F496192
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1980 | 695 | 3960 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300049127|Ga0501306_050997|Ga0501306_050997_264_653 |
| Length | 129 |
| Sequence | VTRELRTEKFMKIVSLAPEVLYGVAMDKIRKNDEVIVLAGKDKGKRGVVSRRVDAEHVIVEGVNVAKKAVKPNPMTGVQGGIVDKTMPIHVSNVALFNAATGKADRVGFKDQDGKKVRVYKSSGEEVKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002863 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300002864 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003157 | Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003159 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003288 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003291 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 34 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 41 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 42 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 43 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 44 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 45 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 46 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 62 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 63 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 66 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 68 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 126 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 127 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 130 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 144 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 145 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 149 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 150 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 151 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 170 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 175 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 176 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 260 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 261 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 263 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 264 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 265 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 266 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 267 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 268 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 274 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 276 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 277 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 278 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 279 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 281 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 282 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 283 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 284 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 285 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 287 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 288 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 289 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 290 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 291 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 295 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 296 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 297 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 301 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 302 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 303 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 305 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 307 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 308 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 309 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 311 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 312 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041457 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT | Metatranscriptome | Rhizoplane |
| 314 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 318 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 320 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 322 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 323 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 324 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 325 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 326 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 327 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 328 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 329 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 330 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 331 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 332 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 333 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 334 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 335 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 336 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 337 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 338 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 339 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 340 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 341 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 342 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 343 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 344 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 345 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 346 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 347 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 348 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 349 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 350 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 351 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 352 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 353 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 354 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 355 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 356 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 357 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 358 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 359 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 360 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 361 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 362 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 363 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 364 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 365 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 366 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 367 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 368 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 369 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 370 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 468 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 469 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 470 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 471 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 472 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 473 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 476 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 477 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 478 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 479 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 480 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 481 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 482 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 483 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 484 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 485 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 486 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 487 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 488 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 489 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 490 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 491 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 504 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 505 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 506 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 507 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 508 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 548 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 549 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 550 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 551 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 552 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 553 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 554 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 555 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 556 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 557 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 558 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 559 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 560 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 561 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 562 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 563 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 564 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 565 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 566 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 567 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 568 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 569 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 570 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 571 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 572 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 575 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 576 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 577 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 578 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 579 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 580 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 581 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 582 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 583 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 586 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 587 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 588 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 591 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 592 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 593 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 594 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 595 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 596 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 597 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 598 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 599 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 600 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 601 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 602 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 604 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 605 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 606 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 607 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 608 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 609 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 610 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 611 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 612 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 613 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 614 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 615 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 616 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 617 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 618 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 619 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 620 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 621 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 622 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 623 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 624 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 625 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 626 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 627 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 628 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 629 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 630 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 631 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 632 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 633 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 634 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 635 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 636 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 637 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 638 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 642 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 643 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 644 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 645 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 646 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 647 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 648 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 649 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 650 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 651 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 652 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 653 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 654 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 655 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 656 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 657 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 658 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 659 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 667 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 668 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 669 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 670 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 671 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 672 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 673 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 674 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 675 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 676 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 677 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 678 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 679 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 680 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 681 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 682 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 683 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 684 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 685 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 690 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 691 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 692 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 693 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 694 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 695 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.28 |
