacteria 1513
1202 Ga0451794_20639 3300041446 Bacteria 572
1203 Ga0451794_21291 3300041446 Bacteria 839
1204 Ga0451791_1736819 3300041451 Bacteria 535
1205 Ga0451793_0424511 3300041452 Bacteria 932
1206 Ga0451793_0637995 3300041452 Bacteria 1739
1207 Ga0451793_1338571 3300041452 Bacteria 1262
1208 Ga0451797_0593740 3300041453 Bacteria 1059
1209 Ga0451797_0784698 3300041453 Bacteria 976
1210 Ga0451799_28190 3300041454 Bacteria 627
1211 Ga0451799_32497 3300041454 Bacteria 728
1212 Ga0451801_26122 3300041455 Bacteria 1026
1213 Ga0451801_40786 3300041455 Bacteria 1763
1214 Ga0451795_0013989 3300041456 Bacteria 2986
1215 Ga0451803_03143 3300041457 Bacteria 807
1216 Ga0451798_0518391 3300041458 Bacteria 605
1217 Ga0451798_1162362 3300041458 Bacteria 1067
1218 Ga0451800_0475520 3300041459 Bacteria 1521
1219 Ga0451800_1232355 3300041459 Bacteria 2467
1220 Ga0451802_1180715 3300041460 Bacteria 606
1221 Ga0451802_1195489 3300041460 Bacteria 1135
1222 Ga0451805_010137 3300041461 Bacteria 1322
1223 Ga0451805_039282 3300041461 Bacteria 1073
1224 Ga0451806_289060 3300041462 Bacteria 900
1225 Ga0451804_0197986 3300041463 Bacteria 561
1226 Ga0451804_0350671 3300041463 Bacteria 3764
1227 Ga0451804_0672156 3300041463 Bacteria 559
1228 Ga0451804_0722325 3300041463 Bacteria 707
1229 Ga0451807_0646883 3300041486 Bacteria 1463
1230 Ga0451807_0837307 3300041486 Bacteria 589
1231 Ga0451807_0984280 3300041486 Bacteria 1424
1232 Ga0451807_1280507 3300041486 Bacteria 1302
1233 Ga0451807_1334682 3300041486 Bacteria 746
1234 Ga0451807_1506488 3300041486 Bacteria 1542
1235 Ga0451833_0205751 3300041491 Bacteria 628
1236 Ga0451835_0635417 3300041492 Bacteria 1032
1237 Ga0451841_0230757 3300041498 Bacteria 611
1238 Ga0451841_0455622 3300041498 Bacteria 851
1239 Ga0451847_0437573 3300041503 Bacteria 650
1240 Ga0451849_1485536 3300041505 Bacteria 679
1241 Ga0451850_07380 3300041506 Bacteria 651
1242 Ga0451851_0477462 3300041507 Bacteria 659
1243 Ga0451854_06224 3300041510 Bacteria 513
1244 Ga0451855_0043459 3300041511 Bacteria 1949
1245 Ga0451853_0694569 3300041512 Bacteria 1631
1246 Ga0451853_1066481 3300041512 Bacteria 2648
1247 Ga0451853_1718278 3300041512 Bacteria 900
1248 Ga0451853_2708289 3300041512 Bacteria 544
1249 Ga0451853_4042749 3300041512 Bacteria 1692
1250 Ga0451853_4125141 3300041512 Bacteria 737
1251 Ga0452271_65294 3300041916 Bacteria 1115
1252 Ga0439462_0063869 3300042015 Bacteria 997
1253 Ga0450914_006348 3300042118 Bacteria 1034
1254 Ga0450923_163606 3300042125 Bacteria 543
1255 Ga0450888_000936 3300042126 Bacteria 2776
1256 Ga0450888_076627 3300042126 Bacteria 509
1257 Ga0450898_151038 3300042134 Bacteria 508
1258 Ga0450906_073666 3300042145 Bacteria 613
1259 Ga0439458_0062075 3300042157 Bacteria 934
1260 Ga0450909_005658 3300042185 Bacteria 1799
1261 Ga0439434_0095345 3300042435 Bacteria 955
1262 Ga0439444_0186821 3300042437 Bacteria 517
1263 Ga0439464_0163579 3300042439 Bacteria 700
1264 Ga0439460_0110012 3300042461 Bacteria 893
1265 Ga0450916_028444 3300042530 Bacteria 803
1266 Ga0450918_106598 3300042531 Bacteria 552
1267 Ga0450893_0014532 3300042532 Bacteria 1321
1268 Ga0450893_0079748 3300042532 Bacteria 646
1269 Ga0451577_0000013 3300042876 Bacteria 550689
1270 Ga0451577_0027488 3300042876 Bacteria 5150
1271 Ga0451577_0168788 3300042876 Bacteria 1971
1272 Ga0451577_0221004 3300042876 Bacteria 1712
1273 Ga0451577_0608581 3300042876 Bacteria 991
1274 Ga0451577_0626488 3300042876 Bacteria 976
1275 Ga0451577_0662158 3300042876 Bacteria 946
1276 Ga0451577_0909734 3300042876 Bacteria 792
1277 Ga0451577_1834259 3300042876 Bacteria 532
1278 Ga0453683_0000059 3300044673 Bacteria 187158
1279 Ga0453683_0030079 3300044673 Bacteria 3434
1280 Ga0453683_0041932 3300044673 Bacteria 2874
1281 Ga0466961_0117869 3300044693 Bacteria 1668
1282 Ga0466963_0155056 3300044694 Bacteria 1592
1283 Ga0453684_0000585 3300044712 Bacteria 135647
1284 Ga0453684_0065104 3300044712 Bacteria 4650
1285 Ga0453684_0077473 3300044712 Bacteria 4166
1286 Ga0453684_0261576 3300044712 Bacteria 1981
1287 Ga0453684_0340103 3300044712 Bacteria 1695
1288 Ga0453684_0462151 3300044712 Bacteria 1411
1289 Ga0453684_0473085 3300044712 Bacteria 1391
1290 Ga0453684_1184361 3300044712 Bacteria 803
1291 Ga0453684_1793636 3300044712 Bacteria 624
1292 Ga0466971_0003261 3300044719 Bacteria 6925
1293 Ga0466957_0004472 3300044842 Bacteria 7796
1294 Ga0466959_0074108 3300045049 Bacteria 2462
1295 Ga0451576_0000018 3300045051 Bacteria 550689
1296 Ga0451576_0000909 3300045051 Bacteria 56035
1297 Ga0451576_0010036 3300045051 Bacteria 10905
1298 Ga0451576_0025038 3300045051 Bacteria 6436
1299 Ga0451576_0079035 3300045051 Bacteria 3422
1300 Ga0451576_0131416 3300045051 Bacteria 2610
1301 Ga0451576_0168870 3300045051 Bacteria 2283
1302 Ga0451576_0177787 3300045051 Bacteria 2222
1303 Ga0451576_1144103 3300045051 Bacteria 814
1304 Ga0451576_1160016 3300045051 Bacteria 807
1305 Ga0466958_0062229 3300045836 Bacteria 2275
1306 Ga0495617_066779 3300046452 Bacteria 1185
1307 Ga0495592_0000203 3300046454 Bacteria 50733
1308 Ga0495592_0002591 3300046454 Bacteria 12773
1309 Ga0495603_0167391 3300046455 Bacteria 1273
1310 Ga0495590_0011864 3300046457 Bacteria 3248
1311 Ga0495590_0076553 3300046457 Bacteria 1177
1312 Ga0495590_0128399 3300046457 Bacteria 911
1313 Ga0495590_0406464 3300046457 Bacteria 523
1314 Ga0495591_001371 3300046458 Bacteria 15266
1315 Ga0495629_0208823 3300046459 Bacteria 1349
1316 Ga0495629_0333459 3300046459 Bacteria 1036
1317 Ga0495638_0020600 3300046460 Bacteria 4356
1318 Ga0495638_0023580 3300046460 Bacteria 4022
1319 Ga0495638_0131647 3300046460 Bacteria 1468
1320 Ga0495638_0162714 3300046460 Bacteria 1286
1321 Ga0495641_0101699 3300046461 Bacteria 1282
1322 Ga0495651_0800123 3300046462 Bacteria 582
1323 Ga0495653_0190214 3300046463 Bacteria 1401
1324 Ga0495650_0000787 3300046471 Bacteria 38830
1325 Ga0495580_0265795 3300046472 Bacteria 1173
1326 Ga0495582_0285985 3300046473 Bacteria 947
1327 Ga0495582_0385106 3300046473 Bacteria 808
1328 Ga0495605_0003552 3300046474 Bacteria 9242
1329 Ga0495605_0242295 3300046474 Bacteria 774
1330 Ga0495605_0454085 3300046474 Bacteria 527
1331 Ga0495639_0103968 3300046475 Bacteria 1343
1332 Ga0495639_0485717 3300046475 Bacteria 630
1333 Ga0495664_0167471 3300046477 Bacteria 1333
1334 Ga0495664_0693486 3300046477 Bacteria 602
1335 Ga0495584_0002357 3300046491 Bacteria 10763
1336 Ga0495585_0124260 3300046492 Bacteria 1363
1337 Ga0495585_0262788 3300046492 Bacteria 858
1338 Ga0495596_0334463 3300046500 Bacteria 589
1339 Ga0495607_0010060 3300046501 Bacteria 6371
1340 Ga0495583_0124309 3300046506 Bacteria 1083
1341 Ga0495606_0004907 3300046507 Bacteria 13094
1342 Ga0495608_0037016 3300046511 Bacteria 3282
1343 Ga0495608_0636945 3300046511 Bacteria 638
1344 Ga0495608_0684824 3300046511 Bacteria 611
1345 Ga0495610_0007369 3300046512 Bacteria 7341
1346 Ga0495610_0025318 3300046512 Bacteria 3186
1347 Ga0495610_0096636 3300046512 Bacteria 1330
1348 Ga0495610_0146980 3300046512 Bacteria 1009
1349 Ga0495610_0152175 3300046512 Bacteria 986
1350 Ga0495616_0006494 3300046513 Bacteria 7072
1351 Ga0495616_0052060 3300046513 Bacteria 2039
1352 Ga0495616_0074407 3300046513 Bacteria 1637
1353 Ga0495616_0093680 3300046513 Bacteria 1418
1354 Ga0495618_0210570 3300046514 Bacteria 1229
1355 Ga0495618_0263098 3300046514 Bacteria 1080
1356 Ga0495618_0632815 3300046514 Bacteria 634
1357 Ga0495620_0021563 3300046515 Bacteria 3126
1358 Ga0495620_0083017 3300046515 Bacteria 1294
1359 Ga0495620_0086369 3300046515 Bacteria 1263
1360 Ga0495620_0096514 3300046515 Bacteria 1181
1361 Ga0495628_0102358 3300046516 Bacteria 2210
1362 Ga0495628_0375959 3300046516 Bacteria 1041
1363 Ga0495630_0126006 3300046517 Bacteria 1944
1364 Ga0495631_0005719 3300046518 Bacteria 6484
1365 Ga0495631_0022122 3300046518 Bacteria 2957
1366 Ga0495632_0014757 3300046519 Bacteria 4407
1367 Ga0495632_0065630 3300046519 Bacteria 1753
1368 Ga0495632_0082343 3300046519 Bacteria 1534
1369 Ga0495632_0113435 3300046519 Bacteria 1271
1370 Ga0495643_0019121 3300046522 Bacteria 3966
1371 Ga0495643_0474258 3300046522 Bacteria 541
1372 Ga0495644_0000420 3300046523 Bacteria 18895
1373 Ga0495648_0007953 3300046524 Bacteria 8408
1374 Ga0495648_0357937 3300046524 Bacteria 664
1375 Ga0495663_0091107 3300046525 Bacteria 994
1376 Ga0495663_0161528 3300046525 Bacteria 769
1377 Ga0495642_0009990 3300046528 Bacteria 3636
1378 Ga0495642_0053512 3300046528 Bacteria 1664
1379 Ga0495642_0130268 3300046528 Bacteria 1082
1380 Ga0495654_0000178 3300046530 Bacteria 62611
1381 Ga0495654_0056414 3300046530 Bacteria 1899
1382 Ga0495654_0208764 3300046530 Bacteria 832
1383 Ga0495654_0283869 3300046530 Bacteria 680
1384 Ga0495665_0139846 3300046531 Bacteria 1266
1385 Ga0495640_0425133 3300046533 Bacteria 814
1386 Ga0495586_0061618 3300046535 Bacteria 2042
1387 Ga0495587_0030902 3300046536 Bacteria 3246
1388 Ga0495587_0270149 3300046536 Bacteria 954
1389 Ga0495587_0440001 3300046536 Bacteria 723
1390 Ga0495598_0388963 3300046537 Bacteria 543
1391 Ga0495621_0111975 3300046539 Bacteria 1047
1392 Ga0495621_0352693 3300046539 Bacteria 617
1393 Ga0495621_0536312 3300046539 Bacteria 507
1394 Ga0495597_0092274 3300046542 Bacteria 1284
1395 Ga0495645_0004671 3300046543 Bacteria 9348
1396 Ga0495645_0034282 3300046543 Bacteria 3704
1397 Ga0495645_0098975 3300046543 Bacteria 2075
1398 Ga0495622_0022381 3300046557 Bacteria 2945
1399 Ga0495622_0288324 3300046557 Bacteria 717
1400 Ga0495633_0048161 3300046558 Bacteria 2013
1401 Ga0495633_0120456 3300046558 Bacteria 1216
1402 Ga0495633_0191697 3300046558 Bacteria 940
1403 Ga0495633_0282068 3300046558 Bacteria 756
1404 Ga0495667_0115936 3300046559 Bacteria 1731
1405 Ga0495667_0295543 3300046559 Bacteria 1027
1406 Ga0495656_0056918 3300046615 Bacteria 1691
1407 Ga0495656_0140084 3300046615 Bacteria 1159
1408 Ga0495668_0164067 3300046616 Bacteria 1217
1409 Ga0495668_0179895 3300046616 Bacteria 1158
1410 Ga0495668_0435670 3300046616 Bacteria 721
1411 Ga0495634_0205692 3300046642 Bacteria 1221
1412 Ga0495634_0227438 3300046642 Bacteria 1149
1413 Ga0495611_0033426 3300046648 Bacteria 2269
1414 Ga0495611_0137743 3300046648 Bacteria 1140
1415 Ga0495625_0006868 3300046660 Bacteria 10052
1416 Ga0495625_0020303 3300046660 Bacteria 5131
1417 Ga0495625_0039878 3300046660 Bacteria 3427
1418 Ga0495625_0102533 3300046660 Bacteria 1964
1419 Ga0495625_0340532 3300046660 Bacteria 950
1420 Ga0495635_0032495 3300046663 Bacteria 3620
1421 Ga0495635_0542978 3300046663 Bacteria 762
1422 Ga0495635_0818213 3300046663 Bacteria 600
1423 Ga0495659_0077302 3300046664 Bacteria 1257
1424 Ga0495659_0084804 3300046664 Bacteria 1208
1425 Ga0495659_0382341 3300046664 Bacteria 605
1426 Ga0495588_0009938 3300046674 Bacteria 4411
1427 Ga0495657_0043896 3300046675 Bacteria 3045
1428 Ga0495657_0099043 3300046675 Bacteria 1860
1429 Ga0495657_0355767 3300046675 Bacteria 866
1430 Ga0495657_0697551 3300046675 Bacteria 584
1431 Ga0495599_0001475 3300046678 Bacteria 13496
1432 Ga0495623_0049231 3300046679 Bacteria 2671
1433 Ga0495623_0189415 3300046679 Bacteria 1190
1434 Ga0495646_0061137 3300046680 Bacteria 2244
1435 Ga0495647_0085698 3300046681 Bacteria 1284
1436 Ga0495647_0090860 3300046681 Bacteria 1252
1437 Ga0495647_0124789 3300046681 Bacteria 1086
1438 Ga0495647_0125943 3300046681 Bacteria 1081
1439 Ga0495647_0134919 3300046681 Bacteria 1049
1440 Ga0495658_0085813 3300046683 Bacteria 1856
1441 Ga0495658_0097472 3300046683 Bacteria 1750
1442 Ga0495658_0105468 3300046683 Bacteria 1688
1443 Ga0495658_0134744 3300046683 Bacteria 1506
1444 Ga0495658_0223594 3300046683 Bacteria 1179
1445 Ga0495658_0277267 3300046683 Bacteria 1058
1446 Ga0495658_0283602 3300046683 Bacteria 1045
1447 Ga0495658_0296678 3300046683 Bacteria 1022
1448 Ga0495658_0455195 3300046683 Bacteria 818
1449 Ga0495669_0084855 3300046684 Bacteria 1457
1450 Ga0495669_0103028 3300046684 Bacteria 1327
1451 Ga0495669_0321926 3300046684 Bacteria 746
1452 Ga0495613_0091108 3300046689 Bacteria 2208
1453 Ga0495613_0120251 3300046689 Bacteria 1886
1454 Ga0495670_0042455 3300046691 Bacteria 2269
1455 Ga0495670_0424075 3300046691 Bacteria 720
1456 Ga0495671_0000488 3300046692 Bacteria 30667
1457 Ga0495671_0198265 3300046692 Bacteria 974
1458 Ga0495671_0295587 3300046692 Bacteria 779
1459 Ga0495671_0305034 3300046692 Bacteria 766
1460 Ga0495671_0415091 3300046692 Bacteria 644
1461 Ga0495671_0421684 3300046692 Bacteria 638
1462 Ga0495671_0429974 3300046692 Bacteria 632
1463 Ga0495649_0006057 3300046694 Bacteria 7562
1464 Ga0495649_0026025 3300046694 Bacteria 3256
1465 Ga0495649_0225215 3300046694 Bacteria 969
1466 Ga0495649_0406068 3300046694 Bacteria 683
1467 Ga0495649_0444741 3300046694 Bacteria 648
1468 Ga0495589_0074447 3300046794 Bacteria 1657
1469 Ga0495589_0133864 3300046794 Bacteria 1189
1470 Ga0495600_0284384 3300046809 Bacteria 1046
1471 Ga0495600_0740671 3300046809 Bacteria 589
1472 Ga0495660_0000352 3300046810 Bacteria 40624
1473 Ga0495660_0151509 3300046810 Bacteria 1144
1474 Ga0495660_0355899 3300046810 Bacteria 650
1475 Ga0495604_0435394 3300047317 Bacteria 859
1476 Ga0495604_0893880 3300047317 Bacteria 555
1477 Ga0495636_0078088 3300047318 Bacteria 1422
1478 Ga0495672_0000011 3300047320 Bacteria 535362
1479 Ga0495672_0124253 3300047320 Bacteria 1367
1480 Ga0495676_0010234 3300047321 Bacteria 8515
1481 Ga0495676_0140426 3300047321 Bacteria 1732
1482 Ga0495680_0062566 3300047322 Bacteria 2861
1483 Ga0495680_0156938 3300047322 Bacteria 1655
1484 Ga0495680_0916563 3300047322 Bacteria 565
1485 Ga0495683_0075953 3300047323 Bacteria 1644
1486 Ga0495687_036928 3300047443 Bacteria 2180
1487 Ga0495679_051289 3300047446 Bacteria 1237
1488 Ga0495679_076308 3300047446 Bacteria 958
1489 Ga0495685_088317 3300047447 Bacteria 1029
1490 Ga0495673_0002408 3300047469 Bacteria 13186
1491 Ga0495673_0135384 3300047469 Bacteria 965
1492 Ga0495673_0182094 3300047469 Bacteria 795
1493 Ga0495681_0051412 3300047470 Bacteria 1938
1494 Ga0495681_0191002 3300047470 Bacteria 836
1495 Ga0495684_0188245 3300047471 Bacteria 1527
1496 Ga0495684_0395216 3300047471 Bacteria 972
1497 Ga0495686_0039632 3300047472 Bacteria 3008
1498 Ga0495686_0054615 3300047472 Bacteria 2500
1499 Ga0495686_0066900 3300047472 Bacteria 2219
1500 Ga0495686_0177695 3300047472 Bacteria 1235
1501 Ga0495686_0195418 3300047472 Bacteria 1164
1502 Ga0495686_0580565 3300047472 Bacteria 582
1503 Ga0495593_0038039 3300047673 Bacteria 2600
1504 Ga0495602_0365616 3300048088 Bacteria 1037
1505 Ga0495614_0095045 3300048089 Bacteria 1299
1506 Ga0495626_0074338 3300048091 Bacteria 1521
1507 Ga0495626_0131805 3300048091 Bacteria 1067
1508 Ga0495626_0154700 3300048091 Bacteria 964
1509 Ga0496100_0076364 3300048903 Bacteria 2249
1510 Ga0496100_0447306 3300048903 Bacteria 990
1511 Ga0496100_0546982 3300048903 Bacteria 895
1512 Ga0496100_1019883 3300048903 Bacteria 651
1513 Ga0496101_0024728 3300048904 Bacteria 4160
1514 Ga0496101_0463082 3300048904 Bacteria 1000
1515 Ga0496101_0633712 3300048904 Bacteria 845
1516 Ga0496102_0007579 3300048905 Bacteria 9273
1517 Ga0496102_0060302 3300048905 Bacteria 3470
1518 Ga0496102_0536484 3300048905 Bacteria 1093
1519 Ga0496102_0704384 3300048905 Bacteria 933
1520 Ga0496104_0008378 3300048907 Bacteria 9189
1521 Ga0496104_0104722 3300048907 Bacteria 2711
1522 Ga0496104_0327787 3300048907 Bacteria 1444
1523 Ga0496104_0579646 3300048907 Bacteria 1032
1524 Ga0496105_0009457 3300048908 Bacteria 7626
1525 Ga0496105_0289103 3300048908 Bacteria 1320
1526 Ga0496105_0693498 3300048908 Bacteria 782
1527 Ga0496106_0275442 3300048909 Bacteria 1347
1528 Ga0496106_0453539 3300048909 Bacteria 1030
1529 Ga0496106_1586289 3300048909 Bacteria 502
1530 Ga0496107_0280025 3300048910 Bacteria 1241
1531 Ga0496107_0429419 3300048910 Bacteria 982
1532 Ga0496107_0695193 3300048910 Bacteria 748
1533 Ga0496108_0005999 3300048911 Bacteria 9840
1534 Ga0496108_0042133 3300048911 Bacteria 3811
1535 Ga0496108_0097580 3300048911 Bacteria 2504
1536 Ga0496108_0309768 3300048911 Bacteria 1376
1537 Ga0496108_0356402 3300048911 Bacteria 1277
1538 Ga0496108_0406535 3300048911 Bacteria 1189
1539 Ga0496109_0259357 3300048912 Bacteria 1637
1540 Ga0496109_0267867 3300048912 Bacteria 1609
1541 Ga0496109_0618045 3300048912 Bacteria 1020
1542 Ga0496109_1217504 3300048912 Bacteria 689
1543 Ga0496110_0026383 3300048913 Bacteria 4971
1544 Ga0496110_0367167 3300048913 Bacteria 1311
1545 Ga0496111_0004330 3300048914 Bacteria 8955
1546 Ga0496111_0558089 3300048914 Bacteria 840
1547 Ga0496112_0411585 3300048915 Bacteria 1291
1548 Ga0496112_0462843 3300048915 Bacteria 1206
1549 Ga0496112_0475015 3300048915 Bacteria 1187
1550 Ga0496113_0211725 3300048916 Bacteria 1543
1551 Ga0496113_0215057 3300048916 Bacteria 1531
1552 Ga0496113_0310758 3300048916 Bacteria 1263
1553 Ga0496113_0885539 3300048916 Bacteria 707
1554 Ga0496114_0009046 3300048917 Bacteria 7897
1555 Ga0496114_0198844 3300048917 Bacteria 1755
1556 Ga0496114_0430906 3300048917 Bacteria 1168
1557 Ga0496114_0574004 3300048917 Bacteria 995
1558 Ga0496115_0030230 3300048918 Bacteria 4260
1559 Ga0496115_0446021 3300048918 Bacteria 1046
1560 Ga0496116_0013625 3300048919 Bacteria 6538
1561 Ga0496119_0010829 3300048922 Bacteria 7630
1562 Ga0496120_0023855 3300048923 Bacteria 3823
1563 Ga0496123_0395689 3300048926 Bacteria 630
1564 Ga0501306_001000 3300049127 Bacteria 2483
1565 Ga0501306_010649 3300049127 Bacteria 1161
1566 Ga0501308_000386 3300049128 Bacteria 2793
1567 Ga0501308_004862 3300049128 Bacteria 1314
1568 Ga0501308_012337 3300049128 Bacteria 975
1569 Ga0501308_015871 3300049128 Bacteria 896
1570 Ga0501309_007735 3300049129 Bacteria 1338
1571 Ga0501309_015019 3300049129 Bacteria 1044
1572 Ga0501309_018080 3300049129 Bacteria 971
1573 Ga0501310_005085 3300049130 Bacteria 1342
1574 Ga0501310_011089 3300049130 Bacteria 1016
1575 Ga0501310_011540 3300049130 Bacteria 1001
1576 Ga0501310_039742 3300049130 Bacteria 652
1577 Ga0501304_001736 3300049160 Bacteria 1438
1578 Ga0501304_009642 3300049160 Bacteria 832
1579 Ga0501305_000819 3300049161 Bacteria 2765
1580 Ga0501305_005417 3300049161 Bacteria 1545
1581 Ga0501305_009585 3300049161 Bacteria 1276
1582 Ga0501305_010469 3300049161 Bacteria 1238
1583 Ga0501305_038350 3300049161 Bacteria 772
1584 Ga0501305_122394 3300049161 Bacteria 500
1585 Ga0501307_000963 3300049162 Bacteria 2241
1586 Ga0501307_025529 3300049162 Bacteria 794
1587 Ga0501307_068984 3300049162 Bacteria 561
1588 Ga0495678_000882 3300049459 Bacteria 26697
1589 Ga0495678_217698 3300049459 Bacteria 581
1590 Ga0495682_0000520 3300049460 Bacteria 26623
1591 Ga0495682_0049136 3300049460 Bacteria 1537
1592 Ga0495682_0058348 3300049460 Bacteria 1396
1593 Ga0501290_008662 3300049513 Bacteria 1289
1594 Ga0501292_005043 3300049515 Bacteria 1828
1595 Ga0501292_046069 3300049515 Bacteria 763
1596 Ga0501299_044313 3300049522 Bacteria 902
1597 Ga0501311_004807 3300049527 Bacteria 1454
1598 Ga0501311_027374 3300049527 Bacteria 809
1599 Ga0501311_039844 3300049527 Bacteria 709
1600 Ga0501312_002743 3300049528 Bacteria 1929
1601 Ga0501312_020297 3300049528 Bacteria 982
1602 Ga0501312_025631 3300049528 Bacteria 899
1603 Ga0501312_101904 3300049528 Bacteria 539
1604 Ga0501313_004401 3300049529 Bacteria 1446
1605 Ga0501313_009732 3300049529 Bacteria 1086
1606 Ga0501313_018129 3300049529 Bacteria 854
1607 Ga0501315_013634 3300049531 Bacteria 1020
1608 Ga0501315_031783 3300049531 Bacteria 764
1609 Ga0501316_001021 3300049532 Bacteria 2235
1610 Ga0501317_020404 3300049533 Bacteria 893
1611 Ga0501317_049831 3300049533 Bacteria 662
1612 Ga0501318_000548 3300049534 Bacteria 2463
1613 Ga0501320_002265 3300049536 Bacteria 1522
1614 Ga0501320_017439 3300049536 Bacteria 803
1615 Ga0501323_006346 3300049539 Bacteria 1319
1616 Ga0501323_011600 3300049539 Bacteria 1066
1617 Ga0501323_051180 3300049539 Bacteria 627
1618 Ga0501325_029777 3300049541 Bacteria 620
1619 Ga0501031_0414151 3300049568 Bacteria 871
1620 Ga0501032_0525586 3300049569 Bacteria 755
1621 Ga0501033_0049659 3300049570 Bacteria 3114