| Metatranscriptomes | 31.41 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.65 |
| Nodule | 0.3 |
| Rhizoplane | 4.09 |
| Rhizosphere | 81.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501306_050997 | 3300049127 | Bacteria | 663 |
| 2 | JGI24737J22298_10004492 | 3300001990 | Bacteria | 4859 |
| 3 | JGI25154J39366_1001042 | 3300002738 | Bacteria | 11063 |
| 4 | JGI25158J39367_1000542 | 3300002739 | Bacteria | 7614 |
| 5 | JGI25157J39369_1015755 | 3300002741 | Bacteria | 929 |
| 6 | JGI25164J39214_1003736 | 3300002772 | Bacteria | 1860 |
| 7 | JGI25152J39213_1001073 | 3300002773 | Bacteria | 12895 |
| 8 | JGI25150J39212_1001923 | 3300002774 | Bacteria | 5456 |
| 9 | JGI25150J39212_1003907 | 3300002774 | Bacteria | 3415 |
| 10 | JGI25150J39212_1011120 | 3300002774 | Bacteria | 1644 |
| 11 | JGI25150J39212_1030565 | 3300002774 | Bacteria | 748 |
| 12 | Ga0006769J43182_103907 | 3300002863 | Bacteria | 1733 |
| 13 | Ga0006764J43180_105416 | 3300002864 | Bacteria | 2303 |
| 14 | Ga0006761J43178_105065 | 3300002865 | Bacteria | 1679 |
| 15 | Ga0006767J43181_105098 | 3300002868 | Bacteria | 2522 |
| 16 | Ga0006767J43181_109868 | 3300002868 | Bacteria | 844 |
| 17 | Ga0006763J43179_104166 | 3300002870 | Bacteria | 5040 |
| 18 | Ga0006762J43184_104373 | 3300002872 | Bacteria | 1440 |
| 19 | JGI25159J45721_1016429 | 3300002987 | Bacteria | 1576 |
| 20 | JGI25159J45721_1022081 | 3300002987 | Bacteria | 1184 |
| 21 | JGI25159J45721_1043703 | 3300002987 | Bacteria | 642 |
| 22 | Ga0006774J45829_10836 | 3300003157 | Bacteria | 1242 |
| 23 | Ga0006760J45825_101715 | 3300003158 | Bacteria | 2437 |
| 24 | Ga0006760J45825_103029 | 3300003158 | Bacteria | 14292 |
| 25 | Ga0006771J45828_104476 | 3300003159 | Bacteria | 1300 |
| 26 | Ga0006779J45831_104820 | 3300003160 | Bacteria | 2487 |
| 27 | Ga0006765J45826_105454 | 3300003161 | Bacteria | 4839 |
| 28 | Ga0006765J45826_116824 | 3300003161 | Bacteria | 875 |
| 29 | Ga0006778J45830_1013714 | 3300003162 | Bacteria | 8778 |
| 30 | Ga0006778J45830_1030895 | 3300003162 | Bacteria | 960 |
| 31 | Ga0006778J45830_1104448 | 3300003162 | Bacteria | 902 |
| 32 | Ga0006759J45824_1006644 | 3300003163 | Bacteria | 1579 |
| 33 | Ga0006759J45824_1006645 | 3300003163 | Bacteria | 4182 |
| 34 | Ga0006759J45824_1010973 | 3300003163 | Bacteria | 1154 |
| 35 | Ga0006759J45824_1011122 | 3300003163 | Bacteria | 15613 |
| 36 | Ga0006759J45824_1019946 | 3300003163 | Bacteria | 12757 |
| 37 | Ga0006759J45824_1026362 | 3300003163 | Bacteria | 8907 |
| 38 | Ga0006759J45824_1037247 | 3300003163 | Bacteria | 729 |
| 39 | Ga0006759J45824_1057424 | 3300003163 | Bacteria | 748 |
| 40 | Ga0006759J45824_1062806 | 3300003163 | Bacteria | 789 |
| 41 | JGI25151J46595_10026799 | 3300003187 | Bacteria | 2320 |
| 42 | JGI25165J46597_1000239 | 3300003214 | Bacteria | 75240 |
| 43 | JGI25153J46596_10002258 | 3300003215 | Bacteria | 11225 |
| 44 | JGI25153J46596_10007740 | 3300003215 | Bacteria | 5229 |
| 45 | JGI25153J46596_10024369 | 3300003215 | Bacteria | 2183 |
| 46 | Ga0007428J48920_101526 | 3300003288 | Bacteria | 3934 |
| 47 | Ga0007421J48921_104512 | 3300003291 | Bacteria | 6358 |
| 48 | Ga0006758J48902_1003545 | 3300003300 | Bacteria | 8441 |
| 49 | Ga0006758J48902_1003546 | 3300003300 | Bacteria | 6400 |
| 50 | Ga0006758J48902_1008804 | 3300003300 | Bacteria | 15348 |
| 51 | Ga0006758J48902_1008911 | 3300003300 | Bacteria | 7674 |
| 52 | Ga0006758J48902_1015271 | 3300003300 | Bacteria | 2328 |
| 53 | Ga0006758J48902_1015967 | 3300003300 | Bacteria | 4965 |
| 54 | Ga0006758J48902_1016024 | 3300003300 | Bacteria | 1731 |
| 55 | Ga0006758J48902_1016608 | 3300003300 | Bacteria | 2081 |
| 56 | Ga0006758J48902_1016798 | 3300003300 | Bacteria | 862 |
| 57 | Ga0006758J48902_1029777 | 3300003300 | Bacteria | 900 |
| 58 | Ga0006770J48903_1010652 | 3300003305 | Bacteria | 1486 |
| 59 | Ga0006770J48903_1021042 | 3300003305 | Bacteria | 2673 |
| 60 | Ga0006770J48903_1024757 | 3300003305 | Bacteria | 880 |
| 61 | Ga0006770J48903_1030572 | 3300003305 | Bacteria | 742 |
| 62 | Ga0006770J48903_1033615 | 3300003305 | Bacteria | 748 |
| 63 | Ga0006770J48903_1040316 | 3300003305 | Bacteria | 4936 |
| 64 | Ga0006777J48905_1009816 | 3300003308 | Bacteria | 3090 |
| 65 | Ga0006777J48905_1042888 | 3300003308 | Bacteria | 2543 |
| 66 | Ga0006777J48905_1043988 | 3300003308 | Bacteria | 1148 |
| 67 | Ga0006777J48905_1047191 | 3300003308 | Bacteria | 998 |
| 68 | rootL2_10028224 | 3300003322 | Bacteria | 1983 |
| 69 | JGI25160J50197_1001051 | 3300003354 | Bacteria | 14224 |
| 70 | JGI25161J50226_1008067 | 3300003374 | Bacteria | 1667 |
| 71 | Ga0007417J51691_1002612 | 3300003544 | Bacteria | 14201 |
| 72 | Ga0007417J51691_1007850 | 3300003544 | Bacteria | 19719 |
| 73 | Ga0007417J51691_1011781 | 3300003544 | Bacteria | 8032 |
| 74 | Ga0007417J51691_1014485 | 3300003544 | Bacteria | 716 |
| 75 | Ga0007417J51691_1022403 | 3300003544 | Bacteria | 2809 |
| 76 | Ga0007417J51691_1024669 | 3300003544 | Bacteria | 1438 |
| 77 | Ga0007427J51700_104411 | 3300003559 | Bacteria | 3323 |
| 78 | Ga0007427J51700_113492 | 3300003559 | Bacteria | 2911 |
| 79 | Ga0007427J51700_117468 | 3300003559 | Bacteria | 1942 |
| 80 | Ga0006781J51513_1010997 | 3300003568 | Bacteria | 3463 |
| 81 | Ga0007410J51695_1002373 | 3300003574 | Bacteria | 2540 |
| 82 | Ga0007410J51695_1004597 | 3300003574 | Bacteria | 14339 |
| 83 | Ga0007410J51695_1005374 | 3300003574 | Bacteria | 15855 |
| 84 | Ga0007410J51695_1012689 | 3300003574 | Bacteria | 12724 |
| 85 | Ga0007410J51695_1020776 | 3300003574 | Bacteria | 2365 |
| 86 | Ga0007410J51695_1025455 | 3300003574 | Bacteria | 2936 |
| 87 | Ga0007410J51695_1042924 | 3300003574 | Bacteria | 983 |
| 88 | Ga0007409J51694_1000684 | 3300003575 | Bacteria | 1425 |
| 89 | Ga0007409J51694_1002576 | 3300003575 | Bacteria | 16363 |
| 90 | Ga0007409J51694_1020347 | 3300003575 | Bacteria | 2058 |
| 91 | Ga0007409J51694_1020348 | 3300003575 | Bacteria | 2313 |
| 92 | Ga0007409J51694_1027019 | 3300003575 | Bacteria | 1636 |
| 93 | Ga0007409J51694_1029751 | 3300003575 | Bacteria | 1903 |
| 94 | Ga0007409J51694_1032549 | 3300003575 | Bacteria | 1530 |
| 95 | Ga0007409J51694_1069872 | 3300003575 | Bacteria | 1698 |
| 96 | Ga0007409J51694_1071440 | 3300003575 | Bacteria | 641 |
| 97 | Ga0007416J51690_1002712 | 3300003577 | Bacteria | 1549 |
| 98 | Ga0007416J51690_1004870 | 3300003577 | Bacteria | 16169 |
| 99 | Ga0007416J51690_1010696 | 3300003577 | Bacteria | 1937 |
| 100 | Ga0007416J51690_1019156 | 3300003577 | Bacteria | 6450 |
| 101 | Ga0007416J51690_1023149 | 3300003577 | Bacteria | 4016 |
| 102 | Ga0007416J51690_1028700 | 3300003577 | Bacteria | 634 |
| 103 | Ga0007416J51690_1030690 | 3300003577 | Bacteria | 1156 |
| 104 | Ga0007416J51690_1049107 | 3300003577 | Bacteria | 871 |
| 105 | Ga0007429J51699_1007754 | 3300003579 | Bacteria | 1077 |
| 106 | Ga0007429J51699_1031025 | 3300003579 | Bacteria | 1503 |
| 107 | Ga0007429J51699_1050371 | 3300003579 | Bacteria | 1543 |
| 108 | Ga0007411J51799_103551 | 3300003611 | Bacteria | 13349 |
| 109 | Ga0007411J51799_103780 | 3300003611 | Bacteria | 16516 |
| 110 | Ga0007411J51799_104897 | 3300003611 | Bacteria | 1525 |
| 111 | Ga0007411J51799_110137 | 3300003611 | Bacteria | 1041 |
| 112 | Ga0007415J51800_102854 | 3300003613 | Bacteria | 5009 |
| 113 | Ga0007415J51800_104265 | 3300003613 | Bacteria | 1228 |
| 114 | Ga0007415J51800_106957 | 3300003613 | Bacteria | 14800 |
| 115 | Ga0007415J51800_109527 | 3300003613 | Bacteria | 1274 |
| 116 | Ga0007415J51800_115272 | 3300003613 | Bacteria | 759 |
| 117 | Ga0032354_1003171 | 3300003693 | Bacteria | 2717 |
| 118 | Ga0032354_1003173 | 3300003693 | Bacteria | 3128 |
| 119 | Ga0032354_1010694 | 3300003693 | Bacteria | 15995 |
| 120 | Ga0032354_1011582 | 3300003693 | Bacteria | 1078 |
| 121 | Ga0032354_1028048 | 3300003693 | Bacteria | 2080 |
| 122 | Ga0032354_1033344 | 3300003693 | Bacteria | 1370 |
| 123 | Ga0032354_1045145 | 3300003693 | Bacteria | 2372 |
| 124 | Ga0032354_1061607 | 3300003693 | Bacteria | 627 |
| 125 | Ga0006766_111745 | 3300003717 | Bacteria | 2278 |
| 126 | Ga0006766_113576 | 3300003717 | Bacteria | 2845 |
| 127 | Ga0006780_1003428 | 3300003735 | Bacteria | 4512 |
| 128 | Ga0006780_1013040 | 3300003735 | Bacteria | 1768 |
| 129 | Ga0055538_1000094 | 3300003751 | Bacteria | 75240 |
| 130 | Ga0055538_1000138 | 3300003751 | Bacteria | 51369 |
| 131 | Ga0055539_1000136 | 3300003752 | Bacteria | 76284 |
| 132 | Ga0055539_1000187 | 3300003752 | Bacteria | 51369 |
| 133 | Ga0055533_1000143 | 3300003756 | Bacteria | 75240 |
| 134 | Ga0055533_1000189 | 3300003756 | Bacteria | 51369 |
| 135 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 136 | Ga0055525_1000188 | 3300003759 | Bacteria | 75240 |
| 137 | Ga0055525_1000254 | 3300003759 | Bacteria | 51369 |
| 138 | Ga0055542_1019379 | 3300003762 | Bacteria | 1017 |
| 139 | Ga0055529_1000079 | 3300003763 | Bacteria | 149370 |
| 140 | Ga0055526_1000791 | 3300003771 | Bacteria | 23567 |
| 141 | Ga0055526_1006085 | 3300003771 | Bacteria | 6666 |
| 142 | Ga0055526_1091554 | 3300003771 | Bacteria | 573 |
| 143 | Ga0055526_1091670 | 3300003771 | Bacteria | 572 |
| 144 | Ga0055537_1008487 | 3300003773 | Bacteria | 2366 |
| 145 | Ga0055524_1003212 | 3300003775 | Bacteria | 8017 |
| 146 | Ga0055524_1009814 | 3300003775 | Bacteria | 3861 |
| 147 | Ga0055534_1006739 | 3300003784 | Bacteria | 2847 |
| 148 | Ga0055534_1030376 | 3300003784 | Bacteria | 835 |
| 149 | Ga0055528_1039396 | 3300003790 | Bacteria | 1080 |
| 150 | Ga0055528_1041929 | 3300003790 | Bacteria | 1014 |
| 151 | Ga0055528_1064545 | 3300003790 | Bacteria | 679 |
| 152 | Ga0055530_10013385 | 3300003791 | Bacteria | 2803 |
| 153 | Ga0055530_10019398 | 3300003791 | Bacteria | 2061 |
| 154 | Ga0055531_10006076 | 3300003794 | Bacteria | 6916 |
| 155 | Ga0055541_1000092 | 3300003841 | Bacteria | 75240 |
| 156 | Ga0055541_1000122 | 3300003841 | Bacteria | 51369 |
| 157 | Ga0055543_1050694 | 3300004625 | Bacteria | 680 |
| 158 | Ga0058858_1025387 | 3300004785 | Bacteria | 767 |
| 159 | Ga0058858_1044898 | 3300004785 | Bacteria | 1684 |
| 160 | Ga0058858_1357897 | 3300004785 | Bacteria | 668 |
| 161 | Ga0058858_1365258 | 3300004785 | Bacteria | 818 |
| 162 | Ga0058858_1437652 | 3300004785 | Bacteria | 1459 |
| 163 | Ga0058859_10052933 | 3300004798 | Bacteria | 1647 |
| 164 | Ga0058859_10157838 | 3300004798 | Bacteria | 1459 |
| 165 | Ga0058859_11479387 | 3300004798 | Bacteria | 907 |
| 166 | Ga0058859_11797660 | 3300004798 | Bacteria | 1044 |
| 167 | Ga0058863_10085600 | 3300004799 | Bacteria | 3459 |
| 168 | Ga0058863_11897775 | 3300004799 | Bacteria | 1362 |
| 169 | Ga0058861_10000050 | 3300004800 | Bacteria | 1287 |
| 170 | Ga0058861_10025764 | 3300004800 | Bacteria | 1145 |
| 171 | Ga0058861_10123833 | 3300004800 | Bacteria | 1216 |
| 172 | Ga0058860_10186761 | 3300004801 | Bacteria | 1353 |
| 173 | Ga0058862_10030562 | 3300004803 | Bacteria | 611 |
| 174 | Ga0058862_10086046 | 3300004803 | Bacteria | 2163 |
| 175 | Ga0058862_10117947 | 3300004803 | Bacteria | 991 |
| 176 | Ga0058862_12858774 | 3300004803 | Bacteria | 1953 |
| 177 | Ga0065165_1007979 | 3300005262 | Bacteria | 5065 |
| 178 | Ga0065165_1045530 | 3300005262 | Bacteria | 1277 |
| 179 | Ga0065165_1109781 | 3300005262 | Bacteria | 680 |
| 180 | Ga0065714_10003225 | 3300005288 | Bacteria | 8263 |
| 181 | Ga0065714_10030331 | 3300005288 | Bacteria | 1114 |
| 182 | Ga0065714_10081698 | 3300005288 | Bacteria | 2356 |
| 183 | Ga0065704_10033996 | 3300005289 | Bacteria | 1164 |
| 184 | Ga0065704_10109441 | 3300005289 | Bacteria | 1994 |
| 185 | Ga0065715_10029350 | 3300005293 | Bacteria | 1109 |
| 186 | Ga0065707_10395474 | 3300005295 | Bacteria | 859 |
| 187 | Ga0065707_10423369 | 3300005295 | Bacteria | 828 |
| 188 | Ga0070676_10056596 | 3300005328 | Bacteria | 2318 |
| 189 | Ga0070683_100088965 | 3300005329 | Bacteria | 2897 |
| 190 | Ga0070670_100298688 | 3300005331 | Bacteria | 1408 |
| 191 | Ga0068869_100399932 | 3300005334 | Bacteria | 1130 |
| 192 | Ga0068869_100512863 | 3300005334 | Bacteria | 1003 |
| 193 | Ga0070666_10594539 | 3300005335 | Bacteria | 807 |
| 194 | Ga0070680_100156061 | 3300005336 | Bacteria | 1917 |
| 195 | Ga0070680_100350879 | 3300005336 | Bacteria | 1254 |
| 196 | Ga0070682_100289738 | 3300005337 | Bacteria | 1197 |
| 197 | Ga0070660_100033862 | 3300005339 | Bacteria | 3855 |
| 198 | Ga0070660_100450254 | 3300005339 | Bacteria | 1068 |
| 199 | Ga0070661_100008785 | 3300005344 | Bacteria | 6991 |
| 200 | Ga0070661_100240283 | 3300005344 | Bacteria | 1394 |
| 201 | Ga0070692_10298703 | 3300005345 | Bacteria | 983 |
| 202 | Ga0070692_10930305 | 3300005345 | Bacteria | 603 |
| 203 | Ga0070675_100262088 | 3300005354 | Bacteria | 1515 |
| 204 | Ga0070675_100617780 | 3300005354 | Bacteria | 984 |
| 205 | Ga0070674_100422527 | 3300005356 | Bacteria | 1094 |
| 206 | Ga0070674_101181066 | 3300005356 | Bacteria | 679 |
| 207 | Ga0070673_100718252 | 3300005364 | Bacteria | 918 |
| 208 | Ga0070688_100739901 | 3300005365 | Bacteria | 765 |
| 209 | Ga0070659_100004652 | 3300005366 | Bacteria | 9804 |
| 210 | Ga0070659_100548477 | 3300005366 | Bacteria | 989 |
| 211 | Ga0070667_101147951 | 3300005367 | Bacteria | 727 |
| 212 | Ga0070714_100277699 | 3300005435 | Bacteria | 1555 |
| 213 | Ga0070705_101938002 | 3300005440 | Bacteria | 502 |
| 214 | Ga0070694_100271604 | 3300005444 | Bacteria | 1289 |
| 215 | Ga0070694_101396819 | 3300005444 | Bacteria | 591 |
| 216 | Ga0070708_100853085 | 3300005445 | Bacteria | 856 |
| 217 | Ga0070663_100474735 | 3300005455 | Bacteria | 1034 |
| 218 | Ga0070678_100931172 | 3300005456 | Bacteria | 796 |
| 219 | Ga0070678_101967645 | 3300005456 | Bacteria | 553 |
| 220 | Ga0070662_100158386 | 3300005457 | Bacteria | 1769 |
| 221 | Ga0070662_100795971 | 3300005457 | Bacteria | 803 |
| 222 | Ga0070681_10288080 | 3300005458 | Bacteria | 1553 |
| 223 | Ga0070681_11616310 | 3300005458 | Bacteria | 574 |
| 224 | Ga0068867_100105263 | 3300005459 | Bacteria | 2160 |
| 225 | Ga0070699_100350041 | 3300005518 | Bacteria | 1331 |
| 226 | Ga0068853_100029320 | 3300005539 | Bacteria | 4637 |
| 227 | Ga0068853_100284609 | 3300005539 | Bacteria | 1524 |
| 228 | Ga0068853_100398896 | 3300005539 | Bacteria | 1287 |
| 229 | Ga0070695_100618785 | 3300005545 | Bacteria | 852 |
| 230 | Ga0070693_100948056 | 3300005547 | Bacteria | 648 |
| 231 | Ga0070665_101901578 | 3300005548 | Bacteria | 601 |
| 232 | Ga0070704_100761978 | 3300005549 | Bacteria | 862 |
| 233 | Ga0068855_100166634 | 3300005563 | Bacteria | 2497 |
| 234 | Ga0068855_100247815 | 3300005563 | Bacteria | 1988 |
| 235 | Ga0068855_100431713 | 3300005563 | Bacteria | 1440 |
| 236 | Ga0068855_101136806 | 3300005563 | Bacteria | 815 |
| 237 | Ga0068855_102593924 | 3300005563 | Bacteria | 503 |
| 238 | Ga0070664_100027769 | 3300005564 | Bacteria | 4705 |
| 239 | Ga0068857_100009923 | 3300005577 | Bacteria | 8264 |
| 240 | Ga0068854_100016031 | 3300005578 | Bacteria | 4985 |
| 241 | Ga0068854_100368679 | 3300005578 | Bacteria | 1180 |
| 242 | Ga0068854_100677887 | 3300005578 | Bacteria | 888 |
| 243 | Ga0068856_100049792 | 3300005614 | Bacteria | 4130 |
| 244 | Ga0068856_100266346 | 3300005614 | Bacteria | 1729 |
| 245 | Ga0068856_100477995 | 3300005614 | Bacteria | 1267 |
| 246 | Ga0070702_100090534 | 3300005615 | Bacteria | 1854 |
| 247 | Ga0070702_101599888 | 3300005615 | Bacteria | 539 |
| 248 | Ga0068852_100838091 | 3300005616 | Bacteria | 935 |
| 249 | Ga0068864_100982145 | 3300005618 | Bacteria | 837 |
| 250 | Ga0068861_102016474 | 3300005719 | Bacteria | 576 |
| 251 | Ga0068851_10001517 | 3300005834 | Bacteria | 10195 |
| 252 | Ga0068851_10034122 | 3300005834 | Bacteria | 2539 |
| 253 | Ga0068870_10444775 | 3300005840 | Bacteria | 853 |