1622 Ga0501033_0106171 3300049570 Bacteria 2046
1623 Ga0501033_0713753 3300049570 Bacteria 682
1624 Ga0501036_0023621 3300049572 Bacteria 5181
1625 Ga0501036_0041349 3300049572 Bacteria 3901
1626 Ga0501036_0048255 3300049572 Bacteria 3605
1627 Ga0501036_0061179 3300049572 Bacteria 3190
1628 Ga0501036_0230381 3300049572 Bacteria 1555
1629 Ga0501036_0533062 3300049572 Bacteria 976
1630 Ga0501036_1443853 3300049572 Bacteria 557
1631 Ga0501037_0024581 3300049573 Bacteria 4455
1632 Ga0501037_0067017 3300049573 Bacteria 2614
1633 Ga0501037_0071416 3300049573 Bacteria 2525
1634 Ga0501037_0146633 3300049573 Bacteria 1688
1635 Ga0501038_0015092 3300049574 Bacteria 7031
1636 Ga0501038_0090870 3300049574 Bacteria 2558
1637 Ga0501039_0021546 3300049575 Bacteria 4943
1638 Ga0501039_0115981 3300049575 Bacteria 2096
1639 Ga0501039_0428377 3300049575 Bacteria 1039
1640 Ga0501039_0702981 3300049575 Bacteria 790
1641 Ga0501040_0008066 3300049576 Bacteria 6839
1642 Ga0501040_0157352 3300049576 Bacteria 1605
1643 Ga0501040_0315558 3300049576 Bacteria 1118
1644 Ga0501040_0716304 3300049576 Bacteria 724
1645 Ga0501040_0970565 3300049576 Bacteria 616
1646 Ga0501040_1098647 3300049576 Bacteria 577
1647 Ga0501041_0001598 3300049577 Bacteria 12636
1648 Ga0501041_0119305 3300049577 Bacteria 1638
1649 Ga0501041_0275567 3300049577 Bacteria 1058
1650 Ga0501041_0315177 3300049577 Bacteria 986
1651 Ga0501041_0665193 3300049577 Bacteria 666
1652 Ga0501041_0775507 3300049577 Bacteria 614
1653 Ga0501042_0001373 3300049578 Bacteria 14288
1654 Ga0501042_0144131 3300049578 Bacteria 1718
1655 Ga0501042_0158721 3300049578 Bacteria 1631
1656 Ga0501042_0295714 3300049578 Bacteria 1170
1657 Ga0501042_0741520 3300049578 Bacteria 714
1658 Ga0501042_1295130 3300049578 Bacteria 531
1659 Ga0501043_0000090 3300049579 Bacteria 81336
1660 Ga0501043_0033943 3300049579 Bacteria 4014
1661 Ga0501043_0542364 3300049579 Bacteria 865
1662 Ga0501046_0000126 3300049580 Bacteria 81334
1663 Ga0501046_0015243 3300049580 Bacteria 6464
1664 Ga0501046_0105554 3300049580 Bacteria 2157
1665 Ga0501046_0179631 3300049580 Bacteria 1583
1666 Ga0501047_0000160 3300049581 Bacteria 81946
1667 Ga0501047_0364875 3300049581 Bacteria 1280
1668 Ga0501048_0003429 3300049582 Bacteria 12039
1669 Ga0501048_0009558 3300049582 Bacteria 7281
1670 Ga0501048_0067468 3300049582 Bacteria 2528
1671 Ga0501048_0282946 3300049582 Bacteria 1179
1672 Ga0501048_0590393 3300049582 Bacteria 797
1673 Ga0501067_0031483 3300049583 Bacteria 2943
1674 Ga0501067_0424614 3300049583 Bacteria 742
1675 Ga0501067_0472701 3300049583 Bacteria 701
1676 Ga0501068_0001465 3300049584 Bacteria 12558
1677 Ga0501068_0026867 3300049584 Bacteria 3395
1678 Ga0501068_0041518 3300049584 Bacteria 2764
1679 Ga0501068_0525903 3300049584 Bacteria 768
1680 Ga0501069_0333741 3300049585 Bacteria 892
1681 Ga0501070_0044235 3300049586 Bacteria 3706
1682 Ga0501070_0169408 3300049586 Bacteria 1799
1683 Ga0501070_0297912 3300049586 Bacteria 1314
1684 Ga0501071_0003527 3300049587 Bacteria 9786
1685 Ga0501071_0024289 3300049587 Bacteria 4238
1686 Ga0501071_0102836 3300049587 Bacteria 2107
1687 Ga0501071_0144858 3300049587 Bacteria 1770
1688 Ga0501071_0160335 3300049587 Bacteria 1681
1689 Ga0501071_0259097 3300049587 Bacteria 1313
1690 Ga0501071_1294920 3300049587 Bacteria 563
1691 Ga0501072_0025385 3300049588 Bacteria 4617
1692 Ga0501072_0063312 3300049588 Bacteria 2917
1693 Ga0501072_0101863 3300049588 Bacteria 2282
1694 Ga0501072_0140535 3300049588 Bacteria 1925
1695 Ga0501072_0321792 3300049588 Bacteria 1229
1696 Ga0501072_0327339 3300049588 Bacteria 1217
1697 Ga0501072_0407521 3300049588 Bacteria 1078
1698 Ga0501072_0513025 3300049588 Bacteria 948
1699 Ga0501072_0916870 3300049588 Bacteria 684
1700 Ga0501073_0000525 3300049589 Bacteria 26880
1701 Ga0501073_0216221 3300049589 Bacteria 1324
1702 Ga0501074_0001124 3300049590 Bacteria 17502
1703 Ga0501074_0018349 3300049590 Bacteria 5081
1704 Ga0501074_0089815 3300049590 Bacteria 2200
1705 Ga0501074_0222352 3300049590 Bacteria 1344
1706 Ga0501075_0015597 3300049591 Bacteria 5453
1707 Ga0501075_0055471 3300049591 Bacteria 2981
1708 Ga0501075_0062590 3300049591 Bacteria 2805
1709 Ga0501075_0231797 3300049591 Bacteria 1408
1710 Ga0501075_0247801 3300049591 Bacteria 1358
1711 Ga0501075_0307152 3300049591 Bacteria 1209
1712 Ga0501075_0484848 3300049591 Bacteria 943
1713 Ga0501076_0004639 3300049592 Bacteria 9791
1714 Ga0501076_0022764 3300049592 Bacteria 4818
1715 Ga0501076_0028505 3300049592 Bacteria 4336
1716 Ga0501076_0046380 3300049592 Bacteria 3434
1717 Ga0501076_0079520 3300049592 Bacteria 2631
1718 Ga0501077_0002875 3300049593 Bacteria 10325
1719 Ga0501077_0007629 3300049593 Bacteria 6677
1720 Ga0501077_0029086 3300049593 Bacteria 3512
1721 Ga0501077_0049998 3300049593 Bacteria 2657
1722 Ga0501077_0059648 3300049593 Bacteria 2422
1723 Ga0501077_0271589 3300049593 Bacteria 1079
1724 Ga0501199_034729 3300049650 Bacteria 634
1725 Ga0501206_009648 3300049653 Bacteria 1286
1726 Ga0501206_015309 3300049653 Bacteria 1061
1727 Ga0501207_022199 3300049654 Bacteria 1024
1728 Ga0501222_041246 3300049662 Bacteria 656
1729 Ga0501228_000607 3300049666 Bacteria 2339
1730 Ga0501239_055810 3300049672 Bacteria 583
1731 Ga0501242_069704 3300049674 Bacteria 549
1732 Ga0501219_009206 3300049703 Bacteria 729
1733 Ga0501234_053845 3300049707 Bacteria 673
1734 Ga0501079_0004772 3300049741 Bacteria 10039
1735 Ga0501079_0006996 3300049741 Bacteria 8503
1736 Ga0501079_0179169 3300049741 Bacteria 1653
1737 Ga0501079_0431909 3300049741 Bacteria 1034
1738 Ga0501079_1077032 3300049741 Bacteria 633
1739 Ga0501079_1097558 3300049741 Bacteria 627
1740 Ga0501080_0001373 3300049742 Bacteria 20360
1741 Ga0501080_0011395 3300049742 Bacteria 8144
1742 Ga0501080_0028144 3300049742 Bacteria 5226
1743 Ga0501080_0037660 3300049742 Bacteria 4517
1744 Ga0501080_0286093 3300049742 Bacteria 1498
1745 Ga0501080_0748801 3300049742 Bacteria 859
1746 Ga0501080_0794587 3300049742 Bacteria 830
1747 Ga0501080_1256064 3300049742 Bacteria 635
1748 Ga0501081_0006719 3300049743 Bacteria 7480
1749 Ga0501081_0018126 3300049743 Bacteria 4672
1750 Ga0501081_0332797 3300049743 Bacteria 1117
1751 Ga0501081_1326275 3300049743 Bacteria 546
1752 Ga0501083_0004501 3300049744 Bacteria 9845
1753 Ga0501083_0032077 3300049744 Bacteria 3604
1754 Ga0501083_0079781 3300049744 Bacteria 2170
1755 Ga0501083_0670429 3300049744 Bacteria 674
1756 Ga0501265_013043 3300049762 Bacteria 1042
1757 Ga0501280_000425 3300049776 Bacteria 10117
1758 Ga0501281_07163 3300049777 Bacteria 778
1759 Ga0501035_0180906 3300049822 Bacteria 1816
1760 Ga0501035_0729904 3300049822 Bacteria 797
1761 Ga0501044_0057237 3300049823 Bacteria 4001
1762 Ga0501044_0344411 3300049823 Bacteria 1411
1763 Ga0501044_0644482 3300049823 Bacteria 949
1764 Ga0501044_0934012 3300049823 Bacteria 741
1765 Ga0501045_0000882 3300049824 Bacteria 19499
1766 Ga0501045_0008747 3300049824 Bacteria 7062
1767 Ga0501045_0084307 3300049824 Bacteria 2344
1768 Ga0501045_0089934 3300049824 Bacteria 2268
1769 Ga0501045_0477922 3300049824 Bacteria 926
1770 Ga0501045_1369787 3300049824 Bacteria 514
1771 nmdc:mga03683_177263_c1 3300050489 Bacteria 971
1772 nmdc:mga03683_18745_c1 3300050489 Bacteria 2635
1773 nmdc:mga03683_330406_c1 3300050489 Bacteria 719
1774 nmdc:mga03n38_4851_c1 3300050490 Bacteria 4507
1775 nmdc:mga03n38_660515_c1 3300050490 Bacteria 600
1776 nmdc:mga00v17_103467_c1 3300050491 Bacteria 1800
1777 nmdc:mga00v17_1065507_c1 3300050491 Bacteria 507
1778 nmdc:mga00v17_17620_c1 3300050491 Bacteria 4047
1779 nmdc:mga00v17_53813_c1 3300050491 Bacteria 2454
1780 nmdc:mga00v17_744286_c1 3300050491 Bacteria 627
1781 nmdc:mga00v17_803227_c1 3300050491 Bacteria 599
1782 nmdc:mga0yw44_11539_c1 3300050492 Bacteria 4567
1783 nmdc:mga0yw44_283449_c1 3300050492 Bacteria 1108
1784 nmdc:mga0k408_1021_c1 3300050493 Bacteria 15347
1785 nmdc:mga0k408_109049_c1 3300050493 Bacteria 1636
1786 nmdc:mga0k408_12806_c1 3300050493 Bacteria 4590
1787 nmdc:mga0k408_137955_c1 3300050493 Bacteria 1450
1788 nmdc:mga0k408_145503_c1 3300050493 Bacteria 1411
1789 nmdc:mga0k408_149455_c1 3300050493 Bacteria 1391
1790 nmdc:mga0k408_153215_c1 3300050493 Bacteria 1373
1791 nmdc:mga0k408_17814_c1 3300050493 Bacteria 3959
1792 nmdc:mga0k408_205529_c1 3300050493 Bacteria 1176
1793 nmdc:mga0k408_210024_c1 3300050493 Bacteria 1162
1794 nmdc:mga0k408_219_c1 3300050493 Bacteria 23656
1795 nmdc:mga0k408_23422_c1 3300050493 Bacteria 3483
1796 nmdc:mga0k408_23786_c1 3300050493 Bacteria 3460
1797 nmdc:mga0k408_28249_c1 3300050493 Bacteria 3190
1798 nmdc:mga0k408_283141_c1 3300050493 Bacteria 990
1799 nmdc:mga0k408_318491_c1 3300050493 Bacteria 928
1800 nmdc:mga0k408_43703_c1 3300050493 Bacteria 2583
1801 nmdc:mga0k408_46982_c1 3300050493 Bacteria 2494
1802 nmdc:mga0k408_49108_c1 3300050493 Bacteria 2443
1803 nmdc:mga0k408_57150_c1 3300050493 Bacteria 2265
1804 nmdc:mga0k408_59396_c1 3300050493 Bacteria 2222
1805 nmdc:mga0k408_61835_c1 3300050493 Bacteria 2177
1806 nmdc:mga0k408_65064_c1 3300050493 Bacteria 2122
1807 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
1808 nmdc:mga06z11_229350_c1 3300050494 Bacteria 1088
1809 nmdc:mga06z11_267106_c1 3300050494 Bacteria 1011
1810 nmdc:mga06z11_3023_c1 3300050494 Bacteria 6473
1811 nmdc:mga06z11_31530_c1 3300050494 Bacteria 2577
1812 nmdc:mga04h51_184316_c1 3300050495 Bacteria 814
1813 nmdc:mga07m45_109788_c1 3300050496 Bacteria 1588
1814 nmdc:mga07m45_15127_c1 3300050496 Bacteria 4120
1815 nmdc:mga07m45_196968_c1 3300050496 Bacteria 1172
1816 nmdc:mga07m45_20386_c1 3300050496 Bacteria 3601
1817 nmdc:mga07m45_359059_c1 3300050496 Bacteria 847
1818 nmdc:mga07m45_521105_c1 3300050496 Bacteria 688
1819 nmdc:mga07m45_69529_c1 3300050496 Bacteria 2002
1820 nmdc:mga07m45_74068_c1 3300050496 Bacteria 1940
1821 nmdc:mga07m45_752759_c1 3300050496 Bacteria 559
1822 nmdc:mga07m45_905430_c1 3300050496 Bacteria 505
1823 nmdc:mga05p37_1575417_c1 3300050507 Bacteria 649
1824 nmdc:mga09592_38477_c1 3300050508 Bacteria 4016
1825 nmdc:mga09592_533821_c1 3300050508 Bacteria 1008
1826 nmdc:mga0qj67_274367_c1 3300050509 Bacteria 1367
1827 nmdc:mga0qj67_50093_c1 3300050509 Bacteria 3301
1828 nmdc:mga0qj67_662317_c1 3300050509 Bacteria 832
1829 nmdc:mga08y16_1296713_c1 3300050511 Bacteria 695
1830 nmdc:mga08y16_208685_c1 3300050511 Bacteria 2023
1831 nmdc:mga08y16_2559_c1 3300050511 Bacteria 18707
1832 nmdc:mga08y16_397291_c1 3300050511 Bacteria 1411
1833 nmdc:mga08y16_485070_c1 3300050511 Bacteria 1257
1834 nmdc:mga08y16_731543_c1 3300050511 Bacteria 987
1835 nmdc:mga08y16_977479_c1 3300050511 Bacteria 828
1836 nmdc:mga0n895_158049_c1 3300050512 Bacteria 2298
1837 nmdc:mga0n895_1599570_c1 3300050512 Bacteria 616
1838 nmdc:mga0n895_789078_c1 3300050512 Bacteria 941
1839 nmdc:mga0rr50_369987_c1 3300050513 Bacteria 1207
1840 nmdc:mga0rr50_423398_c1 3300050513 Bacteria 1126
1841 nmdc:mga0rr50_474247_c1 3300050513 Bacteria 1062
1842 nmdc:mga08x19_2026_c1 3300050514 Bacteria 12425
1843 nmdc:mga0sz30_3989_c1 3300050516 Bacteria 5314
1844 Ga0495601_0002182 3300053077 Bacteria 11016
1845 Ga0495601_0338822 3300053077 Bacteria 978
1846 Ga0495601_0761682 3300053077 Bacteria 616
1847 Ga0495612_0100041 3300053078 Bacteria 1234
1848 Ga0495612_0132131 3300053078 Bacteria 1079
1849 Ga0500635_0116347 3300053080 Bacteria 997
1850 Ga0495655_0027539 3300053083 Bacteria 1349
1851 Ga0495655_0065643 3300053083 Bacteria 1002
1852 Ga0495655_0252931 3300053083 Bacteria 593
1853 Ga0495595_0249086 3300053084 Bacteria 889
1854 Ga0495595_0329422 3300053084 Bacteria 769
1855 Ga0495595_0730298 3300053084 Bacteria 508
1856 Ga0495619_0071847 3300053085 Bacteria 2316
1857 Ga0495619_0076699 3300053085 Bacteria 2244
1858 Ga0495619_0264261 3300053085 Bacteria 1192
1859 Ga0495619_0656583 3300053085 Bacteria 715
1860 Ga0500578_0000292 3300053086 Bacteria 61943
1861 Ga0500578_0079895 3300053086 Bacteria 2081
1862 Ga0500643_048658 3300053087 Bacteria 1218
1863 Ga0500644_0003475 3300053088 Bacteria 3899
1864 Ga0500644_0024450 3300053088 Bacteria 1847
1865 Ga0500646_0014216 3300053090 Bacteria 2064
1866 Ga0500646_0053402 3300053090 Bacteria 1172
1867 Ga0500646_0333222 3300053090 Bacteria 550
1868 Ga0500651_0000274 3300053093 Bacteria 30518
1869 Ga0500651_0129786 3300053093 Bacteria 1525
1870 Ga0500651_0169517 3300053093 Bacteria 1302
1871 Ga0500566_0399313 3300053094 Bacteria 616
1872 Ga0500641_0352164 3300053096 Bacteria 591
1873 Ga0500648_382663 3300053097 Bacteria 548
1874 Ga0500650_0150156 3300053098 Bacteria 1077
1875 Ga0500562_019007 3300053108 Bacteria 1775
1876 Ga0500562_081775 3300053108 Bacteria 874
1877 Ga0500569_001743 3300053109 Bacteria 4166
1878 Ga0500593_000235 3300053117 Bacteria 22775
1879 Ga0500593_079766 3300053117 Bacteria 1405
1880 Ga0500594_0013014 3300053118 Bacteria 1970
1881 Ga0500607_155896 3300053121 Bacteria 1051
1882 Ga0500608_169075 3300053122 Bacteria 939
1883 Ga0500621_000035 3300053126 Bacteria 26463
1884 Ga0500628_006199 3300053129 Bacteria 2015
1885 Ga0500628_019518 3300053129 Bacteria 1350
1886 Ga0500628_167610 3300053129 Bacteria 622
1887 Ga0500642_0002530 3300053130 Bacteria 5383
1888 Ga0500652_000400 3300053131 Bacteria 15538
1889 Ga0500652_069558 3300053131 Bacteria 1457
1890 Ga0500658_0026976 3300053134 Bacteria 2217
1891 Ga0500658_0190721 3300053134 Bacteria 935
1892 Ga0500559_0000097 3300053136 Bacteria 70124
1893 Ga0500564_150120 3300053138 Bacteria 994
1894 Ga0500568_0013644 3300053139 Bacteria 3696
1895 Ga0500568_0015583 3300053139 Bacteria 3401
1896 Ga0500568_0079576 3300053139 Bacteria 1245
1897 Ga0500577_0017376 3300053142 Bacteria 2289
1898 Ga0500579_268554 3300053143 Bacteria 534
1899 Ga0500588_0096304 3300053146 Bacteria 1014
1900 Ga0500589_225266 3300053147 Bacteria 704
1901 Ga0500604_0178893 3300053151 Bacteria 726
1902 Ga0500616_0096791 3300053153 Bacteria 1450
1903 Ga0500619_000012 3300053154 Bacteria 57280
1904 Ga0500619_259909 3300053154 Bacteria 569
1905 Ga0500620_057705 3300053155 Bacteria 1316
1906 Ga0500622_0000198 3300053156 Bacteria 63633
1907 Ga0500622_0000978 3300053156 Bacteria 24237
1908 Ga0500627_0176007 3300053158 Bacteria 963
1909 Ga0500638_200485 3300053162 Bacteria 845
1910 Ga0500636_0125261 3300053177 Bacteria 1437
1911 Ga0500649_215694 3300053722 Bacteria 601
1912 Ga0500570_133500 3300053724 Bacteria 935
1913 Ga0500645_030754 3300053730 Bacteria 1615
1914 Ga0500613_001534 3300053738 Bacteria 1645
1915 Ga0500587_000541 3300053739 Bacteria 4638
1916 Ga0500587_006132 3300053739 Bacteria 1604
1917 Ga0501084_0008704 3300054114 Bacteria 8394
1918 Ga0501084_0022568 3300054114 Bacteria 5252
1919 Ga0501084_0144399 3300054114 Bacteria 2004
1920 Ga0501084_0152777 3300054114 Bacteria 1946
1921 Ga0501084_0285140 3300054114 Bacteria 1395
1922 Ga0501084_0285445 3300054114 Bacteria 1394
1923 Ga0501084_0502704 3300054114 Bacteria 1024
1924 Ga0501084_0638875 3300054114 Bacteria 899
1925 Ga0501084_0874625 3300054114 Bacteria 756
1926 Ga0500661_024419 3300055283 Bacteria 1069
1927 Ga0590075_024840 3300059424 Bacteria 1505
1928 Ga0501082_0004231 3300060353 Bacteria 12537
1929 Ga0501082_0043889 3300060353 Bacteria 3857
1930 Ga0501082_0087089 3300060353 Bacteria 2694
1931 Ga0501082_1949896 3300060353 Bacteria 512
1932 Ga0466962_0341172 3300061719 Bacteria 745
1933 Ga0530510_0006785 3300061734 Bacteria 7977
1934 Ga0530510_0007174 3300061734 Bacteria 7756
1935 Ga0530510_0119058 3300061734 Bacteria 1938
1936 Ga0530510_0121012 3300061734 Bacteria 1922
1937 Ga0530510_0170978 3300061734 Bacteria 1609
1938 Ga0530510_0195752 3300061734 Bacteria 1501
1939 Ga0530510_0329770 3300061734 Bacteria 1145

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0026025 Ga0495649_0026025_24_338 103
2 3300047446 Ga0495679_051289 Ga0495679_051289_24_338 103
3 3300044712 Ga0453684_1793636 Ga0453684_1793636_266_607 113
4 3300046809 Ga0495600_0740671 Ga0495600_0740671_10_351 113
5 3300049529 Ga0501313_009732 Ga0501313_009732_701_1042 113
6 3300049539 Ga0501323_051180 Ga0501323_051180_212_553 113
7 3300049777 Ga0501281_07163 Ga0501281_07163_15_356 113
8 3300050489 nmdc:mga03683_177263_c1 nmdc:mga03683_177263_c1_10_351 113
9 3300053722 Ga0500649_215694 Ga0500649_215694_199_540 113
10 3300055283 Ga0500661_024419 Ga0500661_024419_712_1053 113
11 3300009093 Ga0105240_11610931 Ga0105240_116109312 117
12 3300039110 Ga0400487_16155 Ga0400487_16155_584_943 118
13 3300039437 Ga0436365_1793886 Ga0436365_1793886_142_501 119
14 3300005563 Ga0068855_100288384 Ga0068855_1002883844 120
15 3300009093 Ga0105240_10230108 Ga0105240_102301081 120
16 3300025919 Ga0207657_10109580 Ga0207657_101095802 120
17 3300025949 Ga0207667_10246512 Ga0207667_102465122 120
18 3300032005 Ga0307411_11544693 Ga0307411_115446931 120
19 3300037418 Ga0395900_0034072 Ga0395900_0034072_1664_2059 120
20 3300037471 Ga0395905_0048048 Ga0395905_0048048_1617_2012 120
21 3300038443 Ga0395901_0033769 Ga0395901_0033769_2633_3028 120
22 3300046537 Ga0495598_0388963 Ga0495598_0388963_88_483 120
23 3300046692 Ga0495671_0421684 Ga0495671_0421684_155_550 120
24 3300006871 Ga0075434_100381290 Ga0075434_1003812902 121
25 3300050512 nmdc:mga0n895_158049_c1 nmdc:mga0n895_158049_c1_1389_1784 121
26 3300035089 Ga0373944_0037967 Ga0373944_0037967_20_388 122
27 3300035113 Ga0373936_0023106 Ga0373936_0023106_2041_2409 122
28 3300041451 Ga0451791_1736819 Ga0451791_1736819_151_519 122
29 3300041503 Ga0451847_0437573 Ga0451847_0437573_10_378 122
30 3300042126 Ga0450888_000936 Ga0450888_000936_21_389 122
31 3300049536 Ga0501320_017439 Ga0501320_017439_417_785 122
32 3300049541 Ga0501325_029777 Ga0501325_029777_235_603 122
33 3300049576 Ga0501040_1098647 Ga0501040_1098647_195_563 122
34 3300049579 Ga0501043_0033943 Ga0501043_0033943_11_379 122
35 3300049653 Ga0501206_015309 Ga0501206_015309_11_379 122
36 3300049744 Ga0501083_0670429 Ga0501083_0670429_16_384 122
37 3300049824 Ga0501045_1369787 Ga0501045_1369787_134_502 122
38 3300050493 nmdc:mga0k408_43703_c1 nmdc:mga0k408_43703_c1_2195_2563 122
39 3300050512 nmdc:mga0n895_789078_c1 nmdc:mga0n895_789078_c1_560_928 122
40 3300013308 Ga0157375_10054039 Ga0157375_100540398 123
41 3300035695 Ga0373927_0296254 Ga0373927_0296254_188_583 124
42 3300042876 Ga0451577_1834259 Ga0451577_1834259_68_457 124
43 3300049130 Ga0501310_039742 Ga0501310_039742_29_418 124
44 iso_pu_bacteria 2671180115 2671589088 125
45 iso_pu_bacteria 2842733646 2842737855 125
46 iso_pu_bacteria 2844425489 2844429341 125
47 iso_pu_bacteria 2847085930 2847090216 125
48 iso_pu_bacteria 2885198086 2885203832 125
49 iso_pu_bacteria 2885211737 2885217833 125
50 iso_pu_bacteria 2904456579 2904457935 125
51 iso_pu_bacteria 2904541872 2904546672 125
52 iso_pu_bacteria 2908669403 2908674746 125
53 iso_pu_bacteria 2919704043 2919708820 125
54 iso_pu_bacteria 2928064002 2928067946 125
55 iso_pu_bacteria 2928070936 2928072519 125
56 iso_pu_bacteria 2929160207 2929166123 125
57 3300005327 Ga0070658_10646415 Ga0070658_106464151 126
58 3300005444 Ga0070694_100354195 Ga0070694_1003541952 126
59 3300005840 Ga0068870_10523936 Ga0068870_105239362 126
60 3300006871 Ga0075434_100441455 Ga0075434_1004414553 126
61 3300006914 Ga0075436_100000862 Ga0075436_10000086215 126
62 3300007076 Ga0075435_100054923 Ga0075435_1000549232 126
63 3300009147 Ga0114129_10804073 Ga0114129_108040733 126
64 3300025885 Ga0207653_10294067 Ga0207653_102940671 126
65 3300025908 Ga0207643_10876353 Ga0207643_108763532 126
66 3300028380 Ga0268265_10832986 Ga0268265_108329863 126
67 3300031911 Ga0307412_10537689 Ga0307412_105376893 126
68 3300032002 Ga0307416_100099454 Ga0307416_1000994543 126
69 3300042876 Ga0451577_0662158 Ga0451577_0662158_517_912 126
70 3300044693 Ga0466961_0117869 Ga0466961_0117869_318_713 126
71 3300044842 Ga0466957_0004472 Ga0466957_0004472_132_527 126
72 3300045049 Ga0466959_0074108 Ga0466959_0074108_670_1065 126
73 3300045836 Ga0466958_0062229 Ga0466958_0062229_1237_1632 126
74 3300050514 nmdc:mga08x19_2026_c1 nmdc:mga08x19_2026_c1_8210_8605 126
75 3300061719 Ga0466962_0341172 Ga0466962_0341172_104_499 126
76 3300009036 Ga0105244_10533668 Ga0105244_105336682 127
77 3300013102 Ga0157371_10020143 Ga0157371_100201432 127
78 3300013308 Ga0157375_10225576 Ga0157375_102255762 127
79 3300039062 Ga0400483_081993 Ga0400483_081993_2939_3325 127
80 3300039062 Ga0400483_151841 Ga0400483_151841_4139_4525 127
81 3300046458 Ga0495591_001371 Ga0495591_001371_11003_11389 127
82 3300046471 Ga0495650_0000787 Ga0495650_0000787_17226_17612 127
83 3300046474 Ga0495605_0003552 Ga0495605_0003552_2122_2508 127
84 3300046474 Ga0495605_0454085 Ga0495605_0454085_39_425 127
85 3300046491 Ga0495584_0002357 Ga0495584_0002357_1479_1865 127
86 3300046501 Ga0495607_0010060 Ga0495607_0010060_1076_1462 127
87 3300046507 Ga0495606_0004907 Ga0495606_0004907_4523_4909 127
88 3300046513 Ga0495616_0052060 Ga0495616_0052060_1114_1500 127
89 3300046518 Ga0495631_0005719 Ga0495631_0005719_1401_1787 127
90 3300046523 Ga0495644_0000420 Ga0495644_0000420_8763_9149 127
91 3300046524 Ga0495648_0007953 Ga0495648_0007953_5214_5600 127
92 3300046530 Ga0495654_0000178 Ga0495654_0000178_17187_17573 127
93 3300046692 Ga0495671_0000488 Ga0495671_0000488_13342_13728 127
94 3300046794 Ga0495589_0133864 Ga0495589_0133864_626_1012 127
95 3300046810 Ga0495660_0000352 Ga0495660_0000352_22805_23191 127
96 3300047320 Ga0495672_0000011 Ga0495672_0000011_5214_5600 127
97 3300047323 Ga0495683_0075953 Ga0495683_0075953_391_777 127
98 3300047469 Ga0495673_0002408 Ga0495673_0002408_10695_11081 127
99 3300048919 Ga0496116_0013625 Ga0496116_0013625_981_1367 127
100 3300048922 Ga0496119_0010829 Ga0496119_0010829_5130_5516 127
101 3300048923 Ga0496120_0023855 Ga0496120_0023855_438_824 127
102 3300049459 Ga0495678_000882 Ga0495678_000882_17425_17811 127
103 3300049460 Ga0495682_0000520 Ga0495682_0000520_17354_17740 127
104 3300053126 Ga0500621_000035 Ga0500621_000035_8744_9130 127
105 iso_pu_bacteria 2513020051 2513227574 127
106 iso_pu_bacteria 2513237150 2513956736 127
107 iso_pu_bacteria 2513237165 2514044435 127
108 iso_pu_bacteria 2547132103 2547375773 127
109 iso_pu_bacteria 2547132512 2548846597 127
110 iso_pu_bacteria 2585428057 2587725922 127
111 iso_pu_bacteria 2585428058 2587735573 127
112 iso_pu_bacteria 2585428062 2587758988 127
113 iso_pu_bacteria 2588253510 2588292865 127
114 iso_pu_bacteria 2599185214 2599621937 127
115 iso_pu_bacteria 2599185226 2599676899 127
116 iso_pu_bacteria 2599185227 2599685129 127
117 iso_pu_bacteria 2599185229 2599691447 127
118 iso_pu_bacteria 2643221544 2643746686 127
119 iso_pu_bacteria 2643221585 2643937422 127
120 iso_pu_bacteria 2643221592 2643967974 127
121 iso_pu_bacteria 2643221625 2644143126 127
122 iso_pu_bacteria 2643221639 2644218752 127
123 iso_pu_bacteria 2643221646 2644256839 127
124 iso_pu_bacteria 2643221648 2644271786 127
125 iso_pu_bacteria 2643221654 2644305902 127
126 iso_pu_bacteria 2643221656 2644314960 127
127 iso_pu_bacteria 2643221658 2644326991 127
128 iso_pu_bacteria 2643221660 2644338011 127
129 iso_pu_bacteria 2643221672 2644398791 127
130 iso_pu_bacteria 2643221683 2644466486 127
131 iso_pu_bacteria 2738541277 2738721910 127
132 iso_pu_bacteria 2738541307 2738882076 127
133 iso_pu_bacteria 2738541337 2739057973 127
134 iso_pu_bacteria 2738543013 2739251116 127
135 iso_pu_bacteria 2738543019 2739282274 127
136 iso_pu_bacteria 2818991446 2819598011 127
137 iso_pu_bacteria 2831265667 2831269001 127
138 iso_pu_bacteria 2831864461 2831867515 127
139 iso_pu_bacteria 2838054893 2838058427 127
140 iso_pu_bacteria 2842677519 2842678335 127
141 iso_pu_bacteria 2842747753 2842752786 127
142 iso_pu_bacteria 2846033681 2846034384 127
143 iso_pu_bacteria 2846037992 2846041875 127
144 iso_pu_bacteria 2886848708 2886854503 127
145 iso_pu_bacteria 2899924645 2899929430 127
146 iso_pu_bacteria 2901300506 2901304175 127
147 iso_pu_bacteria 2904449895 2904451081 127
148 iso_pu_bacteria 2904479285 2904482741 127
149 iso_pu_bacteria 2919462493 2919465709 127
150 iso_pu_bacteria 2928037797 2928040126 127
151 iso_pu_bacteria 2928044640 2928047125 127
152 iso_pu_bacteria 2928051484 2928057672 127
153 iso_pu_bacteria 2928084124 2928085707 127
154 iso_pu_bacteria 2929520902 2929526444 127
155 iso_pu_bacteria 2939631187 2939635356 127
156 iso_pu_bacteria 2945909444 2945914969 127
157 iso_pu_bacteria 2945945610 2945950994 127
158 iso_pu_bacteria 2945972063 2945974342 127
159 iso_pu_bacteria 2945984333 2945989628 127
160 iso_pu_bacteria 644736347 644749246 127
161 3300037312 Ga0395899_0005268 Ga0395899_0005268_7070_7459 128
162 3300037418 Ga0395900_0000542 Ga0395900_0000542_27152_27538 128
163 3300037466 Ga0395898_0003063 Ga0395898_0003063_10409_10795 128
164 3300044719 Ga0466971_0003261 Ga0466971_0003261_3956_4342 128
165 3300047471 Ga0495684_0395216 Ga0495684_0395216_23_409 128
166 3300003320 rootH2_10169529 rootH2_101695299 129
167 3300009094 Ga0111539_10002099 Ga0111539_1000209917 129
168 3300009094 Ga0111539_11423128 Ga0111539_114231282 129
169 3300034818 Ga0373950_0134707 Ga0373950_0134707_82_471 129
170 3300034820 Ga0373959_0046903 Ga0373959_0046903_188_577 129
171 3300034957 Ga0373938_0017777 Ga0373938_0017777_408_797 129
172 3300035085 Ga0373929_0098569 Ga0373929_0098569_99_488 129
173 3300035088 Ga0373940_0039203 Ga0373940_0039203_867_1256 129
174 3300035111 Ga0373923_0051212 Ga0373923_0051212_540_929 129
175 3300035112 Ga0373932_0015015 Ga0373932_0015015_261_650 129
176 3300035112 Ga0373932_0032954 Ga0373932_0032954_35_424 129
177 3300035112 Ga0373932_0138381 Ga0373932_0138381_168_557 129
178 3300035114 Ga0373939_0042238 Ga0373939_0042238_320_709 129
179 3300035114 Ga0373939_0042737 Ga0373939_0042737_636_1025 129
180 3300035116 Ga0373945_0062010 Ga0373945_0062010_391_780 129
181 3300035121 Ga0373960_0019605 Ga0373960_0019605_842_1231 129
182 3300035121 Ga0373960_0329674 Ga0373960_0329674_109_498 129
183 3300035170 Ga0373943_0205596 Ga0373943_0205596_683_1072 129
184 3300035171 Ga0373946_0367014 Ga0373946_0367014_175_564 129
185 3300035172 Ga0373955_0063660 Ga0373955_0063660_286_675 129
186 3300035172 Ga0373955_0809760 Ga0373955_0809760_27_416 129
187 3300035242 Ga0373962_0036659 Ga0373962_0036659_913_1302 129
188 3300035691 Ga0373931_0001474 Ga0373931_0001474_5611_6000 129
189 3300035691 Ga0373931_0226087 Ga0373931_0226087_617_1006 129
190 3300035695 Ga0373927_0108327 Ga0373927_0108327_674_1063 129
191 3300035725 Ga0373947_0185796 Ga0373947_0185796_520_909 129
192 3300036712 Ga0316584_0641455 Ga0316584_0641455_148_537 129
193 3300037418 Ga0395900_0770671 Ga0395900_0770671_284_673 129
194 3300038725 Ga0400484_00617 Ga0400484_00617_694_1083 129
195 3300038726 Ga0400490_00437 Ga0400490_00437_6794_7183 129
196 3300038727 Ga0400491_22688 Ga0400491_22688_149_538 129
197 3300038741 Ga0400488_24943 Ga0400488_24943_1628_2017 129
198 3300039062 Ga0400483_092373 Ga0400483_092373_1760_2149 129
199 3300039062 Ga0400483_098932 Ga0400483_098932_383_772 129
200 3300039062 Ga0400483_207547 Ga0400483_207547_1396_1785 129
201 3300039062 Ga0400483_232923 Ga0400483_232923_499_888 129
202 3300039062 Ga0400483_238884 Ga0400483_238884_963_1352 129
203 3300039062 Ga0400483_258389 Ga0400483_258389_746_1135 129
204 3300039437 Ga0436365_0023403 Ga0436365_0023403_193_582 129
205 3300041404 Ga0439436_0032700 Ga0439436_0032700_1038_1427 129
206 3300041410 Ga0439461_0013318 Ga0439461_0013318_25_414 129
207 3300041455 Ga0451801_40786 Ga0451801_40786_817_1206 129
208 3300041457 Ga0451803_03143 Ga0451803_03143_41_430 129
209 3300041458 Ga0451798_1162362 Ga0451798_1162362_258_647 129
210 3300041460 Ga0451802_1180715 Ga0451802_1180715_95_484 129
211 3300041460 Ga0451802_1195489 Ga0451802_1195489_484_873 129
212 3300041462 Ga0451806_289060 Ga0451806_289060_247_636 129
213 3300041486 Ga0451807_1280507 Ga0451807_1280507_155_544 129
214 3300041486 Ga0451807_1334682 Ga0451807_1334682_78_467 129
215 3300041492 Ga0451835_0635417 Ga0451835_0635417_628_1017 129
216 3300041507 Ga0451851_0477462 Ga0451851_0477462_168_560 129
217 3300041510 Ga0451854_06224 Ga0451854_06224_51_440 129
218 3300041512 Ga0451853_4125141 Ga0451853_4125141_123_512 129
219 3300042185 Ga0450909_005658 Ga0450909_005658_25_414 129
220 3300042461 Ga0439460_0110012 Ga0439460_0110012_52_441 129
221 3300042532 Ga0450893_0014532 Ga0450893_0014532_263_652 129
222 3300042876 Ga0451577_0168788 Ga0451577_0168788_1265_1654 129
223 3300042876 Ga0451577_0608581 Ga0451577_0608581_484_873 129
224 3300042876 Ga0451577_0626488 Ga0451577_0626488_33_422 129
225 3300044673 Ga0453683_0030079 Ga0453683_0030079_1469_1858 129
226 3300044673 Ga0453683_0041932 Ga0453683_0041932_1917_2306 129
227 3300044712 Ga0453684_0065104 Ga0453684_0065104_365_754 129
228 3300044712 Ga0453684_0462151 Ga0453684_0462151_949_1338 129
229 3300044712 Ga0453684_0473085 Ga0453684_0473085_381_818 129
230 3300044712 Ga0453684_1184361 Ga0453684_1184361_216_605 129
231 3300045051 Ga0451576_0010036 Ga0451576_0010036_5858_6247 129
232 3300045051 Ga0451576_0025038 Ga0451576_0025038_52_441 129
233 3300045051 Ga0451576_0177787 Ga0451576_0177787_563_952 129
234 3300046454 Ga0495592_0002591 Ga0495592_0002591_5732_6121 129
235 3300046457 Ga0495590_0011864 Ga0495590_0011864_1012_1401 129
236 3300046459 Ga0495629_0208823 Ga0495629_0208823_654_1043 129
237 3300046459 Ga0495629_0333459 Ga0495629_0333459_304_693 129
238 3300046463 Ga0495653_0190214 Ga0495653_0190214_360_749 129
239 3300046475 Ga0495639_0103968 Ga0495639_0103968_906_1295 129
240 3300046477 Ga0495664_0167471 Ga0495664_0167471_79_468 129
241 3300046492 Ga0495585_0262788 Ga0495585_0262788_239_628 129
242 3300046511 Ga0495608_0037016 Ga0495608_0037016_1429_1818 129
243 3300046512 Ga0495610_0146980 Ga0495610_0146980_296_685 129
244 3300046513 Ga0495616_0093680 Ga0495616_0093680_573_962 129
245 3300046515 Ga0495620_0086369 Ga0495620_0086369_18_407 129
246 3300046516 Ga0495628_0102358 Ga0495628_0102358_1413_1802 129
247 3300046516 Ga0495628_0375959 Ga0495628_0375959_440_829 129
248 3300046519 Ga0495632_0014757 Ga0495632_0014757_3273_3662 129
249 3300046519 Ga0495632_0082343 Ga0495632_0082343_85_474 129
250 3300046528 Ga0495642_0009990 Ga0495642_0009990_256_645 129
251 3300046528 Ga0495642_0130268 Ga0495642_0130268_525_914 129
252 3300046531 Ga0495665_0139846 Ga0495665_0139846_752_1141 129
253 3300046536 Ga0495587_0030902 Ga0495587_0030902_192_581 129
254 3300046539 Ga0495621_0111975 Ga0495621_0111975_430_819 129
255 3300046539 Ga0495621_0536312 Ga0495621_0536312_94_483 129
256 3300046543 Ga0495645_0004671 Ga0495645_0004671_1579_1968 129
257 3300046557 Ga0495622_0288324 Ga0495622_0288324_260_649 129
258 3300046615 Ga0495656_0056918 Ga0495656_0056918_30_419 129
259 3300046615 Ga0495656_0140084 Ga0495656_0140084_479_868 129
260 3300046616 Ga0495668_0164067 Ga0495668_0164067_342_731 129
261 3300046660 Ga0495625_0020303 Ga0495625_0020303_694_1083 129
262 3300046660 Ga0495625_0102533 Ga0495625_0102533_1198_1587 129
263 3300046663 Ga0495635_0032495 Ga0495635_0032495_878_1267 129
264 3300046664 Ga0495659_0382341 Ga0495659_0382341_40_429 129
265 3300046674 Ga0495588_0009938 Ga0495588_0009938_554_943 129
266 3300046675 Ga0495657_0043896 Ga0495657_0043896_2044_2433 129
267 3300046675 Ga0495657_0355767 Ga0495657_0355767_418_807 129
268 3300046675 Ga0495657_0697551 Ga0495657_0697551_170_559 129
269 3300046678 Ga0495599_0001475 Ga0495599_0001475_496_885 129
270 3300046679 Ga0495623_0049231 Ga0495623_0049231_321_710 129
271 3300046683 Ga0495658_0134744 Ga0495658_0134744_224_613 129
272 3300046683 Ga0495658_0283602 Ga0495658_0283602_185_574 129
273 3300046683 Ga0495658_0296678 Ga0495658_0296678_103_492 129
274 3300046692 Ga0495671_0305034 Ga0495671_0305034_343_732 129
275 3300046692 Ga0495671_0415091 Ga0495671_0415091_231_620 129
276 3300046694 Ga0495649_0006057 Ga0495649_0006057_5734_6123 129
277 3300046794 Ga0495589_0074447 Ga0495589_0074447_603_992 129
278 3300046810 Ga0495660_0151509 Ga0495660_0151509_155_544 129
279 3300047318 Ga0495636_0078088 Ga0495636_0078088_549_938 129
280 3300047320 Ga0495672_0124253 Ga0495672_0124253_968_1357 129
281 3300047322 Ga0495680_0156938 Ga0495680_0156938_1087_1476 129
282 3300047443 Ga0495687_036928 Ga0495687_036928_1083_1472 129
283 3300047471 Ga0495684_0188245 Ga0495684_0188245_342_731 129
284 3300047472 Ga0495686_0177695 Ga0495686_0177695_565_954 129
285 3300048088 Ga0495602_0365616 Ga0495602_0365616_82_471 129
286 3300048903 Ga0496100_0076364 Ga0496100_0076364_475_864 129
287 3300048903 Ga0496100_0546982 Ga0496100_0546982_366_755 129
288 3300048904 Ga0496101_0024728 Ga0496101_0024728_3174_3563 129
289 3300048904 Ga0496101_0463082 Ga0496101_0463082_137_526 129
290 3300048905 Ga0496102_0007579 Ga0496102_0007579_4023_4412 129
291 3300048907 Ga0496104_0008378 Ga0496104_0008378_7404_7793 129
292 3300048907 Ga0496104_0104722 Ga0496104_0104722_1261_1650 129
293 3300048907 Ga0496104_0579646 Ga0496104_0579646_581_970 129
294 3300048908 Ga0496105_0009457 Ga0496105_0009457_86_475 129
295 3300048909 Ga0496106_0453539 Ga0496106_0453539_364_753 129
296 3300048910 Ga0496107_0280025 Ga0496107_0280025_448_837 129
297 3300048910 Ga0496107_0429419 Ga0496107_0429419_559_948 129
298 3300048910 Ga0496107_0695193 Ga0496107_0695193_282_671 129
299 3300048911 Ga0496108_0042133 Ga0496108_0042133_513_902 129
300 3300048911 Ga0496108_0356402 Ga0496108_0356402_340_729 129
301 3300048911 Ga0496108_0406535 Ga0496108_0406535_762_1151 129
302 3300048913 Ga0496110_0026383 Ga0496110_0026383_1398_1787 129
303 3300048913 Ga0496110_0367167 Ga0496110_0367167_812_1201 129
304 3300048914 Ga0496111_0004330 Ga0496111_0004330_2614_3003 129
305 3300048915 Ga0496112_0411585 Ga0496112_0411585_360_749 129
306 3300048916 Ga0496113_0310758 Ga0496113_0310758_446_835 129
307 3300048917 Ga0496114_0198844 Ga0496114_0198844_369_758 129
308 3300048918 Ga0496115_0446021 Ga0496115_0446021_175_564 129
309 3300048926 Ga0496123_0395689 Ga0496123_0395689_61_450 129
310 3300049127 Ga0501306_010649 Ga0501306_010649_340_729 129
311 3300049128 Ga0501308_000386 Ga0501308_000386_1705_2094 129
312 3300049128 Ga0501308_012337 Ga0501308_012337_514_903 129
313 3300049129 Ga0501309_007735 Ga0501309_007735_127_516 129
314 3300049129 Ga0501309_015019 Ga0501309_015019_436_825 129
315 3300049160 Ga0501304_009642 Ga0501304_009642_26_415 129
316 3300049161 Ga0501305_009585 Ga0501305_009585_108_497 129
317 3300049161 Ga0501305_122394 Ga0501305_122394_23_412 129
318 3300049459 Ga0495678_217698 Ga0495678_217698_98_487 129
319 3300049460 Ga0495682_0058348 Ga0495682_0058348_831_1220 129
320 3300049513 Ga0501290_008662 Ga0501290_008662_377_766 129
321 3300049515 Ga0501292_005043 Ga0501292_005043_481_870 129
322 3300049527 Ga0501311_004807 Ga0501311_004807_842_1231 129
323 3300049527 Ga0501311_039844 Ga0501311_039844_145_534 129
324 3300049528 Ga0501312_002743 Ga0501312_002743_433_822 129
325 3300049528 Ga0501312_101904 Ga0501312_101904_26_415 129
326 3300049529 Ga0501313_004401 Ga0501313_004401_381_770 129
327 3300049531 Ga0501315_031783 Ga0501315_031783_116_505 129
328 3300049532 Ga0501316_001021 Ga0501316_001021_1115_1504 129
329 3300049534 Ga0501318_000548 Ga0501318_000548_1083_1472 129
330 3300049536 Ga0501320_002265 Ga0501320_002265_794_1183 129
331 3300049572 Ga0501036_0230381 Ga0501036_0230381_923_1315 129
332 3300049573 Ga0501037_0024581 Ga0501037_0024581_3283_3672 129
333 3300049574 Ga0501038_0090870 Ga0501038_0090870_685_1074 129
334 3300049576 Ga0501040_0157352 Ga0501040_0157352_908_1300 129
335 3300049576 Ga0501040_0315558 Ga0501040_0315558_428_820 129
336 3300049578 Ga0501042_0295714 Ga0501042_0295714_444_833 129
337 3300049578 Ga0501042_1295130 Ga0501042_1295130_125_514 129
338 3300049582 Ga0501048_0067468 Ga0501048_0067468_1115_1504 129
339 3300049586 Ga0501070_0297912 Ga0501070_0297912_285_674 129
340 3300049587 Ga0501071_0003527 Ga0501071_0003527_8417_8806 129
341 3300049587 Ga0501071_0160335 Ga0501071_0160335_608_1000 129
342 3300049588 Ga0501072_0321792 Ga0501072_0321792_807_1199 129
343 3300049588 Ga0501072_0407521 Ga0501072_0407521_306_698 129
344 3300049590 Ga0501074_0222352 Ga0501074_0222352_478_867 129
345 3300049591 Ga0501075_0055471 Ga0501075_0055471_1100_1489 129
346 3300049591 Ga0501075_0062590 Ga0501075_0062590_1367_1759 129
347 3300049591 Ga0501075_0307152 Ga0501075_0307152_73_465 129
348 3300049592 Ga0501076_0079520 Ga0501076_0079520_1508_1900 129
349 3300049593 Ga0501077_0271589 Ga0501077_0271589_542_934 129
350 3300049653 Ga0501206_009648 Ga0501206_009648_464_853 129
351 3300049654 Ga0501207_022199 Ga0501207_022199_457_846 129
352 3300049741 Ga0501079_0179169 Ga0501079_0179169_490_879 129
353 3300049742 Ga0501080_0037660 Ga0501080_0037660_3371_3760 129
354 3300049742 Ga0501080_0286093 Ga0501080_0286093_898_1290 129
355 3300049742 Ga0501080_0748801 Ga0501080_0748801_55_444 129
356 3300049762 Ga0501265_013043 Ga0501265_013043_465_854 129
357 3300049824 Ga0501045_0477922 Ga0501045_0477922_156_548 129
358 3300050491 nmdc:mga00v17_1065507_c1 nmdc:mga00v17_1065507_c1_74_463 129
359 3300050491 nmdc:mga00v17_17620_c1 nmdc:mga00v17_17620_c1_2710_3099 129
360 3300050491 nmdc:mga00v17_744286_c1 nmdc:mga00v17_744286_c1_95_484 129
361 3300050492 nmdc:mga0yw44_11539_c1 nmdc:mga0yw44_11539_c1_371_760 129
362 3300050492 nmdc:mga0yw44_283449_c1 nmdc:mga0yw44_283449_c1_347_736 129
363 3300050493 nmdc:mga0k408_145503_c1 nmdc:mga0k408_145503_c1_892_1281 129
364 3300050493 nmdc:mga0k408_57150_c1 nmdc:mga0k408_57150_c1_107_496 129
365 3300050493 nmdc:mga0k408_65064_c1 nmdc:mga0k408_65064_c1_923_1312 129
366 3300050493 nmdc:mga0k408_712_c1 nmdc:mga0k408_712_c1_3816_4205 129
367 3300050496 nmdc:mga07m45_109788_c1 nmdc:mga07m45_109788_c1_653_1042 129
368 3300050496 nmdc:mga07m45_15127_c1 nmdc:mga07m45_15127_c1_2782_3171 129
369 3300050496 nmdc:mga07m45_69529_c1 nmdc:mga07m45_69529_c1_399_788 129
370 3300050496 nmdc:mga07m45_752759_c1 nmdc:mga07m45_752759_c1_110_499 129
371 3300050509 nmdc:mga0qj67_274367_c1 nmdc:mga0qj67_274367_c1_524_913 129
372 3300050511 nmdc:mga08y16_2559_c1 nmdc:mga08y16_2559_c1_13018_13407 129
373 3300050511 nmdc:mga08y16_977479_c1 nmdc:mga08y16_977479_c1_86_475 129
374 3300050513 nmdc:mga0rr50_474247_c1 nmdc:mga0rr50_474247_c1_182_571 129
375 3300050516 nmdc:mga0sz30_3989_c1 nmdc:mga0sz30_3989_c1_2882_3271 129
376 3300053077 Ga0495601_0002182 Ga0495601_0002182_795_1184 129
377 3300053083 Ga0495655_0065643 Ga0495655_0065643_149_538 129
378 3300053085 Ga0495619_0071847 Ga0495619_0071847_1652_2041 129
379 3300053093 Ga0500651_0129786 Ga0500651_0129786_421_810 129
380 3300053122 Ga0500608_169075 Ga0500608_169075_417_806 129
381 3300053129 Ga0500628_167610 Ga0500628_167610_52_534 129
382 3300053134 Ga0500658_0026976 Ga0500658_0026976_235_624 129
383 3300053158 Ga0500627_0176007 Ga0500627_0176007_266_655 129
384 3300053738 Ga0500613_001534 Ga0500613_001534_524_913 129
385 3300054114 Ga0501084_0152777 Ga0501084_0152777_461_853 129
386 3300054114 Ga0501084_0285140 Ga0501084_0285140_857_1249 129
387 3300060353 Ga0501082_1949896 Ga0501082_1949896_19_411 129
388 3300061734 Ga0530510_0121012 Ga0530510_0121012_127_519 129
389 3300061734 Ga0530510_0329770 Ga0530510_0329770_659_1051 129
390 3300009098 Ga0105245_10397024 Ga0105245_103970242 130
391 3300010375 Ga0105239_11816629 Ga0105239_118166292 130
392 3300025960 Ga0207651_10247449 Ga0207651_102474492 130
393 3300031235 Ga0265330_10024527 Ga0265330_100245272 130
394 3300031238 Ga0265332_10001783 Ga0265332_100017838 130
395 3300031239 Ga0265328_10020219 Ga0265328_100202194 130
396 3300031241 Ga0265325_10057810 Ga0265325_100578103 130
397 3300031250 Ga0265331_10000635 Ga0265331_1000063534 130
398 3300031251 Ga0265327_10031432 Ga0265327_100314322 130
399 3300031344 Ga0265316_10021393 Ga0265316_100213934 130
400 3300031548 Ga0307408_100519381 Ga0307408_1005193812 130
401 3300031711 Ga0265314_10070955 Ga0265314_100709555 130
402 3300032168 Ga0316593_10000520 Ga0316593_100005206 130
403 3300033524 Ga0316592_1032584 Ga0316592_10325842 130
404 3300033541 Ga0316596_1000040 Ga0316596_100004012 130
405 3300036401 Ga0373937_0990449 Ga0373937_0990449_282_674 130
406 3300036647 Ga0316582_0054399 Ga0316582_0054399_467_859 130