| 254 | Ga0068863_100705757 | 3300005841 | Bacteria | 1003 |
| 255 | Ga0068862_100722442 | 3300005844 | Bacteria | 967 |
| 256 | Ga0068862_101325660 | 3300005844 | Bacteria | 722 |
| 257 | Ga0070717_10765390 | 3300006028 | Bacteria | 878 |
| 258 | Ga0075368_10189666 | 3300006042 | Bacteria | 868 |
| 259 | Ga0075363_100005889 | 3300006048 | Bacteria | 5519 |
| 260 | Ga0075363_100805349 | 3300006048 | Bacteria | 571 |
| 261 | Ga0075364_10032491 | 3300006051 | Bacteria | 3355 |
| 262 | Ga0075364_10092282 | 3300006051 | Bacteria | 2010 |
| 263 | Ga0075362_10000222 | 3300006177 | Bacteria | 15765 |
| 264 | Ga0075362_10000565 | 3300006177 | Bacteria | 10784 |
| 265 | Ga0075367_10000855 | 3300006178 | Bacteria | 12145 |
| 266 | Ga0075369_10005325 | 3300006186 | Bacteria | 4797 |
| 267 | Ga0075366_10023561 | 3300006195 | Bacteria | 3587 |
| 268 | Ga0075366_10033384 | 3300006195 | Bacteria | 3031 |
| 269 | Ga0075366_10199541 | 3300006195 | Bacteria | 1216 |
| 270 | Ga0075366_10218034 | 3300006195 | Bacteria | 1162 |
| 271 | Ga0075366_10820726 | 3300006195 | Bacteria | 579 |
| 272 | Ga0097621_100021406 | 3300006237 | Bacteria | 5001 |
| 273 | Ga0075370_10001150 | 3300006353 | Bacteria | 11110 |
| 274 | Ga0075370_10064344 | 3300006353 | Bacteria | 2091 |
| 275 | Ga0075370_10104070 | 3300006353 | Bacteria | 1645 |
| 276 | Ga0075370_10152303 | 3300006353 | Bacteria | 1355 |
| 277 | Ga0068871_100015656 | 3300006358 | Bacteria | 5684 |
| 278 | Ga0075433_10202721 | 3300006852 | Bacteria | 1764 |
| 279 | Ga0068865_100074639 | 3300006881 | Bacteria | 2416 |
| 280 | Ga0068865_100140074 | 3300006881 | Bacteria | 1823 |
| 281 | Ga0068865_100921340 | 3300006881 | Bacteria | 761 |
| 282 | Ga0079104_1004078 | 3300006946 | Bacteria | 6424 |
| 283 | Ga0079104_1104358 | 3300006946 | Bacteria | 565 |
| 284 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 285 | Ga0075435_100367572 | 3300007076 | Bacteria | 1234 |
| 286 | Ga0099794_10383343 | 3300007265 | Bacteria | 733 |
| 287 | Ga0105244_10023517 | 3300009036 | Bacteria | 3377 |
| 288 | Ga0105244_10028871 | 3300009036 | Bacteria | 2972 |
| 289 | Ga0105244_10045359 | 3300009036 | Bacteria | 2262 |
| 290 | Ga0105244_10084777 | 3300009036 | Bacteria | 1564 |
| 291 | Ga0105244_10463019 | 3300009036 | Bacteria | 583 |
| 292 | Ga0105240_10005705 | 3300009093 | Bacteria | 18471 |
| 293 | Ga0105240_10009383 | 3300009093 | Bacteria | 13863 |
| 294 | Ga0105240_10327528 | 3300009093 | Bacteria | 1744 |
| 295 | Ga0105240_10523357 | 3300009093 | Bacteria | 1316 |
| 296 | Ga0105245_10023078 | 3300009098 | Bacteria | 5460 |
| 297 | Ga0105243_10006860 | 3300009148 | Bacteria | 8779 |
| 298 | Ga0105243_10499114 | 3300009148 | Bacteria | 1153 |
| 299 | Ga0105243_12034967 | 3300009148 | Bacteria | 609 |
| 300 | Ga0105241_10057980 | 3300009174 | Bacteria | 2972 |
| 301 | Ga0105242_10007953 | 3300009176 | Bacteria | 8168 |
| 302 | Ga0105242_12640934 | 3300009176 | Bacteria | 551 |
| 303 | Ga0105248_10539440 | 3300009177 | Bacteria | 1316 |
| 304 | Ga0105237_10134008 | 3300009545 | Bacteria | 2472 |
| 305 | Ga0105237_10460777 | 3300009545 | Bacteria | 1277 |
| 306 | Ga0105238_10000255 | 3300009551 | Bacteria | 59531 |
| 307 | Ga0105238_10162679 | 3300009551 | Bacteria | 2208 |
| 308 | Ga0105238_10455386 | 3300009551 | Bacteria | 1277 |
| 309 | Ga0105249_10303710 | 3300009553 | Bacteria | 1602 |
| 310 | Ga0105249_13417083 | 3300009553 | Bacteria | 511 |
| 311 | Ga0130087_1030513 | 3300009828 | Bacteria | 1078 |
| 312 | Ga0130087_1090781 | 3300009828 | Bacteria | 1165 |
| 313 | Ga0130087_1095535 | 3300009828 | Bacteria | 1211 |
| 314 | Ga0130086_1025653 | 3300009829 | Bacteria | 1165 |
| 315 | Ga0130086_1025943 | 3300009829 | Bacteria | 1211 |
| 316 | Ga0130086_1026814 | 3300009829 | Bacteria | 1078 |
| 317 | Ga0130085_1073923 | 3300009850 | Bacteria | 1165 |
| 318 | Ga0130085_1083711 | 3300009850 | Bacteria | 1078 |
| 319 | Ga0130085_1132233 | 3300009850 | Bacteria | 1211 |
| 320 | Ga0105239_10001561 | 3300010375 | Bacteria | 30314 |
| 321 | Ga0105246_10744899 | 3300011119 | Bacteria | 864 |
| 322 | Ga0105246_12194323 | 3300011119 | Bacteria | 537 |
| 323 | Ga0157321_1010116 | 3300012487 | Bacteria | 714 |
| 324 | Ga0157319_1007161 | 3300012497 | Bacteria | 820 |
| 325 | Ga0157327_1057832 | 3300012512 | Bacteria | 570 |
| 326 | Ga0154014_155471 | 3300013052 | Bacteria | 1050 |
| 327 | Ga0157373_10015732 | 3300013100 | Bacteria | 5524 |
| 328 | Ga0157373_10154902 | 3300013100 | Bacteria | 1612 |
| 329 | Ga0157373_10459447 | 3300013100 | Bacteria | 917 |
| 330 | Ga0157371_10001564 | 3300013102 | Bacteria | 23533 |
| 331 | Ga0157371_10250157 | 3300013102 | Bacteria | 1276 |
| 332 | Ga0157371_10501027 | 3300013102 | Bacteria | 897 |
| 333 | Ga0157370_10325401 | 3300013104 | Bacteria | 1418 |
| 334 | Ga0157370_11707859 | 3300013104 | Bacteria | 565 |
| 335 | Ga0157369_10315337 | 3300013105 | Bacteria | 1626 |
| 336 | Ga0157374_10009298 | 3300013296 | Bacteria | 8429 |
| 337 | Ga0157374_10143777 | 3300013296 | Bacteria | 2316 |
| 338 | Ga0157378_10027087 | 3300013297 | Bacteria | 5057 |
| 339 | Ga0157378_10248653 | 3300013297 | Bacteria | 1701 |
| 340 | Ga0157378_11242214 | 3300013297 | Bacteria | 785 |
| 341 | Ga0163162_10060438 | 3300013306 | Bacteria | 3825 |
| 342 | Ga0163162_10103155 | 3300013306 | Bacteria | 2946 |
| 343 | Ga0163162_10139871 | 3300013306 | Bacteria | 2533 |
| 344 | Ga0157372_10991197 | 3300013307 | Bacteria | 973 |
| 345 | Ga0157375_11430153 | 3300013308 | Bacteria | 815 |
| 346 | Ga0157375_11776352 | 3300013308 | Bacteria | 731 |
| 347 | Ga0182008_10001808 | 3300014497 | Bacteria | 13967 |
| 348 | Ga0182008_10003186 | 3300014497 | Bacteria | 10028 |
| 349 | Ga0182008_10039266 | 3300014497 | Bacteria | 2366 |
| 350 | Ga0182008_10329668 | 3300014497 | Bacteria | 805 |
| 351 | Ga0157377_10259659 | 3300014745 | Bacteria | 1130 |
| 352 | Ga0157377_10637996 | 3300014745 | Bacteria | 765 |
| 353 | Ga0157376_11698828 | 3300014969 | Bacteria | 666 |
| 354 | Ga0182006_1000240 | 3300015261 | Bacteria | 51334 |
| 355 | Ga0182006_1000274 | 3300015261 | Bacteria | 46140 |
| 356 | Ga0182006_1048484 | 3300015261 | Bacteria | 1643 |
| 357 | Ga0182006_1293840 | 3300015261 | Bacteria | 533 |
| 358 | Ga0182007_10000196 | 3300015262 | Bacteria | 40434 |
| 359 | Ga0182007_10014439 | 3300015262 | Bacteria | 2977 |
| 360 | Ga0182007_10044315 | 3300015262 | Bacteria | 1476 |
| 361 | Ga0182007_10098690 | 3300015262 | Bacteria | 966 |
| 362 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 363 | Ga0182005_1000163 | 3300015265 | Bacteria | 46142 |
| 364 | Ga0182005_1000370 | 3300015265 | Bacteria | 24872 |
| 365 | Ga0163161_10007196 | 3300017792 | Bacteria | 7692 |
| 366 | Ga0163161_10039119 | 3300017792 | Bacteria | 3403 |
| 367 | Ga0197907_10298599 | 3300020069 | Bacteria | 556 |
| 368 | Ga0197907_10941484 | 3300020069 | Bacteria | 887 |
| 369 | Ga0206355_1235934 | 3300020076 | Bacteria | 791 |
| 370 | Ga0206352_10695704 | 3300020078 | Bacteria | 659 |
| 371 | Ga0206352_11129984 | 3300020078 | Bacteria | 815 |
| 372 | Ga0206354_11576217 | 3300020081 | Bacteria | 925 |
| 373 | Ga0206353_10105939 | 3300020082 | Bacteria | 750 |
| 374 | Ga0154015_1381451 | 3300020610 | Bacteria | 1317 |
| 375 | Ga0213872_10000307 | 3300021361 | Bacteria | 41810 |
| 376 | Ga0213872_10003461 | 3300021361 | Bacteria | 8770 |
| 377 | Ga0213872_10041234 | 3300021361 | Bacteria | 2107 |
| 378 | Ga0213872_10070274 | 3300021361 | Bacteria | 1578 |
| 379 | Ga0213872_10070360 | 3300021361 | Bacteria | 1577 |
| 380 | Ga0213872_10215334 | 3300021361 | Bacteria | 819 |
| 381 | Ga0256744_118715 | 3300023309 | Bacteria | 1400 |
| 382 | Ga0209760_109176 | 3300025207 | Bacteria | 688 |
| 383 | Ga0209436_100401 | 3300025208 | Bacteria | 19545 |
| 384 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 385 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 386 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 387 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 388 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 389 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 390 | Ga0209672_105905 | 3300025228 | Bacteria | 2050 |
| 391 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 392 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 393 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 394 | Ga0207427_100342 | 3300025231 | Bacteria | 30270 |
| 395 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 396 | Ga0209437_103125 | 3300025233 | Bacteria | 3048 |
| 397 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 398 | Ga0207425_1000680 | 3300025245 | Bacteria | 18554 |
| 399 | Ga0207425_1000845 | 3300025245 | Bacteria | 15112 |
| 400 | Ga0207425_1000932 | 3300025245 | Bacteria | 13905 |
| 401 | Ga0207425_1049412 | 3300025245 | Bacteria | 773 |
| 402 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 403 | Ga0209026_1003315 | 3300025250 | Bacteria | 5361 |
| 404 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 405 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 406 | Ga0209677_102227 | 3300025253 | Bacteria | 7521 |
| 407 | Ga0209148_1000444 | 3300025254 | Bacteria | 45400 |
| 408 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 409 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 410 | Ga0209129_1052977 | 3300025258 | Bacteria | 615 |
| 411 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 412 | Ga0209565_1001042 | 3300025263 | Bacteria | 14043 |
| 413 | Ga0209565_1006230 | 3300025263 | Bacteria | 3374 |
| 414 | Ga0209565_1011005 | 3300025263 | Bacteria | 2222 |
| 415 | Ga0209565_1077228 | 3300025263 | Bacteria | 553 |
| 416 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 417 | Ga0209455_1001216 | 3300025272 | Bacteria | 12270 |
| 418 | Ga0209673_1000730 | 3300025273 | Bacteria | 45590 |
| 419 | Ga0209673_1004093 | 3300025273 | Bacteria | 8026 |
| 420 | Ga0209673_1004985 | 3300025273 | Bacteria | 6882 |
| 421 | Ga0209673_1010299 | 3300025273 | Bacteria | 3948 |
| 422 | Ga0209130_1010313 | 3300025284 | Bacteria | 2584 |
| 423 | Ga0209675_1012428 | 3300025291 | Bacteria | 2743 |
| 424 | Ga0209675_1046147 | 3300025291 | Bacteria | 922 |
| 425 | Ga0209025_1006398 | 3300025294 | Bacteria | 9163 |
| 426 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 427 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 428 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 429 | Ga0209564_1002740 | 3300025295 | Bacteria | 13260 |
| 430 | Ga0209564_1037233 | 3300025295 | Bacteria | 1375 |
| 431 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 432 | Ga0209758_1000322 | 3300025297 | Bacteria | 92458 |
| 433 | Ga0209758_1000910 | 3300025297 | Bacteria | 40059 |
| 434 | Ga0209758_1011080 | 3300025297 | Bacteria | 5275 |
| 435 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 436 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 437 | Ga0209050_1002922 | 3300025298 | Bacteria | 13390 |
| 438 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 439 | Ga0209256_1002719 | 3300025299 | Bacteria | 13723 |
| 440 | Ga0209256_1004416 | 3300025299 | Bacteria | 8844 |
| 441 | Ga0209256_1009680 | 3300025299 | Bacteria | 4174 |
| 442 | Ga0209256_1095645 | 3300025299 | Bacteria | 624 |
| 443 | Ga0207426_1000802 | 3300025302 | Bacteria | 34010 |
| 444 | Ga0209051_1018074 | 3300025303 | Bacteria | 3132 |
| 445 | Ga0209051_1026168 | 3300025303 | Bacteria | 2358 |
| 446 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 447 | Ga0209257_1043589 | 3300025304 | Bacteria | 1315 |
| 448 | Ga0207656_10040557 | 3300025321 | Bacteria | 1974 |
| 449 | Ga0207656_10058704 | 3300025321 | Bacteria | 1682 |
| 450 | Ga0207655_1000499 | 3300025728 | Bacteria | 50341 |
| 451 | Ga0207655_1024949 | 3300025728 | Bacteria | 2916 |
| 452 | Ga0207655_1028515 | 3300025728 | Bacteria | 2632 |
| 453 | Ga0207655_1031488 | 3300025728 | Bacteria | 2443 |
| 454 | Ga0207680_10310463 | 3300025903 | Bacteria | 1101 |
| 455 | Ga0207647_10029480 | 3300025904 | Bacteria | 3551 |
| 456 | Ga0207685_10411976 | 3300025905 | Bacteria | 695 |
| 457 | Ga0207645_10064364 | 3300025907 | Bacteria | 2343 |
| 458 | Ga0207643_10369110 | 3300025908 | Bacteria | 903 |
| 459 | Ga0207705_10016800 | 3300025909 | Bacteria | 5240 |
| 460 | Ga0207654_10109708 | 3300025911 | Bacteria | 1715 |
| 461 | Ga0207695_10001345 | 3300025913 | Bacteria | 41663 |
| 462 | Ga0207695_10174538 | 3300025913 | Bacteria | 2072 |
| 463 | Ga0207695_10283352 | 3300025913 | Bacteria | 1551 |
| 464 | Ga0207671_10007790 | 3300025914 | Bacteria | 9221 |
| 465 | Ga0207671_10013783 | 3300025914 | Bacteria | 6419 |
| 466 | Ga0207660_10096089 | 3300025917 | Bacteria | 2205 |
| 467 | Ga0207657_10001495 | 3300025919 | Bacteria | 25015 |
| 468 | Ga0207657_10030110 | 3300025919 | Bacteria | 4931 |
| 469 | Ga0207657_10110762 | 3300025919 | Bacteria | 2268 |
| 470 | Ga0207649_10086318 | 3300025920 | Bacteria | 2045 |
| 471 | Ga0207652_10278953 | 3300025921 | Bacteria | 1507 |
| 472 | Ga0207652_11458011 | 3300025921 | Bacteria | 588 |
| 473 | Ga0207694_10000193 | 3300025924 | Bacteria | 61887 |
| 474 | Ga0207694_10049485 | 3300025924 | Bacteria | 3254 |
| 475 | Ga0207694_10633585 | 3300025924 | Bacteria | 900 |
| 476 | Ga0207650_10051822 | 3300025925 | Bacteria | 3038 |
| 477 | Ga0207659_10170020 | 3300025926 | Bacteria | 1719 |
| 478 | Ga0207659_10205388 | 3300025926 | Bacteria | 1576 |
| 479 | Ga0207687_10038586 | 3300025927 | Bacteria | 3265 |
| 480 | Ga0207664_10675927 | 3300025929 | Bacteria | 928 |
| 481 | Ga0207690_10000959 | 3300025932 | Bacteria | 18469 |
| 482 | Ga0207690_10141151 | 3300025932 | Bacteria | 1775 |
| 483 | Ga0207706_10008025 | 3300025933 | Bacteria | 9741 |
| 484 | Ga0207706_10190592 | 3300025933 | Bacteria | 1800 |
| 485 | Ga0207686_10344068 | 3300025934 | Bacteria | 1121 |
| 486 | Ga0207686_10998987 | 3300025934 | Bacteria | 679 |
| 487 | Ga0207686_11763727 | 3300025934 | Bacteria | 512 |
| 488 | Ga0207709_10019899 | 3300025935 | Bacteria | 3780 |
| 489 | Ga0207709_11186340 | 3300025935 | Bacteria | 629 |
| 490 | Ga0207669_10288508 | 3300025937 | Bacteria | 1241 |
| 491 | Ga0207669_10439485 | 3300025937 | Bacteria | 1031 |
| 492 | Ga0207704_10041905 | 3300025938 | Bacteria | 2689 |
| 493 | Ga0207704_11504908 | 3300025938 | Bacteria | 578 |
| 494 | Ga0207665_10328579 | 3300025939 | Bacteria | 1149 |
| 495 | Ga0207691_10977588 | 3300025940 | Bacteria | 707 |
| 496 | Ga0207711_10196937 | 3300025941 | Bacteria | 1838 |
| 497 | Ga0207689_10023710 | 3300025942 | Bacteria | 5147 |
| 498 | Ga0207689_11576762 | 3300025942 | Bacteria | 547 |
| 499 | Ga0207679_10002718 | 3300025945 | Bacteria | 10935 |
| 500 | Ga0207667_10006290 | 3300025949 | Bacteria | 14403 |
| 501 | Ga0207667_10100133 | 3300025949 | Bacteria | 2989 |
| 502 | Ga0207667_10234580 | 3300025949 | Bacteria | 1878 |
| 503 | Ga0207667_10465494 | 3300025949 | Bacteria | 1284 |
| 504 | Ga0207667_11705803 | 3300025949 | Bacteria | 596 |
| 505 | Ga0207651_10155920 | 3300025960 | Bacteria | 1784 |
| 506 | Ga0207640_10004199 | 3300025981 | Bacteria | 7793 |
| 507 | Ga0207640_10384480 | 3300025981 | Bacteria | 1138 |
| 508 | Ga0207640_10393025 | 3300025981 | Bacteria | 1127 |
| 509 | Ga0207639_10048176 | 3300026041 | Bacteria | 3224 |
| 510 | Ga0207639_10485780 | 3300026041 | Bacteria | 1126 |
| 511 | Ga0207678_10003236 | 3300026067 | Bacteria | 14714 |
| 512 | Ga0207702_10043312 | 3300026078 | Bacteria | 3779 |
| 513 | Ga0207702_10629001 | 3300026078 | Bacteria | 1055 |
| 514 | Ga0207702_10905349 | 3300026078 | Bacteria | 874 |
| 515 | Ga0207648_10166766 | 3300026089 | Bacteria | 1946 |
| 516 | Ga0207674_10005520 | 3300026116 | Bacteria | 15020 |
| 517 | Ga0207674_10033169 | 3300026116 | Bacteria | 5406 |
| 518 | Ga0207674_11711104 | 3300026116 | Bacteria | 597 |
| 519 | Ga0207675_101347115 | 3300026118 | Bacteria | 734 |
| 520 | Ga0207683_10519516 | 3300026121 | Bacteria | 1100 |
| 521 | Ga0207683_11336632 | 3300026121 | Bacteria | 663 |