407 3300037312 Ga0395899_0342891 Ga0395899_0342891_445_837 130
408 3300042435 Ga0439434_0095345 Ga0439434_0095345_31_423 130
409 3300046683 Ga0495658_0277267 Ga0495658_0277267_195_587 130
410 3300049529 Ga0501313_018129 Ga0501313_018129_73_465 130
411 3300049531 Ga0501315_013634 Ga0501315_013634_211_603 130
412 3300049572 Ga0501036_1443853 Ga0501036_1443853_96_488 130
413 3300049576 Ga0501040_0716304 Ga0501040_0716304_133_525 130
414 3300049577 Ga0501041_0275567 Ga0501041_0275567_504_896 130
415 3300049578 Ga0501042_0144131 Ga0501042_0144131_1036_1428 130
416 3300049587 Ga0501071_1294920 Ga0501071_1294920_154_546 130
417 3300049588 Ga0501072_0916870 Ga0501072_0916870_31_423 130
418 3300049591 Ga0501075_0247801 Ga0501075_0247801_116_508 130
419 3300053085 Ga0495619_0656583 Ga0495619_0656583_69_461 130
420 3300054114 Ga0501084_0285445 Ga0501084_0285445_231_623 130
421 2162886007 SwRhRL2b_contig_1228071 SwRhRL2b_0093.00004480 131
422 3300000546 LJNas_1015535 LJNas_10155352 131
423 3300001976 JGI24752J21851_1044283 JGI24752J21851_10442831 131
424 3300001978 JGI24747J21853_1009316 JGI24747J21853_10093163 131
425 3300001989 JGI24739J22299_10006228 JGI24739J22299_100062287 131
426 3300002070 JGI24750J21931_1030210 JGI24750J21931_10302101 131
427 3300002077 JGI24744J21845_10066100 JGI24744J21845_100661001 131
428 3300002126 JGI24035J26624_1018097 JGI24035J26624_10180971 131
429 3300002155 JGI24033J26618_1051580 JGI24033J26618_10515802 131
430 3300002244 JGI24742J22300_10015246 JGI24742J22300_100152463 131
431 3300002739 JGI25158J39367_1016229 JGI25158J39367_10162292 131
432 3300002773 JGI25152J39213_1001073 JGI25152J39213_100107310 131
433 3300002774 JGI25150J39212_1003907 JGI25150J39212_10039074 131
434 3300002987 JGI25159J45721_1048433 JGI25159J45721_10484331 131
435 3300003162 Ga0006778J45830_1009213 Ga0006778J45830_100921317 131
436 3300003163 Ga0006759J45824_1029126 Ga0006759J45824_10291265 131
437 3300003163 Ga0006759J45824_1064290 Ga0006759J45824_10642901 131
438 3300003215 JGI25153J46596_10007740 JGI25153J46596_100077407 131
439 3300003215 JGI25153J46596_10008637 JGI25153J46596_100086373 131
440 3300003300 Ga0006758J48902_1016024 Ga0006758J48902_10160244 131
441 3300003305 Ga0006770J48903_1001899 Ga0006770J48903_10018999 131
442 3300003308 Ga0006777J48905_1014855 Ga0006777J48905_10148555 131
443 3300003308 Ga0006777J48905_1103387 Ga0006777J48905_11033872 131
444 3300003322 rootL2_10001301 rootL2_100013019 131
445 3300003347 JGI26128J50194_1000191 JGI26128J50194_10001912 131
446 3300003504 JGI26138J51218_106156 JGI26138J51218_1061561 131
447 3300003559 Ga0007427J51700_118227 Ga0007427J51700_1182273 131
448 3300003575 Ga0007409J51694_1045076 Ga0007409J51694_10450762 131
449 3300003575 Ga0007409J51694_1147697 Ga0007409J51694_11476971 131
450 3300003577 Ga0007416J51690_1051124 Ga0007416J51690_10511245 131
451 3300003579 Ga0007429J51699_1075853 Ga0007429J51699_10758532 131
452 3300003693 Ga0032354_1038952 Ga0032354_10389523 131
453 3300003693 Ga0032354_1072421 Ga0032354_10724211 131
454 3300003693 Ga0032354_1076006 Ga0032354_10760061 131
455 3300003752 Ga0055539_1013170 Ga0055539_10131701 131
456 3300003771 Ga0055526_1000791 Ga0055526_100079115 131
457 3300003791 Ga0055530_10019398 Ga0055530_100193981 131
458 3300004803 Ga0058862_10046561 Ga0058862_100465617 131
459 3300005262 Ga0065165_1001259 Ga0065165_10012591 131
460 3300005288 Ga0065714_10138237 Ga0065714_101382373 131
461 3300005289 Ga0065704_10187738 Ga0065704_101877382 131
462 3300005290 Ga0065712_10080555 Ga0065712_100805555 131
463 3300005290 Ga0065712_10107042 Ga0065712_101070422 131
464 3300005290 Ga0065712_10788760 Ga0065712_107887601 131
465 3300005293 Ga0065715_10005249 Ga0065715_100052491 131
466 3300005293 Ga0065715_10024824 Ga0065715_100248243 131
467 3300005293 Ga0065715_10636148 Ga0065715_106361481 131
468 3300005295 Ga0065707_10401468 Ga0065707_104014682 131
469 3300005327 Ga0070658_10152764 Ga0070658_101527644 131
470 3300005327 Ga0070658_10160545 Ga0070658_101605454 131
471 3300005327 Ga0070658_10996892 Ga0070658_109968921 131
472 3300005328 Ga0070676_10002282 Ga0070676_100022823 131
473 3300005328 Ga0070676_10021276 Ga0070676_100212764 131
474 3300005328 Ga0070676_10052224 Ga0070676_100522241 131
475 3300005328 Ga0070676_10078497 Ga0070676_100784973 131
476 3300005328 Ga0070676_10294672 Ga0070676_102946723 131
477 3300005328 Ga0070676_10334482 Ga0070676_103344822 131
478 3300005328 Ga0070676_10684369 Ga0070676_106843692 131
479 3300005328 Ga0070676_11223034 Ga0070676_112230341 131
480 3300005329 Ga0070683_100315172 Ga0070683_1003151721 131
481 3300005329 Ga0070683_100470633 Ga0070683_1004706333 131
482 3300005329 Ga0070683_101311876 Ga0070683_1013118761 131
483 3300005330 Ga0070690_100006927 Ga0070690_1000069279 131
484 3300005330 Ga0070690_100231854 Ga0070690_1002318541 131
485 3300005330 Ga0070690_101044094 Ga0070690_1010440941 131
486 3300005330 Ga0070690_101437765 Ga0070690_1014377651 131
487 3300005331 Ga0070670_100023628 Ga0070670_1000236283 131
488 3300005331 Ga0070670_100054237 Ga0070670_1000542374 131
489 3300005331 Ga0070670_100064589 Ga0070670_1000645894 131
490 3300005331 Ga0070670_100065507 Ga0070670_1000655076 131
491 3300005331 Ga0070670_100183537 Ga0070670_1001835373 131
492 3300005331 Ga0070670_100305986 Ga0070670_1003059863 131
493 3300005331 Ga0070670_100436330 Ga0070670_1004363302 131
494 3300005331 Ga0070670_101289446 Ga0070670_1012894462 131
495 3300005333 Ga0070677_10126334 Ga0070677_101263341 131
496 3300005333 Ga0070677_10384582 Ga0070677_103845821 131
497 3300005333 Ga0070677_10614212 Ga0070677_106142122 131
498 3300005334 Ga0068869_100077114 Ga0068869_1000771145 131
499 3300005334 Ga0068869_100146255 Ga0068869_1001462553 131
500 3300005334 Ga0068869_100263074 Ga0068869_1002630743 131
501 3300005334 Ga0068869_100284560 Ga0068869_1002845601 131
502 3300005334 Ga0068869_100900370 Ga0068869_1009003702 131
503 3300005335 Ga0070666_10221816 Ga0070666_102218161 131
504 3300005335 Ga0070666_10235916 Ga0070666_102359162 131
505 3300005335 Ga0070666_10239237 Ga0070666_102392371 131
506 3300005335 Ga0070666_10589561 Ga0070666_105895612 131
507 3300005336 Ga0070680_100032809 Ga0070680_1000328097 131
508 3300005337 Ga0070682_100031523 Ga0070682_1000315237 131
509 3300005337 Ga0070682_100057764 Ga0070682_1000577644 131
510 3300005337 Ga0070682_100093827 Ga0070682_1000938274 131
511 3300005337 Ga0070682_100149406 Ga0070682_1001494064 131
512 3300005337 Ga0070682_100351164 Ga0070682_1003511642 131
513 3300005337 Ga0070682_100881295 Ga0070682_1008812952 131
514 3300005338 Ga0068868_100133352 Ga0068868_1001333522 131
515 3300005338 Ga0068868_100211639 Ga0068868_1002116391 131
516 3300005338 Ga0068868_100449603 Ga0068868_1004496032 131
517 3300005338 Ga0068868_100578715 Ga0068868_1005787152 131
518 3300005338 Ga0068868_100797352 Ga0068868_1007973522 131
519 3300005338 Ga0068868_100874744 Ga0068868_1008747441 131
520 3300005338 Ga0068868_102073964 Ga0068868_1020739641 131
521 3300005338 Ga0068868_102090024 Ga0068868_1020900241 131
522 3300005339 Ga0070660_100467133 Ga0070660_1004671332 131
523 3300005339 Ga0070660_100475236 Ga0070660_1004752362 131
524 3300005339 Ga0070660_100572021 Ga0070660_1005720212 131
525 3300005339 Ga0070660_101051513 Ga0070660_1010515131 131
526 3300005339 Ga0070660_101233271 Ga0070660_1012332711 131
527 3300005340 Ga0070689_100015417 Ga0070689_10001541711 131
528 3300005340 Ga0070689_100546341 Ga0070689_1005463412 131
529 3300005340 Ga0070689_100756953 Ga0070689_1007569532 131
530 3300005340 Ga0070689_100903169 Ga0070689_1009031692 131
531 3300005341 Ga0070691_10071558 Ga0070691_100715584 131
532 3300005343 Ga0070687_100132497 Ga0070687_1001324973 131
533 3300005343 Ga0070687_100201346 Ga0070687_1002013462 131
534 3300005344 Ga0070661_100092952 Ga0070661_1000929524 131
535 3300005344 Ga0070661_100105291 Ga0070661_1001052914 131
536 3300005344 Ga0070661_100476134 Ga0070661_1004761342 131
537 3300005344 Ga0070661_100979681 Ga0070661_1009796812 131
538 3300005347 Ga0070668_100072291 Ga0070668_1000722916 131
539 3300005347 Ga0070668_100277179 Ga0070668_1002771793 131
540 3300005347 Ga0070668_100603159 Ga0070668_1006031592 131
541 3300005347 Ga0070668_100707992 Ga0070668_1007079922 131
542 3300005353 Ga0070669_100017536 Ga0070669_1000175365 131
543 3300005353 Ga0070669_100031250 Ga0070669_1000312507 131
544 3300005353 Ga0070669_100306076 Ga0070669_1003060763 131
545 3300005353 Ga0070669_100685263 Ga0070669_1006852631 131
546 3300005354 Ga0070675_100044665 Ga0070675_1000446655 131
547 3300005354 Ga0070675_100107037 Ga0070675_1001070374 131
548 3300005354 Ga0070675_100124843 Ga0070675_1001248432 131
549 3300005354 Ga0070675_100131492 Ga0070675_1001314923 131
550 3300005354 Ga0070675_100137403 Ga0070675_1001374034 131
551 3300005354 Ga0070675_100188013 Ga0070675_1001880133 131
552 3300005354 Ga0070675_100347697 Ga0070675_1003476972 131
553 3300005354 Ga0070675_100413240 Ga0070675_1004132402 131
554 3300005355 Ga0070671_100019537 Ga0070671_1000195377 131
555 3300005355 Ga0070671_100085884 Ga0070671_1000858845 131
556 3300005355 Ga0070671_100133178 Ga0070671_1001331784 131
557 3300005355 Ga0070671_100189988 Ga0070671_1001899882 131
558 3300005355 Ga0070671_100383911 Ga0070671_1003839111 131
559 3300005355 Ga0070671_100963231 Ga0070671_1009632311 131
560 3300005356 Ga0070674_100039880 Ga0070674_1000398806 131
561 3300005356 Ga0070674_100056124 Ga0070674_1000561245 131
562 3300005356 Ga0070674_100096649 Ga0070674_1000966494 131
563 3300005356 Ga0070674_100310754 Ga0070674_1003107542 131
564 3300005356 Ga0070674_100364718 Ga0070674_1003647182 131
565 3300005356 Ga0070674_100399417 Ga0070674_1003994173 131
566 3300005356 Ga0070674_100667031 Ga0070674_1006670312 131
567 3300005356 Ga0070674_100687011 Ga0070674_1006870112 131
568 3300005356 Ga0070674_100854573 Ga0070674_1008545732 131
569 3300005356 Ga0070674_101003197 Ga0070674_1010031972 131
570 3300005356 Ga0070674_101903081 Ga0070674_1019030811 131
571 3300005364 Ga0070673_100015167 Ga0070673_1000151679 131
572 3300005364 Ga0070673_100034303 Ga0070673_1000343035 131
573 3300005364 Ga0070673_100092283 Ga0070673_1000922834 131
574 3300005364 Ga0070673_100192497 Ga0070673_1001924972 131
575 3300005364 Ga0070673_100341751 Ga0070673_1003417513 131
576 3300005364 Ga0070673_100682053 Ga0070673_1006820532 131
577 3300005365 Ga0070688_100100587 Ga0070688_1001005873 131
578 3300005365 Ga0070688_100304757 Ga0070688_1003047573 131
579 3300005365 Ga0070688_100375525 Ga0070688_1003755252 131
580 3300005366 Ga0070659_100250633 Ga0070659_1002506331 131
581 3300005366 Ga0070659_100378036 Ga0070659_1003780362 131
582 3300005366 Ga0070659_100428407 Ga0070659_1004284072 131
583 3300005366 Ga0070659_100865268 Ga0070659_1008652681 131
584 3300005366 Ga0070659_101257943 Ga0070659_1012579431 131
585 3300005366 Ga0070659_101322051 Ga0070659_1013220511 131
586 3300005366 Ga0070659_101646251 Ga0070659_1016462512 131
587 3300005367 Ga0070667_100022362 Ga0070667_1000223628 131
588 3300005367 Ga0070667_100083378 Ga0070667_1000833784 131
589 3300005367 Ga0070667_100129962 Ga0070667_1001299624 131
590 3300005367 Ga0070667_100158747 Ga0070667_1001587472 131
591 3300005367 Ga0070667_100191574 Ga0070667_1001915741 131
592 3300005367 Ga0070667_100204785 Ga0070667_1002047853 131
593 3300005367 Ga0070667_100231002 Ga0070667_1002310023 131
594 3300005434 Ga0070709_10079106 Ga0070709_100791064 131
595 3300005434 Ga0070709_10501440 Ga0070709_105014402 131
596 3300005434 Ga0070709_11202713 Ga0070709_112027132 131
597 3300005435 Ga0070714_100019666 Ga0070714_1000196669 131
598 3300005436 Ga0070713_100092760 Ga0070713_1000927603 131
599 3300005437 Ga0070710_10297749 Ga0070710_102977492 131
600 3300005438 Ga0070701_10012276 Ga0070701_100122762 131
601 3300005438 Ga0070701_10134721 Ga0070701_101347211 131
602 3300005438 Ga0070701_10711485 Ga0070701_107114851 131
603 3300005439 Ga0070711_101263279 Ga0070711_1012632791 131
604 3300005440 Ga0070705_101369690 Ga0070705_1013696902 131
605 3300005441 Ga0070700_100111081 Ga0070700_1001110814 131
606 3300005441 Ga0070700_100185857 Ga0070700_1001858572 131
607 3300005441 Ga0070700_100203545 Ga0070700_1002035452 131
608 3300005441 Ga0070700_100366844 Ga0070700_1003668441 131
609 3300005441 Ga0070700_100575157 Ga0070700_1005751572 131
610 3300005444 Ga0070694_100435416 Ga0070694_1004354162 131
611 3300005444 Ga0070694_101210701 Ga0070694_1012107012 131
612 3300005455 Ga0070663_100003492 Ga0070663_1000034923 131
613 3300005455 Ga0070663_100383305 Ga0070663_1003833052 131
614 3300005455 Ga0070663_100460622 Ga0070663_1004606223 131
615 3300005455 Ga0070663_101254864 Ga0070663_1012548642 131
616 3300005455 Ga0070663_101578771 Ga0070663_1015787712 131
617 3300005456 Ga0070678_100082508 Ga0070678_1000825085 131
618 3300005456 Ga0070678_100104114 Ga0070678_1001041143 131
619 3300005456 Ga0070678_100137945 Ga0070678_1001379452 131
620 3300005456 Ga0070678_100500637 Ga0070678_1005006371 131
621 3300005456 Ga0070678_100776147 Ga0070678_1007761472 131
622 3300005456 Ga0070678_100914938 Ga0070678_1009149382 131
623 3300005457 Ga0070662_100051713 Ga0070662_1000517135 131
624 3300005457 Ga0070662_100193386 Ga0070662_1001933862 131
625 3300005457 Ga0070662_100613806 Ga0070662_1006138061 131
626 3300005457 Ga0070662_100782507 Ga0070662_1007825071 131
627 3300005458 Ga0070681_10088377 Ga0070681_100883775 131
628 3300005459 Ga0068867_100000552 Ga0068867_10000055223 131
629 3300005459 Ga0068867_100002598 Ga0068867_10000259811 131
630 3300005459 Ga0068867_100011425 Ga0068867_1000114255 131
631 3300005459 Ga0068867_100064867 Ga0068867_1000648675 131
632 3300005459 Ga0068867_100069225 Ga0068867_1000692251 131
633 3300005459 Ga0068867_100087646 Ga0068867_1000876464 131
634 3300005459 Ga0068867_100276422 Ga0068867_1002764221 131
635 3300005459 Ga0068867_100284808 Ga0068867_1002848083 131
636 3300005459 Ga0068867_100292499 Ga0068867_1002924992 131
637 3300005459 Ga0068867_100336428 Ga0068867_1003364281 131
638 3300005459 Ga0068867_100582762 Ga0068867_1005827623 131
639 3300005459 Ga0068867_100695754 Ga0068867_1006957541 131
640 3300005466 Ga0070685_10075272 Ga0070685_100752723 131
641 3300005466 Ga0070685_10101298 Ga0070685_101012981 131
642 3300005466 Ga0070685_10394830 Ga0070685_103948301 131
643 3300005466 Ga0070685_10423778 Ga0070685_104237782 131
644 3300005466 Ga0070685_10454733 Ga0070685_104547332 131
645 3300005467 Ga0070706_101474223 Ga0070706_1014742231 131
646 3300005468 Ga0070707_100905496 Ga0070707_1009054962 131
647 3300005518 Ga0070699_101072406 Ga0070699_1010724062 131
648 3300005530 Ga0070679_100007565 Ga0070679_1000075657 131
649 3300005530 Ga0070679_101164604 Ga0070679_1011646042 131
650 3300005535 Ga0070684_100178663 Ga0070684_1001786633 131
651 3300005535 Ga0070684_100247020 Ga0070684_1002470203 131
652 3300005536 Ga0070697_100735690 Ga0070697_1007356902 131
653 3300005539 Ga0068853_100320550 Ga0068853_1003205502 131
654 3300005539 Ga0068853_100330775 Ga0068853_1003307751 131
655 3300005539 Ga0068853_100868330 Ga0068853_1008683302 131
656 3300005539 Ga0068853_100880616 Ga0068853_1008806161 131
657 3300005539 Ga0068853_100930104 Ga0068853_1009301042 131
658 3300005539 Ga0068853_101141703 Ga0068853_1011417031 131
659 3300005543 Ga0070672_100006187 Ga0070672_10000618712 131
660 3300005543 Ga0070672_100010859 Ga0070672_10001085912 131
661 3300005543 Ga0070672_100044598 Ga0070672_1000445985 131
662 3300005543 Ga0070672_100198587 Ga0070672_1001985873 131
663 3300005543 Ga0070672_100378493 Ga0070672_1003784932 131
664 3300005543 Ga0070672_100571956 Ga0070672_1005719562 131
665 3300005543 Ga0070672_100747572 Ga0070672_1007475722 131
666 3300005543 Ga0070672_101096081 Ga0070672_1010960812 131
667 3300005543 Ga0070672_101600140 Ga0070672_1016001401 131
668 3300005543 Ga0070672_101794085 Ga0070672_1017940851 131
669 3300005544 Ga0070686_100304762 Ga0070686_1003047622 131
670 3300005544 Ga0070686_100621476 Ga0070686_1006214761 131
671 3300005545 Ga0070695_100207075 Ga0070695_1002070753 131
672 3300005545 Ga0070695_100315217 Ga0070695_1003152172 131
673 3300005546 Ga0070696_100094917 Ga0070696_1000949172 131
674 3300005547 Ga0070693_100023342 Ga0070693_1000233425 131
675 3300005547 Ga0070693_100069686 Ga0070693_1000696863 131
676 3300005548 Ga0070665_100320840 Ga0070665_1003208402 131
677 3300005548 Ga0070665_100373744 Ga0070665_1003737443 131
678 3300005548 Ga0070665_100468764 Ga0070665_1004687642 131
679 3300005548 Ga0070665_100552322 Ga0070665_1005523222 131
680 3300005548 Ga0070665_100751082 Ga0070665_1007510822 131
681 3300005549 Ga0070704_100096958 Ga0070704_1000969583 131
682 3300005549 Ga0070704_102227173 Ga0070704_1022271731 131
683 3300005563 Ga0068855_100040434 Ga0068855_1000404347 131
684 3300005563 Ga0068855_100058607 Ga0068855_1000586072 131
685 3300005563 Ga0068855_100490245 Ga0068855_1004902453 131
686 3300005564 Ga0070664_100155787 Ga0070664_1001557875 131
687 3300005564 Ga0070664_100238231 Ga0070664_1002382314 131
688 3300005564 Ga0070664_100273368 Ga0070664_1002733681 131
689 3300005564 Ga0070664_100284562 Ga0070664_1002845621 131
690 3300005564 Ga0070664_100380435 Ga0070664_1003804353 131
691 3300005564 Ga0070664_102024331 Ga0070664_1020243311 131
692 3300005564 Ga0070664_102082275 Ga0070664_1020822752 131
693 3300005577 Ga0068857_100040688 Ga0068857_1000406885 131
694 3300005577 Ga0068857_100209439 Ga0068857_1002094393 131
695 3300005577 Ga0068857_100519076 Ga0068857_1005190762 131
696 3300005577 Ga0068857_100685991 Ga0068857_1006859913 131
697 3300005577 Ga0068857_100767834 Ga0068857_1007678342 131
698 3300005577 Ga0068857_101282743 Ga0068857_1012827432 131
699 3300005578 Ga0068854_100044785 Ga0068854_1000447857 131
700 3300005578 Ga0068854_100230274 Ga0068854_1002302744 131
701 3300005578 Ga0068854_102251975 Ga0068854_1022519751 131
702 3300005614 Ga0068856_100183859 Ga0068856_1001838593 131
703 3300005614 Ga0068856_100244565 Ga0068856_1002445654 131
704 3300005614 Ga0068856_100345416 Ga0068856_1003454163 131
705 3300005614 Ga0068856_101672088 Ga0068856_1016720882 131
706 3300005615 Ga0070702_100403402 Ga0070702_1004034022 131
707 3300005615 Ga0070702_100490995 Ga0070702_1004909952 131
708 3300005615 Ga0070702_100832465 Ga0070702_1008324652 131
709 3300005616 Ga0068852_100102229 Ga0068852_1001022294 131
710 3300005616 Ga0068852_100307390 Ga0068852_1003073904 131
711 3300005616 Ga0068852_100315873 Ga0068852_1003158733 131
712 3300005616 Ga0068852_100651676 Ga0068852_1006516762 131
713 3300005616 Ga0068852_100824589 Ga0068852_1008245891 131
714 3300005616 Ga0068852_100889233 Ga0068852_1008892331 131
715 3300005616 Ga0068852_101084487 Ga0068852_1010844872 131
716 3300005617 Ga0068859_100047020 Ga0068859_1000470206 131
717 3300005617 Ga0068859_100130187 Ga0068859_1001301871 131
718 3300005617 Ga0068859_100627269 Ga0068859_1006272692 131
719 3300005617 Ga0068859_100701377 Ga0068859_1007013772 131
720 3300005617 Ga0068859_100794112 Ga0068859_1007941122 131
721 3300005617 Ga0068859_100993513 Ga0068859_1009935132 131
722 3300005617 Ga0068859_101730399 Ga0068859_1017303992 131
723 3300005618 Ga0068864_100043033 Ga0068864_1000430339 131
724 3300005618 Ga0068864_100144620 Ga0068864_1001446202 131
725 3300005618 Ga0068864_100277415 Ga0068864_1002774153 131
726 3300005618 Ga0068864_100353670 Ga0068864_1003536702 131
727 3300005618 Ga0068864_101060311 Ga0068864_1010603111 131
728 3300005618 Ga0068864_101644636 Ga0068864_1016446362 131
729 3300005618 Ga0068864_102557003 Ga0068864_1025570032 131
730 3300005718 Ga0068866_10091328 Ga0068866_100913283 131
731 3300005718 Ga0068866_10091532 Ga0068866_100915323 131
732 3300005718 Ga0068866_10957394 Ga0068866_109573941 131
733 3300005719 Ga0068861_100004770 Ga0068861_10000477016 131
734 3300005719 Ga0068861_100016735 Ga0068861_1000167357 131
735 3300005719 Ga0068861_100021676 Ga0068861_1000216767 131
736 3300005719 Ga0068861_100170807 Ga0068861_1001708072 131