| 522 | Ga0207698_10180633 | 3300026142 | Bacteria | 1869 |
| 523 | Ga0207698_10579895 | 3300026142 | Bacteria | 1103 |
| 524 | Ga0207698_10973984 | 3300026142 | Bacteria | 858 |
| 525 | Ga0207698_12351927 | 3300026142 | Bacteria | 544 |
| 526 | Ga0209281_1002282 | 3300027111 | Bacteria | 8082 |
| 527 | Ga0209281_1004157 | 3300027111 | Bacteria | 4423 |
| 528 | Ga0209969_1018620 | 3300027360 | Bacteria | 1027 |
| 529 | Ga0209984_1005637 | 3300027424 | Bacteria | 1511 |
| 530 | Ga0209995_1009327 | 3300027471 | Bacteria | 1586 |
| 531 | Ga0210002_1016192 | 3300027617 | Bacteria | 1179 |
| 532 | Ga0209983_1024556 | 3300027665 | Bacteria | 1269 |
| 533 | Ga0209282_1000072 | 3300027666 | Bacteria | 81137 |
| 534 | Ga0209971_1088753 | 3300027682 | Bacteria | 754 |
| 535 | Ga0209813_10024775 | 3300027866 | Bacteria | 1720 |
| 536 | Ga0209974_10050246 | 3300027876 | Bacteria | 1400 |
| 537 | Ga0268266_10446814 | 3300028379 | Bacteria | 1228 |
| 538 | Ga0268265_10330997 | 3300028380 | Bacteria | 1383 |
| 539 | Ga0307517_10103679 | 3300028786 | Bacteria | 2221 |
| 540 | Ga0307515_10115015 | 3300028794 | Bacteria | 3104 |
| 541 | Ga0307515_10288992 | 3300028794 | Bacteria | 1337 |
| 542 | Ga0307515_10371984 | 3300028794 | Bacteria | 1065 |
| 543 | Ga0307515_10485433 | 3300028794 | Bacteria | 847 |
| 544 | Ga0265338_10293180 | 3300028800 | Bacteria | 1185 |
| 545 | Ga0316177_1056223 | 3300030731 | Bacteria | 1049 |
| 546 | Ga0316176_1064342 | 3300030732 | Bacteria | 1011 |
| 547 | Ga0314311_1151902 | 3300030733 | Bacteria | 1608 |
| 548 | Ga0314311_1236493 | 3300030733 | Bacteria | 568 |
| 549 | Ga0316178_1001132 | 3300030735 | Bacteria | 2234 |
| 550 | Ga0316180_1056555 | 3300030736 | Bacteria | 3840 |
| 551 | Ga0316181_1006587 | 3300030744 | Bacteria | 1206 |
| 552 | Ga0316181_1065259 | 3300030744 | Bacteria | 3733 |
| 553 | Ga0265767_101870 | 3300030836 | Bacteria | 1076 |
| 554 | Ga0265766_1000491 | 3300030863 | Bacteria | 1732 |
| 555 | Ga0265766_1010647 | 3300030863 | Bacteria | 659 |
| 556 | Ga0265766_1014427 | 3300030863 | Bacteria | 601 |
| 557 | Ga0265769_105630 | 3300030888 | Bacteria | 767 |
| 558 | Ga0265774_104728 | 3300031011 | Bacteria | 579 |
| 559 | Ga0265779_102213 | 3300031043 | Bacteria | 919 |
| 560 | Ga0265330_10000012 | 3300031235 | Bacteria | 180837 |
| 561 | Ga0265332_10000012 | 3300031238 | Bacteria | 272641 |
| 562 | Ga0265325_10006225 | 3300031241 | Bacteria | 7276 |
| 563 | Ga0265316_10039600 | 3300031344 | Bacteria | 3784 |
| 564 | Ga0307513_10019858 | 3300031456 | Bacteria | 7985 |
| 565 | Ga0307513_10088393 | 3300031456 | Bacteria | 3167 |
| 566 | Ga0307513_10663036 | 3300031456 | Bacteria | 750 |
| 567 | Ga0307408_100013705 | 3300031548 | Bacteria | 5383 |
| 568 | Ga0307408_100050653 | 3300031548 | Bacteria | 2987 |
| 569 | Ga0307408_100181519 | 3300031548 | Bacteria | 1688 |
| 570 | Ga0307408_100202378 | 3300031548 | Bacteria | 1608 |
| 571 | Ga0307408_101120757 | 3300031548 | Bacteria | 731 |
| 572 | Ga0307408_102297936 | 3300031548 | Bacteria | 522 |
| 573 | Ga0265314_10000029 | 3300031711 | Bacteria | 272506 |
| 574 | Ga0307405_12076467 | 3300031731 | Bacteria | 510 |
| 575 | Ga0307413_10594475 | 3300031824 | Bacteria | 905 |
| 576 | Ga0307413_11932844 | 3300031824 | Bacteria | 531 |
| 577 | Ga0307518_10004256 | 3300031838 | Bacteria | 10276 |
| 578 | Ga0326468_10029529 | 3300031889 | Bacteria | 717 |
| 579 | Ga0307406_10116737 | 3300031901 | Bacteria | 1847 |
| 580 | Ga0307406_10166340 | 3300031901 | Bacteria | 1591 |
| 581 | Ga0307406_10603852 | 3300031901 | Bacteria | 905 |
| 582 | Ga0307412_10198406 | 3300031911 | Bacteria | 1522 |
| 583 | Ga0307412_10454576 | 3300031911 | Bacteria | 1056 |
| 584 | Ga0307412_12200207 | 3300031911 | Bacteria | 513 |
| 585 | Ga0307416_100002061 | 3300032002 | Bacteria | 11324 |
| 586 | Ga0307416_100778036 | 3300032002 | Bacteria | 1051 |
| 587 | Ga0307416_102262363 | 3300032002 | Bacteria | 644 |
| 588 | Ga0307416_102582978 | 3300032002 | Bacteria | 606 |
| 589 | Ga0307416_103007350 | 3300032002 | Bacteria | 564 |
| 590 | Ga0307414_10047643 | 3300032004 | Bacteria | 2951 |
| 591 | Ga0307414_10075764 | 3300032004 | Bacteria | 2442 |
| 592 | Ga0307414_10283744 | 3300032004 | Bacteria | 1393 |
| 593 | Ga0307414_10296273 | 3300032004 | Bacteria | 1366 |
| 594 | Ga0307411_10480233 | 3300032005 | Bacteria | 1046 |
| 595 | Ga0307411_10581881 | 3300032005 | Bacteria | 960 |
| 596 | Ga0307411_10594037 | 3300032005 | Bacteria | 951 |
| 597 | Ga0307411_11697426 | 3300032005 | Bacteria | 584 |
| 598 | Ga0307415_100439096 | 3300032126 | Bacteria | 1125 |
| 599 | Ga0307415_101534612 | 3300032126 | Bacteria | 638 |
| 600 | Ga0307510_10271247 | 3300033180 | Bacteria | 1173 |
| 601 | Ga0373928_0149585 | 3300035084 | Bacteria | 646 |
| 602 | Ga0373939_0050899 | 3300035114 | Bacteria | 1286 |
| 603 | Ga0265778_019850 | 3300036457 | Bacteria | 824 |
| 604 | Ga0265778_056008 | 3300036457 | Bacteria | 546 |
| 605 | Ga0395899_0326984 | 3300037312 | Bacteria | 1031 |
| 606 | Ga0395900_0006501 | 3300037418 | Bacteria | 12183 |
| 607 | Ga0395900_0063774 | 3300037418 | Bacteria | 3787 |
| 608 | Ga0395900_0223727 | 3300037418 | Bacteria | 1896 |
| 609 | Ga0395900_0810752 | 3300037418 | Bacteria | 863 |
| 610 | Ga0395900_0838651 | 3300037418 | Bacteria | 845 |
| 611 | Ga0395900_0890928 | 3300037418 | Bacteria | 813 |
| 612 | Ga0395898_0182958 | 3300037466 | Bacteria | 2003 |
| 613 | Ga0395898_0536365 | 3300037466 | Bacteria | 1112 |
| 614 | Ga0395905_0000549 | 3300037471 | Bacteria | 51321 |
| 615 | Ga0395905_0012898 | 3300037471 | Bacteria | 8034 |
| 616 | Ga0395905_0043570 | 3300037471 | Bacteria | 4210 |
| 617 | Ga0395905_0103307 | 3300037471 | Bacteria | 2675 |
| 618 | Ga0395905_0228005 | 3300037471 | Bacteria | 1742 |
| 619 | Ga0436364_0513076 | 3300037853 | Bacteria | 702 |
| 620 | Ga0395901_0028412 | 3300038443 | Bacteria | 5751 |
| 621 | Ga0395901_0036377 | 3300038443 | Bacteria | 5089 |
| 622 | Ga0395901_0093407 | 3300038443 | Bacteria | 3150 |
| 623 | Ga0395901_0112851 | 3300038443 | Bacteria | 2854 |
| 624 | Ga0395901_0176537 | 3300038443 | Bacteria | 2240 |
| 625 | Ga0395901_0347594 | 3300038443 | Bacteria | 1531 |
| 626 | Ga0436361_0110739 | 3300039447 | Bacteria | 2796 |
| 627 | Ga0436361_0209532 | 3300039447 | Bacteria | 1601 |
| 628 | Ga0436361_0391791 | 3300039447 | Bacteria | 42494 |
| 629 | Ga0436361_0797417 | 3300039447 | Bacteria | 1325 |
| 630 | Ga0436361_0902855 | 3300039447 | Bacteria | 3267 |
| 631 | Ga0436361_1016700 | 3300039447 | Bacteria | 56598 |
| 632 | Ga0436361_1041947 | 3300039447 | Bacteria | 6318 |
| 633 | Ga0439453_0001276 | 3300041408 | Bacteria | 3191 |
| 634 | Ga0439465_0215707 | 3300041413 | Bacteria | 702 |
| 635 | Ga0439465_0334429 | 3300041413 | Bacteria | 570 |
| 636 | Ga0451787_207356 | 3300041441 | Bacteria | 1321 |
| 637 | Ga0451788_14269 | 3300041442 | Bacteria | 666 |
| 638 | Ga0451788_26491 | 3300041442 | Bacteria | 503 |
| 639 | Ga0451789_0965253 | 3300041443 | Bacteria | 2538 |
| 640 | Ga0451790_30858 | 3300041444 | Bacteria | 1457 |
| 641 | Ga0451792_06578 | 3300041445 | Bacteria | 535 |
| 642 | Ga0451794_03992 | 3300041446 | Bacteria | 648 |
| 643 | Ga0451794_43844 | 3300041446 | Bacteria | 563 |
| 644 | Ga0451794_56996 | 3300041446 | Bacteria | 834 |
| 645 | Ga0451793_1842659 | 3300041452 | Bacteria | 1288 |
| 646 | Ga0451799_25489 | 3300041454 | Bacteria | 1149 |
| 647 | Ga0451799_25968 | 3300041454 | Bacteria | 1221 |
| 648 | Ga0451799_35494 | 3300041454 | Bacteria | 749 |
| 649 | Ga0451801_03902 | 3300041455 | Bacteria | 628 |
| 650 | Ga0451801_05624 | 3300041455 | Bacteria | 1058 |
| 651 | Ga0451795_0013989 | 3300041456 | Bacteria | 2986 |
| 652 | Ga0451803_00380 | 3300041457 | Bacteria | 574 |
| 653 | Ga0451798_0308085 | 3300041458 | Bacteria | 1147 |
| 654 | Ga0451798_0595355 | 3300041458 | Bacteria | 816 |
| 655 | Ga0451800_0613767 | 3300041459 | Bacteria | 869 |
| 656 | Ga0451802_0433132 | 3300041460 | Bacteria | 1756 |
| 657 | Ga0451802_0690103 | 3300041460 | Bacteria | 949 |
| 658 | Ga0451805_059694 | 3300041461 | Bacteria | 1252 |
| 659 | Ga0451805_117766 | 3300041461 | Bacteria | 550 |
| 660 | Ga0451804_0350671 | 3300041463 | Bacteria | 3764 |
| 661 | Ga0451808_27185 | 3300041464 | Bacteria | 621 |
| 662 | Ga0451808_27571 | 3300041464 | Bacteria | 742 |
| 663 | Ga0451807_0444576 | 3300041486 | Bacteria | 654 |
| 664 | Ga0451807_1127722 | 3300041486 | Bacteria | 2271 |
| 665 | Ga0451833_1024724 | 3300041491 | Bacteria | 645 |
| 666 | Ga0451837_1802545 | 3300041494 | Bacteria | 543 |
| 667 | Ga0451839_0712830 | 3300041496 | Bacteria | 1227 |
| 668 | Ga0451841_0095596 | 3300041498 | Bacteria | 558 |
| 669 | Ga0451845_0906783 | 3300041501 | Bacteria | 583 |
| 670 | Ga0451849_1511665 | 3300041505 | Bacteria | 517 |
| 671 | Ga0451850_46944 | 3300041506 | Bacteria | 1036 |
| 672 | Ga0451843_0626631 | 3300041509 | Bacteria | 542 |
| 673 | Ga0451855_1729568 | 3300041511 | Bacteria | 1205 |
| 674 | Ga0451853_0176051 | 3300041512 | Bacteria | 891 |
| 675 | Ga0452268_24915 | 3300041907 | Bacteria | 1251 |
| 676 | Ga0439442_030241 | 3300042002 | Bacteria | 1131 |
| 677 | Ga0439448_0091069 | 3300042005 | Bacteria | 1030 |
| 678 | Ga0439432_109856 | 3300042006 | Bacteria | 821 |
| 679 | Ga0439449_0003878 | 3300042007 | Bacteria | 5800 |
| 680 | Ga0439449_0111033 | 3300042007 | Bacteria | 1016 |
| 681 | Ga0439450_002944 | 3300042008 | Bacteria | 2753 |
| 682 | Ga0439454_001689 | 3300042011 | Bacteria | 2184 |
| 683 | Ga0439454_036314 | 3300042011 | Bacteria | 792 |
| 684 | Ga0439455_0064096 | 3300042012 | Bacteria | 978 |
| 685 | Ga0439455_0074073 | 3300042012 | Bacteria | 918 |
| 686 | Ga0450911_005087 | 3300042115 | Bacteria | 2075 |
| 687 | Ga0450890_040459 | 3300042127 | Bacteria | 688 |
| 688 | Ga0450897_032275 | 3300042128 | Bacteria | 596 |
| 689 | Ga0450898_003136 | 3300042134 | Bacteria | 2356 |
| 690 | Ga0450898_029605 | 3300042134 | Bacteria | 999 |
| 691 | Ga0450898_029717 | 3300042134 | Bacteria | 998 |
| 692 | Ga0450904_000961 | 3300042139 | Bacteria | 4531 |
| 693 | Ga0450906_030486 | 3300042145 | Bacteria | 954 |
| 694 | Ga0450906_104913 | 3300042145 | Bacteria | 517 |
| 695 | Ga0450910_105598 | 3300042147 | Bacteria | 508 |
| 696 | Ga0439458_0031353 | 3300042157 | Bacteria | 1267 |
| 697 | Ga0439434_0250235 | 3300042435 | Bacteria | 606 |
| 698 | Ga0439459_0055055 | 3300042438 | Bacteria | 885 |
| 699 | Ga0439464_0256052 | 3300042439 | Bacteria | 566 |
| 700 | Ga0439460_0206241 | 3300042461 | Bacteria | 671 |
| 701 | Ga0450893_0013738 | 3300042532 | Bacteria | 1352 |
| 702 | Ga0450893_0026452 | 3300042532 | Bacteria | 1020 |
| 703 | Ga0451577_0038506 | 3300042876 | Bacteria | 4301 |
| 704 | Ga0466969_0312193 | 3300044656 | Bacteria | 711 |
| 705 | Ga0466969_0572319 | 3300044656 | Bacteria | 517 |
| 706 | Ga0466972_0020192 | 3300044658 | Bacteria | 3329 |
| 707 | Ga0466972_0039363 | 3300044658 | Bacteria | 2307 |
| 708 | Ga0466972_0098911 | 3300044658 | Bacteria | 1381 |
| 709 | Ga0466972_0221359 | 3300044658 | Bacteria | 885 |
| 710 | Ga0466972_0272724 | 3300044658 | Bacteria | 790 |
| 711 | Ga0453683_0392256 | 3300044673 | Bacteria | 894 |
| 712 | Ga0466965_0027577 | 3300044683 | Bacteria | 2757 |
| 713 | Ga0466965_0036619 | 3300044683 | Bacteria | 2407 |
| 714 | Ga0466965_0095415 | 3300044683 | Bacteria | 1516 |
| 715 | Ga0466966_0032032 | 3300044684 | Bacteria | 3410 |
| 716 | Ga0466966_0154067 | 3300044684 | Bacteria | 1400 |
| 717 | Ga0466966_0510731 | 3300044684 | Bacteria | 723 |
| 718 | Ga0466966_0630353 | 3300044684 | Bacteria | 645 |
| 719 | Ga0466961_0059959 | 3300044693 | Bacteria | 2419 |
| 720 | Ga0466963_0066574 | 3300044694 | Bacteria | 2416 |
| 721 | Ga0466964_0177531 | 3300044706 | Bacteria | 1007 |
| 722 | Ga0466964_0222909 | 3300044706 | Bacteria | 916 |
| 723 | Ga0453684_0142976 | 3300044712 | Bacteria | 2853 |
| 724 | Ga0466971_0355328 | 3300044719 | Bacteria | 709 |
| 725 | Ga0466968_0024670 | 3300044735 | Bacteria | 2458 |
| 726 | Ga0466968_0068221 | 3300044735 | Bacteria | 1543 |
| 727 | Ga0466970_0695742 | 3300044765 | Bacteria | 592 |
| 728 | Ga0466957_0173268 | 3300044842 | Bacteria | 1406 |
| 729 | Ga0466957_0262826 | 3300044842 | Bacteria | 1150 |
| 730 | Ga0466957_1007085 | 3300044842 | Bacteria | 598 |
| 731 | Ga0466960_0134659 | 3300044901 | Bacteria | 1307 |
| 732 | Ga0466960_0364078 | 3300044901 | Bacteria | 827 |
| 733 | Ga0466960_0884225 | 3300044901 | Bacteria | 544 |
| 734 | Ga0466959_0862059 | 3300045049 | Bacteria | 604 |
| 735 | Ga0466959_1014431 | 3300045049 | Bacteria | 553 |
| 736 | Ga0466959_1020608 | 3300045049 | Bacteria | 551 |
| 737 | Ga0451576_0013761 | 3300045051 | Bacteria | 9038 |
| 738 | Ga0451576_0083384 | 3300045051 | Bacteria | 3325 |
| 739 | Ga0451576_0936124 | 3300045051 | Bacteria | 909 |
| 740 | Ga0466958_0482820 | 3300045836 | Bacteria | 803 |
| 741 | Ga0495617_000397 | 3300046452 | Bacteria | 24142 |
| 742 | Ga0495617_000636 | 3300046452 | Bacteria | 17611 |
| 743 | Ga0495617_000830 | 3300046452 | Bacteria | 14706 |
| 744 | Ga0495617_031068 | 3300046452 | Bacteria | 1794 |
| 745 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 746 | Ga0495627_008059 | 3300046453 | Bacteria | 3972 |
| 747 | Ga0495627_014179 | 3300046453 | Bacteria | 2788 |
| 748 | Ga0495627_019933 | 3300046453 | Bacteria | 2242 |
| 749 | Ga0495592_0035699 | 3300046454 | Bacteria | 3745 |
| 750 | Ga0495603_0001612 | 3300046455 | Bacteria | 13252 |
| 751 | Ga0495603_0020924 | 3300046455 | Bacteria | 3960 |
| 752 | Ga0495603_0409204 | 3300046455 | Bacteria | 777 |
| 753 | Ga0495603_0415278 | 3300046455 | Bacteria | 771 |
| 754 | Ga0495603_0726653 | 3300046455 | Bacteria | 567 |
| 755 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 756 | Ga0495590_0000632 | 3300046457 | Bacteria | 16341 |
| 757 | Ga0495590_0001551 | 3300046457 | Bacteria | 9865 |
| 758 | Ga0495590_0056853 | 3300046457 | Bacteria | 1367 |
| 759 | Ga0495590_0251682 | 3300046457 | Bacteria | 657 |
| 760 | Ga0495591_034720 | 3300046458 | Bacteria | 1481 |
| 761 | Ga0495629_0007936 | 3300046459 | Bacteria | 7808 |
| 762 | Ga0495629_0021816 | 3300046459 | Bacteria | 4570 |
| 763 | Ga0495638_0000235 | 3300046460 | Bacteria | 75760 |
| 764 | Ga0495638_0008741 | 3300046460 | Bacteria | 7157 |
| 765 | Ga0495638_0090421 | 3300046460 | Bacteria | 1845 |
| 766 | Ga0495638_0148740 | 3300046460 | Bacteria | 1360 |
| 767 | Ga0495638_0181110 | 3300046460 | Bacteria | 1202 |
| 768 | Ga0495638_0343610 | 3300046460 | Bacteria | 790 |
| 769 | Ga0495638_0388315 | 3300046460 | Bacteria | 727 |
| 770 | Ga0495638_0512403 | 3300046460 | Bacteria | 602 |
| 771 | Ga0495651_0842696 | 3300046462 | Bacteria | 563 |
| 772 | Ga0495653_0000067 | 3300046463 | Bacteria | 90116 |
| 773 | Ga0495653_0004702 | 3300046463 | Bacteria | 11053 |
| 774 | Ga0495653_0009522 | 3300046463 | Bacteria | 7946 |
| 775 | Ga0495653_0175649 | 3300046463 | Bacteria | 1474 |
| 776 | Ga0495653_0452357 | 3300046463 | Bacteria | 807 |
| 777 | Ga0495650_0000200 | 3300046471 | Bacteria | 130223 |
| 778 | Ga0495650_0001809 | 3300046471 | Bacteria | 19254 |
| 779 | Ga0495650_0002469 | 3300046471 | Bacteria | 14877 |
| 780 | Ga0495650_0014707 | 3300046471 | Bacteria | 4050 |
| 781 | Ga0495650_0023728 | 3300046471 | Bacteria | 2914 |
| 782 | Ga0495650_0026097 | 3300046471 | Bacteria | 2724 |
| 783 | Ga0495580_0009003 | 3300046472 | Bacteria | 7881 |
| 784 | Ga0495580_0314594 | 3300046472 | Bacteria | 1065 |
| 785 | Ga0495580_0665811 | 3300046472 | Bacteria | 683 |
| 786 | Ga0495582_0019511 | 3300046473 | Bacteria | 3707 |
| 787 | Ga0495582_0063422 | 3300046473 | Bacteria | 2041 |
| 788 | Ga0495582_0302408 | 3300046473 | Bacteria | 919 |
| 789 | Ga0495605_0001330 | 3300046474 | Bacteria | 16349 |
| 790 | Ga0495605_0001735 | 3300046474 | Bacteria | 13971 |
| 791 | Ga0495605_0005449 | 3300046474 | Bacteria | 7411 |
| 792 | Ga0495605_0010393 | 3300046474 | Bacteria | 5209 |
| 793 | Ga0495605_0013769 | 3300046474 | Bacteria | 4445 |
| 794 | Ga0495605_0061515 | 3300046474 | Bacteria | 1796 |
| 795 | Ga0495605_0094007 | 3300046474 | Bacteria | 1385 |
| 796 | Ga0495605_0162942 | 3300046474 | Bacteria | 989 |
| 797 | Ga0495605_0328009 | 3300046474 | Bacteria | 644 |
| 798 | Ga0495639_0088079 | 3300046475 | Bacteria | 1454 |
| 799 | Ga0495639_0445425 | 3300046475 | Bacteria | 657 |
| 800 | Ga0495664_0244637 | 3300046477 | Bacteria | 1085 |
| 801 | Ga0495584_0000636 | 3300046491 | Bacteria | 23364 |
| 802 | Ga0495584_0002002 | 3300046491 | Bacteria | 11717 |
| 803 | Ga0495584_0022316 | 3300046491 | Bacteria | 3212 |
| 804 | Ga0495584_0023314 | 3300046491 | Bacteria | 3138 |
| 805 | Ga0495584_0030129 | 3300046491 | Bacteria | 2749 |
| 806 | Ga0495584_0036677 | 3300046491 | Bacteria | 2476 |
| 807 | Ga0495584_0041411 | 3300046491 | Bacteria | 2325 |
| 808 | Ga0495584_0080454 | 3300046491 | Bacteria | 1639 |
| 809 | Ga0495584_0088913 | 3300046491 | Bacteria | 1557 |
| 810 | Ga0495584_0109915 | 3300046491 | Bacteria | 1394 |
| 811 | Ga0495584_0150994 | 3300046491 | Bacteria | 1180 |
| 812 | Ga0495584_0323231 | 3300046491 | Bacteria | 783 |
| 813 | Ga0495584_0515190 | 3300046491 | Bacteria | 609 |
| 814 | Ga0495584_0636787 | 3300046491 | Bacteria | 543 |
| 815 | Ga0495585_0015948 | 3300046492 | Bacteria | 4357 |
| 816 | Ga0495585_0022456 | 3300046492 | Bacteria | 3621 |
| 817 | Ga0495585_0025799 | 3300046492 | Bacteria | 3361 |
| 818 | Ga0495585_0036832 | 3300046492 | Bacteria | 2756 |
| 819 | Ga0495585_0060017 | 3300046492 | Bacteria | 2094 |
| 820 | Ga0495585_0061827 | 3300046492 | Bacteria | 2057 |
| 821 | Ga0495585_0147891 | 3300046492 | Bacteria | 1226 |
| 822 | Ga0495585_0171964 | 3300046492 | Bacteria | 1118 |
| 823 | Ga0495585_0282346 | 3300046492 | Bacteria | 820 |
| 824 | Ga0495585_0389221 | 3300046492 | Bacteria | 672 |
| 825 | Ga0495585_0397963 | 3300046492 | Bacteria | 663 |
| 826 | Ga0495585_0448161 | 3300046492 | Bacteria | 617 |
| 827 | Ga0495585_0533323 | 3300046492 | Bacteria | 555 |
| 828 | Ga0495594_0026606 | 3300046499 | Bacteria | 3113 |
| 829 | Ga0495594_0050249 | 3300046499 | Bacteria | 2292 |
| 830 | Ga0495594_0050658 | 3300046499 | Bacteria | 2284 |
| 831 | Ga0495594_0139761 | 3300046499 | Bacteria | 1373 |
| 832 | Ga0495594_0247101 | 3300046499 | Bacteria | 1016 |
| 833 | Ga0495594_0549179 | 3300046499 | Bacteria | 655 |
| 834 | Ga0495594_0626289 | 3300046499 | Bacteria | 609 |
| 835 | Ga0495594_0652878 | 3300046499 | Bacteria | 595 |
| 836 | Ga0495596_0001745 | 3300046500 | Bacteria | 12192 |
| 837 | Ga0495596_0001963 | 3300046500 | Bacteria | 11349 |
| 838 | Ga0495596_0040152 | 3300046500 | Bacteria | 1847 |
| 839 | Ga0495596_0078041 | 3300046500 | Bacteria | 1285 |
| 840 | Ga0495596_0126402 | 3300046500 | Bacteria | 992 |
| 841 | Ga0495596_0196401 | 3300046500 | Bacteria | 784 |
| 842 | Ga0495596_0349598 | 3300046500 | Bacteria | 575 |
| 843 | Ga0495607_0042980 | 3300046501 | Bacteria | 2675 |
| 844 | Ga0495607_0045844 | 3300046501 | Bacteria | 2569 |
| 845 | Ga0495607_0148073 | 3300046501 | Bacteria | 1204 |
| 846 | Ga0495607_0190403 | 3300046501 | Bacteria | 1022 |
| 847 | Ga0495607_0199105 | 3300046501 | Bacteria | 992 |
| 848 | Ga0495607_0277544 | 3300046501 | Bacteria | 796 |
| 849 | Ga0495607_0345024 | 3300046501 | Bacteria | 688 |
| 850 | Ga0495607_0392730 | 3300046501 | Bacteria | 632 |
| 851 | Ga0495607_0479457 | 3300046501 | Bacteria | 554 |
| 852 | Ga0495607_0521843 | 3300046501 | Bacteria | 524 |
| 853 | Ga0495607_0559062 | 3300046501 | Bacteria | 501 |
| 854 | Ga0495583_0000317 | 3300046506 | Bacteria | 76193 |
| 855 | Ga0495583_0002046 | 3300046506 | Bacteria | 18350 |
| 856 | Ga0495583_0003152 | 3300046506 | Bacteria | 13002 |
| 857 | Ga0495583_0006153 | 3300046506 | Bacteria | 7904 |
| 858 | Ga0495583_0029176 | 3300046506 | Bacteria | 2702 |
| 859 | Ga0495583_0077755 | 3300046506 | Bacteria | 1446 |
| 860 | Ga0495583_0129354 | 3300046506 | Bacteria | 1057 |
| 861 | Ga0495583_0190547 | 3300046506 | Bacteria | 836 |
| 862 | Ga0495583_0306402 | 3300046506 | Bacteria | 630 |
| 863 | Ga0495606_0000433 | 3300046507 | Bacteria | 69506 |
| 864 | Ga0495606_0004241 | 3300046507 | Bacteria | 14500 |
| 865 | Ga0495606_0009821 | 3300046507 | Bacteria | 8038 |
| 866 | Ga0495606_0013080 | 3300046507 | Bacteria | 6592 |
| 867 | Ga0495606_0032750 | 3300046507 | Bacteria | 3595 |
| 868 | Ga0495606_0035831 | 3300046507 | Bacteria | 3387 |
| 869 | Ga0495606_0037395 | 3300046507 | Bacteria | 3297 |
| 870 | Ga0495606_0058361 | 3300046507 | Bacteria | 2480 |
| 871 | Ga0495606_0158420 | 3300046507 | Bacteria | 1323 |
| 872 | Ga0495606_0248652 | 3300046507 | Bacteria | 987 |
| 873 | Ga0495606_0335379 | 3300046507 | Bacteria | 807 |
| 874 | Ga0495606_0374445 | 3300046507 | Bacteria | 748 |
| 875 | Ga0495606_0388069 | 3300046507 | Bacteria | 730 |
| 876 | Ga0495606_0536463 | 3300046507 | Bacteria | 584 |
| 877 | Ga0495608_0037678 | 3300046511 | Bacteria | 3251 |
| 878 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 879 | Ga0495610_0004520 | 3300046512 | Bacteria | 10242 |
| 880 | Ga0495610_0042199 | 3300046512 | Bacteria | 2283 |
| 881 | Ga0495610_0048651 | 3300046512 | Bacteria | 2080 |
| 882 | Ga0495610_0188392 | 3300046512 | Bacteria | 853 |
| 883 | Ga0495616_0003800 | 3300046513 | Bacteria | 9623 |
| 884 | Ga0495616_0004467 | 3300046513 | Bacteria | 8805 |
| 885 | Ga0495616_0018110 | 3300046513 | Bacteria | 3874 |
| 886 | Ga0495616_0028095 | 3300046513 | Bacteria | 2980 |
| 887 | Ga0495616_0040567 | 3300046513 | Bacteria | 2377 |
| 888 | Ga0495616_0053180 | 3300046513 | Bacteria | 2013 |
| 889 | Ga0495616_0070526 | 3300046513 | Bacteria | 1691 |
| 890 | Ga0495616_0090767 | 3300046513 | Bacteria | 1446 |
| 891 | Ga0495616_0153679 | 3300046513 | Bacteria | 1039 |
| 892 | Ga0495616_0183476 | 3300046513 | Bacteria | 928 |
| 893 | Ga0495620_0001543 | 3300046515 | Bacteria | 13683 |
| 894 | Ga0495628_0089954 | 3300046516 | Bacteria | 2376 |
| 895 | Ga0495628_0758225 | 3300046516 | Bacteria | 681 |
| 896 | Ga0495630_0050068 | 3300046517 | Bacteria | 3126 |
| 897 | Ga0495630_0214174 | 3300046517 | Bacteria | 1470 |
| 898 | Ga0495631_0084495 | 3300046518 | Bacteria | 1367 |
| 899 | Ga0495631_0109370 | 3300046518 | Bacteria | 1188 |
| 900 | Ga0495631_0113533 | 3300046518 | Bacteria | 1165 |
| 901 | Ga0495631_0141332 | 3300046518 | Bacteria | 1033 |
| 902 | Ga0495631_0376151 | 3300046518 | Bacteria | 604 |
| 903 | Ga0495632_0018868 | 3300046519 | Bacteria | 3770 |
| 904 | Ga0495632_0035459 | 3300046519 | Bacteria | 2545 |
| 905 | Ga0495632_0102867 | 3300046519 | Bacteria | 1345 |
| 906 | Ga0495632_0269148 | 3300046519 | Bacteria | 760 |
| 907 | Ga0495632_0402833 | 3300046519 | Bacteria | 597 |
| 908 | Ga0495637_0001780 | 3300046520 | Bacteria | 12324 |
| 909 | Ga0495637_0002190 | 3300046520 | Bacteria | 10923 |
| 910 | Ga0495637_0006713 | 3300046520 | Bacteria | 5762 |
| 911 | Ga0495637_0035119 | 3300046520 | Bacteria | 2191 |
| 912 | Ga0495643_0002891 | 3300046522 | Bacteria | 13023 |
| 913 | Ga0495643_0016892 | 3300046522 | Bacteria | 4279 |
| 914 | Ga0495643_0026373 | 3300046522 | Bacteria | 3279 |
| 915 | Ga0495643_0040909 | 3300046522 | Bacteria | 2529 |
| 916 | Ga0495643_0092098 | 3300046522 | Bacteria | 1562 |
| 917 | Ga0495643_0107363 | 3300046522 | Bacteria | 1423 |
| 918 | Ga0495643_0117768 | 3300046522 | Bacteria | 1344 |
| 919 | Ga0495643_0129407 | 3300046522 | Bacteria | 1268 |
| 920 | Ga0495643_0231320 | 3300046522 | Bacteria | 871 |
| 921 | Ga0495643_0276333 | 3300046522 | Bacteria | 774 |
| 922 | Ga0495643_0291310 | 3300046522 | Bacteria | 747 |
| 923 | Ga0495643_0313202 | 3300046522 | Bacteria | 711 |
| 924 | Ga0495643_0406296 | 3300046522 | Bacteria | 600 |
| 925 | Ga0495643_0486618 | 3300046522 | Bacteria | 532 |
| 926 | Ga0495644_0012857 | 3300046523 | Bacteria | 3218 |
| 927 | Ga0495644_0029052 | 3300046523 | Bacteria | 2090 |
| 928 | Ga0495644_0085048 | 3300046523 | Bacteria | 1192 |
| 929 | Ga0495644_0107321 | 3300046523 | Bacteria | 1058 |
| 930 | Ga0495644_0117781 | 3300046523 | Bacteria | 1009 |
| 931 | Ga0495644_0140519 | 3300046523 | Bacteria | 922 |
| 932 | Ga0495644_0159870 | 3300046523 | Bacteria | 863 |
| 933 | Ga0495644_0213997 | 3300046523 | Bacteria | 744 |
| 934 | Ga0495644_0247801 | 3300046523 | Bacteria | 691 |
| 935 | Ga0495648_0003167 | 3300046524 | Bacteria | 14648 |
| 936 | Ga0495648_0009195 | 3300046524 | Bacteria | 7688 |
| 937 | Ga0495648_0011794 | 3300046524 | Bacteria | 6557 |
| 938 | Ga0495648_0118352 | 3300046524 | Bacteria | 1428 |
| 939 | Ga0495648_0133789 | 3300046524 | Bacteria | 1314 |
| 940 | Ga0495648_0209844 | 3300046524 | Bacteria | 968 |
| 941 | Ga0495648_0213620 | 3300046524 | Bacteria | 956 |
| 942 | Ga0495663_0015755 | 3300046525 | Bacteria | 2132 |
| 943 | Ga0495663_0037423 | 3300046525 | Bacteria | 1463 |
| 944 | Ga0495663_0056569 | 3300046525 | Bacteria | 1225 |
| 945 | Ga0495663_0097365 | 3300046525 | Bacteria | 965 |
| 946 | Ga0495666_0002326 | 3300046526 | Bacteria | 9474 |
| 947 | Ga0495666_0009599 | 3300046526 | Bacteria | 4837 |
| 948 | Ga0495666_0096128 | 3300046526 | Bacteria | 1396 |
| 949 | Ga0495666_0316509 | 3300046526 | Bacteria | 705 |
| 950 | Ga0495666_0388536 | 3300046526 | Bacteria | 627 |
| 951 | Ga0495642_0005824 | 3300046528 | Bacteria | 4726 |
| 952 | Ga0495642_0007068 | 3300046528 | Bacteria | 4306 |
| 953 | Ga0495642_0010689 | 3300046528 | Bacteria | 3515 |
| 954 | Ga0495642_0052967 | 3300046528 | Bacteria | 1671 |
| 955 | Ga0495642_0114350 | 3300046528 | Bacteria | 1155 |
| 956 | Ga0495642_0127484 | 3300046528 | Bacteria | 1094 |
| 957 | Ga0495642_0286284 | 3300046528 | Bacteria | 721 |
| 958 | Ga0495642_0294808 | 3300046528 | Bacteria | 710 |
| 959 | Ga0495642_0567772 | 3300046528 | Bacteria | 503 |
| 960 | Ga0495652_0019185 | 3300046529 | Bacteria | 6091 |
| 961 | Ga0495652_0095835 | 3300046529 | Bacteria | 2417 |
| 962 | Ga0495652_0183867 | 3300046529 | Bacteria | 1601 |
| 963 | Ga0495654_0000060 | 3300046530 | Bacteria | 134307 |
| 964 | Ga0495654_0018887 | 3300046530 | Bacteria | 3607 |
| 965 | Ga0495654_0063474 | 3300046530 | Bacteria | 1768 |
| 966 | Ga0495654_0073901 | 3300046530 | Bacteria | 1611 |
| 967 | Ga0495654_0105944 | 3300046530 | Bacteria | 1288 |
| 968 | Ga0495654_0126676 | 3300046530 | Bacteria | 1150 |
| 969 | Ga0495654_0170706 | 3300046530 | Bacteria | 948 |
| 970 | Ga0495654_0399106 | 3300046530 | Bacteria | 546 |
| 971 | Ga0495665_0005868 | 3300046531 | Bacteria | 6620 |
| 972 | Ga0495665_0026128 | 3300046531 | Bacteria | 3136 |
| 973 | Ga0495665_0026164 | 3300046531 | Bacteria | 3134 |
| 974 | Ga0495665_0053041 | 3300046531 | Bacteria | 2145 |
| 975 | Ga0495665_0089182 | 3300046531 | Bacteria | 1620 |
| 976 | Ga0495665_0550280 | 3300046531 | Bacteria | 579 |
| 977 | Ga0495665_0681242 | 3300046531 | Bacteria | 510 |
| 978 | Ga0495640_0537766 | 3300046533 | Bacteria | 709 |
| 979 | Ga0495586_0006554 | 3300046535 | Bacteria | 6219 |
| 980 | Ga0495586_0007592 | 3300046535 | Bacteria | 5789 |
| 981 | Ga0495586_0010558 | 3300046535 | Bacteria | 4913 |
| 982 | Ga0495586_0233786 | 3300046535 | Bacteria | 1046 |
| 983 | Ga0495587_0028480 | 3300046536 | Bacteria | 3396 |
| 984 | Ga0495587_0037432 | 3300046536 | Bacteria | 2913 |
| 985 | Ga0495598_0076189 | 3300046537 | Bacteria | 1067 |
| 986 | Ga0495609_0001840 | 3300046538 | Bacteria | 13593 |
| 987 | Ga0495609_0005522 | 3300046538 | Bacteria | 6610 |
| 988 | Ga0495609_0018793 | 3300046538 | Bacteria | 3201 |
| 989 | Ga0495609_0019006 | 3300046538 | Bacteria | 3181 |
| 990 | Ga0495609_0026758 | 3300046538 | Bacteria | 2639 |
| 991 | Ga0495609_0026889 | 3300046538 | Bacteria | 2631 |
| 992 | Ga0495609_0064148 | 3300046538 | Bacteria | 1620 |
| 993 | Ga0495609_0099256 | 3300046538 | Bacteria | 1262 |
| 994 | Ga0495609_0114491 | 3300046538 | Bacteria | 1162 |
| 995 | Ga0495609_0273136 | 3300046538 | Bacteria | 692 |
| 996 | Ga0495609_0417573 | 3300046538 | Bacteria | 535 |
| 997 | Ga0495621_0015352 | 3300046539 | Bacteria | 2441 |
| 998 | Ga0495621_0084944 | 3300046539 | Bacteria | 1186 |
| 999 | Ga0495597_0004273 | 3300046542 | Bacteria | 7899 |
| 1000 | Ga0495597_0007533 | 3300046542 | Bacteria | 5520 |
| 1001 | Ga0495597_0013129 | 3300046542 | Bacteria | 3975 |
| 1002 | Ga0495597_0021380 | 3300046542 | Bacteria | 3008 |
| 1003 | Ga0495597_0025313 | 3300046542 | Bacteria | 2732 |
| 1004 | Ga0495597_0049072 | 3300046542 | Bacteria | 1866 |
| 1005 | Ga0495597_0059514 | 3300046542 | Bacteria | 1668 |
| 1006 | Ga0495597_0085111 | 3300046542 | Bacteria | 1347 |
| 1007 | Ga0495597_0096517 | 3300046542 | Bacteria | 1249 |
| 1008 | Ga0495597_0112149 | 3300046542 | Bacteria | 1142 |
| 1009 | Ga0495597_0124240 | 3300046542 | Bacteria | 1074 |
| 1010 | Ga0495597_0198836 | 3300046542 | Bacteria | 803 |
| 1011 | Ga0495597_0220377 | 3300046542 | Bacteria | 753 |
| 1012 | Ga0495597_0227659 | 3300046542 | Bacteria | 738 |
| 1013 | Ga0495597_0240810 | 3300046542 | Bacteria | 713 |
| 1014 | Ga0495597_0259120 | 3300046542 | Bacteria | 681 |
| 1015 | Ga0495645_0181667 | 3300046543 | Bacteria | 1441 |
| 1016 | Ga0495645_0821012 | 3300046543 | Bacteria | 556 |
| 1017 | Ga0495622_0002906 | 3300046557 | Bacteria | 8173 |
| 1018 | Ga0495622_0003244 | 3300046557 | Bacteria | 7699 |
| 1019 | Ga0495622_0010858 | 3300046557 | Bacteria | 4202 |
| 1020 | Ga0495622_0016244 | 3300046557 | Bacteria | 3466 |
| 1021 | Ga0495622_0033985 | 3300046557 | Bacteria | 2379 |
| 1022 | Ga0495622_0061317 | 3300046557 | Bacteria | 1741 |
| 1023 | Ga0495622_0191348 | 3300046557 | Bacteria | 914 |
| 1024 | Ga0495622_0352903 | 3300046557 | Bacteria | 636 |
| 1025 | Ga0495633_0010195 | 3300046558 | Bacteria | 5140 |
| 1026 | Ga0495633_0017696 | 3300046558 | Bacteria | 3636 |
| 1027 | Ga0495633_0032840 | 3300046558 | Bacteria | 2505 |
| 1028 | Ga0495633_0051460 | 3300046558 | Bacteria | 1940 |
| 1029 | Ga0495633_0099041 | 3300046558 | Bacteria | 1353 |
| 1030 | Ga0495633_0105604 | 3300046558 | Bacteria | 1306 |
| 1031 | Ga0495633_0190322 | 3300046558 | Bacteria | 943 |
| 1032 | Ga0495633_0342535 | 3300046558 | Bacteria | 677 |
| 1033 | Ga0495633_0353490 | 3300046558 | Bacteria | 665 |
| 1034 | Ga0495633_0496025 | 3300046558 | Bacteria | 550 |
| 1035 | Ga0495633_0524675 | 3300046558 | Bacteria | 533 |
| 1036 | Ga0495667_0042014 | 3300046559 | Bacteria | 3031 |
| 1037 | Ga0495656_0010822 | 3300046615 | Bacteria | 3330 |
| 1038 | Ga0495656_0040826 | 3300046615 | Bacteria | 1935 |
| 1039 | Ga0495656_0100242 | 3300046615 | Bacteria | 1338 |
| 1040 | Ga0495656_0107150 | 3300046615 | Bacteria | 1301 |
| 1041 | Ga0495656_0115998 | 3300046615 | Bacteria | 1258 |
| 1042 | Ga0495668_0002640 | 3300046616 | Bacteria | 14406 |
| 1043 | Ga0495668_0005163 | 3300046616 | Bacteria | 8962 |
| 1044 | Ga0495668_0008733 | 3300046616 | Bacteria | 6291 |
| 1045 | Ga0495668_0011342 | 3300046616 | Bacteria | 5343 |
| 1046 | Ga0495668_0063066 | 3300046616 | Bacteria | 2041 |
| 1047 | Ga0495668_0092399 | 3300046616 | Bacteria | 1657 |
| 1048 | Ga0495668_0129828 | 3300046616 | Bacteria | 1379 |
| 1049 | Ga0495668_0174806 | 3300046616 | Bacteria | 1176 |
| 1050 | Ga0495668_0195544 | 3300046616 | Bacteria | 1107 |
| 1051 | Ga0495668_0284779 | 3300046616 | Bacteria | 905 |
| 1052 | Ga0495668_0309249 | 3300046616 | Bacteria | 867 |
| 1053 | Ga0495668_0447727 | 3300046616 | Bacteria | 710 |
| 1054 | Ga0495668_0831789 | 3300046616 | Bacteria | 511 |
| 1055 | Ga0495634_0014598 | 3300046642 | Bacteria | 5659 |
| 1056 | Ga0495634_0400610 | 3300046642 | Bacteria | 815 |
| 1057 | Ga0495611_0001662 | 3300046648 | Bacteria | 10778 |
| 1058 | Ga0495611_0002069 | 3300046648 | Bacteria | 9442 |
| 1059 | Ga0495611_0005909 | 3300046648 | Bacteria | 5219 |
| 1060 | Ga0495611_0007454 | 3300046648 | Bacteria | 4643 |
| 1061 | Ga0495611_0011467 | 3300046648 | Bacteria | 3757 |
| 1062 | Ga0495611_0020577 | 3300046648 | Bacteria | 2841 |