737 3300005719 Ga0068861_100174810 Ga0068861_1001748104 131
738 3300005719 Ga0068861_100885579 Ga0068861_1008855792 131
739 3300005719 Ga0068861_102523344 Ga0068861_1025233441 131
740 3300005834 Ga0068851_10332137 Ga0068851_103321372 131
741 3300005840 Ga0068870_10164633 Ga0068870_101646332 131
742 3300005840 Ga0068870_10224043 Ga0068870_102240432 131
743 3300005840 Ga0068870_10231402 Ga0068870_102314023 131
744 3300005840 Ga0068870_10569048 Ga0068870_105690482 131
745 3300005840 Ga0068870_10983496 Ga0068870_109834961 131
746 3300005840 Ga0068870_11243514 Ga0068870_112435141 131
747 3300005841 Ga0068863_100011076 Ga0068863_10001107615 131
748 3300005841 Ga0068863_100156589 Ga0068863_1001565894 131
749 3300005841 Ga0068863_100242760 Ga0068863_1002427602 131
750 3300005841 Ga0068863_100316460 Ga0068863_1003164603 131
751 3300005841 Ga0068863_100368482 Ga0068863_1003684822 131
752 3300005841 Ga0068863_100901362 Ga0068863_1009013622 131
753 3300005841 Ga0068863_101044897 Ga0068863_1010448972 131
754 3300005842 Ga0068858_100008125 Ga0068858_10000812512 131
755 3300005842 Ga0068858_100194536 Ga0068858_1001945364 131
756 3300005842 Ga0068858_100477508 Ga0068858_1004775082 131
757 3300005843 Ga0068860_100008442 Ga0068860_1000084429 131
758 3300005843 Ga0068860_100048811 Ga0068860_1000488116 131
759 3300005843 Ga0068860_100065679 Ga0068860_1000656793 131
760 3300005843 Ga0068860_100074726 Ga0068860_1000747264 131
761 3300005843 Ga0068860_100125358 Ga0068860_1001253585 131
762 3300005843 Ga0068860_100210653 Ga0068860_1002106532 131
763 3300005843 Ga0068860_100214297 Ga0068860_1002142972 131
764 3300005843 Ga0068860_100234051 Ga0068860_1002340514 131
765 3300005843 Ga0068860_100722091 Ga0068860_1007220912 131
766 3300005844 Ga0068862_100009442 Ga0068862_1000094426 131
767 3300005844 Ga0068862_100098243 Ga0068862_1000982434 131
768 3300005844 Ga0068862_100103723 Ga0068862_1001037232 131
769 3300005844 Ga0068862_100137286 Ga0068862_1001372863 131
770 3300005844 Ga0068862_100145559 Ga0068862_1001455592 131
771 3300005844 Ga0068862_100471684 Ga0068862_1004716843 131
772 3300005844 Ga0068862_100722741 Ga0068862_1007227413 131
773 3300005844 Ga0068862_101455220 Ga0068862_1014552202 131
774 3300005937 Ga0081455_10008699 Ga0081455_1000869912 131
775 3300005937 Ga0081455_10199133 Ga0081455_101991332 131
776 3300006038 Ga0075365_10100810 Ga0075365_101008104 131
777 3300006038 Ga0075365_10318739 Ga0075365_103187392 131
778 3300006038 Ga0075365_10467937 Ga0075365_104679372 131
779 3300006042 Ga0075368_10058905 Ga0075368_100589053 131
780 3300006042 Ga0075368_10064460 Ga0075368_100644603 131
781 3300006042 Ga0075368_10064476 Ga0075368_100644762 131
782 3300006048 Ga0075363_100005889 Ga0075363_1000058894 131
783 3300006048 Ga0075363_100049841 Ga0075363_1000498413 131
784 3300006048 Ga0075363_100204317 Ga0075363_1002043173 131
785 3300006048 Ga0075363_100312622 Ga0075363_1003126222 131
786 3300006048 Ga0075363_100707422 Ga0075363_1007074222 131
787 3300006048 Ga0075363_100816685 Ga0075363_1008166852 131
788 3300006051 Ga0075364_10032491 Ga0075364_100324916 131
789 3300006051 Ga0075364_10038599 Ga0075364_100385995 131
790 3300006051 Ga0075364_10134805 Ga0075364_101348054 131
791 3300006051 Ga0075364_10564781 Ga0075364_105647812 131
792 3300006051 Ga0075364_10573168 Ga0075364_105731682 131
793 3300006058 Ga0075432_10133565 Ga0075432_101335652 131
794 3300006163 Ga0070715_10079026 Ga0070715_100790262 131
795 3300006163 Ga0070715_10111151 Ga0070715_101111513 131
796 3300006173 Ga0070716_100069303 Ga0070716_1000693033 131
797 3300006173 Ga0070716_100521023 Ga0070716_1005210232 131
798 3300006177 Ga0075362_10000222 Ga0075362_1000022217 131
799 3300006177 Ga0075362_10060918 Ga0075362_100609181 131
800 3300006177 Ga0075362_10085974 Ga0075362_100859742 131
801 3300006177 Ga0075362_10168463 Ga0075362_101684632 131
802 3300006177 Ga0075362_10285808 Ga0075362_102858082 131
803 3300006177 Ga0075362_10374102 Ga0075362_103741022 131
804 3300006177 Ga0075362_10474507 Ga0075362_104745072 131
805 3300006178 Ga0075367_10000855 Ga0075367_1000085511 131
806 3300006178 Ga0075367_10010768 Ga0075367_100107683 131
807 3300006178 Ga0075367_10092185 Ga0075367_100921853 131
808 3300006178 Ga0075367_10246017 Ga0075367_102460172 131
809 3300006178 Ga0075367_10348297 Ga0075367_103482971 131
810 3300006178 Ga0075367_10707440 Ga0075367_107074402 131
811 3300006186 Ga0075369_10005325 Ga0075369_100053257 131
812 3300006186 Ga0075369_10110152 Ga0075369_101101523 131
813 3300006186 Ga0075369_10215809 Ga0075369_102158092 131
814 3300006186 Ga0075369_10423981 Ga0075369_104239812 131
815 3300006195 Ga0075366_10033848 Ga0075366_100338483 131
816 3300006195 Ga0075366_10050535 Ga0075366_100505352 131
817 3300006195 Ga0075366_10058278 Ga0075366_100582782 131
818 3300006195 Ga0075366_10077134 Ga0075366_100771343 131
819 3300006195 Ga0075366_10081535 Ga0075366_100815354 131
820 3300006195 Ga0075366_10096819 Ga0075366_100968192 131
821 3300006195 Ga0075366_10138878 Ga0075366_101388784 131
822 3300006195 Ga0075366_10153936 Ga0075366_101539363 131
823 3300006195 Ga0075366_10166789 Ga0075366_101667892 131
824 3300006195 Ga0075366_10263345 Ga0075366_102633453 131
825 3300006195 Ga0075366_10321927 Ga0075366_103219271 131
826 3300006195 Ga0075366_10328391 Ga0075366_103283912 131
827 3300006195 Ga0075366_10469892 Ga0075366_104698922 131
828 3300006195 Ga0075366_10507801 Ga0075366_105078011 131
829 3300006195 Ga0075366_10965137 Ga0075366_109651371 131
830 3300006237 Ga0097621_100115517 Ga0097621_1001155173 131
831 3300006237 Ga0097621_100139427 Ga0097621_1001394272 131
832 3300006237 Ga0097621_100480099 Ga0097621_1004800992 131
833 3300006237 Ga0097621_100512914 Ga0097621_1005129142 131
834 3300006237 Ga0097621_100662626 Ga0097621_1006626262 131
835 3300006237 Ga0097621_100944722 Ga0097621_1009447222 131
836 3300006353 Ga0075370_10001150 Ga0075370_1000115010 131
837 3300006353 Ga0075370_10023630 Ga0075370_100236307 131
838 3300006353 Ga0075370_10064344 Ga0075370_100643442 131
839 3300006358 Ga0068871_100126623 Ga0068871_1001266232 131
840 3300006358 Ga0068871_100221491 Ga0068871_1002214913 131
841 3300006358 Ga0068871_100408440 Ga0068871_1004084402 131
842 3300006358 Ga0068871_100453812 Ga0068871_1004538123 131
843 3300006358 Ga0068871_100540442 Ga0068871_1005404421 131
844 3300006358 Ga0068871_100982475 Ga0068871_1009824752 131
845 3300006844 Ga0075428_100000808 Ga0075428_10000080817 131
846 3300006846 Ga0075430_100218759 Ga0075430_1002187592 131
847 3300006846 Ga0075430_100233239 Ga0075430_1002332393 131
848 3300006846 Ga0075430_100302039 Ga0075430_1003020392 131
849 3300006871 Ga0075434_100855539 Ga0075434_1008555393 131
850 3300006880 Ga0075429_100034628 Ga0075429_1000346282 131
851 3300006880 Ga0075429_100043701 Ga0075429_1000437013 131
852 3300006880 Ga0075429_100123917 Ga0075429_1001239172 131
853 3300006881 Ga0068865_100004060 Ga0068865_1000040605 131
854 3300006881 Ga0068865_100647903 Ga0068865_1006479031 131
855 3300006881 Ga0068865_100882343 Ga0068865_1008823431 131
856 3300006881 Ga0068865_101254167 Ga0068865_1012541671 131
857 3300006931 Ga0097620_100047018 Ga0097620_1000470186 131
858 3300006931 Ga0097620_100130185 Ga0097620_1001301851 131
859 3300006931 Ga0097620_100627282 Ga0097620_1006272822 131
860 3300006931 Ga0097620_100701492 Ga0097620_1007014922 131
861 3300006931 Ga0097620_100794090 Ga0097620_1007940902 131
862 3300006931 Ga0097620_100993489 Ga0097620_1009934892 131
863 3300006931 Ga0097620_101730416 Ga0097620_1017304161 131
864 3300006948 Ga0099826_10000024 Ga0099826_1000002417 131
865 3300009011 Ga0105251_10023641 Ga0105251_100236415 131
866 3300009093 Ga0105240_10627271 Ga0105240_106272711 131
867 3300009094 Ga0111539_10529840 Ga0111539_105298402 131
868 3300009094 Ga0111539_11140813 Ga0111539_111408132 131
869 3300009094 Ga0111539_11150091 Ga0111539_111500911 131
870 3300009094 Ga0111539_11374449 Ga0111539_113744492 131
871 3300009094 Ga0111539_11738195 Ga0111539_117381952 131
872 3300009094 Ga0111539_12219808 Ga0111539_122198081 131
873 3300009098 Ga0105245_10300472 Ga0105245_103004724 131
874 3300009098 Ga0105245_10973459 Ga0105245_109734592 131
875 3300009098 Ga0105245_12137730 Ga0105245_121377301 131
876 3300009101 Ga0105247_10117961 Ga0105247_101179614 131
877 3300009101 Ga0105247_10250972 Ga0105247_102509723 131
878 3300009147 Ga0114129_10778086 Ga0114129_107780862 131
879 3300009148 Ga0105243_10001789 Ga0105243_1000178917 131
880 3300009148 Ga0105243_10177569 Ga0105243_101775692 131
881 3300009148 Ga0105243_10194189 Ga0105243_101941893 131
882 3300009148 Ga0105243_10230579 Ga0105243_102305792 131
883 3300009148 Ga0105243_10387979 Ga0105243_103879792 131
884 3300009148 Ga0105243_10913307 Ga0105243_109133071 131
885 3300009148 Ga0105243_11520960 Ga0105243_115209601 131
886 3300009148 Ga0105243_11762942 Ga0105243_117629422 131
887 3300009174 Ga0105241_10082907 Ga0105241_100829075 131
888 3300009176 Ga0105242_10059064 Ga0105242_100590646 131
889 3300009176 Ga0105242_10090242 Ga0105242_100902426 131
890 3300009176 Ga0105242_12014288 Ga0105242_120142882 131
891 3300009177 Ga0105248_10028458 Ga0105248_1002845813 131
892 3300009177 Ga0105248_10047589 Ga0105248_100475892 131
893 3300009177 Ga0105248_10208334 Ga0105248_102083342 131
894 3300009177 Ga0105248_10511830 Ga0105248_105118302 131
895 3300009177 Ga0105248_10531205 Ga0105248_105312051 131
896 3300009177 Ga0105248_10542893 Ga0105248_105428932 131
897 3300009177 Ga0105248_11419336 Ga0105248_114193361 131
898 3300009177 Ga0105248_12022369 Ga0105248_120223692 131
899 3300009545 Ga0105237_10020609 Ga0105237_100206093 131
900 3300009545 Ga0105237_10393453 Ga0105237_103934533 131
901 3300009545 Ga0105237_12755999 Ga0105237_127559991 131
902 3300009551 Ga0105238_10064333 Ga0105238_100643337 131
903 3300009551 Ga0105238_10951806 Ga0105238_109518062 131
904 3300009551 Ga0105238_11583629 Ga0105238_115836292 131
905 3300009553 Ga0105249_10309743 Ga0105249_103097432 131
906 3300009553 Ga0105249_10484018 Ga0105249_104840182 131
907 3300009553 Ga0105249_10993164 Ga0105249_109931642 131
908 3300010375 Ga0105239_10444502 Ga0105239_104445023 131
909 3300010375 Ga0105239_10557327 Ga0105239_105573271 131
910 3300011119 Ga0105246_10452402 Ga0105246_104524023 131
911 3300011119 Ga0105246_10873656 Ga0105246_108736562 131
912 3300011119 Ga0105246_10919730 Ga0105246_109197302 131
913 3300011119 Ga0105246_10963508 Ga0105246_109635082 131
914 3300012475 Ga0157317_1014804 Ga0157317_10148041 131
915 3300012478 Ga0157328_1000557 Ga0157328_10005573 131
916 3300012482 Ga0157318_1012036 Ga0157318_10120362 131
917 3300012494 Ga0157341_1001034 Ga0157341_10010343 131
918 3300012498 Ga0157345_1013061 Ga0157345_10130612 131
919 3300012500 Ga0157314_1004276 Ga0157314_10042762 131
920 3300012503 Ga0157313_1006133 Ga0157313_10061332 131
921 3300012507 Ga0157342_1044135 Ga0157342_10441352 131
922 3300012508 Ga0157315_1018239 Ga0157315_10182392 131
923 3300012512 Ga0157327_1001789 Ga0157327_10017892 131
924 3300013100 Ga0157373_10040286 Ga0157373_100402865 131
925 3300013100 Ga0157373_10230096 Ga0157373_102300963 131
926 3300013104 Ga0157370_10299273 Ga0157370_102992733 131
927 3300013104 Ga0157370_11085771 Ga0157370_110857712 131
928 3300013105 Ga0157369_10115967 Ga0157369_101159674 131
929 3300013105 Ga0157369_10254222 Ga0157369_102542222 131
930 3300013105 Ga0157369_11576446 Ga0157369_115764462 131
931 3300013296 Ga0157374_10009298 Ga0157374_100092986 131
932 3300013296 Ga0157374_10039033 Ga0157374_1003903310 131
933 3300013296 Ga0157374_10093529 Ga0157374_100935294 131
934 3300013296 Ga0157374_10183964 Ga0157374_101839643 131
935 3300013296 Ga0157374_10261841 Ga0157374_102618411 131
936 3300013296 Ga0157374_10684056 Ga0157374_106840562 131
937 3300013297 Ga0157378_10008661 Ga0157378_100086616 131
938 3300013297 Ga0157378_10248653 Ga0157378_102486534 131
939 3300013297 Ga0157378_10328899 Ga0157378_103288992 131
940 3300013297 Ga0157378_10415154 Ga0157378_104151543 131
941 3300013297 Ga0157378_10458589 Ga0157378_104585892 131
942 3300013297 Ga0157378_10477084 Ga0157378_104770842 131
943 3300013297 Ga0157378_10478068 Ga0157378_104780683 131
944 3300013297 Ga0157378_12237547 Ga0157378_122375471 131
945 3300013306 Ga0163162_10004148 Ga0163162_1000414816 131
946 3300013306 Ga0163162_10033165 Ga0163162_100331656 131
947 3300013306 Ga0163162_10211873 Ga0163162_102118735 131
948 3300013306 Ga0163162_10241802 Ga0163162_102418023 131
949 3300013306 Ga0163162_10424477 Ga0163162_104244773 131
950 3300013306 Ga0163162_10491825 Ga0163162_104918251 131
951 3300013306 Ga0163162_10646134 Ga0163162_106461342 131
952 3300013306 Ga0163162_11021846 Ga0163162_110218462 131
953 3300013307 Ga0157372_10023087 Ga0157372_100230871 131
954 3300013307 Ga0157372_10549579 Ga0157372_105495792 131
955 3300013307 Ga0157372_11041560 Ga0157372_110415603 131
956 3300013308 Ga0157375_10026295 Ga0157375_100262958 131
957 3300013308 Ga0157375_10041626 Ga0157375_100416267 131
958 3300013308 Ga0157375_10151438 Ga0157375_101514384 131
959 3300013308 Ga0157375_10239233 Ga0157375_102392334 131
960 3300013308 Ga0157375_10240286 Ga0157375_102402862 131
961 3300013308 Ga0157375_10250739 Ga0157375_102507393 131
962 3300013308 Ga0157375_10493225 Ga0157375_104932253 131
963 3300013308 Ga0157375_10545902 Ga0157375_105459023 131
964 3300013308 Ga0157375_11614891 Ga0157375_116148911 131
965 3300014325 Ga0163163_10098438 Ga0163163_100984384 131
966 3300014325 Ga0163163_10176222 Ga0163163_101762224 131
967 3300014325 Ga0163163_10404151 Ga0163163_104041512 131
968 3300014325 Ga0163163_10652447 Ga0163163_106524472 131
969 3300014325 Ga0163163_10733157 Ga0163163_107331571 131
970 3300014325 Ga0163163_10975385 Ga0163163_109753852 131
971 3300014326 Ga0157380_10205210 Ga0157380_102052105 131
972 3300014326 Ga0157380_10220567 Ga0157380_102205674 131
973 3300014326 Ga0157380_10534216 Ga0157380_105342163 131
974 3300014326 Ga0157380_11328546 Ga0157380_113285462 131
975 3300014497 Ga0182008_10034449 Ga0182008_100344495 131
976 3300014497 Ga0182008_10334392 Ga0182008_103343922 131
977 3300014745 Ga0157377_10000368 Ga0157377_1000036816 131
978 3300014745 Ga0157377_10396808 Ga0157377_103968081 131
979 3300014968 Ga0157379_10037733 Ga0157379_100377332 131
980 3300014968 Ga0157379_10040412 Ga0157379_100404126 131
981 3300014968 Ga0157379_10061342 Ga0157379_100613426 131
982 3300014968 Ga0157379_10090060 Ga0157379_100900604 131
983 3300014968 Ga0157379_10251368 Ga0157379_102513683 131
984 3300014968 Ga0157379_10728786 Ga0157379_107287862 131
985 3300014968 Ga0157379_10958172 Ga0157379_109581721 131
986 3300014968 Ga0157379_11369269 Ga0157379_113692692 131
987 3300014968 Ga0157379_12031019 Ga0157379_120310191 131
988 3300014969 Ga0157376_10085443 Ga0157376_100854433 131
989 3300014969 Ga0157376_10957460 Ga0157376_109574602 131
990 3300014969 Ga0157376_10983337 Ga0157376_109833371 131
991 3300014969 Ga0157376_11269830 Ga0157376_112698302 131
992 3300014969 Ga0157376_13087901 Ga0157376_130879011 131
993 3300015262 Ga0182007_10061846 Ga0182007_100618462 131
994 3300017792 Ga0163161_10009049 Ga0163161_1000904911 131
995 3300017792 Ga0163161_10021239 Ga0163161_100212396 131
996 3300017792 Ga0163161_10042621 Ga0163161_100426217 131
997 3300017792 Ga0163161_10057420 Ga0163161_100574203 131
998 3300017792 Ga0163161_10378130 Ga0163161_103781301 131
999 3300017792 Ga0163161_11431780 Ga0163161_114317802 131
1000 3300020082 Ga0206353_11953414 Ga0206353_119534142 131
1001 3300021361 Ga0213872_10000672 Ga0213872_1000067217 131
1002 3300021377 Ga0213874_10021138 Ga0213874_100211381 131
1003 3300021377 Ga0213874_10078842 Ga0213874_100788422 131
1004 3300025245 Ga0207425_1000680 Ga0207425_100068013 131
1005 3300025258 Ga0209129_1000158 Ga0209129_100015847 131
1006 3300025273 Ga0209673_1004093 Ga0209673_10040935 131
1007 3300025273 Ga0209673_1032334 Ga0209673_10323342 131
1008 3300025290 Ga0207673_1016945 Ga0207673_10169452 131
1009 3300025295 Ga0209564_1000282 Ga0209564_100028247 131
1010 3300025297 Ga0209758_1000910 Ga0209758_10009108 131
1011 3300025297 Ga0209758_1011080 Ga0209758_10110804 131
1012 3300025298 Ga0209050_1000223 Ga0209050_100022370 131
1013 3300025299 Ga0209256_1009680 Ga0209256_10096806 131
1014 3300025303 Ga0209051_1018074 Ga0209051_10180743 131
1015 3300025315 Ga0207697_10011122 Ga0207697_100111227 131
1016 3300025315 Ga0207697_10027047 Ga0207697_100270472 131
1017 3300025315 Ga0207697_10029574 Ga0207697_100295743 131
1018 3300025321 Ga0207656_10100216 Ga0207656_101002163 131
1019 3300025321 Ga0207656_10182284 Ga0207656_101822843 131
1020 3300025735 Ga0207713_1023386 Ga0207713_10233866 131
1021 3300025893 Ga0207682_10002147 Ga0207682_100021476 131
1022 3300025893 Ga0207682_10021887 Ga0207682_100218873 131
1023 3300025893 Ga0207682_10077687 Ga0207682_100776873 131
1024 3300025893 Ga0207682_10277013 Ga0207682_102770131 131
1025 3300025893 Ga0207682_10432489 Ga0207682_104324891 131
1026 3300025898 Ga0207692_10217960 Ga0207692_102179602 131
1027 3300025899 Ga0207642_10092854 Ga0207642_100928543 131
1028 3300025899 Ga0207642_10108364 Ga0207642_101083643 131
1029 3300025899 Ga0207642_10492183 Ga0207642_104921832 131
1030 3300025899 Ga0207642_11028319 Ga0207642_110283191 131
1031 3300025900 Ga0207710_10306473 Ga0207710_103064732 131
1032 3300025901 Ga0207688_10037622 Ga0207688_100376222 131
1033 3300025901 Ga0207688_10063302 Ga0207688_100633024 131
1034 3300025901 Ga0207688_10077775 Ga0207688_100777752 131
1035 3300025901 Ga0207688_10144333 Ga0207688_101443331 131
1036 3300025901 Ga0207688_10231679 Ga0207688_102316793 131
1037 3300025903 Ga0207680_10187572 Ga0207680_101875723 131
1038 3300025903 Ga0207680_10257091 Ga0207680_102570913 131
1039 3300025903 Ga0207680_10353603 Ga0207680_103536031 131
1040 3300025903 Ga0207680_10645731 Ga0207680_106457312 131
1041 3300025903 Ga0207680_10957317 Ga0207680_109573171 131
1042 3300025905 Ga0207685_10158287 Ga0207685_101582872 131
1043 3300025905 Ga0207685_10675810 Ga0207685_106758102 131
1044 3300025907 Ga0207645_10009972 Ga0207645_100099729 131
1045 3300025907 Ga0207645_10012543 Ga0207645_100125438 131
1046 3300025907 Ga0207645_10027678 Ga0207645_100276785 131
1047 3300025907 Ga0207645_10047232 Ga0207645_100472324 131
1048 3300025907 Ga0207645_10048474 Ga0207645_100484745 131
1049 3300025907 Ga0207645_10086402 Ga0207645_100864023 131
1050 3300025907 Ga0207645_10139657 Ga0207645_101396572 131
1051 3300025907 Ga0207645_10301667 Ga0207645_103016672 131
1052 3300025907 Ga0207645_10880985 Ga0207645_108809851 131
1053 3300025908 Ga0207643_10070432 Ga0207643_100704324 131
1054 3300025908 Ga0207643_10697330 Ga0207643_106973302 131
1055 3300025908 Ga0207643_11141960 Ga0207643_111419601 131
1056 3300025909 Ga0207705_10812019 Ga0207705_108120192 131
1057 3300025909 Ga0207705_11234190 Ga0207705_112341901 131
1058 3300025909 Ga0207705_11441062 Ga0207705_114410621 131
1059 3300025910 Ga0207684_10500490 Ga0207684_105004902 131
1060 3300025910 Ga0207684_10803308 Ga0207684_108033082 131
1061 3300025911 Ga0207654_10442697 Ga0207654_104426971 131
1062 3300025914 Ga0207671_10730804 Ga0207671_107308042 131
1063 3300025915 Ga0207693_10536869 Ga0207693_105368691 131
1064 3300025916 Ga0207663_10369763 Ga0207663_103697633 131
1065 3300025917 Ga0207660_10046145 Ga0207660_100461453 131
1066 3300025918 Ga0207662_10034330 Ga0207662_100343305 131
1067 3300025918 Ga0207662_10036401 Ga0207662_100364014 131
1068 3300025918 Ga0207662_10097784 Ga0207662_100977843 131
1069 3300025918 Ga0207662_10201054 Ga0207662_102010542 131
1070 3300025919 Ga0207657_10092779 Ga0207657_100927794 131
1071 3300025919 Ga0207657_10218405 Ga0207657_102184053 131
1072 3300025920 Ga0207649_10004699 Ga0207649_100046993 131
1073 3300025920 Ga0207649_10183146 Ga0207649_101831462 131
1074 3300025921 Ga0207652_10002940 Ga0207652_1000294012 131
1075 3300025921 Ga0207652_11225289 Ga0207652_112252891 131
1076 3300025923 Ga0207681_10005925 Ga0207681_100059255 131
1077 3300025923 Ga0207681_10021332 Ga0207681_100213327 131