| 1063 | Ga0495611_0041368 | 3300046648 | Bacteria | 2055 |
| 1064 | Ga0495611_0305916 | 3300046648 | Bacteria | 732 |
| 1065 | Ga0495625_0005454 | 3300046660 | Bacteria | 11594 |
| 1066 | Ga0495625_0018357 | 3300046660 | Bacteria | 5463 |
| 1067 | Ga0495625_0042626 | 3300046660 | Bacteria | 3296 |
| 1068 | Ga0495625_0056429 | 3300046660 | Bacteria | 2795 |
| 1069 | Ga0495625_0090743 | 3300046660 | Bacteria | 2113 |
| 1070 | Ga0495625_0095414 | 3300046660 | Bacteria | 2050 |
| 1071 | Ga0495625_0214661 | 3300046660 | Bacteria | 1263 |
| 1072 | Ga0495625_0223273 | 3300046660 | Bacteria | 1233 |
| 1073 | Ga0495625_0388500 | 3300046660 | Bacteria | 874 |
| 1074 | Ga0495625_0550096 | 3300046660 | Bacteria | 699 |
| 1075 | Ga0495635_0026620 | 3300046663 | Bacteria | 4022 |
| 1076 | Ga0495635_0181994 | 3300046663 | Bacteria | 1428 |
| 1077 | Ga0495635_0904837 | 3300046663 | Bacteria | 565 |
| 1078 | Ga0495659_0002211 | 3300046664 | Bacteria | 6333 |
| 1079 | Ga0495659_0037680 | 3300046664 | Bacteria | 1713 |
| 1080 | Ga0495659_0041386 | 3300046664 | Bacteria | 1645 |
| 1081 | Ga0495659_0092967 | 3300046664 | Bacteria | 1160 |
| 1082 | Ga0495659_0093772 | 3300046664 | Bacteria | 1155 |
| 1083 | Ga0495659_0105752 | 3300046664 | Bacteria | 1094 |
| 1084 | Ga0495659_0393753 | 3300046664 | Bacteria | 597 |
| 1085 | Ga0495661_0018525 | 3300046665 | Bacteria | 4577 |
| 1086 | Ga0495661_0022142 | 3300046665 | Bacteria | 4136 |
| 1087 | Ga0495661_0048413 | 3300046665 | Bacteria | 2582 |
| 1088 | Ga0495661_0060113 | 3300046665 | Bacteria | 2258 |
| 1089 | Ga0495661_0061371 | 3300046665 | Bacteria | 2231 |
| 1090 | Ga0495661_0068457 | 3300046665 | Bacteria | 2082 |
| 1091 | Ga0495661_0071076 | 3300046665 | Bacteria | 2034 |
| 1092 | Ga0495661_0127892 | 3300046665 | Bacteria | 1395 |
| 1093 | Ga0495661_0128906 | 3300046665 | Bacteria | 1388 |
| 1094 | Ga0495661_0169133 | 3300046665 | Bacteria | 1167 |
| 1095 | Ga0495661_0206455 | 3300046665 | Bacteria | 1025 |
| 1096 | Ga0495661_0208125 | 3300046665 | Bacteria | 1020 |
| 1097 | Ga0495661_0324453 | 3300046665 | Bacteria | 764 |
| 1098 | Ga0495661_0413168 | 3300046665 | Bacteria | 654 |
| 1099 | Ga0495661_0417194 | 3300046665 | Bacteria | 650 |
| 1100 | Ga0495661_0623059 | 3300046665 | Bacteria | 506 |
| 1101 | Ga0495588_0000091 | 3300046674 | Bacteria | 183183 |
| 1102 | Ga0495588_0009876 | 3300046674 | Bacteria | 4424 |
| 1103 | Ga0495588_0022754 | 3300046674 | Bacteria | 3099 |
| 1104 | Ga0495588_0032819 | 3300046674 | Bacteria | 2618 |
| 1105 | Ga0495588_0038295 | 3300046674 | Bacteria | 2438 |
| 1106 | Ga0495588_0075112 | 3300046674 | Bacteria | 1760 |
| 1107 | Ga0495588_0126891 | 3300046674 | Bacteria | 1345 |
| 1108 | Ga0495588_0167032 | 3300046674 | Bacteria | 1163 |
| 1109 | Ga0495588_0219939 | 3300046674 | Bacteria | 1002 |
| 1110 | Ga0495588_0258362 | 3300046674 | Bacteria | 918 |
| 1111 | Ga0495657_0046439 | 3300046675 | Bacteria | 2940 |
| 1112 | Ga0495599_0001590 | 3300046678 | Bacteria | 13082 |
| 1113 | Ga0495599_0061532 | 3300046678 | Bacteria | 2346 |
| 1114 | Ga0495599_0569109 | 3300046678 | Bacteria | 662 |
| 1115 | Ga0495623_0008893 | 3300046679 | Bacteria | 6519 |
| 1116 | Ga0495623_0020652 | 3300046679 | Bacteria | 4257 |
| 1117 | Ga0495623_0228894 | 3300046679 | Bacteria | 1055 |
| 1118 | Ga0495646_0063908 | 3300046680 | Bacteria | 2183 |
| 1119 | Ga0495646_0403601 | 3300046680 | Bacteria | 710 |
| 1120 | Ga0495669_0001596 | 3300046684 | Bacteria | 9305 |
| 1121 | Ga0495669_0015677 | 3300046684 | Bacteria | 3245 |
| 1122 | Ga0495669_0084861 | 3300046684 | Bacteria | 1456 |
| 1123 | Ga0495669_0091582 | 3300046684 | Bacteria | 1404 |
| 1124 | Ga0495669_0157656 | 3300046684 | Bacteria | 1076 |
| 1125 | Ga0495669_0420575 | 3300046684 | Bacteria | 648 |
| 1126 | Ga0495613_0337429 | 3300046689 | Bacteria | 1037 |
| 1127 | Ga0495624_0036411 | 3300046690 | Bacteria | 3172 |
| 1128 | Ga0495624_0069735 | 3300046690 | Bacteria | 2189 |
| 1129 | Ga0495670_0004991 | 3300046691 | Bacteria | 6522 |
| 1130 | Ga0495670_0010742 | 3300046691 | Bacteria | 4499 |
| 1131 | Ga0495670_0015412 | 3300046691 | Bacteria | 3755 |
| 1132 | Ga0495670_0019932 | 3300046691 | Bacteria | 3304 |
| 1133 | Ga0495670_0031340 | 3300046691 | Bacteria | 2641 |
| 1134 | Ga0495670_0081921 | 3300046691 | Bacteria | 1644 |
| 1135 | Ga0495670_0135699 | 3300046691 | Bacteria | 1284 |
| 1136 | Ga0495670_0381420 | 3300046691 | Bacteria | 760 |
| 1137 | Ga0495670_0448993 | 3300046691 | Bacteria | 698 |
| 1138 | Ga0495670_0488228 | 3300046691 | Bacteria | 668 |
| 1139 | Ga0495671_0000037 | 3300046692 | Bacteria | 177605 |
| 1140 | Ga0495671_0085680 | 3300046692 | Bacteria | 1543 |
| 1141 | Ga0495671_0118753 | 3300046692 | Bacteria | 1290 |
| 1142 | Ga0495671_0198747 | 3300046692 | Bacteria | 972 |
| 1143 | Ga0495671_0325797 | 3300046692 | Bacteria | 737 |
| 1144 | Ga0495649_0012662 | 3300046694 | Bacteria | 4895 |
| 1145 | Ga0495649_0027792 | 3300046694 | Bacteria | 3137 |
| 1146 | Ga0495649_0073185 | 3300046694 | Bacteria | 1836 |
| 1147 | Ga0495649_0098580 | 3300046694 | Bacteria | 1554 |
| 1148 | Ga0495649_0118681 | 3300046694 | Bacteria | 1399 |
| 1149 | Ga0495649_0387844 | 3300046694 | Bacteria | 702 |
| 1150 | Ga0495649_0600575 | 3300046694 | Bacteria | 543 |
| 1151 | Ga0495649_0691454 | 3300046694 | Bacteria | 500 |
| 1152 | Ga0495589_0014264 | 3300046794 | Bacteria | 4094 |
| 1153 | Ga0495589_0029351 | 3300046794 | Bacteria | 2772 |
| 1154 | Ga0495589_0030733 | 3300046794 | Bacteria | 2704 |
| 1155 | Ga0495589_0037560 | 3300046794 | Bacteria | 2426 |
| 1156 | Ga0495589_0072308 | 3300046794 | Bacteria | 1684 |
| 1157 | Ga0495589_0101699 | 3300046794 | Bacteria | 1390 |
| 1158 | Ga0495589_0114336 | 3300046794 | Bacteria | 1301 |
| 1159 | Ga0495589_0183245 | 3300046794 | Bacteria | 992 |
| 1160 | Ga0495589_0472950 | 3300046794 | Bacteria | 573 |
| 1161 | Ga0495600_0004009 | 3300046809 | Bacteria | 8753 |
| 1162 | Ga0495600_0006486 | 3300046809 | Bacteria | 7122 |
| 1163 | Ga0495600_0423937 | 3300046809 | Bacteria | 825 |
| 1164 | Ga0495600_0754054 | 3300046809 | Bacteria | 582 |
| 1165 | Ga0495660_0001966 | 3300046810 | Bacteria | 13364 |
| 1166 | Ga0495660_0007547 | 3300046810 | Bacteria | 6384 |
| 1167 | Ga0495660_0010186 | 3300046810 | Bacteria | 5468 |
| 1168 | Ga0495660_0030532 | 3300046810 | Bacteria | 3035 |
| 1169 | Ga0495660_0034825 | 3300046810 | Bacteria | 2815 |
| 1170 | Ga0495660_0296308 | 3300046810 | Bacteria | 734 |
| 1171 | Ga0495660_0498638 | 3300046810 | Bacteria | 521 |
| 1172 | Ga0495581_0018479 | 3300047315 | Bacteria | 4049 |
| 1173 | Ga0495581_0095106 | 3300047315 | Bacteria | 1729 |
| 1174 | Ga0495581_0203954 | 3300047315 | Bacteria | 1156 |
| 1175 | Ga0495581_0354421 | 3300047315 | Bacteria | 856 |
| 1176 | Ga0495604_0003421 | 3300047317 | Bacteria | 12655 |
| 1177 | Ga0495604_0010101 | 3300047317 | Bacteria | 7477 |
| 1178 | Ga0495604_0010804 | 3300047317 | Bacteria | 7251 |
| 1179 | Ga0495604_0063319 | 3300047317 | Bacteria | 2821 |
| 1180 | Ga0495604_0738025 | 3300047317 | Bacteria | 623 |
| 1181 | Ga0495636_0001434 | 3300047318 | Bacteria | 9014 |
| 1182 | Ga0495636_0002112 | 3300047318 | Bacteria | 7637 |
| 1183 | Ga0495636_0003788 | 3300047318 | Bacteria | 5890 |
| 1184 | Ga0495636_0013181 | 3300047318 | Bacteria | 3279 |
| 1185 | Ga0495636_0545651 | 3300047318 | Bacteria | 563 |
| 1186 | Ga0495674_0009303 | 3300047319 | Bacteria | 9338 |
| 1187 | Ga0495674_0289372 | 3300047319 | Bacteria | 1340 |
| 1188 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 1189 | Ga0495672_0000157 | 3300047320 | Bacteria | 98544 |
| 1190 | Ga0495672_0007686 | 3300047320 | Bacteria | 8079 |
| 1191 | Ga0495672_0016220 | 3300047320 | Bacteria | 5030 |
| 1192 | Ga0495672_0020286 | 3300047320 | Bacteria | 4361 |
| 1193 | Ga0495672_0021784 | 3300047320 | Bacteria | 4174 |
| 1194 | Ga0495672_0069849 | 3300047320 | Bacteria | 1992 |
| 1195 | Ga0495672_0082508 | 3300047320 | Bacteria | 1787 |
| 1196 | Ga0495672_0247872 | 3300047320 | Bacteria | 866 |
| 1197 | Ga0495676_0004545 | 3300047321 | Bacteria | 12688 |
| 1198 | Ga0495676_0031634 | 3300047321 | Bacteria | 4472 |
| 1199 | Ga0495676_0135297 | 3300047321 | Bacteria | 1773 |
| 1200 | Ga0495676_0157887 | 3300047321 | Bacteria | 1607 |
| 1201 | Ga0495676_0167264 | 3300047321 | Bacteria | 1550 |
| 1202 | Ga0495680_0272308 | 3300047322 | Bacteria | 1195 |
| 1203 | Ga0495680_0398534 | 3300047322 | Bacteria | 950 |
| 1204 | Ga0495680_0465911 | 3300047322 | Bacteria | 863 |
| 1205 | Ga0495683_0003225 | 3300047323 | Bacteria | 9532 |
| 1206 | Ga0495683_0014031 | 3300047323 | Bacteria | 4174 |
| 1207 | Ga0495683_0015642 | 3300047323 | Bacteria | 3943 |
| 1208 | Ga0495683_0043280 | 3300047323 | Bacteria | 2268 |
| 1209 | Ga0495683_0081874 | 3300047323 | Bacteria | 1573 |
| 1210 | Ga0495683_0148116 | 3300047323 | Bacteria | 1095 |
| 1211 | Ga0495683_0228820 | 3300047323 | Bacteria | 825 |
| 1212 | Ga0495683_0388285 | 3300047323 | Bacteria | 582 |
| 1213 | Ga0495687_000342 | 3300047443 | Bacteria | 59692 |
| 1214 | Ga0495687_001562 | 3300047443 | Bacteria | 20787 |
| 1215 | Ga0495687_002781 | 3300047443 | Bacteria | 13521 |
| 1216 | Ga0495687_002921 | 3300047443 | Bacteria | 12995 |
| 1217 | Ga0495687_011455 | 3300047443 | Bacteria | 4768 |
| 1218 | Ga0495687_023933 | 3300047443 | Bacteria | 2911 |
| 1219 | Ga0495687_024921 | 3300047443 | Bacteria | 2836 |
| 1220 | Ga0495687_055162 | 3300047443 | Bacteria | 1662 |
| 1221 | Ga0495687_069898 | 3300047443 | Bacteria | 1411 |
| 1222 | Ga0495687_089986 | 3300047443 | Bacteria | 1177 |
| 1223 | Ga0495687_090176 | 3300047443 | Bacteria | 1175 |
| 1224 | Ga0495675_0021158 | 3300047444 | Bacteria | 4140 |
| 1225 | Ga0495675_0038185 | 3300047444 | Bacteria | 3057 |
| 1226 | Ga0495675_0249845 | 3300047444 | Bacteria | 1065 |
| 1227 | Ga0495675_0340054 | 3300047444 | Bacteria | 884 |
| 1228 | Ga0495677_0001866 | 3300047445 | Bacteria | 8421 |
| 1229 | Ga0495677_0016634 | 3300047445 | Bacteria | 2669 |
| 1230 | Ga0495677_0032598 | 3300047445 | Bacteria | 1897 |
| 1231 | Ga0495677_0035722 | 3300047445 | Bacteria | 1813 |
| 1232 | Ga0495677_0084424 | 3300047445 | Bacteria | 1192 |
| 1233 | Ga0495677_0102771 | 3300047445 | Bacteria | 1083 |
| 1234 | Ga0495677_0107809 | 3300047445 | Bacteria | 1057 |
| 1235 | Ga0495677_0125506 | 3300047445 | Bacteria | 980 |
| 1236 | Ga0495677_0161241 | 3300047445 | Bacteria | 865 |
| 1237 | Ga0495677_0166219 | 3300047445 | Bacteria | 852 |
| 1238 | Ga0495677_0180237 | 3300047445 | Bacteria | 818 |
| 1239 | Ga0495677_0270108 | 3300047445 | Bacteria | 666 |
| 1240 | Ga0495679_005019 | 3300047446 | Bacteria | 5954 |
| 1241 | Ga0495679_006474 | 3300047446 | Bacteria | 5030 |
| 1242 | Ga0495679_025594 | 3300047446 | Bacteria | 1970 |
| 1243 | Ga0495679_070561 | 3300047446 | Bacteria | 1007 |
| 1244 | Ga0495679_160771 | 3300047446 | Bacteria | 600 |
| 1245 | Ga0495685_000474 | 3300047447 | Bacteria | 12514 |
| 1246 | Ga0495685_009709 | 3300047447 | Bacteria | 3221 |
| 1247 | Ga0495685_069325 | 3300047447 | Bacteria | 1182 |
| 1248 | Ga0495685_095624 | 3300047447 | Bacteria | 982 |
| 1249 | Ga0495685_099061 | 3300047447 | Bacteria | 963 |
| 1250 | Ga0495685_221769 | 3300047447 | Bacteria | 603 |
| 1251 | Ga0495673_0000248 | 3300047469 | Bacteria | 75224 |
| 1252 | Ga0495673_0010480 | 3300047469 | Bacteria | 5036 |
| 1253 | Ga0495673_0017349 | 3300047469 | Bacteria | 3660 |
| 1254 | Ga0495681_0012224 | 3300047470 | Bacteria | 5057 |
| 1255 | Ga0495681_0043132 | 3300047470 | Bacteria | 2177 |
| 1256 | Ga0495681_0053354 | 3300047470 | Bacteria | 1893 |
| 1257 | Ga0495681_0072599 | 3300047470 | Bacteria | 1556 |
| 1258 | Ga0495681_0089523 | 3300047470 | Bacteria | 1361 |
| 1259 | Ga0495681_0113480 | 3300047470 | Bacteria | 1170 |
| 1260 | Ga0495681_0146985 | 3300047470 | Bacteria | 991 |
| 1261 | Ga0495681_0160248 | 3300047470 | Bacteria | 937 |
| 1262 | Ga0495681_0176785 | 3300047470 | Bacteria | 879 |
| 1263 | Ga0495681_0290220 | 3300047470 | Bacteria | 635 |
| 1264 | Ga0495681_0401191 | 3300047470 | Bacteria | 512 |
| 1265 | Ga0495686_0007683 | 3300047472 | Bacteria | 8051 |
| 1266 | Ga0495686_0012785 | 3300047472 | Bacteria | 5856 |
| 1267 | Ga0495686_0018441 | 3300047472 | Bacteria | 4684 |
| 1268 | Ga0495686_0021073 | 3300047472 | Bacteria | 4336 |
| 1269 | Ga0495686_0062817 | 3300047472 | Bacteria | 2302 |
| 1270 | Ga0495686_0070207 | 3300047472 | Bacteria | 2158 |
| 1271 | Ga0495686_0617336 | 3300047472 | Bacteria | 560 |
| 1272 | Ga0495593_0002955 | 3300047673 | Bacteria | 10225 |
| 1273 | Ga0495593_0015516 | 3300047673 | Bacteria | 4313 |
| 1274 | Ga0495593_0016080 | 3300047673 | Bacteria | 4223 |
| 1275 | Ga0495593_0304065 | 3300047673 | Bacteria | 797 |
| 1276 | Ga0495602_0049802 | 3300048088 | Bacteria | 3748 |
| 1277 | Ga0495602_0187032 | 3300048088 | Bacteria | 1591 |
| 1278 | Ga0495602_0236904 | 3300048088 | Bacteria | 1367 |
| 1279 | Ga0495614_0054658 | 3300048089 | Bacteria | 1712 |
| 1280 | Ga0495614_0178530 | 3300048089 | Bacteria | 954 |
| 1281 | Ga0495615_0038328 | 3300048090 | Bacteria | 1184 |
| 1282 | Ga0495615_0287656 | 3300048090 | Bacteria | 529 |
| 1283 | Ga0495626_0002147 | 3300048091 | Bacteria | 14252 |
| 1284 | Ga0495626_0014493 | 3300048091 | Bacteria | 4062 |
| 1285 | Ga0495626_0029462 | 3300048091 | Bacteria | 2656 |
| 1286 | Ga0495626_0032266 | 3300048091 | Bacteria | 2515 |
| 1287 | Ga0495626_0037979 | 3300048091 | Bacteria | 2285 |
| 1288 | Ga0495626_0054009 | 3300048091 | Bacteria | 1846 |
| 1289 | Ga0495626_0074354 | 3300048091 | Bacteria | 1520 |
| 1290 | Ga0495626_0091062 | 3300048091 | Bacteria | 1340 |
| 1291 | Ga0495626_0117815 | 3300048091 | Bacteria | 1144 |
| 1292 | Ga0495626_0174463 | 3300048091 | Bacteria | 894 |
| 1293 | Ga0495626_0379776 | 3300048091 | Bacteria | 548 |
| 1294 | Ga0496100_0014114 | 3300048903 | Bacteria | 4630 |
| 1295 | Ga0496100_0848752 | 3300048903 | Bacteria | 716 |
| 1296 | Ga0496100_1570695 | 3300048903 | Bacteria | 520 |
| 1297 | Ga0496101_0056958 | 3300048904 | Bacteria | 2825 |
| 1298 | Ga0496101_0161155 | 3300048904 | Bacteria | 1720 |
| 1299 | Ga0496101_0947987 | 3300048904 | Bacteria | 677 |
| 1300 | Ga0496102_0022102 | 3300048905 | Bacteria | 5634 |
| 1301 | Ga0496102_0315662 | 3300048905 | Bacteria | 1472 |
| 1302 | Ga0496102_0447744 | 3300048905 | Bacteria | 1211 |
| 1303 | Ga0496102_0499438 | 3300048905 | Bacteria | 1138 |
| 1304 | Ga0496102_0823476 | 3300048905 | Bacteria | 850 |
| 1305 | Ga0496102_1208221 | 3300048905 | Bacteria | 675 |
| 1306 | Ga0496103_0010940 | 3300048906 | Bacteria | 5370 |
| 1307 | Ga0496103_0014572 | 3300048906 | Bacteria | 4670 |
| 1308 | Ga0496103_0020711 | 3300048906 | Bacteria | 3953 |
| 1309 | Ga0496103_0100485 | 3300048906 | Bacteria | 1830 |
| 1310 | Ga0496103_0420848 | 3300048906 | Bacteria | 857 |
| 1311 | Ga0496103_0540278 | 3300048906 | Bacteria | 744 |
| 1312 | Ga0496104_0224974 | 3300048907 | Bacteria | 1788 |
| 1313 | Ga0496104_0392286 | 3300048907 | Bacteria | 1300 |
| 1314 | Ga0496104_0562827 | 3300048907 | Bacteria | 1051 |
| 1315 | Ga0496105_0090765 | 3300048908 | Bacteria | 2523 |
| 1316 | Ga0496105_0731574 | 3300048908 | Bacteria | 757 |
| 1317 | Ga0496106_0168970 | 3300048909 | Bacteria | 1732 |
| 1318 | Ga0496106_0217913 | 3300048909 | Bacteria | 1521 |
| 1319 | Ga0496106_0724466 | 3300048909 | Bacteria | 792 |
| 1320 | Ga0496106_0738447 | 3300048909 | Bacteria | 783 |
| 1321 | Ga0496107_0047151 | 3300048910 | Bacteria | 3103 |
| 1322 | Ga0496107_0122539 | 3300048910 | Bacteria | 1916 |
| 1323 | Ga0496107_0263854 | 3300048910 | Bacteria | 1281 |
| 1324 | Ga0496107_0324055 | 3300048910 | Bacteria | 1146 |
| 1325 | Ga0496108_0561420 | 3300048911 | Bacteria | 995 |
| 1326 | Ga0496108_0597717 | 3300048911 | Bacteria | 961 |
| 1327 | Ga0496108_1430065 | 3300048911 | Bacteria | 577 |
| 1328 | Ga0496109_0584534 | 3300048912 | Bacteria | 1052 |
| 1329 | Ga0496109_1574844 | 3300048912 | Bacteria | 591 |