1078 3300025923 Ga0207681_10041280 Ga0207681_100412804 131
1079 3300025923 Ga0207681_10071603 Ga0207681_100716034 131
1080 3300025923 Ga0207681_10111387 Ga0207681_101113872 131
1081 3300025923 Ga0207681_10901391 Ga0207681_109013911 131
1082 3300025924 Ga0207694_10034844 Ga0207694_100348443 131
1083 3300025924 Ga0207694_10452972 Ga0207694_104529723 131
1084 3300025924 Ga0207694_10505280 Ga0207694_105052802 131
1085 3300025924 Ga0207694_10688670 Ga0207694_106886702 131
1086 3300025925 Ga0207650_10002454 Ga0207650_1000245418 131
1087 3300025925 Ga0207650_10022053 Ga0207650_100220534 131
1088 3300025925 Ga0207650_10054455 Ga0207650_100544554 131
1089 3300025925 Ga0207650_10387104 Ga0207650_103871042 131
1090 3300025925 Ga0207650_10640715 Ga0207650_106407152 131
1091 3300025925 Ga0207650_10727506 Ga0207650_107275062 131
1092 3300025926 Ga0207659_10003025 Ga0207659_100030254 131
1093 3300025926 Ga0207659_10052760 Ga0207659_100527603 131
1094 3300025926 Ga0207659_10056531 Ga0207659_100565313 131
1095 3300025926 Ga0207659_10061691 Ga0207659_100616918 131
1096 3300025926 Ga0207659_10142255 Ga0207659_101422554 131
1097 3300025926 Ga0207659_11013374 Ga0207659_110133742 131
1098 3300025927 Ga0207687_10108511 Ga0207687_101085113 131
1099 3300025927 Ga0207687_10753634 Ga0207687_107536342 131
1100 3300025931 Ga0207644_10027492 Ga0207644_100274927 131
1101 3300025931 Ga0207644_10118657 Ga0207644_101186574 131
1102 3300025931 Ga0207644_10151897 Ga0207644_101518972 131
1103 3300025931 Ga0207644_10184530 Ga0207644_101845301 131
1104 3300025931 Ga0207644_10256867 Ga0207644_102568672 131
1105 3300025931 Ga0207644_10258810 Ga0207644_102588103 131
1106 3300025931 Ga0207644_10388082 Ga0207644_103880822 131
1107 3300025931 Ga0207644_10639011 Ga0207644_106390111 131
1108 3300025931 Ga0207644_11256548 Ga0207644_112565481 131
1109 3300025932 Ga0207690_10056794 Ga0207690_100567943 131
1110 3300025932 Ga0207690_10791310 Ga0207690_107913101 131
1111 3300025932 Ga0207690_11306269 Ga0207690_113062692 131
1112 3300025933 Ga0207706_10035361 Ga0207706_100353612 131
1113 3300025933 Ga0207706_10079225 Ga0207706_100792254 131
1114 3300025933 Ga0207706_10375437 Ga0207706_103754372 131
1115 3300025933 Ga0207706_10595316 Ga0207706_105953161 131
1116 3300025933 Ga0207706_10597721 Ga0207706_105977212 131
1117 3300025933 Ga0207706_11166811 Ga0207706_111668111 131
1118 3300025934 Ga0207686_10048318 Ga0207686_100483182 131
1119 3300025934 Ga0207686_10050824 Ga0207686_100508246 131
1120 3300025934 Ga0207686_10072816 Ga0207686_100728163 131
1121 3300025934 Ga0207686_10255208 Ga0207686_102552083 131
1122 3300025935 Ga0207709_10001005 Ga0207709_1000100519 131
1123 3300025935 Ga0207709_10020689 Ga0207709_100206893 131
1124 3300025935 Ga0207709_10146045 Ga0207709_101460454 131
1125 3300025935 Ga0207709_10431056 Ga0207709_104310561 131
1126 3300025936 Ga0207670_10450600 Ga0207670_104506002 131
1127 3300025936 Ga0207670_11438900 Ga0207670_114389001 131
1128 3300025936 Ga0207670_11564474 Ga0207670_115644742 131
1129 3300025937 Ga0207669_10027395 Ga0207669_100273953 131
1130 3300025937 Ga0207669_10068174 Ga0207669_100681744 131
1131 3300025937 Ga0207669_10093241 Ga0207669_100932414 131
1132 3300025937 Ga0207669_10124757 Ga0207669_101247574 131
1133 3300025937 Ga0207669_10367135 Ga0207669_103671352 131
1134 3300025937 Ga0207669_10527251 Ga0207669_105272512 131
1135 3300025937 Ga0207669_10835859 Ga0207669_108358591 131
1136 3300025937 Ga0207669_11153017 Ga0207669_111530172 131
1137 3300025937 Ga0207669_11346721 Ga0207669_113467212 131
1138 3300025938 Ga0207704_10474258 Ga0207704_104742581 131
1139 3300025938 Ga0207704_10660232 Ga0207704_106602321 131
1140 3300025938 Ga0207704_11151269 Ga0207704_111512692 131
1141 3300025939 Ga0207665_10131977 Ga0207665_101319773 131
1142 3300025939 Ga0207665_10452521 Ga0207665_104525212 131
1143 3300025940 Ga0207691_10002550 Ga0207691_1000255014 131
1144 3300025940 Ga0207691_10071477 Ga0207691_100714775 131
1145 3300025940 Ga0207691_10104939 Ga0207691_101049392 131
1146 3300025940 Ga0207691_10126451 Ga0207691_101264514 131
1147 3300025940 Ga0207691_10214431 Ga0207691_102144313 131
1148 3300025940 Ga0207691_10216133 Ga0207691_102161332 131
1149 3300025940 Ga0207691_10242604 Ga0207691_102426042 131
1150 3300025940 Ga0207691_10821521 Ga0207691_108215211 131
1151 3300025940 Ga0207691_11185143 Ga0207691_111851431 131
1152 3300025941 Ga0207711_10023140 Ga0207711_100231404 131
1153 3300025941 Ga0207711_10072285 Ga0207711_100722854 131
1154 3300025941 Ga0207711_10471526 Ga0207711_104715262 131
1155 3300025941 Ga0207711_10950482 Ga0207711_109504822 131
1156 3300025941 Ga0207711_11309585 Ga0207711_113095852 131
1157 3300025942 Ga0207689_10033146 Ga0207689_100331467 131
1158 3300025942 Ga0207689_10038004 Ga0207689_100380044 131
1159 3300025942 Ga0207689_10117050 Ga0207689_101170504 131
1160 3300025942 Ga0207689_10127570 Ga0207689_101275702 131
1161 3300025942 Ga0207689_10232116 Ga0207689_102321162 131
1162 3300025942 Ga0207689_10684752 Ga0207689_106847521 131
1163 3300025942 Ga0207689_10711450 Ga0207689_107114502 131
1164 3300025942 Ga0207689_10764762 Ga0207689_107647622 131
1165 3300025942 Ga0207689_10776336 Ga0207689_107763362 131
1166 3300025942 Ga0207689_11600848 Ga0207689_116008481 131
1167 3300025944 Ga0207661_10026944 Ga0207661_100269442 131
1168 3300025945 Ga0207679_10016048 Ga0207679_100160487 131
1169 3300025945 Ga0207679_10127063 Ga0207679_101270632 131
1170 3300025945 Ga0207679_10449730 Ga0207679_104497302 131
1171 3300025945 Ga0207679_10953006 Ga0207679_109530061 131
1172 3300025945 Ga0207679_11307681 Ga0207679_113076811 131
1173 3300025949 Ga0207667_10188077 Ga0207667_101880774 131
1174 3300025960 Ga0207651_10004839 Ga0207651_1000483913 131
1175 3300025960 Ga0207651_10043195 Ga0207651_100431953 131
1176 3300025960 Ga0207651_10049602 Ga0207651_100496025 131
1177 3300025960 Ga0207651_10063480 Ga0207651_100634804 131
1178 3300025960 Ga0207651_10092035 Ga0207651_100920355 131
1179 3300025960 Ga0207651_10274919 Ga0207651_102749192 131
1180 3300025960 Ga0207651_10307666 Ga0207651_103076662 131
1181 3300025960 Ga0207651_10352293 Ga0207651_103522932 131
1182 3300025961 Ga0207712_10040645 Ga0207712_100406455 131
1183 3300025961 Ga0207712_10063392 Ga0207712_100633925 131
1184 3300025961 Ga0207712_10258983 Ga0207712_102589832 131
1185 3300025961 Ga0207712_10976782 Ga0207712_109767822 131
1186 3300025972 Ga0207668_10008000 Ga0207668_100080004 131
1187 3300025972 Ga0207668_10053760 Ga0207668_100537601 131
1188 3300025972 Ga0207668_10264120 Ga0207668_102641203 131
1189 3300025972 Ga0207668_10332527 Ga0207668_103325272 131
1190 3300025972 Ga0207668_10498202 Ga0207668_104982021 131
1191 3300025981 Ga0207640_10014813 Ga0207640_100148133 131
1192 3300025981 Ga0207640_10146361 Ga0207640_101463612 131
1193 3300025981 Ga0207640_10361518 Ga0207640_103615182 131
1194 3300025981 Ga0207640_10739392 Ga0207640_107393921 131
1195 3300025981 Ga0207640_11342870 Ga0207640_113428702 131
1196 3300025981 Ga0207640_11422139 Ga0207640_114221392 131
1197 3300025986 Ga0207658_10002481 Ga0207658_100024817 131
1198 3300025986 Ga0207658_10019932 Ga0207658_100199326 131
1199 3300025986 Ga0207658_10059878 Ga0207658_100598785 131
1200 3300025986 Ga0207658_10174279 Ga0207658_101742794 131
1201 3300025986 Ga0207658_10204295 Ga0207658_102042951 131
1202 3300025986 Ga0207658_10253878 Ga0207658_102538782 131
1203 3300025986 Ga0207658_10823380 Ga0207658_108233802 131
1204 3300025986 Ga0207658_11440281 Ga0207658_114402811 131
1205 3300026023 Ga0207677_10222318 Ga0207677_102223184 131
1206 3300026023 Ga0207677_10493235 Ga0207677_104932351 131
1207 3300026023 Ga0207677_10597666 Ga0207677_105976662 131
1208 3300026023 Ga0207677_10762614 Ga0207677_107626142 131
1209 3300026023 Ga0207677_11440248 Ga0207677_114402482 131
1210 3300026023 Ga0207677_11845572 Ga0207677_118455722 131
1211 3300026035 Ga0207703_10002613 Ga0207703_100026132 131
1212 3300026035 Ga0207703_10027342 Ga0207703_100273427 131
1213 3300026035 Ga0207703_10139551 Ga0207703_101395514 131
1214 3300026035 Ga0207703_10590706 Ga0207703_105907062 131
1215 3300026035 Ga0207703_11346177 Ga0207703_113461772 131
1216 3300026041 Ga0207639_10460001 Ga0207639_104600013 131
1217 3300026041 Ga0207639_10601595 Ga0207639_106015951 131
1218 3300026067 Ga0207678_10008286 Ga0207678_1000828617 131
1219 3300026067 Ga0207678_10090610 Ga0207678_100906102 131
1220 3300026067 Ga0207678_10099481 Ga0207678_100994814 131
1221 3300026067 Ga0207678_10230487 Ga0207678_102304871 131
1222 3300026067 Ga0207678_10696626 Ga0207678_106966262 131
1223 3300026067 Ga0207678_10876259 Ga0207678_108762592 131
1224 3300026067 Ga0207678_11995843 Ga0207678_119958431 131
1225 3300026075 Ga0207708_10036414 Ga0207708_100364145 131
1226 3300026075 Ga0207708_10154972 Ga0207708_101549724 131
1227 3300026075 Ga0207708_10168085 Ga0207708_101680853 131
1228 3300026075 Ga0207708_10175723 Ga0207708_101757233 131
1229 3300026078 Ga0207702_10004993 Ga0207702_1000499315 131
1230 3300026078 Ga0207702_10150760 Ga0207702_101507603 131
1231 3300026078 Ga0207702_10429607 Ga0207702_104296071 131
1232 3300026078 Ga0207702_11220565 Ga0207702_112205651 131
1233 3300026088 Ga0207641_10007438 Ga0207641_100074387 131
1234 3300026088 Ga0207641_10028453 Ga0207641_100284532 131
1235 3300026088 Ga0207641_10106203 Ga0207641_101062035 131
1236 3300026088 Ga0207641_10164506 Ga0207641_101645062 131
1237 3300026088 Ga0207641_10524581 Ga0207641_105245812 131
1238 3300026088 Ga0207641_10751729 Ga0207641_107517291 131
1239 3300026088 Ga0207641_10850293 Ga0207641_108502932 131
1240 3300026088 Ga0207641_10953814 Ga0207641_109538142 131
1241 3300026088 Ga0207641_11293854 Ga0207641_112938541 131
1242 3300026089 Ga0207648_10002176 Ga0207648_1000217620 131
1243 3300026089 Ga0207648_10005939 Ga0207648_1000593915 131
1244 3300026089 Ga0207648_10015751 Ga0207648_1001575112 131
1245 3300026089 Ga0207648_10084574 Ga0207648_100845741 131
1246 3300026089 Ga0207648_10087281 Ga0207648_100872816 131
1247 3300026089 Ga0207648_10097294 Ga0207648_100972944 131
1248 3300026089 Ga0207648_10159685 Ga0207648_101596853 131
1249 3300026089 Ga0207648_10200666 Ga0207648_102006664 131
1250 3300026089 Ga0207648_10379894 Ga0207648_103798943 131
1251 3300026089 Ga0207648_10533699 Ga0207648_105336992 131
1252 3300026089 Ga0207648_10766947 Ga0207648_107669471 131
1253 3300026095 Ga0207676_10005874 Ga0207676_100058743 131
1254 3300026095 Ga0207676_10038749 Ga0207676_100387499 131
1255 3300026095 Ga0207676_10083692 Ga0207676_100836926 131
1256 3300026095 Ga0207676_10095279 Ga0207676_100952792 131
1257 3300026095 Ga0207676_10467768 Ga0207676_104677682 131
1258 3300026095 Ga0207676_10680064 Ga0207676_106800642 131
1259 3300026095 Ga0207676_11418800 Ga0207676_114188002 131
1260 3300026116 Ga0207674_10158756 Ga0207674_101587565 131
1261 3300026116 Ga0207674_10171993 Ga0207674_101719933 131
1262 3300026116 Ga0207674_10522615 Ga0207674_105226153 131
1263 3300026118 Ga0207675_100006663 Ga0207675_10000666313 131
1264 3300026118 Ga0207675_100166548 Ga0207675_1001665485 131
1265 3300026118 Ga0207675_100255531 Ga0207675_1002555313 131
1266 3300026118 Ga0207675_100263048 Ga0207675_1002630481 131
1267 3300026118 Ga0207675_100264070 Ga0207675_1002640704 131
1268 3300026118 Ga0207675_100314320 Ga0207675_1003143202 131
1269 3300026118 Ga0207675_100373676 Ga0207675_1003736762 131
1270 3300026118 Ga0207675_100375270 Ga0207675_1003752702 131
1271 3300026118 Ga0207675_100537098 Ga0207675_1005370982 131
1272 3300026118 Ga0207675_100632434 Ga0207675_1006324342 131
1273 3300026118 Ga0207675_101729437 Ga0207675_1017294371 131
1274 3300026121 Ga0207683_10005923 Ga0207683_100059237 131
1275 3300026121 Ga0207683_10141534 Ga0207683_101415344 131
1276 3300026121 Ga0207683_10166036 Ga0207683_101660362 131
1277 3300026121 Ga0207683_10228474 Ga0207683_102284742 131
1278 3300026121 Ga0207683_10276638 Ga0207683_102766381 131
1279 3300026121 Ga0207683_10664863 Ga0207683_106648631 131
1280 3300026142 Ga0207698_10137421 Ga0207698_101374212 131
1281 3300026142 Ga0207698_10171946 Ga0207698_101719462 131
1282 3300026142 Ga0207698_10790579 Ga0207698_107905792 131
1283 3300026142 Ga0207698_11099288 Ga0207698_110992882 131
1284 3300026142 Ga0207698_11280264 Ga0207698_112802642 131
1285 3300027364 Ga0209967_1053814 Ga0209967_10538142 131
1286 3300027552 Ga0209982_1051954 Ga0209982_10519542 131
1287 3300027614 Ga0209970_1026685 Ga0209970_10266852 131
1288 3300027666 Ga0209282_1000032 Ga0209282_1000032148 131
1289 3300027866 Ga0209813_10158999 Ga0209813_101589992 131
1290 3300027876 Ga0209974_10000149 Ga0209974_1000014918 131
1291 3300027907 Ga0207428_10002412 Ga0207428_1000241214 131
1292 3300027907 Ga0207428_10148534 Ga0207428_101485344 131
1293 3300027907 Ga0207428_10525240 Ga0207428_105252402 131
1294 3300027907 Ga0207428_11140572 Ga0207428_111405721 131
1295 3300027907 Ga0207428_11245660 Ga0207428_112456601 131
1296 3300028379 Ga0268266_10013518 Ga0268266_1001351810 131
1297 3300028379 Ga0268266_10165713 Ga0268266_101657132 131
1298 3300028379 Ga0268266_10248383 Ga0268266_102483832 131
1299 3300028379 Ga0268266_10427489 Ga0268266_104274893 131
1300 3300028379 Ga0268266_11187049 Ga0268266_111870492 131
1301 3300028379 Ga0268266_11880327 Ga0268266_118803272 131
1302 3300028380 Ga0268265_10048765 Ga0268265_100487655 131
1303 3300028380 Ga0268265_10076755 Ga0268265_100767553 131
1304 3300028380 Ga0268265_10144177 Ga0268265_101441774 131
1305 3300028380 Ga0268265_10186906 Ga0268265_101869064 131
1306 3300028380 Ga0268265_10241678 Ga0268265_102416781 131
1307 3300028380 Ga0268265_11552378 Ga0268265_115523782 131
1308 3300028381 Ga0268264_10002070 Ga0268264_1000207020 131
1309 3300028381 Ga0268264_10002318 Ga0268264_1000231818 131
1310 3300028381 Ga0268264_10053634 Ga0268264_100536343 131
1311 3300028381 Ga0268264_10085143 Ga0268264_100851438 131
1312 3300028381 Ga0268264_10510540 Ga0268264_105105402 131
1313 3300028381 Ga0268264_10944666 Ga0268264_109446662 131
1314 3300028381 Ga0268264_11441364 Ga0268264_114413642 131
1315 3300028381 Ga0268264_11726741 Ga0268264_117267411 131
1316 3300028573 Ga0265334_10000005 Ga0265334_10000005203 131
1317 3300028666 Ga0265336_10000618 Ga0265336_1000061817 131
1318 3300028786 Ga0307517_10014561 Ga0307517_100145618 131
1319 3300028786 Ga0307517_10110559 Ga0307517_101105591 131
1320 3300028794 Ga0307515_10002443 Ga0307515_100024436 131
1321 3300028794 Ga0307515_10053115 Ga0307515_100531156 131
1322 3300028794 Ga0307515_10186828 Ga0307515_101868283 131
1323 3300028794 Ga0307515_10541499 Ga0307515_105414992 131
1324 3300028794 Ga0307515_10675781 Ga0307515_106757812 131
1325 3300028800 Ga0265338_10116506 Ga0265338_101165065 131
1326 3300029957 Ga0265324_10000002 Ga0265324_1000000280 131
1327 3300029957 Ga0265324_10000500 Ga0265324_1000050029 131
1328 3300029957 Ga0265324_10050377 Ga0265324_100503773 131
1329 3300030521 Ga0307511_10232578 Ga0307511_102325781 131
1330 3300030522 Ga0307512_10045873 Ga0307512_100458737 131
1331 3300030522 Ga0307512_10091067 Ga0307512_100910673 131
1332 3300030522 Ga0307512_10098413 Ga0307512_100984132 131
1333 3300031238 Ga0265332_10000030 Ga0265332_1000003035 131
1334 3300031239 Ga0265328_10000007 Ga0265328_1000000785 131
1335 3300031241 Ga0265325_10001662 Ga0265325_100016626 131
1336 3300031241 Ga0265325_10008599 Ga0265325_1000859911 131
1337 3300031250 Ga0265331_10070855 Ga0265331_100708554 131
1338 3300031250 Ga0265331_10140817 Ga0265331_101408173 131
1339 3300031344 Ga0265316_10163987 Ga0265316_101639872 131
1340 3300031344 Ga0265316_10446833 Ga0265316_104468332 131
1341 3300031456 Ga0307513_10007825 Ga0307513_100078257 131
1342 3300031456 Ga0307513_10019109 Ga0307513_1001910914 131
1343 3300031456 Ga0307513_10034953 Ga0307513_100349532 131
1344 3300031456 Ga0307513_10058418 Ga0307513_100584189 131
1345 3300031456 Ga0307513_10063852 Ga0307513_100638525 131
1346 3300031456 Ga0307513_10097095 Ga0307513_100970952 131
1347 3300031456 Ga0307513_10184235 Ga0307513_101842352 131
1348 3300031456 Ga0307513_10262845 Ga0307513_102628451 131
1349 3300031456 Ga0307513_10418258 Ga0307513_104182583 131
1350 3300031507 Ga0307509_10000050 Ga0307509_1000005060 131
1351 3300031507 Ga0307509_10003616 Ga0307509_1000361628 131
1352 3300031507 Ga0307509_10091388 Ga0307509_100913881 131
1353 3300031507 Ga0307509_10111735 Ga0307509_101117354 131
1354 3300031507 Ga0307509_10141229 Ga0307509_101412293 131
1355 3300031507 Ga0307509_10147814 Ga0307509_101478142 131
1356 3300031507 Ga0307509_10504506 Ga0307509_105045062 131
1357 3300031548 Ga0307408_100178067 Ga0307408_1001780673 131
1358 3300031548 Ga0307408_100186366 Ga0307408_1001863664 131
1359 3300031548 Ga0307408_100193528 Ga0307408_1001935282 131
1360 3300031548 Ga0307408_100260880 Ga0307408_1002608803 131
1361 3300031548 Ga0307408_100469453 Ga0307408_1004694532 131
1362 3300031548 Ga0307408_100492733 Ga0307408_1004927332 131
1363 3300031548 Ga0307408_102277064 Ga0307408_1022770641 131
1364 3300031595 Ga0265313_10000014 Ga0265313_10000014137 131
1365 3300031616 Ga0307508_10000392 Ga0307508_1000039242 131
1366 3300031616 Ga0307508_10407074 Ga0307508_104070742 131
1367 3300031616 Ga0307508_10537503 Ga0307508_105375032 131
1368 3300031649 Ga0307514_10034392 Ga0307514_100343927 131
1369 3300031649 Ga0307514_10104256 Ga0307514_101042564 131
1370 3300031649 Ga0307514_10178976 Ga0307514_101789762 131
1371 3300031649 Ga0307514_10181649 Ga0307514_101816491 131
1372 3300031649 Ga0307514_10213346 Ga0307514_102133463 131
1373 3300031665 Ga0316575_10108836 Ga0316575_101088361 131
1374 3300031711 Ga0265314_10001521 Ga0265314_1000152117 131
1375 3300031711 Ga0265314_10075432 Ga0265314_100754323 131
1376 3300031730 Ga0307516_10011689 Ga0307516_1001168918 131
1377 3300031730 Ga0307516_10019197 Ga0307516_1001919712 131
1378 3300031730 Ga0307516_10397791 Ga0307516_103977912 131
1379 3300031731 Ga0307405_10005729 Ga0307405_100057292 131
1380 3300031731 Ga0307405_10012091 Ga0307405_100120916 131
1381 3300031731 Ga0307405_10046436 Ga0307405_100464364 131
1382 3300031731 Ga0307405_10155277 Ga0307405_101552773 131
1383 3300031731 Ga0307405_10823826 Ga0307405_108238262 131
1384 3300031731 Ga0307405_11140977 Ga0307405_111409772 131
1385 3300031731 Ga0307405_12096718 Ga0307405_120967181 131
1386 3300031824 Ga0307413_10001429 Ga0307413_1000142915 131
1387 3300031824 Ga0307413_10032313 Ga0307413_100323134 131
1388 3300031824 Ga0307413_10035769 Ga0307413_100357693 131
1389 3300031824 Ga0307413_10206648 Ga0307413_102066483 131
1390 3300031824 Ga0307413_10641796 Ga0307413_106417962 131
1391 3300031824 Ga0307413_10747659 Ga0307413_107476592 131
1392 3300031852 Ga0307410_10002645 Ga0307410_1000264514 131
1393 3300031852 Ga0307410_10006977 Ga0307410_100069772 131
1394 3300031852 Ga0307410_10073323 Ga0307410_100733234 131
1395 3300031852 Ga0307410_10531987 Ga0307410_105319871 131
1396 3300031852 Ga0307410_10762095 Ga0307410_107620951 131
1397 3300031852 Ga0307410_10916788 Ga0307410_109167882 131
1398 3300031901 Ga0307406_10004866 Ga0307406_100048669 131
1399 3300031901 Ga0307406_10054966 Ga0307406_100549666 131
1400 3300031901 Ga0307406_10163268 Ga0307406_101632682 131
1401 3300031901 Ga0307406_10214883 Ga0307406_102148832 131
1402 3300031903 Ga0307407_10006994 Ga0307407_1000699410 131
1403 3300031903 Ga0307407_10007323 Ga0307407_100073232 131
1404 3300031903 Ga0307407_10061462 Ga0307407_100614624 131
1405 3300031903 Ga0307407_10323671 Ga0307407_103236712 131
1406 3300031903 Ga0307407_11399922 Ga0307407_113999221 131
1407 3300031911 Ga0307412_10011559 Ga0307412_100115593 131
1408 3300031911 Ga0307412_10074922 Ga0307412_100749223 131
1409 3300031911 Ga0307412_10094847 Ga0307412_100948472 131
1410 3300031911 Ga0307412_10263875 Ga0307412_102638753 131
1411 3300031911 Ga0307412_10275217 Ga0307412_102752172 131
1412 3300031911 Ga0307412_10300299 Ga0307412_103002993 131
1413 3300031911 Ga0307412_10819269 Ga0307412_108192691 131
1414 3300031911 Ga0307412_12037627 Ga0307412_120376271 131
1415 3300031995 Ga0307409_100000577 Ga0307409_10000057722 131
1416 3300031995 Ga0307409_100018987 Ga0307409_1000189875 131
1417 3300031995 Ga0307409_100034200 Ga0307409_1000342001 131
1418 3300031995 Ga0307409_100072562 Ga0307409_1000725622 131
1419 3300031995 Ga0307409_100686881 Ga0307409_1006868812 131
1420 3300032002 Ga0307416_100028404 Ga0307416_1000284047 131
1421 3300032002 Ga0307416_100043561 Ga0307416_1000435614 131
1422 3300032002 Ga0307416_100550299 Ga0307416_1005502992 131
1423 3300032002 Ga0307416_100764931 Ga0307416_1007649312 131
1424 3300032002 Ga0307416_101030487 Ga0307416_1010304872 131
1425 3300032002 Ga0307416_101105132 Ga0307416_1011051322 131
1426 3300032002 Ga0307416_101119617 Ga0307416_1011196172 131
1427 3300032002 Ga0307416_101230578 Ga0307416_1012305782 131
1428 3300032004 Ga0307414_10358891 Ga0307414_103588912 131
1429 3300032004 Ga0307414_10678899 Ga0307414_106788992 131
1430 3300032005 Ga0307411_10001998 Ga0307411_1000199814 131
1431 3300032005 Ga0307411_10034772 Ga0307411_100347726 131
1432 3300032005 Ga0307411_10249959 Ga0307411_102499592 131
1433 3300032005 Ga0307411_10330148 Ga0307411_103301481 131
1434 3300032005 Ga0307411_10354795 Ga0307411_103547952 131
1435 3300032005 Ga0307411_10427072 Ga0307411_104270722 131
1436 3300032005 Ga0307411_10540746 Ga0307411_105407462 131
1437 3300032005 Ga0307411_10603921 Ga0307411_106039212 131
1438 3300032005 Ga0307411_10655015 Ga0307411_106550152 131
1439 3300032005 Ga0307411_11130764 Ga0307411_111307641 131
1440 3300032005 Ga0307411_12146570 Ga0307411_121465701 131
1441 3300032126 Ga0307415_100034663 Ga0307415_1000346634 131
1442 3300032126 Ga0307415_100039097 Ga0307415_1000390976 131
1443 3300032126 Ga0307415_100210379 Ga0307415_1002103793 131
1444 3300032126 Ga0307415_100239312 Ga0307415_1002393123 131
1445 3300032126 Ga0307415_100278380 Ga0307415_1002783803 131
1446 3300032126 Ga0307415_100482114 Ga0307415_1004821142 131
1447 3300032126 Ga0307415_101335212 Ga0307415_1013352122 131
1448 3300032133 Ga0316583_10161702 Ga0316583_101617022 131
1449 3300032168 Ga0316593_10040336 Ga0316593_100403363 131
1450 3300032168 Ga0316593_10198099 Ga0316593_101980991 131
1451 3300033179 Ga0307507_10087876 Ga0307507_100878762 131
1452 3300033179 Ga0307507_10154935 Ga0307507_101549353 131
1453 3300033180 Ga0307510_10168701 Ga0307510_101687013 131
1454 3300033180 Ga0307510_10170741 Ga0307510_101707412 131
1455 3300033180 Ga0307510_10523931 Ga0307510_105239312 131
1456 3300033541 Ga0316596_1229670 Ga0316596_12296701 131
1457 3300035083 Ga0373926_0022611 Ga0373926_0022611_1078_1473 131
1458 3300035083 Ga0373926_0079568 Ga0373926_0079568_366_761 131
1459 3300035084 Ga0373928_0014100 Ga0373928_0014100_667_1062 131
1460 3300035084 Ga0373928_0246433 Ga0373928_0246433_65_460 131
1461 3300035086 Ga0373934_0243828 Ga0373934_0243828_265_660 131
1462 3300035088 Ga0373940_0013603 Ga0373940_0013603_1335_1730 131
1463 3300035089 Ga0373944_0026001 Ga0373944_0026001_121_516 131
1464 3300035089 Ga0373944_0122902 Ga0373944_0122902_287_682 131
1465 3300035089 Ga0373944_0136517 Ga0373944_0136517_331_726 131
1466 3300035091 Ga0373951_0036869 Ga0373951_0036869_233_628 131
1467 3300035092 Ga0373952_0009457 Ga0373952_0009457_1393_1788 131
1468 3300035111 Ga0373923_0117766 Ga0373923_0117766_512_907 131
1469 3300035112 Ga0373932_0064786 Ga0373932_0064786_550_945 131
1470 3300035114 Ga0373939_0101011 Ga0373939_0101011_327_722 131
1471 3300035115 Ga0373941_0291295 Ga0373941_0291295_82_477 131
1472 3300035117 Ga0373953_0042168 Ga0373953_0042168_1239_1634 131
1473 3300035117 Ga0373953_0334618 Ga0373953_0334618_190_585 131
1474 3300035118 Ga0373954_0124223 Ga0373954_0124223_141_536 131
1475 3300035119 Ga0373956_0085842 Ga0373956_0085842_137_532 131
1476 3300035119 Ga0373956_0136201 Ga0373956_0136201_534_929 131
1477 3300035119 Ga0373956_0441351 Ga0373956_0441351_202_597 131
1478 3300035120 Ga0373957_0044948 Ga0373957_0044948_787_1182 131
1479 3300035120 Ga0373957_0070420 Ga0373957_0070420_587_982 131
1480 3300035170 Ga0373943_0250809 Ga0373943_0250809_372_767 131
1481 3300035170 Ga0373943_0421698 Ga0373943_0421698_106_501 131
1482 3300035171 Ga0373946_0057466 Ga0373946_0057466_857_1252 131
1483 3300035171 Ga0373946_0150156 Ga0373946_0150156_35_430 131
1484 3300035171 Ga0373946_0167214 Ga0373946_0167214_95_490 131
1485 3300035172 Ga0373955_0018160 Ga0373955_0018160_1750_2145 131
1486 3300035172 Ga0373955_0081524 Ga0373955_0081524_81_476 131
1487 3300035172 Ga0373955_0092432 Ga0373955_0092432_462_857 131
1488 3300035172 Ga0373955_0292723 Ga0373955_0292723_277_672 131
1489 3300035207 Ga0373942_0133951 Ga0373942_0133951_28_423 131
1490 3300035242 Ga0373962_0139983 Ga0373962_0139983_329_724 131
1491 3300035398 Ga0316574_0285455 Ga0316574_0285455_312_707 131
1492 3300035410 Ga0373924_0102911 Ga0373924_0102911_253_648 131
1493 3300035410 Ga0373924_0247167 Ga0373924_0247167_380_775 131
1494 3300035691 Ga0373931_0008660 Ga0373931_0008660_1432_1827 131
1495 3300035691 Ga0373931_0446973 Ga0373931_0446973_294_689 131
1496 3300035691 Ga0373931_0606530 Ga0373931_0606530_48_443 131
1497 3300035692 Ga0373935_0013375 Ga0373935_0013375_4194_4589 131
1498 3300035692 Ga0373935_1117509 Ga0373935_1117509_145_540 131
1499 3300035695 Ga0373927_0074508 Ga0373927_0074508_167_562 131
1500 3300035695 Ga0373927_0306888 Ga0373927_0306888_539_934 131
1501 3300035695 Ga0373927_0421769 Ga0373927_0421769_391_786 131
1502 3300035724 Ga0373933_0864838 Ga0373933_0864838_168_563 131
1503 3300035725 Ga0373947_0114560 Ga0373947_0114560_1189_1584 131
1504 3300036401 Ga0373937_0120811 Ga0373937_0120811_1291_1686 131
1505 3300036401 Ga0373937_0488619 Ga0373937_0488619_203_598 131
1506 3300037068 Ga0373925_0089907 Ga0373925_0089907_676_1071 131
1507 3300037068 Ga0373925_0375274 Ga0373925_0375274_264_659 131
1508 3300037068 Ga0373925_0466364 Ga0373925_0466364_547_942 131
1509 3300037068 Ga0373925_0747219 Ga0373925_0747219_16_411 131
1510 3300037471 Ga0395905_0038305 Ga0395905_0038305_1797_2192 131
1511 3300039062 Ga0400483_226967 Ga0400483_226967_53_448 131
1512 3300039437 Ga0436365_0772335 Ga0436365_0772335_298_693 131
1513 3300039450 Ga0436363_0160364 Ga0436363_0160364_444_839 131
1514 3300039450 Ga0436363_1530821 Ga0436363_1530821_2268_2663 131
1515 3300039450 Ga0436363_1604646 Ga0436363_1604646_119_514 131
1516 3300041406 Ga0439439_0093230 Ga0439439_0093230_170_565 131
1517 3300041413 Ga0439465_0154212 Ga0439465_0154212_317_712 131
1518 3300041441 Ga0451787_578519 Ga0451787_578519_62_457 131
1519 3300041441 Ga0451787_682059 Ga0451787_682059_521_916 131
1520 3300041443 Ga0451789_0604896 Ga0451789_0604896_255_650 131
1521 3300041443 Ga0451789_0701085 Ga0451789_0701085_101_496 131
1522 3300041443 Ga0451789_0781745 Ga0451789_0781745_785_1180 131
1523 3300041443 Ga0451789_0965253 Ga0451789_0965253_1622_2017 131
1524 3300041443 Ga0451789_1079498 Ga0451789_1079498_323_718 131
1525 3300041444 Ga0451790_47197 Ga0451790_47197_571_966 131
1526 3300041446 Ga0451794_03533 Ga0451794_03533_13_408 131
1527 3300041446 Ga0451794_20639 Ga0451794_20639_101_496 131
1528 3300041446 Ga0451794_21291 Ga0451794_21291_272_667 131
1529 3300041452 Ga0451793_0424511 Ga0451793_0424511_498_893 131
1530 3300041452 Ga0451793_0637995 Ga0451793_0637995_1215_1610 131
1531 3300041452 Ga0451793_1338571 Ga0451793_1338571_420_815 131
1532 3300041453 Ga0451797_0593740 Ga0451797_0593740_502_897 131
1533 3300041453 Ga0451797_0784698 Ga0451797_0784698_36_431 131
1534 3300041454 Ga0451799_28190 Ga0451799_28190_66_461 131
1535 3300041454 Ga0451799_32497 Ga0451799_32497_81_476 131
1536 3300041455 Ga0451801_26122 Ga0451801_26122_530_925 131
1537 3300041456 Ga0451795_0013989 Ga0451795_0013989_49_444 131
1538 3300041458 Ga0451798_0518391 Ga0451798_0518391_164_559 131
1539 3300041459 Ga0451800_0475520 Ga0451800_0475520_704_1099 131
1540 3300041459 Ga0451800_1232355 Ga0451800_1232355_1323_1718 131
1541 3300041461 Ga0451805_010137 Ga0451805_010137_685_1080 131
1542 3300041461 Ga0451805_039282 Ga0451805_039282_521_916 131
1543 3300041463 Ga0451804_0197986 Ga0451804_0197986_104_499 131
1544 3300041463 Ga0451804_0350671 Ga0451804_0350671_2843_3238 131
1545 3300041463 Ga0451804_0672156 Ga0451804_0672156_71_466 131
1546 3300041463 Ga0451804_0722325 Ga0451804_0722325_113_508 131
1547 3300041486 Ga0451807_0646883 Ga0451807_0646883_1051_1446 131
1548 3300041486 Ga0451807_0837307 Ga0451807_0837307_108_503 131
1549 3300041486 Ga0451807_0984280 Ga0451807_0984280_194_589 131
1550 3300041486 Ga0451807_1506488 Ga0451807_1506488_83_478 131
1551 3300041491 Ga0451833_0205751 Ga0451833_0205751_71_466 131
1552 3300041498 Ga0451841_0230757 Ga0451841_0230757_15_410 131
1553 3300041498 Ga0451841_0455622 Ga0451841_0455622_146_541 131
1554 3300041505 Ga0451849_1485536 Ga0451849_1485536_151_546 131
1555 3300041506 Ga0451850_07380 Ga0451850_07380_216_611 131
1556 3300041511 Ga0451855_0043459 Ga0451855_0043459_942_1337 131
1557 3300041512 Ga0451853_0694569 Ga0451853_0694569_242_637 131
1558 3300041512 Ga0451853_1066481 Ga0451853_1066481_483_878 131
1559 3300041512 Ga0451853_1718278 Ga0451853_1718278_292_687 131
1560 3300041512 Ga0451853_2708289 Ga0451853_2708289_18_413 131
1561 3300041512 Ga0451853_4042749 Ga0451853_4042749_1042_1437 131
1562 3300041916 Ga0452271_65294 Ga0452271_65294_165_560 131
1563 3300042015 Ga0439462_0063869 Ga0439462_0063869_37_432 131
1564 3300042118 Ga0450914_006348 Ga0450914_006348_184_579 131
1565 3300042125 Ga0450923_163606 Ga0450923_163606_99_494 131
1566 3300042126 Ga0450888_076627 Ga0450888_076627_39_434 131
1567 3300042134 Ga0450898_151038 Ga0450898_151038_97_492 131
1568 3300042145 Ga0450906_073666 Ga0450906_073666_99_494 131
1569 3300042157 Ga0439458_0062075 Ga0439458_0062075_284_679 131
1570 3300042437 Ga0439444_0186821 Ga0439444_0186821_59_454 131
1571 3300042439 Ga0439464_0163579 Ga0439464_0163579_101_496 131
1572 3300042530 Ga0450916_028444 Ga0450916_028444_101_496 131
1573 3300042531 Ga0450918_106598 Ga0450918_106598_55_450 131
1574 3300042532 Ga0450893_0079748 Ga0450893_0079748_95_490 131
1575 3300042876 Ga0451577_0000013 Ga0451577_0000013_421990_422385 131
1576 3300042876 Ga0451577_0027488 Ga0451577_0027488_3625_4020 131
1577 3300042876 Ga0451577_0221004 Ga0451577_0221004_1067_1462 131
1578 3300042876 Ga0451577_0909734 Ga0451577_0909734_338_733 131
1579 3300044673 Ga0453683_0000059 Ga0453683_0000059_58459_58854 131
1580 3300044694 Ga0466963_0155056 Ga0466963_0155056_679_1074 131
1581 3300044712 Ga0453684_0000585 Ga0453684_0000585_6948_7343 131
1582 3300044712 Ga0453684_0077473 Ga0453684_0077473_472_867 131
1583 3300044712 Ga0453684_0261576 Ga0453684_0261576_525_920 131
1584 3300044712 Ga0453684_0340103 Ga0453684_0340103_554_949 131
1585 3300045051 Ga0451576_0000018 Ga0451576_0000018_128305_128700 131
1586 3300045051 Ga0451576_0000909 Ga0451576_0000909_48427_48822 131
1587 3300045051 Ga0451576_0079035 Ga0451576_0079035_2246_2641 131
1588 3300045051 Ga0451576_0131416 Ga0451576_0131416_508_903 131
1589 3300045051 Ga0451576_0168870 Ga0451576_0168870_1494_1889 131
1590 3300045051 Ga0451576_1144103 Ga0451576_1144103_321_716 131
1591 3300045051 Ga0451576_1160016 Ga0451576_1160016_385_780 131
1592 3300046452 Ga0495617_066779 Ga0495617_066779_70_465 131
1593 3300046454 Ga0495592_0000203 Ga0495592_0000203_42371_42766 131
1594 3300046455 Ga0495603_0167391 Ga0495603_0167391_166_561 131
1595 3300046457 Ga0495590_0076553 Ga0495590_0076553_604_999 131
1596 3300046457 Ga0495590_0128399 Ga0495590_0128399_196_591 131
1597 3300046457 Ga0495590_0406464 Ga0495590_0406464_41_436 131
1598 3300046460 Ga0495638_0020600 Ga0495638_0020600_3249_3644 131
1599 3300046460 Ga0495638_0023580 Ga0495638_0023580_396_791 131
1600 3300046460 Ga0495638_0131647 Ga0495638_0131647_462_857 131
1601 3300046460 Ga0495638_0162714 Ga0495638_0162714_552_947 131
1602 3300046461 Ga0495641_0101699 Ga0495641_0101699_353_748 131
1603 3300046462 Ga0495651_0800123 Ga0495651_0800123_33_428 131
1604 3300046472 Ga0495580_0265795 Ga0495580_0265795_508_903 131
1605 3300046473 Ga0495582_0285985 Ga0495582_0285985_363_758 131
1606 3300046473 Ga0495582_0385106 Ga0495582_0385106_160_555 131
1607 3300046474 Ga0495605_0242295 Ga0495605_0242295_79_474 131
1608 3300046475 Ga0495639_0485717 Ga0495639_0485717_170_565 131
1609 3300046477 Ga0495664_0693486 Ga0495664_0693486_194_589 131
1610 3300046492 Ga0495585_0124260 Ga0495585_0124260_214_609 131
1611 3300046500 Ga0495596_0334463 Ga0495596_0334463_35_430 131
1612 3300046506 Ga0495583_0124309 Ga0495583_0124309_184_579 131
1613 3300046511 Ga0495608_0636945 Ga0495608_0636945_59_454 131
1614 3300046511 Ga0495608_0684824 Ga0495608_0684824_55_450 131
1615 3300046512 Ga0495610_0007369 Ga0495610_0007369_2194_2589 131
1616 3300046512 Ga0495610_0025318 Ga0495610_0025318_2404_2799 131
1617 3300046512 Ga0495610_0096636 Ga0495610_0096636_846_1241 131
1618 3300046512 Ga0495610_0152175 Ga0495610_0152175_345_740 131
1619 3300046513 Ga0495616_0006494 Ga0495616_0006494_2217_2612 131
1620 3300046513 Ga0495616_0074407 Ga0495616_0074407_1091_1486 131
1621 3300046514 Ga0495618_0210570 Ga0495618_0210570_621_1016 131
1622 3300046514 Ga0495618_0263098 Ga0495618_0263098_251_646 131
1623 3300046514 Ga0495618_0632815 Ga0495618_0632815_190_585 131
1624 3300046515 Ga0495620_0021563 Ga0495620_0021563_513_908 131
1625 3300046515 Ga0495620_0083017 Ga0495620_0083017_313_708 131
1626 3300046515 Ga0495620_0096514 Ga0495620_0096514_287_682 131
1627 3300046517 Ga0495630_0126006 Ga0495630_0126006_1127_1522 131
1628 3300046518 Ga0495631_0022122 Ga0495631_0022122_1215_1610 131
1629 3300046519 Ga0495632_0065630 Ga0495632_0065630_789_1184 131
1630 3300046519 Ga0495632_0113435 Ga0495632_0113435_459_854 131
1631 3300046522 Ga0495643_0019121 Ga0495643_0019121_3228_3623 131
1632 3300046522 Ga0495643_0474258 Ga0495643_0474258_78_473 131
1633 3300046524 Ga0495648_0357937 Ga0495648_0357937_19_414 131
1634 3300046525 Ga0495663_0091107 Ga0495663_0091107_373_768 131
1635 3300046525 Ga0495663_0161528 Ga0495663_0161528_239_634 131
1636 3300046528 Ga0495642_0053512 Ga0495642_0053512_782_1177 131
1637 3300046530 Ga0495654_0056414 Ga0495654_0056414_657_1052 131
1638 3300046530 Ga0495654_0208764 Ga0495654_0208764_157_552 131
1639 3300046530 Ga0495654_0283869 Ga0495654_0283869_137_532 131
1640 3300046533 Ga0495640_0425133 Ga0495640_0425133_207_602 131
1641 3300046535 Ga0495586_0061618 Ga0495586_0061618_1354_1749 131
1642 3300046536 Ga0495587_0270149 Ga0495587_0270149_159_554 131
1643 3300046536 Ga0495587_0440001 Ga0495587_0440001_34_429 131
1644 3300046539 Ga0495621_0352693 Ga0495621_0352693_206_601 131
1645 3300046542 Ga0495597_0092274 Ga0495597_0092274_715_1110 131
1646 3300046543 Ga0495645_0034282 Ga0495645_0034282_2220_2615 131
1647 3300046543 Ga0495645_0098975 Ga0495645_0098975_563_958 131
1648 3300046557 Ga0495622_0022381 Ga0495622_0022381_1965_2360 131
1649 3300046558 Ga0495633_0048161 Ga0495633_0048161_231_626 131
1650 3300046558 Ga0495633_0120456 Ga0495633_0120456_341_736 131
1651 3300046558 Ga0495633_0191697 Ga0495633_0191697_211_606 131
1652 3300046558 Ga0495633_0282068 Ga0495633_0282068_293_688 131
1653 3300046559 Ga0495667_0115936 Ga0495667_0115936_713_1108 131
1654 3300046559 Ga0495667_0295543 Ga0495667_0295543_199_594 131
1655 3300046616 Ga0495668_0179895 Ga0495668_0179895_150_545 131
1656 3300046616 Ga0495668_0435670 Ga0495668_0435670_167_562 131
1657 3300046642 Ga0495634_0205692 Ga0495634_0205692_707_1102 131
1658 3300046642 Ga0495634_0227438 Ga0495634_0227438_501_896 131
1659 3300046648 Ga0495611_0033426 Ga0495611_0033426_1076_1471 131
1660 3300046648 Ga0495611_0137743 Ga0495611_0137743_165_560 131
1661 3300046660 Ga0495625_0006868 Ga0495625_0006868_3808_4203 131
1662 3300046660 Ga0495625_0039878 Ga0495625_0039878_1462_1857 131
1663 3300046660 Ga0495625_0340532 Ga0495625_0340532_442_837 131
1664 3300046663 Ga0495635_0542978 Ga0495635_0542978_308_703 131
1665 3300046663 Ga0495635_0818213 Ga0495635_0818213_166_561 131
1666 3300046664 Ga0495659_0077302 Ga0495659_0077302_115_510 131
1667 3300046664 Ga0495659_0084804 Ga0495659_0084804_103_498 131
1668 3300046675 Ga0495657_0099043 Ga0495657_0099043_1051_1446 131
1669 3300046679 Ga0495623_0189415 Ga0495623_0189415_220_615 131
1670 3300046680 Ga0495646_0061137 Ga0495646_0061137_1552_1947 131
1671 3300046681 Ga0495647_0085698 Ga0495647_0085698_323_718 131
1672 3300046681 Ga0495647_0090860 Ga0495647_0090860_527_922 131
1673 3300046681 Ga0495647_0124789 Ga0495647_0124789_559_954 131
1674 3300046681 Ga0495647_0125943 Ga0495647_0125943_182_577 131
1675 3300046681 Ga0495647_0134919 Ga0495647_0134919_477_872 131
1676 3300046683 Ga0495658_0085813 Ga0495658_0085813_1043_1438 131
1677 3300046683 Ga0495658_0097472 Ga0495658_0097472_272_667 131
1678 3300046683 Ga0495658_0105468 Ga0495658_0105468_639_1034 131
1679 3300046683 Ga0495658_0223594 Ga0495658_0223594_508_903 131
1680 3300046683 Ga0495658_0455195 Ga0495658_0455195_342_737 131
1681 3300046684 Ga0495669_0084855 Ga0495669_0084855_532_927 131
1682 3300046684 Ga0495669_0103028 Ga0495669_0103028_167_562 131
1683 3300046684 Ga0495669_0321926 Ga0495669_0321926_279_674 131
1684 3300046689 Ga0495613_0091108 Ga0495613_0091108_1010_1405 131
1685 3300046689 Ga0495613_0120251 Ga0495613_0120251_1461_1856 131
1686 3300046691 Ga0495670_0042455 Ga0495670_0042455_649_1044 131
1687 3300046691 Ga0495670_0424075 Ga0495670_0424075_199_594 131
1688 3300046692 Ga0495671_0198265 Ga0495671_0198265_237_632 131
1689 3300046692 Ga0495671_0295587 Ga0495671_0295587_368_763 131
1690 3300046692 Ga0495671_0429974 Ga0495671_0429974_159_554 131
1691 3300046694 Ga0495649_0225215 Ga0495649_0225215_242_637 131
1692 3300046694 Ga0495649_0406068 Ga0495649_0406068_10_405 131
1693 3300046694 Ga0495649_0444741 Ga0495649_0444741_169_564 131
1694 3300046809 Ga0495600_0284384 Ga0495600_0284384_590_985 131
1695 3300046810 Ga0495660_0355899 Ga0495660_0355899_219_614 131
1696 3300047317 Ga0495604_0435394 Ga0495604_0435394_309_704 131
1697 3300047317 Ga0495604_0893880 Ga0495604_0893880_150_545 131
1698 3300047321 Ga0495676_0010234 Ga0495676_0010234_6101_6496 131
1699 3300047321 Ga0495676_0140426 Ga0495676_0140426_1096_1491 131
1700 3300047322 Ga0495680_0062566 Ga0495680_0062566_642_1037 131
1701 3300047322 Ga0495680_0916563 Ga0495680_0916563_80_475 131
1702 3300047446 Ga0495679_076308 Ga0495679_076308_203_598 131
1703 3300047447 Ga0495685_088317 Ga0495685_088317_95_490 131
1704 3300047469 Ga0495673_0135384 Ga0495673_0135384_40_435 131
1705 3300047469 Ga0495673_0182094 Ga0495673_0182094_289_684 131
1706 3300047470 Ga0495681_0051412 Ga0495681_0051412_204_599 131
1707 3300047470 Ga0495681_0191002 Ga0495681_0191002_257_652 131
1708 3300047472 Ga0495686_0039632 Ga0495686_0039632_271_666 131
1709 3300047472 Ga0495686_0054615 Ga0495686_0054615_1940_2335 131
1710 3300047472 Ga0495686_0066900 Ga0495686_0066900_1215_1610 131
1711 3300047472 Ga0495686_0195418 Ga0495686_0195418_175_570 131
1712 3300047472 Ga0495686_0580565 Ga0495686_0580565_166_561 131
1713 3300047673 Ga0495593_0038039 Ga0495593_0038039_1094_1489 131
1714 3300048089 Ga0495614_0095045 Ga0495614_0095045_418_813 131
1715 3300048091 Ga0495626_0074338 Ga0495626_0074338_411_806 131
1716 3300048091 Ga0495626_0131805 Ga0495626_0131805_74_469 131
1717 3300048091 Ga0495626_0154700 Ga0495626_0154700_386_781 131
1718 3300048903 Ga0496100_0447306 Ga0496100_0447306_44_439 131
1719 3300048903 Ga0496100_1019883 Ga0496100_1019883_182_577 131
1720 3300048904 Ga0496101_0633712 Ga0496101_0633712_371_766 131
1721 3300048905 Ga0496102_0060302 Ga0496102_0060302_437_832 131
1722 3300048905 Ga0496102_0536484 Ga0496102_0536484_572_967 131
1723 3300048905 Ga0496102_0704384 Ga0496102_0704384_352_747 131
1724 3300048907 Ga0496104_0327787 Ga0496104_0327787_352_747 131
1725 3300048908 Ga0496105_0289103 Ga0496105_0289103_385_780 131
1726 3300048908 Ga0496105_0693498 Ga0496105_0693498_204_599 131
1727 3300048909 Ga0496106_0275442 Ga0496106_0275442_348_743 131
1728 3300048909 Ga0496106_1586289 Ga0496106_1586289_18_413 131
1729 3300048911 Ga0496108_0005999 Ga0496108_0005999_7358_7753 131