| 1330 | Ga0496110_0110339 | 3300048913 | Bacteria | 2471 |
| 1331 | Ga0496110_0454328 | 3300048913 | Bacteria | 1168 |
| 1332 | Ga0496110_1223550 | 3300048913 | Bacteria | 660 |
| 1333 | Ga0496110_1819096 | 3300048913 | Bacteria | 519 |
| 1334 | Ga0496111_0076448 | 3300048914 | Bacteria | 2440 |
| 1335 | Ga0496111_0135130 | 3300048914 | Bacteria | 1826 |
| 1336 | Ga0496112_1052819 | 3300048915 | Bacteria | 732 |
| 1337 | Ga0496112_1832459 | 3300048915 | Bacteria | 518 |
| 1338 | Ga0496114_0041004 | 3300048917 | Bacteria | 3836 |
| 1339 | Ga0496114_0863153 | 3300048917 | Bacteria | 785 |
| 1340 | Ga0496115_0050480 | 3300048918 | Bacteria | 3332 |
| 1341 | Ga0496115_0137305 | 3300048918 | Bacteria | 2016 |
| 1342 | Ga0496115_0202044 | 3300048918 | Bacteria | 1641 |
| 1343 | Ga0496115_0337943 | 3300048918 | Bacteria | 1229 |
| 1344 | Ga0496115_0575713 | 3300048918 | Bacteria | 897 |
| 1345 | Ga0496115_1123949 | 3300048918 | Bacteria | 594 |
| 1346 | Ga0496116_0078388 | 3300048919 | Bacteria | 2060 |
| 1347 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 1348 | Ga0496117_0323166 | 3300048920 | Bacteria | 808 |
| 1349 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 1350 | Ga0496118_0426591 | 3300048921 | Bacteria | 680 |
| 1351 | Ga0496119_0071811 | 3300048922 | Bacteria | 2025 |
| 1352 | Ga0496120_0160080 | 3300048923 | Bacteria | 1123 |
| 1353 | Ga0496121_0004491 | 3300048924 | Bacteria | 18710 |
| 1354 | Ga0496121_0018508 | 3300048924 | Bacteria | 7020 |
| 1355 | Ga0496121_0023798 | 3300048924 | Bacteria | 5881 |
| 1356 | Ga0496121_0042385 | 3300048924 | Bacteria | 3960 |
| 1357 | Ga0496121_0114637 | 3300048924 | Bacteria | 2048 |
| 1358 | Ga0496121_0508057 | 3300048924 | Bacteria | 763 |
| 1359 | Ga0496122_0005873 | 3300048925 | Bacteria | 14382 |
| 1360 | Ga0496122_0211557 | 3300048925 | Bacteria | 1122 |
| 1361 | Ga0496122_0499701 | 3300048925 | Bacteria | 591 |
| 1362 | Ga0496123_0005104 | 3300048926 | Bacteria | 13404 |
| 1363 | Ga0496123_0020755 | 3300048926 | Bacteria | 5128 |
| 1364 | Ga0496123_0048880 | 3300048926 | Bacteria | 2841 |
| 1365 | Ga0496123_0273029 | 3300048926 | Bacteria | 821 |
| 1366 | Ga0496124_0001830 | 3300048927 | Bacteria | 29398 |
| 1367 | Ga0496124_0009077 | 3300048927 | Bacteria | 10283 |
| 1368 | Ga0496124_0015482 | 3300048927 | Bacteria | 7307 |
| 1369 | Ga0496124_0101682 | 3300048927 | Bacteria | 2328 |
| 1370 | Ga0496124_0120196 | 3300048927 | Bacteria | 2100 |
| 1371 | Ga0496124_0279288 | 3300048927 | Bacteria | 1218 |
| 1372 | Ga0496124_0571215 | 3300048927 | Bacteria | 742 |
| 1373 | Ga0496124_0618387 | 3300048927 | Bacteria | 701 |
| 1374 | Ga0496125_0005905 | 3300048928 | Bacteria | 13422 |
| 1375 | Ga0496125_0009685 | 3300048928 | Bacteria | 9840 |
| 1376 | Ga0496125_0013937 | 3300048928 | Bacteria | 7862 |
| 1377 | Ga0496125_0040516 | 3300048928 | Bacteria | 3995 |
| 1378 | Ga0496125_0129144 | 3300048928 | Bacteria | 1783 |
| 1379 | Ga0496125_0211435 | 3300048928 | Bacteria | 1259 |
| 1380 | Ga0496125_0376596 | 3300048928 | Bacteria | 838 |
| 1381 | Ga0496125_0405857 | 3300048928 | Bacteria | 795 |
| 1382 | Ga0496126_0004622 | 3300048929 | Bacteria | 16312 |
| 1383 | Ga0496126_0317516 | 3300048929 | Bacteria | 1281 |
| 1384 | Ga0496126_0619610 | 3300048929 | Bacteria | 850 |
| 1385 | Ga0501306_000005 | 3300049127 | Bacteria | 11576 |
| 1386 | Ga0501306_000979 | 3300049127 | Bacteria | 2501 |
| 1387 | Ga0501306_001799 | 3300049127 | Bacteria | 2089 |
| 1388 | Ga0501306_003684 | 3300049127 | Bacteria | 1667 |
| 1389 | Ga0501306_008516 | 3300049127 | Bacteria | 1253 |
| 1390 | Ga0501306_018600 | 3300049127 | Bacteria | 951 |
| 1391 | Ga0501306_030700 | 3300049127 | Bacteria | 797 |
| 1392 | Ga0501306_038015 | 3300049127 | Bacteria | 738 |
| 1393 | Ga0501306_038884 | 3300049127 | Bacteria | 732 |
| 1394 | Ga0501306_087384 | 3300049127 | Bacteria | 544 |
| 1395 | Ga0501308_000002 | 3300049128 | Bacteria | 13277 |
| 1396 | Ga0501308_000177 | 3300049128 | Bacteria | 3494 |
| 1397 | Ga0501308_000386 | 3300049128 | Bacteria | 2793 |
| 1398 | Ga0501308_005794 | 3300049128 | Bacteria | 1245 |
| 1399 | Ga0501308_008008 | 3300049128 | Bacteria | 1120 |
| 1400 | Ga0501308_009740 | 3300049128 | Bacteria | 1055 |
| 1401 | Ga0501308_020892 | 3300049128 | Bacteria | 818 |
| 1402 | Ga0501308_025496 | 3300049128 | Bacteria | 766 |
| 1403 | Ga0501308_028896 | 3300049128 | Bacteria | 735 |
| 1404 | Ga0501308_029721 | 3300049128 | Bacteria | 727 |
| 1405 | Ga0501308_056773 | 3300049128 | Bacteria | 584 |
| 1406 | Ga0501308_069780 | 3300049128 | Bacteria | 544 |
| 1407 | Ga0501309_000464 | 3300049129 | Bacteria | 3253 |
| 1408 | Ga0501309_002567 | 3300049129 | Bacteria | 1972 |
| 1409 | Ga0501309_003438 | 3300049129 | Bacteria | 1792 |
| 1410 | Ga0501309_004776 | 3300049129 | Bacteria | 1590 |
| 1411 | Ga0501309_013328 | 3300049129 | Bacteria | 1092 |
| 1412 | Ga0501309_030503 | 3300049129 | Bacteria | 793 |
| 1413 | Ga0501310_000065 | 3300049130 | Bacteria | 9861 |
| 1414 | Ga0501310_002047 | 3300049130 | Bacteria | 1887 |
| 1415 | Ga0501310_002676 | 3300049130 | Bacteria | 1701 |
| 1416 | Ga0501310_004061 | 3300049130 | Bacteria | 1454 |
| 1417 | Ga0501310_008997 | 3300049130 | Bacteria | 1093 |
| 1418 | Ga0501310_009999 | 3300049130 | Bacteria | 1052 |
| 1419 | Ga0501310_014411 | 3300049130 | Bacteria | 928 |
| 1420 | Ga0501310_018690 | 3300049130 | Bacteria | 848 |
| 1421 | Ga0501310_023172 | 3300049130 | Bacteria | 788 |
| 1422 | Ga0501310_023895 | 3300049130 | Bacteria | 779 |
| 1423 | Ga0501310_024232 | 3300049130 | Bacteria | 776 |
| 1424 | Ga0501310_029314 | 3300049130 | Bacteria | 725 |
| 1425 | Ga0501310_029604 | 3300049130 | Bacteria | 722 |
| 1426 | Ga0501310_042297 | 3300049130 | Bacteria | 638 |
| 1427 | Ga0501310_073912 | 3300049130 | Bacteria | 526 |
| 1428 | Ga0501341_00897 | 3300049131 | Bacteria | 1384 |
| 1429 | Ga0501341_05783 | 3300049131 | Bacteria | 747 |
| 1430 | Ga0501341_07080 | 3300049131 | Bacteria | 698 |
| 1431 | Ga0501341_15080 | 3300049131 | Bacteria | 540 |
| 1432 | Ga0501343_000585 | 3300049132 | Bacteria | 2200 |
| 1433 | Ga0501343_000946 | 3300049132 | Bacteria | 1870 |
| 1434 | Ga0501343_002039 | 3300049132 | Bacteria | 1417 |
| 1435 | Ga0501343_006485 | 3300049132 | Bacteria | 912 |
| 1436 | Ga0501343_008083 | 3300049132 | Bacteria | 837 |
| 1437 | Ga0501343_011815 | 3300049132 | Bacteria | 721 |
| 1438 | Ga0501344_01065 | 3300049133 | Bacteria | 1284 |
| 1439 | Ga0501344_04650 | 3300049133 | Bacteria | 759 |
| 1440 | Ga0501344_05240 | 3300049133 | Bacteria | 728 |
| 1441 | Ga0501345_00091 | 3300049134 | Bacteria | 2211 |
| 1442 | Ga0501304_000001 | 3300049160 | Bacteria | 14569 |
| 1443 | Ga0501304_000986 | 3300049160 | Bacteria | 1703 |
| 1444 | Ga0501304_001750 | 3300049160 | Bacteria | 1434 |
| 1445 | Ga0501304_002722 | 3300049160 | Bacteria | 1249 |
| 1446 | Ga0501304_013411 | 3300049160 | Bacteria | 749 |
| 1447 | Ga0501304_023108 | 3300049160 | Bacteria | 627 |
| 1448 | Ga0501304_024999 | 3300049160 | Bacteria | 610 |
| 1449 | Ga0501305_000399 | 3300049161 | Bacteria | 3488 |
| 1450 | Ga0501305_000819 | 3300049161 | Bacteria | 2765 |
| 1451 | Ga0501305_003101 | 3300049161 | Bacteria | 1859 |
| 1452 | Ga0501305_004353 | 3300049161 | Bacteria | 1661 |
| 1453 | Ga0501305_011851 | 3300049161 | Bacteria | 1184 |
| 1454 | Ga0501305_012120 | 3300049161 | Bacteria | 1175 |
| 1455 | Ga0501305_014715 | 3300049161 | Bacteria | 1098 |
| 1456 | Ga0501305_034752 | 3300049161 | Bacteria | 800 |
| 1457 | Ga0501305_066877 | 3300049161 | Bacteria | 627 |
| 1458 | Ga0501305_082266 | 3300049161 | Bacteria | 580 |
| 1459 | Ga0501307_000313 | 3300049162 | Bacteria | 3029 |
| 1460 | Ga0501307_000583 | 3300049162 | Bacteria | 2593 |
| 1461 | Ga0501307_000963 | 3300049162 | Bacteria | 2241 |
| 1462 | Ga0501307_005419 | 3300049162 | Bacteria | 1344 |
| 1463 | Ga0501307_006878 | 3300049162 | Bacteria | 1241 |
| 1464 | Ga0501307_012923 | 3300049162 | Bacteria | 1001 |
| 1465 | Ga0501307_016299 | 3300049162 | Bacteria | 925 |
| 1466 | Ga0501307_016459 | 3300049162 | Bacteria | 922 |
| 1467 | Ga0501307_038688 | 3300049162 | Bacteria | 686 |
| 1468 | Ga0501307_051118 | 3300049162 | Bacteria | 622 |
| 1469 | Ga0501307_082101 | 3300049162 | Bacteria | 528 |
| 1470 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 1471 | Ga0495678_006909 | 3300049459 | Bacteria | 5955 |
| 1472 | Ga0495678_013870 | 3300049459 | Bacteria | 3770 |
| 1473 | Ga0495678_025294 | 3300049459 | Bacteria | 2551 |
| 1474 | Ga0495678_058347 | 3300049459 | Bacteria | 1458 |
| 1475 | Ga0495678_125922 | 3300049459 | Bacteria | 854 |
| 1476 | Ga0495682_0004602 | 3300049460 | Bacteria | 5864 |
| 1477 | Ga0495682_0039543 | 3300049460 | Bacteria | 1731 |
| 1478 | Ga0495682_0040889 | 3300049460 | Bacteria | 1699 |
| 1479 | Ga0495682_0057328 | 3300049460 | Bacteria | 1410 |
| 1480 | Ga0501291_102997 | 3300049514 | Bacteria | 598 |
| 1481 | Ga0501298_149702 | 3300049521 | Bacteria | 570 |
| 1482 | Ga0501299_056087 | 3300049522 | Bacteria | 825 |
| 1483 | Ga0501300_044609 | 3300049523 | Bacteria | 674 |
| 1484 | Ga0501301_021515 | 3300049524 | Bacteria | 624 |
| 1485 | Ga0501311_000002 | 3300049527 | Bacteria | 12093 |
| 1486 | Ga0501311_004818 | 3300049527 | Bacteria | 1453 |
| 1487 | Ga0501311_010684 | 3300049527 | Bacteria | 1118 |
| 1488 | Ga0501311_012041 | 3300049527 | Bacteria | 1073 |
| 1489 | Ga0501311_031969 | 3300049527 | Bacteria | 766 |
| 1490 | Ga0501311_053518 | 3300049527 | Bacteria | 638 |
| 1491 | Ga0501311_062752 | 3300049527 | Bacteria | 603 |
| 1492 | Ga0501312_004364 | 3300049528 | Bacteria | 1663 |
| 1493 | Ga0501312_005434 | 3300049528 | Bacteria | 1549 |
| 1494 | Ga0501312_006206 | 3300049528 | Bacteria | 1484 |
| 1495 | Ga0501312_012205 | 3300049528 | Bacteria | 1179 |
| 1496 | Ga0501312_020539 | 3300049528 | Bacteria | 978 |
| 1497 | Ga0501312_024758 | 3300049528 | Bacteria | 911 |
| 1498 | Ga0501312_024759 | 3300049528 | Bacteria | 911 |
| 1499 | Ga0501312_029738 | 3300049528 | Bacteria | 852 |
| 1500 | Ga0501312_034907 | 3300049528 | Bacteria | 803 |
| 1501 | Ga0501312_098925 | 3300049528 | Bacteria | 545 |
| 1502 | Ga0501313_000012 | 3300049529 | Bacteria | 8507 |
| 1503 | Ga0501313_000686 | 3300049529 | Bacteria | 2491 |
| 1504 | Ga0501313_001951 | 3300049529 | Bacteria | 1893 |
| 1505 | Ga0501313_007422 | 3300049529 | Bacteria | 1208 |
| 1506 | Ga0501313_022404 | 3300049529 | Bacteria | 787 |
| 1507 | Ga0501314_000622 | 3300049530 | Bacteria | 2258 |
| 1508 | Ga0501314_001267 | 3300049530 | Bacteria | 1800 |
| 1509 | Ga0501314_005240 | 3300049530 | Bacteria | 1099 |
| 1510 | Ga0501314_014323 | 3300049530 | Bacteria | 776 |
| 1511 | Ga0501314_027263 | 3300049530 | Bacteria | 621 |
| 1512 | Ga0501314_029997 | 3300049530 | Bacteria | 601 |
| 1513 | Ga0501314_043415 | 3300049530 | Bacteria | 529 |
| 1514 | Ga0501315_000004 | 3300049531 | Bacteria | 11326 |
| 1515 | Ga0501315_000082 | 3300049531 | Bacteria | 4574 |
| 1516 | Ga0501315_001820 | 3300049531 | Bacteria | 1903 |
| 1517 | Ga0501315_005197 | 3300049531 | Bacteria | 1400 |
| 1518 | Ga0501315_006843 | 3300049531 | Bacteria | 1282 |
| 1519 | Ga0501315_008816 | 3300049531 | Bacteria | 1181 |
| 1520 | Ga0501315_020164 | 3300049531 | Bacteria | 893 |
| 1521 | Ga0501315_021631 | 3300049531 | Bacteria | 872 |
| 1522 | Ga0501315_032762 | 3300049531 | Bacteria | 756 |
| 1523 | Ga0501315_061027 | 3300049531 | Bacteria | 610 |
| 1524 | Ga0501315_070785 | 3300049531 | Bacteria | 578 |
| 1525 | Ga0501315_076019 | 3300049531 | Bacteria | 564 |
| 1526 | Ga0501316_000002 | 3300049532 | Bacteria | 13278 |
| 1527 | Ga0501316_000608 | 3300049532 | Bacteria | 2595 |
| 1528 | Ga0501316_011965 | 3300049532 | Bacteria | 1008 |
| 1529 | Ga0501316_012649 | 3300049532 | Bacteria | 989 |
| 1530 | Ga0501316_013073 | 3300049532 | Bacteria | 977 |
| 1531 | Ga0501316_023380 | 3300049532 | Bacteria | 793 |
| 1532 | Ga0501316_033072 | 3300049532 | Bacteria | 699 |
| 1533 | Ga0501316_058934 | 3300049532 | Bacteria | 565 |
| 1534 | Ga0501316_064078 | 3300049532 | Bacteria | 547 |
| 1535 | Ga0501316_079238 | 3300049532 | Bacteria | 506 |
| 1536 | Ga0501317_000565 | 3300049533 | Bacteria | 2707 |
| 1537 | Ga0501317_001174 | 3300049533 | Bacteria | 2181 |
| 1538 | Ga0501317_009930 | 3300049533 | Bacteria | 1128 |
| 1539 | Ga0501317_024341 | 3300049533 | Bacteria | 842 |
| 1540 | Ga0501317_043563 | 3300049533 | Bacteria | 693 |
| 1541 | Ga0501317_045370 | 3300049533 | Bacteria | 683 |
| 1542 | Ga0501317_048067 | 3300049533 | Bacteria | 670 |
| 1543 | Ga0501317_049979 | 3300049533 | Bacteria | 662 |
| 1544 | Ga0501318_000292 | 3300049534 | Bacteria | 2919 |
| 1545 | Ga0501318_002062 | 3300049534 | Bacteria | 1690 |
| 1546 | Ga0501318_002754 | 3300049534 | Bacteria | 1556 |
| 1547 | Ga0501318_008537 | 3300049534 | Bacteria | 1097 |
| 1548 | Ga0501318_015106 | 3300049534 | Bacteria | 918 |
| 1549 | Ga0501318_088309 | 3300049534 | Bacteria | 511 |
| 1550 | Ga0501319_000071 | 3300049535 | Bacteria | 3451 |
| 1551 | Ga0501319_000080 | 3300049535 | Bacteria | 3309 |
| 1552 | Ga0501319_002073 | 3300049535 | Bacteria | 1240 |
| 1553 | Ga0501319_002652 | 3300049535 | Bacteria | 1148 |
| 1554 | Ga0501319_006814 | 3300049535 | Bacteria | 853 |
| 1555 | Ga0501319_010549 | 3300049535 | Bacteria | 736 |
| 1556 | Ga0501319_027091 | 3300049535 | Bacteria | 539 |
| 1557 | Ga0501320_000176 | 3300049536 | Bacteria | 3180 |
| 1558 | Ga0501320_000935 | 3300049536 | Bacteria | 1940 |
| 1559 | Ga0501320_003295 | 3300049536 | Bacteria | 1359 |
| 1560 | Ga0501320_004743 | 3300049536 | Bacteria | 1211 |
| 1561 | Ga0501320_005008 | 3300049536 | Bacteria | 1191 |
| 1562 | Ga0501320_006579 | 3300049536 | Bacteria | 1094 |
| 1563 | Ga0501320_007575 | 3300049536 | Bacteria | 1048 |
| 1564 | Ga0501320_010965 | 3300049536 | Bacteria | 932 |
| 1565 | Ga0501320_021334 | 3300049536 | Bacteria | 751 |
| 1566 | Ga0501320_027177 | 3300049536 | Bacteria | 695 |
| 1567 | Ga0501320_046170 | 3300049536 | Bacteria | 583 |
| 1568 | Ga0501320_055096 | 3300049536 | Bacteria | 549 |
| 1569 | Ga0501320_057117 | 3300049536 | Bacteria | 542 |
| 1570 | Ga0501320_060230 | 3300049536 | Bacteria | 533 |
| 1571 | Ga0501320_060558 | 3300049536 | Bacteria | 532 |
| 1572 | Ga0501321_001325 | 3300049537 | Bacteria | 1944 |
| 1573 | Ga0501321_001469 | 3300049537 | Bacteria | 1883 |
| 1574 | Ga0501321_003832 | 3300049537 | Bacteria | 1405 |
| 1575 | Ga0501321_010433 | 3300049537 | Bacteria | 1020 |
| 1576 | Ga0501321_012219 | 3300049537 | Bacteria | 970 |
| 1577 | Ga0501321_012554 | 3300049537 | Bacteria | 961 |
| 1578 | Ga0501321_013256 | 3300049537 | Bacteria | 945 |
| 1579 | Ga0501321_013278 | 3300049537 | Bacteria | 944 |
| 1580 | Ga0501321_020595 | 3300049537 | Bacteria | 817 |
| 1581 | Ga0501321_072790 | 3300049537 | Bacteria | 537 |
| 1582 | Ga0501322_000544 | 3300049538 | Bacteria | 1815 |
| 1583 | Ga0501322_000699 | 3300049538 | Bacteria | 1673 |
| 1584 | Ga0501322_004204 | 3300049538 | Bacteria | 960 |
| 1585 | Ga0501322_004747 | 3300049538 | Bacteria | 924 |
| 1586 | Ga0501322_007469 | 3300049538 | Bacteria | 797 |
| 1587 | Ga0501322_010011 | 3300049538 | Bacteria | 725 |
| 1588 | Ga0501322_011712 | 3300049538 | Bacteria | 690 |
| 1589 | Ga0501323_000169 | 3300049539 | Bacteria | 4034 |
| 1590 | Ga0501323_000193 | 3300049539 | Bacteria | 3915 |
| 1591 | Ga0501323_000710 | 3300049539 | Bacteria | 2614 |
| 1592 | Ga0501323_001897 | 3300049539 | Bacteria | 1945 |
| 1593 | Ga0501323_012054 | 3300049539 | Bacteria | 1052 |
| 1594 | Ga0501323_025879 | 3300049539 | Bacteria | 801 |
| 1595 | Ga0501323_029492 | 3300049539 | Bacteria | 764 |
| 1596 | Ga0501323_046603 | 3300049539 | Bacteria | 648 |
| 1597 | Ga0501323_055610 | 3300049539 | Bacteria | 609 |
| 1598 | Ga0501323_077991 | 3300049539 | Bacteria | 538 |
| 1599 | Ga0501324_000433 | 3300049540 | Bacteria | 2229 |
| 1600 | Ga0501324_004674 | 3300049540 | Bacteria | 1098 |