1730 3300048911 Ga0496108_0097580 Ga0496108_0097580_1045_1440 131
1731 3300048911 Ga0496108_0309768 Ga0496108_0309768_936_1331 131
1732 3300048912 Ga0496109_0259357 Ga0496109_0259357_682_1077 131
1733 3300048912 Ga0496109_0267867 Ga0496109_0267867_706_1101 131
1734 3300048912 Ga0496109_0618045 Ga0496109_0618045_38_433 131
1735 3300048912 Ga0496109_1217504 Ga0496109_1217504_98_493 131
1736 3300048914 Ga0496111_0558089 Ga0496111_0558089_326_721 131
1737 3300048915 Ga0496112_0462843 Ga0496112_0462843_187_582 131
1738 3300048915 Ga0496112_0475015 Ga0496112_0475015_736_1131 131
1739 3300048916 Ga0496113_0211725 Ga0496113_0211725_847_1242 131
1740 3300048916 Ga0496113_0215057 Ga0496113_0215057_164_559 131
1741 3300048916 Ga0496113_0885539 Ga0496113_0885539_112_507 131
1742 3300048917 Ga0496114_0009046 Ga0496114_0009046_5567_5962 131
1743 3300048917 Ga0496114_0430906 Ga0496114_0430906_449_844 131
1744 3300048917 Ga0496114_0574004 Ga0496114_0574004_226_621 131
1745 3300048918 Ga0496115_0030230 Ga0496115_0030230_2772_3167 131
1746 3300049127 Ga0501306_001000 Ga0501306_001000_1996_2391 131
1747 3300049128 Ga0501308_004862 Ga0501308_004862_406_801 131
1748 3300049128 Ga0501308_015871 Ga0501308_015871_254_649 131
1749 3300049129 Ga0501309_018080 Ga0501309_018080_177_572 131
1750 3300049130 Ga0501310_005085 Ga0501310_005085_251_646 131
1751 3300049130 Ga0501310_011089 Ga0501310_011089_358_753 131
1752 3300049130 Ga0501310_011540 Ga0501310_011540_428_823 131
1753 3300049160 Ga0501304_001736 Ga0501304_001736_26_421 131
1754 3300049161 Ga0501305_000819 Ga0501305_000819_41_436 131
1755 3300049161 Ga0501305_005417 Ga0501305_005417_1113_1508 131
1756 3300049161 Ga0501305_010469 Ga0501305_010469_531_926 131
1757 3300049161 Ga0501305_038350 Ga0501305_038350_129_524 131
1758 3300049162 Ga0501307_000963 Ga0501307_000963_179_574 131
1759 3300049162 Ga0501307_025529 Ga0501307_025529_213_608 131
1760 3300049162 Ga0501307_068984 Ga0501307_068984_85_480 131
1761 3300049460 Ga0495682_0049136 Ga0495682_0049136_794_1189 131
1762 3300049515 Ga0501292_046069 Ga0501292_046069_210_614 131
1763 3300049522 Ga0501299_044313 Ga0501299_044313_151_555 131
1764 3300049527 Ga0501311_027374 Ga0501311_027374_336_731 131
1765 3300049528 Ga0501312_020297 Ga0501312_020297_74_469 131
1766 3300049528 Ga0501312_025631 Ga0501312_025631_428_823 131
1767 3300049533 Ga0501317_020404 Ga0501317_020404_452_847 131
1768 3300049533 Ga0501317_049831 Ga0501317_049831_248_643 131
1769 3300049539 Ga0501323_006346 Ga0501323_006346_416_811 131
1770 3300049539 Ga0501323_011600 Ga0501323_011600_113_508 131
1771 3300049568 Ga0501031_0414151 Ga0501031_0414151_81_476 131
1772 3300049569 Ga0501032_0525586 Ga0501032_0525586_62_457 131
1773 3300049570 Ga0501033_0049659 Ga0501033_0049659_1429_1824 131
1774 3300049570 Ga0501033_0106171 Ga0501033_0106171_1588_1983 131
1775 3300049570 Ga0501033_0713753 Ga0501033_0713753_119_514 131
1776 3300049572 Ga0501036_0023621 Ga0501036_0023621_1431_1826 131
1777 3300049572 Ga0501036_0041349 Ga0501036_0041349_1854_2249 131
1778 3300049572 Ga0501036_0048255 Ga0501036_0048255_2444_2839 131
1779 3300049572 Ga0501036_0061179 Ga0501036_0061179_2722_3117 131
1780 3300049572 Ga0501036_0533062 Ga0501036_0533062_341_736 131
1781 3300049573 Ga0501037_0067017 Ga0501037_0067017_1806_2201 131
1782 3300049573 Ga0501037_0071416 Ga0501037_0071416_361_756 131
1783 3300049573 Ga0501037_0146633 Ga0501037_0146633_713_1108 131
1784 3300049574 Ga0501038_0015092 Ga0501038_0015092_3017_3412 131
1785 3300049575 Ga0501039_0021546 Ga0501039_0021546_3799_4194 131
1786 3300049575 Ga0501039_0115981 Ga0501039_0115981_1199_1594 131
1787 3300049575 Ga0501039_0428377 Ga0501039_0428377_86_481 131
1788 3300049575 Ga0501039_0702981 Ga0501039_0702981_334_729 131
1789 3300049576 Ga0501040_0008066 Ga0501040_0008066_5172_5567 131
1790 3300049576 Ga0501040_0970565 Ga0501040_0970565_124_519 131
1791 3300049577 Ga0501041_0001598 Ga0501041_0001598_2656_3051 131
1792 3300049577 Ga0501041_0119305 Ga0501041_0119305_706_1101 131
1793 3300049577 Ga0501041_0315177 Ga0501041_0315177_253_648 131
1794 3300049577 Ga0501041_0665193 Ga0501041_0665193_198_593 131
1795 3300049577 Ga0501041_0775507 Ga0501041_0775507_65_460 131
1796 3300049578 Ga0501042_0001373 Ga0501042_0001373_6357_6752 131
1797 3300049578 Ga0501042_0158721 Ga0501042_0158721_484_879 131
1798 3300049578 Ga0501042_0741520 Ga0501042_0741520_255_650 131
1799 3300049579 Ga0501043_0000090 Ga0501043_0000090_72885_73280 131
1800 3300049579 Ga0501043_0542364 Ga0501043_0542364_436_831 131
1801 3300049580 Ga0501046_0000126 Ga0501046_0000126_72883_73278 131
1802 3300049580 Ga0501046_0015243 Ga0501046_0015243_3336_3731 131
1803 3300049580 Ga0501046_0105554 Ga0501046_0105554_1141_1536 131
1804 3300049580 Ga0501046_0179631 Ga0501046_0179631_539_934 131
1805 3300049581 Ga0501047_0000160 Ga0501047_0000160_8057_8452 131
1806 3300049581 Ga0501047_0364875 Ga0501047_0364875_806_1201 131
1807 3300049582 Ga0501048_0003429 Ga0501048_0003429_10614_11009 131
1808 3300049582 Ga0501048_0009558 Ga0501048_0009558_1541_1936 131
1809 3300049582 Ga0501048_0282946 Ga0501048_0282946_149_544 131
1810 3300049582 Ga0501048_0590393 Ga0501048_0590393_64_459 131
1811 3300049583 Ga0501067_0031483 Ga0501067_0031483_2084_2479 131
1812 3300049583 Ga0501067_0424614 Ga0501067_0424614_29_424 131
1813 3300049583 Ga0501067_0472701 Ga0501067_0472701_111_506 131
1814 3300049584 Ga0501068_0001465 Ga0501068_0001465_6183_6578 131
1815 3300049584 Ga0501068_0026867 Ga0501068_0026867_2973_3368 131
1816 3300049584 Ga0501068_0041518 Ga0501068_0041518_1816_2211 131
1817 3300049584 Ga0501068_0525903 Ga0501068_0525903_273_668 131
1818 3300049585 Ga0501069_0333741 Ga0501069_0333741_309_704 131
1819 3300049586 Ga0501070_0044235 Ga0501070_0044235_2021_2416 131
1820 3300049586 Ga0501070_0169408 Ga0501070_0169408_54_449 131
1821 3300049587 Ga0501071_0024289 Ga0501071_0024289_812_1207 131
1822 3300049587 Ga0501071_0102836 Ga0501071_0102836_426_821 131
1823 3300049587 Ga0501071_0144858 Ga0501071_0144858_553_948 131
1824 3300049587 Ga0501071_0259097 Ga0501071_0259097_22_417 131
1825 3300049588 Ga0501072_0025385 Ga0501072_0025385_3605_4000 131
1826 3300049588 Ga0501072_0063312 Ga0501072_0063312_870_1265 131
1827 3300049588 Ga0501072_0101863 Ga0501072_0101863_1788_2183 131
1828 3300049588 Ga0501072_0140535 Ga0501072_0140535_1418_1813 131
1829 3300049588 Ga0501072_0327339 Ga0501072_0327339_727_1122 131
1830 3300049588 Ga0501072_0513025 Ga0501072_0513025_495_890 131
1831 3300049589 Ga0501073_0000525 Ga0501073_0000525_8700_9095 131
1832 3300049589 Ga0501073_0216221 Ga0501073_0216221_174_569 131
1833 3300049590 Ga0501074_0001124 Ga0501074_0001124_13966_14361 131
1834 3300049590 Ga0501074_0018349 Ga0501074_0018349_1743_2138 131
1835 3300049590 Ga0501074_0089815 Ga0501074_0089815_326_721 131
1836 3300049591 Ga0501075_0015597 Ga0501075_0015597_3274_3669 131
1837 3300049591 Ga0501075_0231797 Ga0501075_0231797_99_494 131
1838 3300049591 Ga0501075_0484848 Ga0501075_0484848_87_482 131
1839 3300049592 Ga0501076_0004639 Ga0501076_0004639_5453_5848 131
1840 3300049592 Ga0501076_0022764 Ga0501076_0022764_756_1151 131
1841 3300049592 Ga0501076_0028505 Ga0501076_0028505_2965_3360 131
1842 3300049592 Ga0501076_0046380 Ga0501076_0046380_2309_2704 131
1843 3300049593 Ga0501077_0002875 Ga0501077_0002875_2500_2895 131
1844 3300049593 Ga0501077_0007629 Ga0501077_0007629_3057_3452 131
1845 3300049593 Ga0501077_0029086 Ga0501077_0029086_706_1101 131
1846 3300049593 Ga0501077_0049998 Ga0501077_0049998_126_521 131
1847 3300049593 Ga0501077_0059648 Ga0501077_0059648_335_730 131
1848 3300049650 Ga0501199_034729 Ga0501199_034729_85_489 131
1849 3300049662 Ga0501222_041246 Ga0501222_041246_216_611 131
1850 3300049666 Ga0501228_000607 Ga0501228_000607_116_523 131
1851 3300049672 Ga0501239_055810 Ga0501239_055810_90_485 131
1852 3300049674 Ga0501242_069704 Ga0501242_069704_82_477 131
1853 3300049703 Ga0501219_009206 Ga0501219_009206_53_448 131
1854 3300049707 Ga0501234_053845 Ga0501234_053845_18_422 131
1855 3300049741 Ga0501079_0004772 Ga0501079_0004772_1598_1993 131
1856 3300049741 Ga0501079_0006996 Ga0501079_0006996_1080_1475 131
1857 3300049741 Ga0501079_0431909 Ga0501079_0431909_160_555 131
1858 3300049741 Ga0501079_1077032 Ga0501079_1077032_45_440 131
1859 3300049741 Ga0501079_1097558 Ga0501079_1097558_94_489 131
1860 3300049742 Ga0501080_0001373 Ga0501080_0001373_7995_8390 131
1861 3300049742 Ga0501080_0011395 Ga0501080_0011395_519_914 131
1862 3300049742 Ga0501080_0028144 Ga0501080_0028144_2925_3320 131
1863 3300049742 Ga0501080_0794587 Ga0501080_0794587_77_472 131
1864 3300049742 Ga0501080_1256064 Ga0501080_1256064_196_591 131
1865 3300049743 Ga0501081_0006719 Ga0501081_0006719_4341_4736 131
1866 3300049743 Ga0501081_0018126 Ga0501081_0018126_706_1101 131
1867 3300049743 Ga0501081_0332797 Ga0501081_0332797_77_472 131
1868 3300049743 Ga0501081_1326275 Ga0501081_1326275_100_495 131
1869 3300049744 Ga0501083_0004501 Ga0501083_0004501_3269_3664 131
1870 3300049744 Ga0501083_0032077 Ga0501083_0032077_1539_1934 131
1871 3300049744 Ga0501083_0079781 Ga0501083_0079781_456_851 131
1872 3300049776 Ga0501280_000425 Ga0501280_000425_6734_7129 131
1873 3300049822 Ga0501035_0180906 Ga0501035_0180906_239_634 131
1874 3300049822 Ga0501035_0729904 Ga0501035_0729904_48_443 131
1875 3300049823 Ga0501044_0057237 Ga0501044_0057237_2191_2586 131
1876 3300049823 Ga0501044_0344411 Ga0501044_0344411_352_747 131
1877 3300049823 Ga0501044_0644482 Ga0501044_0644482_10_405 131
1878 3300049823 Ga0501044_0934012 Ga0501044_0934012_326_721 131
1879 3300049824 Ga0501045_0000882 Ga0501045_0000882_2538_2933 131
1880 3300049824 Ga0501045_0008747 Ga0501045_0008747_3688_4083 131
1881 3300049824 Ga0501045_0084307 Ga0501045_0084307_892_1287 131
1882 3300049824 Ga0501045_0089934 Ga0501045_0089934_1758_2153 131
1883 3300050489 nmdc:mga03683_18745_c1 nmdc:mga03683_18745_c1_1425_1820 131
1884 3300050489 nmdc:mga03683_330406_c1 nmdc:mga03683_330406_c1_270_665 131
1885 3300050490 nmdc:mga03n38_4851_c1 nmdc:mga03n38_4851_c1_2343_2738 131
1886 3300050490 nmdc:mga03n38_660515_c1 nmdc:mga03n38_660515_c1_31_426 131
1887 3300050491 nmdc:mga00v17_103467_c1 nmdc:mga00v17_103467_c1_51_446 131
1888 3300050491 nmdc:mga00v17_53813_c1 nmdc:mga00v17_53813_c1_828_1223 131
1889 3300050491 nmdc:mga00v17_803227_c1 nmdc:mga00v17_803227_c1_56_451 131
1890 3300050493 nmdc:mga0k408_1021_c1 nmdc:mga0k408_1021_c1_9151_9546 131
1891 3300050493 nmdc:mga0k408_109049_c1 nmdc:mga0k408_109049_c1_190_585 131
1892 3300050493 nmdc:mga0k408_12806_c1 nmdc:mga0k408_12806_c1_2388_2783 131
1893 3300050493 nmdc:mga0k408_137955_c1 nmdc:mga0k408_137955_c1_965_1360 131
1894 3300050493 nmdc:mga0k408_149455_c1 nmdc:mga0k408_149455_c1_479_874 131
1895 3300050493 nmdc:mga0k408_153215_c1 nmdc:mga0k408_153215_c1_13_408 131
1896 3300050493 nmdc:mga0k408_17814_c1 nmdc:mga0k408_17814_c1_2952_3347 131
1897 3300050493 nmdc:mga0k408_205529_c1 nmdc:mga0k408_205529_c1_652_1047 131
1898 3300050493 nmdc:mga0k408_210024_c1 nmdc:mga0k408_210024_c1_632_1027 131
1899 3300050493 nmdc:mga0k408_219_c1 nmdc:mga0k408_219_c1_8152_8547 131
1900 3300050493 nmdc:mga0k408_23422_c1 nmdc:mga0k408_23422_c1_2118_2513 131
1901 3300050493 nmdc:mga0k408_23786_c1 nmdc:mga0k408_23786_c1_1144_1539 131
1902 3300050493 nmdc:mga0k408_28249_c1 nmdc:mga0k408_28249_c1_561_956 131
1903 3300050493 nmdc:mga0k408_283141_c1 nmdc:mga0k408_283141_c1_381_776 131
1904 3300050493 nmdc:mga0k408_318491_c1 nmdc:mga0k408_318491_c1_467_862 131
1905 3300050493 nmdc:mga0k408_46982_c1 nmdc:mga0k408_46982_c1_895_1290 131
1906 3300050493 nmdc:mga0k408_49108_c1 nmdc:mga0k408_49108_c1_701_1096 131
1907 3300050493 nmdc:mga0k408_59396_c1 nmdc:mga0k408_59396_c1_1541_1936 131
1908 3300050493 nmdc:mga0k408_61835_c1 nmdc:mga0k408_61835_c1_1682_2077 131
1909 3300050494 nmdc:mga06z11_229350_c1 nmdc:mga06z11_229350_c1_57_452 131
1910 3300050494 nmdc:mga06z11_267106_c1 nmdc:mga06z11_267106_c1_596_991 131
1911 3300050494 nmdc:mga06z11_3023_c1 nmdc:mga06z11_3023_c1_2887_3282 131
1912 3300050494 nmdc:mga06z11_31530_c1 nmdc:mga06z11_31530_c1_480_875 131
1913 3300050495 nmdc:mga04h51_184316_c1 nmdc:mga04h51_184316_c1_244_639 131
1914 3300050496 nmdc:mga07m45_196968_c1 nmdc:mga07m45_196968_c1_205_600 131
1915 3300050496 nmdc:mga07m45_20386_c1 nmdc:mga07m45_20386_c1_3171_3566 131
1916 3300050496 nmdc:mga07m45_359059_c1 nmdc:mga07m45_359059_c1_36_431 131
1917 3300050496 nmdc:mga07m45_521105_c1 nmdc:mga07m45_521105_c1_251_646 131
1918 3300050496 nmdc:mga07m45_74068_c1 nmdc:mga07m45_74068_c1_1042_1437 131
1919 3300050496 nmdc:mga07m45_905430_c1 nmdc:mga07m45_905430_c1_76_471 131
1920 3300050507 nmdc:mga05p37_1575417_c1 nmdc:mga05p37_1575417_c1_111_506 131
1921 3300050508 nmdc:mga09592_38477_c1 nmdc:mga09592_38477_c1_298_693 131
1922 3300050508 nmdc:mga09592_533821_c1 nmdc:mga09592_533821_c1_223_618 131
1923 3300050509 nmdc:mga0qj67_50093_c1 nmdc:mga0qj67_50093_c1_204_599 131
1924 3300050509 nmdc:mga0qj67_662317_c1 nmdc:mga0qj67_662317_c1_146_541 131
1925 3300050511 nmdc:mga08y16_1296713_c1 nmdc:mga08y16_1296713_c1_32_427 131
1926 3300050511 nmdc:mga08y16_208685_c1 nmdc:mga08y16_208685_c1_308_703 131
1927 3300050511 nmdc:mga08y16_397291_c1 nmdc:mga08y16_397291_c1_653_1048 131
1928 3300050511 nmdc:mga08y16_485070_c1 nmdc:mga08y16_485070_c1_606_1001 131
1929 3300050511 nmdc:mga08y16_731543_c1 nmdc:mga08y16_731543_c1_172_567 131
1930 3300050512 nmdc:mga0n895_1599570_c1 nmdc:mga0n895_1599570_c1_198_593 131
1931 3300050513 nmdc:mga0rr50_369987_c1 nmdc:mga0rr50_369987_c1_199_594 131
1932 3300050513 nmdc:mga0rr50_423398_c1 nmdc:mga0rr50_423398_c1_444_839 131
1933 3300053077 Ga0495601_0338822 Ga0495601_0338822_394_789 131
1934 3300053077 Ga0495601_0761682 Ga0495601_0761682_73_468 131
1935 3300053078 Ga0495612_0100041 Ga0495612_0100041_403_798 131
1936 3300053078 Ga0495612_0132131 Ga0495612_0132131_259_654 131
1937 3300053080 Ga0500635_0116347 Ga0500635_0116347_432_827 131
1938 3300053083 Ga0495655_0027539 Ga0495655_0027539_572_967 131
1939 3300053083 Ga0495655_0252931 Ga0495655_0252931_177_572 131
1940 3300053084 Ga0495595_0249086 Ga0495595_0249086_381_776 131
1941 3300053084 Ga0495595_0329422 Ga0495595_0329422_17_412 131
1942 3300053084 Ga0495595_0730298 Ga0495595_0730298_101_496 131
1943 3300053085 Ga0495619_0076699 Ga0495619_0076699_1517_1912 131
1944 3300053085 Ga0495619_0264261 Ga0495619_0264261_454_849 131
1945 3300053086 Ga0500578_0000292 Ga0500578_0000292_61101_61496 131
1946 3300053086 Ga0500578_0079895 Ga0500578_0079895_1204_1599 131
1947 3300053087 Ga0500643_048658 Ga0500643_048658_415_810 131
1948 3300053088 Ga0500644_0003475 Ga0500644_0003475_2330_2725 131
1949 3300053088 Ga0500644_0024450 Ga0500644_0024450_1405_1800 131
1950 3300053090 Ga0500646_0014216 Ga0500646_0014216_901_1296 131
1951 3300053090 Ga0500646_0053402 Ga0500646_0053402_451_846 131
1952 3300053090 Ga0500646_0333222 Ga0500646_0333222_57_452 131
1953 3300053093 Ga0500651_0000274 Ga0500651_0000274_13717_14112 131
1954 3300053093 Ga0500651_0169517 Ga0500651_0169517_605_1000 131
1955 3300053094 Ga0500566_0399313 Ga0500566_0399313_35_430 131
1956 3300053096 Ga0500641_0352164 Ga0500641_0352164_174_569 131
1957 3300053097 Ga0500648_382663 Ga0500648_382663_142_537 131
1958 3300053098 Ga0500650_0150156 Ga0500650_0150156_594_989 131
1959 3300053108 Ga0500562_019007 Ga0500562_019007_715_1110 131
1960 3300053108 Ga0500562_081775 Ga0500562_081775_19_414 131
1961 3300053109 Ga0500569_001743 Ga0500569_001743_3591_3986 131
1962 3300053117 Ga0500593_000235 Ga0500593_000235_16778_17173 131
1963 3300053117 Ga0500593_079766 Ga0500593_079766_393_788 131
1964 3300053118 Ga0500594_0013014 Ga0500594_0013014_863_1258 131
1965 3300053121 Ga0500607_155896 Ga0500607_155896_572_967 131
1966 3300053129 Ga0500628_006199 Ga0500628_006199_880_1275 131
1967 3300053129 Ga0500628_019518 Ga0500628_019518_14_409 131
1968 3300053130 Ga0500642_0002530 Ga0500642_0002530_134_529 131
1969 3300053131 Ga0500652_000400 Ga0500652_000400_9149_9544 131
1970 3300053131 Ga0500652_069558 Ga0500652_069558_35_430 131
1971 3300053134 Ga0500658_0190721 Ga0500658_0190721_79_474 131
1972 3300053136 Ga0500559_0000097 Ga0500559_0000097_238_633 131
1973 3300053138 Ga0500564_150120 Ga0500564_150120_112_507 131
1974 3300053139 Ga0500568_0013644 Ga0500568_0013644_3162_3557 131
1975 3300053139 Ga0500568_0015583 Ga0500568_0015583_2454_2849 131
1976 3300053139 Ga0500568_0079576 Ga0500568_0079576_367_762 131
1977 3300053142 Ga0500577_0017376 Ga0500577_0017376_1308_1703 131
1978 3300053143 Ga0500579_268554 Ga0500579_268554_40_435 131
1979 3300053146 Ga0500588_0096304 Ga0500588_0096304_418_813 131
1980 3300053147 Ga0500589_225266 Ga0500589_225266_82_477 131
1981 3300053151 Ga0500604_0178893 Ga0500604_0178893_18_413 131
1982 3300053153 Ga0500616_0096791 Ga0500616_0096791_431_826 131
1983 3300053154 Ga0500619_000012 Ga0500619_000012_49219_49614 131
1984 3300053154 Ga0500619_259909 Ga0500619_259909_59_454 131
1985 3300053155 Ga0500620_057705 Ga0500620_057705_705_1100 131
1986 3300053156 Ga0500622_0000198 Ga0500622_0000198_36586_36981 131
1987 3300053156 Ga0500622_0000978 Ga0500622_0000978_3798_4193 131
1988 3300053162 Ga0500638_200485 Ga0500638_200485_97_492 131
1989 3300053177 Ga0500636_0125261 Ga0500636_0125261_541_936 131
1990 3300053724 Ga0500570_133500 Ga0500570_133500_58_453 131
1991 3300053730 Ga0500645_030754 Ga0500645_030754_165_560 131
1992 3300053739 Ga0500587_000541 Ga0500587_000541_3267_3662 131
1993 3300053739 Ga0500587_006132 Ga0500587_006132_644_1039 131
1994 3300054114 Ga0501084_0008704 Ga0501084_0008704_919_1314 131
1995 3300054114 Ga0501084_0022568 Ga0501084_0022568_3238_3633 131
1996 3300054114 Ga0501084_0144399 Ga0501084_0144399_779_1174 131
1997 3300054114 Ga0501084_0502704 Ga0501084_0502704_290_685 131
1998 3300054114 Ga0501084_0638875 Ga0501084_0638875_264_659 131
1999 3300054114 Ga0501084_0874625 Ga0501084_0874625_299_694 131
2000 3300059424 Ga0590075_024840 Ga0590075_024840_756_1151 131
2001 3300060353 Ga0501082_0004231 Ga0501082_0004231_9776_10171 131
2002 3300060353 Ga0501082_0043889 Ga0501082_0043889_2968_3363 131
2003 3300060353 Ga0501082_0087089 Ga0501082_0087089_1117_1512 131
2004 3300061734 Ga0530510_0006785 Ga0530510_0006785_7291_7686 131
2005 3300061734 Ga0530510_0007174 Ga0530510_0007174_3985_4380 131
2006 3300061734 Ga0530510_0119058 Ga0530510_0119058_1378_1773 131
2007 3300061734 Ga0530510_0170978 Ga0530510_0170978_635_1030 131
2008 3300061734 Ga0530510_0195752 Ga0530510_0195752_290_685 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

19

145

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9845 4 131
7m4u-assembly1.cif.gz_h a. baumannii ribosome-eravacycline complex: 30s 0.9819 2 131
7unu-assembly1.cif.gz_h pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9762 2 131
7m4u-assembly1.cif.gz_h a. baumannii ribosome-eravacycline complex: 30s 0.9745 2 131
7nhn-assembly1.cif.gz_i vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9734 3 131
ID Description Score Start End Superfamily
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9796 74 131 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9746 74 131 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9634 74 131 3.30.1490.10
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9632 4 73 3.30.1370.30
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9586 74 131 3.30.1490.10
ID Description Score Start End GO Terms
AF-A0A351BDG7-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 1.003 62 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A352KI84-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 1.001 62 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A435JWK2-F1-model_v4 deleted 1 62 131
AF-A0A1Q6ZZ57-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9998 64 131 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V6DPD0-F1-model_v4 deleted 0.9978 64 131

Feature Viewer

pLDDT pTM Quality
95.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map