| 1601 | Ga0501324_005894 | 3300049540 | Bacteria | 1017 |
| 1602 | Ga0501324_010339 | 3300049540 | Bacteria | 849 |
| 1603 | Ga0501324_010831 | 3300049540 | Bacteria | 836 |
| 1604 | Ga0501324_014280 | 3300049540 | Bacteria | 760 |
| 1605 | Ga0501324_016549 | 3300049540 | Bacteria | 724 |
| 1606 | Ga0501324_019768 | 3300049540 | Bacteria | 682 |
| 1607 | Ga0501324_040499 | 3300049540 | Bacteria | 531 |
| 1608 | Ga0501324_042627 | 3300049540 | Bacteria | 522 |
| 1609 | Ga0501325_004347 | 3300049541 | Bacteria | 1080 |
| 1610 | Ga0501325_015283 | 3300049541 | Bacteria | 756 |
| 1611 | Ga0501325_017804 | 3300049541 | Bacteria | 723 |
| 1612 | Ga0501325_020463 | 3300049541 | Bacteria | 694 |
| 1613 | Ga0501325_034826 | 3300049541 | Bacteria | 592 |
| 1614 | Ga0501326_00189 | 3300049542 | Bacteria | 2215 |
| 1615 | Ga0501326_00267 | 3300049542 | Bacteria | 1941 |
| 1616 | Ga0501326_11809 | 3300049542 | Bacteria | 533 |
| 1617 | Ga0501327_00604 | 3300049543 | Bacteria | 1513 |
| 1618 | Ga0501327_02933 | 3300049543 | Bacteria | 912 |
| 1619 | Ga0501327_09272 | 3300049543 | Bacteria | 636 |
| 1620 | Ga0501328_00400 | 3300049544 | Bacteria | 1431 |
| 1621 | Ga0501328_09994 | 3300049544 | Bacteria | 532 |
| 1622 | Ga0501329_02712 | 3300049545 | Bacteria | 865 |
| 1623 | Ga0501329_05630 | 3300049545 | Bacteria | 698 |
| 1624 | Ga0501329_13596 | 3300049545 | Bacteria | 537 |
| 1625 | Ga0501330_002006 | 3300049546 | Bacteria | 1120 |
| 1626 | Ga0501330_006947 | 3300049546 | Bacteria | 751 |
| 1627 | Ga0501330_015962 | 3300049546 | Bacteria | 574 |
| 1628 | Ga0501332_10413 | 3300049548 | Bacteria | 622 |
| 1629 | Ga0501332_14445 | 3300049548 | Bacteria | 556 |
| 1630 | Ga0501333_011666 | 3300049549 | Bacteria | 637 |
| 1631 | Ga0501333_015352 | 3300049549 | Bacteria | 580 |
| 1632 | Ga0501334_01394 | 3300049550 | Bacteria | 1329 |
| 1633 | Ga0501334_05682 | 3300049550 | Bacteria | 827 |
| 1634 | Ga0501334_07543 | 3300049550 | Bacteria | 751 |
| 1635 | Ga0501334_12104 | 3300049550 | Bacteria | 638 |
| 1636 | Ga0501335_000409 | 3300049551 | Bacteria | 2685 |
| 1637 | Ga0501335_016359 | 3300049551 | Bacteria | 764 |
| 1638 | Ga0501335_023262 | 3300049551 | Bacteria | 672 |
| 1639 | Ga0501335_023611 | 3300049551 | Bacteria | 668 |
| 1640 | Ga0501335_025828 | 3300049551 | Bacteria | 646 |
| 1641 | Ga0501335_029274 | 3300049551 | Bacteria | 617 |
| 1642 | Ga0501335_032355 | 3300049551 | Bacteria | 595 |
| 1643 | Ga0501336_000167 | 3300049552 | Bacteria | 2751 |
| 1644 | Ga0501336_001363 | 3300049552 | Bacteria | 1443 |
| 1645 | Ga0501337_003001 | 3300049553 | Bacteria | 1058 |
| 1646 | Ga0501337_005538 | 3300049553 | Bacteria | 848 |
| 1647 | Ga0501337_006521 | 3300049553 | Bacteria | 798 |
| 1648 | Ga0501337_010797 | 3300049553 | Bacteria | 669 |
| 1649 | Ga0501337_010948 | 3300049553 | Bacteria | 667 |
| 1650 | Ga0501337_014108 | 3300049553 | Bacteria | 608 |
| 1651 | Ga0501337_015299 | 3300049553 | Bacteria | 592 |
| 1652 | Ga0501338_00312 | 3300049554 | Bacteria | 2096 |
| 1653 | Ga0501338_10404 | 3300049554 | Bacteria | 626 |
| 1654 | Ga0501339_00948 | 3300049555 | Bacteria | 676 |
| 1655 | Ga0501340_001367 | 3300049556 | Bacteria | 1307 |
| 1656 | Ga0501340_002758 | 3300049556 | Bacteria | 1029 |
| 1657 | Ga0501340_007553 | 3300049556 | Bacteria | 752 |
| 1658 | Ga0501340_014173 | 3300049556 | Bacteria | 620 |
| 1659 | Ga0501031_0477807 | 3300049568 | Bacteria | 804 |
| 1660 | Ga0501031_0565482 | 3300049568 | Bacteria | 732 |
| 1661 | Ga0501032_0005689 | 3300049569 | Bacteria | 9231 |
| 1662 | Ga0501033_0001803 | 3300049570 | Bacteria | 18695 |
| 1663 | Ga0501033_0706795 | 3300049570 | Bacteria | 685 |
| 1664 | Ga0501034_0029030 | 3300049571 | Bacteria | 5623 |
| 1665 | Ga0501036_0011113 | 3300049572 | Bacteria | 7445 |
| 1666 | Ga0501037_0029069 | 3300049573 | Bacteria | 4082 |
| 1667 | Ga0501037_0046758 | 3300049573 | Bacteria | 3173 |
| 1668 | Ga0501038_0004562 | 3300049574 | Bacteria | 12890 |
| 1669 | Ga0501038_0286054 | 3300049574 | Bacteria | 1297 |
| 1670 | Ga0501038_0434049 | 3300049574 | Bacteria | 1012 |
| 1671 | Ga0501039_0138984 | 3300049575 | Bacteria | 1908 |
| 1672 | Ga0501043_0011146 | 3300049579 | Bacteria | 7040 |
| 1673 | Ga0501043_0093617 | 3300049579 | Bacteria | 2362 |
| 1674 | Ga0501043_0197840 | 3300049579 | Bacteria | 1561 |
| 1675 | Ga0501046_0007619 | 3300049580 | Bacteria | 9496 |
| 1676 | Ga0501047_0089170 | 3300049581 | Bacteria | 2961 |
| 1677 | Ga0501047_0708154 | 3300049581 | Bacteria | 824 |
| 1678 | Ga0501047_1156958 | 3300049581 | Bacteria | 587 |
| 1679 | Ga0501048_0432662 | 3300049582 | Bacteria | 942 |
| 1680 | Ga0501199_038701 | 3300049650 | Bacteria | 612 |
| 1681 | Ga0501202_039928 | 3300049652 | Bacteria | 1010 |
| 1682 | Ga0501207_084022 | 3300049654 | Bacteria | 617 |
| 1683 | Ga0501211_021197 | 3300049658 | Bacteria | 684 |
| 1684 | Ga0501222_036527 | 3300049662 | Bacteria | 687 |
| 1685 | Ga0501227_015572 | 3300049665 | Bacteria | 1699 |
| 1686 | Ga0501230_001749 | 3300049667 | Bacteria | 2651 |
| 1687 | Ga0501233_025241 | 3300049668 | Bacteria | 1305 |
| 1688 | Ga0501235_104667 | 3300049669 | Bacteria | 694 |
| 1689 | Ga0501238_000213 | 3300049671 | Bacteria | 8393 |
| 1690 | Ga0501238_011742 | 3300049671 | Bacteria | 1180 |
| 1691 | Ga0501246_003814 | 3300049676 | Bacteria | 1227 |
| 1692 | Ga0501249_216847 | 3300049679 | Bacteria | 508 |
| 1693 | Ga0501221_006424 | 3300049704 | Bacteria | 1988 |
| 1694 | Ga0501229_003004 | 3300049706 | Bacteria | 2006 |
| 1695 | Ga0501234_034107 | 3300049707 | Bacteria | 825 |
| 1696 | Ga0501241_033343 | 3300049758 | Bacteria | 978 |
| 1697 | Ga0501262_000574 | 3300049759 | Bacteria | 4379 |
| 1698 | Ga0501263_012109 | 3300049760 | Bacteria | 1079 |
| 1699 | Ga0501265_002083 | 3300049762 | Bacteria | 2280 |
| 1700 | Ga0501268_046021 | 3300049765 | Bacteria | 833 |
| 1701 | Ga0501269_000003 | 3300049766 | Bacteria | 111299 |
| 1702 | Ga0501269_002814 | 3300049766 | Bacteria | 2120 |
| 1703 | Ga0501276_018743 | 3300049773 | Bacteria | 647 |
| 1704 | Ga0501279_000683 | 3300049775 | Bacteria | 4449 |
| 1705 | Ga0501279_008680 | 3300049775 | Bacteria | 1358 |
| 1706 | Ga0501035_0007388 | 3300049822 | Bacteria | 10272 |
| 1707 | Ga0501035_0010452 | 3300049822 | Bacteria | 8602 |
| 1708 | Ga0501035_0010523 | 3300049822 | Bacteria | 8572 |
| 1709 | Ga0501035_0084650 | 3300049822 | Bacteria | 2796 |
| 1710 | Ga0501035_1312417 | 3300049822 | Bacteria | 557 |
| 1711 | Ga0501035_1376759 | 3300049822 | Bacteria | 541 |
| 1712 | Ga0501035_1550089 | 3300049822 | Bacteria | 504 |
| 1713 | Ga0501044_0000210 | 3300049823 | Bacteria | 74323 |
| 1714 | Ga0501044_0007653 | 3300049823 | Bacteria | 11876 |
| 1715 | Ga0501044_0025863 | 3300049823 | Bacteria | 6221 |
| 1716 | Ga0501044_0241667 | 3300049823 | Bacteria | 1749 |
| 1717 | Ga0501226_040218 | 3300049853 | Bacteria | 537 |
| 1718 | nmdc:mga03683_192040_c1 | 3300050489 | Bacteria | 935 |
| 1719 | nmdc:mga03683_22136_c1 | 3300050489 | Bacteria | 2461 |
| 1720 | nmdc:mga03n38_4851_c1 | 3300050490 | Bacteria | 4507 |
| 1721 | nmdc:mga03n38_59764_c1 | 3300050490 | Bacteria | 1731 |
| 1722 | nmdc:mga00v17_25609_c1 | 3300050491 | Bacteria | 3430 |
| 1723 | nmdc:mga00v17_630988_c1 | 3300050491 | Bacteria | 690 |
| 1724 | nmdc:mga0yw44_371288_c1 | 3300050492 | Bacteria | 965 |
| 1725 | nmdc:mga0k408_52239_c1 | 3300050493 | Bacteria | 2369 |
| 1726 | nmdc:mga0k408_679800_c1 | 3300050493 | Bacteria | 604 |
| 1727 | nmdc:mga0k408_712_c1 | 3300050493 | Bacteria | 18213 |
| 1728 | nmdc:mga06z11_3023_c1 | 3300050494 | Bacteria | 6473 |
| 1729 | nmdc:mga04h51_47659_c1 | 3300050495 | Bacteria | 1425 |
| 1730 | nmdc:mga07m45_348122_c1 | 3300050496 | Bacteria | 861 |
| 1731 | nmdc:mga07m45_67895_c1 | 3300050496 | Bacteria | 2027 |
| 1732 | nmdc:mga07m45_691362_c1 | 3300050496 | Bacteria | 587 |
| 1733 | nmdc:mga06r32_1149912_c1 | 3300050510 | Bacteria | 724 |
| 1734 | nmdc:mga0n895_1079125_c1 | 3300050512 | Bacteria | 781 |
| 1735 | nmdc:mga0rr50_1578394_c1 | 3300050513 | Bacteria | 554 |
| 1736 | nmdc:mga0a205_104296_c1 | 3300050515 | Bacteria | 2734 |
| 1737 | nmdc:mga0sz30_3989_c1 | 3300050516 | Bacteria | 5314 |
| 1738 | Ga0495601_0117248 | 3300053077 | Bacteria | 1727 |
| 1739 | Ga0495619_0772700 | 3300053085 | Bacteria | 651 |
| 1740 | Ga0500578_0003978 | 3300053086 | Bacteria | 10700 |
| 1741 | Ga0500643_134293 | 3300053087 | Bacteria | 665 |
| 1742 | Ga0500646_0011171 | 3300053090 | Bacteria | 2306 |
| 1743 | Ga0500651_0000274 | 3300053093 | Bacteria | 30518 |
| 1744 | Ga0500650_0072451 | 3300053098 | Bacteria | 1610 |
| 1745 | Ga0500556_0257267 | 3300053104 | Bacteria | 687 |
| 1746 | Ga0500562_016703 | 3300053108 | Bacteria | 1888 |
| 1747 | Ga0500562_151087 | 3300053108 | Bacteria | 632 |
| 1748 | Ga0500569_001743 | 3300053109 | Bacteria | 4166 |
| 1749 | Ga0500572_221041 | 3300053111 | Bacteria | 619 |
| 1750 | Ga0500593_257026 | 3300053117 | Bacteria | 587 |
| 1751 | Ga0500594_0063615 | 3300053118 | Bacteria | 1069 |
| 1752 | Ga0500594_0086002 | 3300053118 | Bacteria | 947 |
| 1753 | Ga0500595_008416 | 3300053119 | Bacteria | 4214 |
| 1754 | Ga0500618_002645 | 3300053125 | Bacteria | 6592 |
| 1755 | Ga0500621_177758 | 3300053126 | Bacteria | 774 |
| 1756 | Ga0500628_048117 | 3300053129 | Bacteria | 1001 |
| 1757 | Ga0500642_0002530 | 3300053130 | Bacteria | 5383 |
| 1758 | Ga0500652_000400 | 3300053131 | Bacteria | 15538 |
| 1759 | Ga0500655_119690 | 3300053133 | Bacteria | 558 |
| 1760 | Ga0500561_0020973 | 3300053137 | Bacteria | 1534 |
| 1761 | Ga0500561_0067768 | 3300053137 | Bacteria | 1014 |
| 1762 | Ga0500568_0013644 | 3300053139 | Bacteria | 3696 |
| 1763 | Ga0500573_0295304 | 3300053140 | Bacteria | 813 |
| 1764 | Ga0500574_000403 | 3300053141 | Bacteria | 5436 |
| 1765 | Ga0500574_028175 | 3300053141 | Bacteria | 1488 |
| 1766 | Ga0500577_0006134 | 3300053142 | Bacteria | 3292 |
| 1767 | Ga0500577_0202515 | 3300053142 | Bacteria | 857 |
| 1768 | Ga0500586_006873 | 3300053145 | Bacteria | 2993 |
| 1769 | Ga0500586_053986 | 3300053145 | Bacteria | 1389 |
| 1770 | Ga0500588_0219596 | 3300053146 | Bacteria | 708 |
| 1771 | Ga0500604_0033502 | 3300053151 | Bacteria | 1519 |
| 1772 | Ga0500616_0028067 | 3300053153 | Bacteria | 3105 |
| 1773 | Ga0500619_089331 | 3300053154 | Bacteria | 1040 |
| 1774 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 1775 | Ga0500624_004964 | 3300053157 | Bacteria | 1761 |
| 1776 | Ga0500627_0121237 | 3300053158 | Bacteria | 1180 |
| 1777 | Ga0500627_0246273 | 3300053158 | Bacteria | 792 |
| 1778 | Ga0500634_0000642 | 3300053161 | Bacteria | 11826 |
| 1779 | Ga0500636_0464995 | 3300053177 | Bacteria | 568 |
| 1780 | Ga0500637_0321398 | 3300053178 | Bacteria | 836 |
| 1781 | Ga0500552_082609 | 3300053733 | Bacteria | 591 |
| 1782 | Ga0500661_099610 | 3300055283 | Bacteria | 550 |
| 1783 | Ga0587084_000213 | 3300059477 | Bacteria | 3885 |
| 1784 | Ga0587084_000401 | 3300059477 | Bacteria | 3315 |
| 1785 | Ga0587084_025419 | 3300059477 | Bacteria | 918 |
| 1786 | Ga0587084_035365 | 3300059477 | Bacteria | 825 |
| 1787 | Ga0587084_043931 | 3300059477 | Bacteria | 769 |
| 1788 | Ga0587093_000380 | 3300059478 | Bacteria | 2980 |
| 1789 | Ga0587093_001062 | 3300059478 | Bacteria | 2196 |
| 1790 | Ga0587093_052406 | 3300059478 | Bacteria | 647 |
| 1791 | Ga0587093_060912 | 3300059478 | Bacteria | 616 |
| 1792 | Ga0587093_092837 | 3300059478 | Bacteria | 536 |
| 1793 | Ga0587066_000001 | 3300059490 | Bacteria | 11779 |
| 1794 | Ga0587066_001525 | 3300059490 | Bacteria | 2348 |
| 1795 | Ga0587066_073625 | 3300059490 | Bacteria | 725 |
| 1796 | Ga0587070_004333 | 3300059491 | Bacteria | 1783 |
| 1797 | Ga0587070_030492 | 3300059491 | Bacteria | 974 |
| 1798 | Ga0587070_116654 | 3300059491 | Bacteria | 633 |
| 1799 | Ga0587073_0000035 | 3300059492 | Bacteria | 7203 |
| 1800 | Ga0587073_0122107 | 3300059492 | Bacteria | 705 |
| 1801 | Ga0587077_000648 | 3300059493 | Bacteria | 3182 |
| 1802 | Ga0587077_007748 | 3300059493 | Bacteria | 1576 |
| 1803 | Ga0587077_118437 | 3300059493 | Bacteria | 658 |
| 1804 | Ga0587077_154127 | 3300059493 | Bacteria | 603 |
| 1805 | Ga0587080_000038 | 3300059503 | Bacteria | 6744 |
| 1806 | Ga0587080_012184 | 3300059503 | Bacteria | 1296 |
| 1807 | Ga0587080_018572 | 3300059503 | Bacteria | 1118 |
| 1808 | Ga0587080_021806 | 3300059503 | Bacteria | 1056 |
| 1809 | Ga0587082_000027 | 3300059504 | Bacteria | 6899 |
| 1810 | Ga0587082_008647 | 3300059504 | Bacteria | 1425 |
| 1811 | Ga0587082_016254 | 3300059504 | Bacteria | 1159 |
| 1812 | Ga0587082_050421 | 3300059504 | Bacteria | 792 |
| 1813 | Ga0587083_0000039 | 3300059505 | Bacteria | 6410 |
| 1814 | Ga0587083_0000305 | 3300059505 | Bacteria | 3960 |
| 1815 | Ga0587083_0010072 | 3300059505 | Bacteria | 1523 |
| 1816 | Ga0587083_0031320 | 3300059505 | Bacteria | 1060 |
| 1817 | Ga0587083_0055289 | 3300059505 | Bacteria | 878 |
| 1818 | Ga0587085_002630 | 3300059506 | Bacteria | 1853 |
| 1819 | Ga0587085_002980 | 3300059506 | Bacteria | 1792 |
| 1820 | Ga0587085_007329 | 3300059506 | Bacteria | 1373 |
| 1821 | Ga0587085_057021 | 3300059506 | Bacteria | 728 |
| 1822 | Ga0587086_000453 | 3300059507 | Bacteria | 2936 |
| 1823 | Ga0587086_000753 | 3300059507 | Bacteria | 2555 |
| 1824 | Ga0587088_000001 | 3300059508 | Bacteria | 14678 |
| 1825 | Ga0587088_001117 | 3300059508 | Bacteria | 2664 |
| 1826 | Ga0587088_169938 | 3300059508 | Bacteria | 540 |
| 1827 | Ga0587089_000565 | 3300059509 | Bacteria | 2935 |
| 1828 | Ga0587089_001052 | 3300059509 | Bacteria | 2434 |
| 1829 | Ga0587090_001908 | 3300059510 | Bacteria | 2200 |
| 1830 | Ga0587090_003259 | 3300059510 | Bacteria | 1872 |
| 1831 | Ga0587090_011821 | 3300059510 | Bacteria | 1234 |
| 1832 | Ga0587090_018838 | 3300059510 | Bacteria | 1059 |
| 1833 | Ga0587091_002949 | 3300059511 | Bacteria | 2086 |
| 1834 | Ga0587091_007570 | 3300059511 | Bacteria | 1572 |
| 1835 | Ga0587091_010932 | 3300059511 | Bacteria | 1403 |
| 1836 | Ga0587092_000969 | 3300059512 | Bacteria | 2624 |
| 1837 | Ga0587092_003731 | 3300059512 | Bacteria | 1756 |
| 1838 | Ga0587092_009204 | 3300059512 | Bacteria | 1323 |
| 1839 | Ga0587092_069447 | 3300059512 | Bacteria | 675 |
| 1840 | Ga0587092_159481 | 3300059512 | Bacteria | 509 |
| 1841 | Ga0587094_008925 | 3300059513 | Bacteria | 1267 |
| 1842 | Ga0587094_012910 | 3300059513 | Bacteria | 1122 |
| 1843 | Ga0587095_002116 | 3300059514 | Bacteria | 1307 |
| 1844 | Ga0587095_009187 | 3300059514 | Bacteria | 814 |
| 1845 | Ga0587097_02013 | 3300059603 | Bacteria | 785 |
| 1846 | Ga0587098_012861 | 3300059604 | Bacteria | 964 |
| 1847 | Ga0587106_000122 | 3300059605 | Bacteria | 3963 |
| 1848 | Ga0587106_001550 | 3300059605 | Bacteria | 2066 |
| 1849 | Ga0587106_017006 | 3300059605 | Bacteria | 1035 |
| 1850 | Ga0587121_00999 | 3300059606 | Bacteria | 1339 |
| 1851 | Ga0587121_05107 | 3300059606 | Bacteria | 753 |
| 1852 | Ga0587125_002765 | 3300059607 | Bacteria | 1439 |
| 1853 | Ga0587125_012182 | 3300059607 | Bacteria | 914 |
| 1854 | Ga0587125_017429 | 3300059607 | Bacteria | 816 |
| 1855 | Ga0587125_036413 | 3300059607 | Bacteria | 649 |
| 1856 | Ga0587125_057661 | 3300059607 | Bacteria | 561 |
| 1857 | Ga0587129_000136 | 3300059608 | Bacteria | 2634 |
| 1858 | Ga0587129_014311 | 3300059608 | Bacteria | 652 |
| 1859 | Ga0587131_001141 | 3300059609 | Bacteria | 1253 |
| 1860 | Ga0587131_015980 | 3300059609 | Bacteria | 584 |
| 1861 | Ga0587099_000239 | 3300059622 | Bacteria | 2770 |
| 1862 | Ga0587099_001284 | 3300059622 | Bacteria | 1763 |
| 1863 | Ga0587101_000023 | 3300059623 | Bacteria | 7377 |
| 1864 | Ga0587101_002644 | 3300059623 | Bacteria | 1735 |
| 1865 | Ga0587101_092996 | 3300059623 | Bacteria | 589 |
| 1866 | Ga0587109_004786 | 3300059624 | Bacteria | 1904 |
| 1867 | Ga0587109_012058 | 3300059624 | Bacteria | 1409 |
| 1868 | Ga0587109_013863 | 3300059624 | Bacteria | 1344 |
| 1869 | Ga0587109_191445 | 3300059624 | Bacteria | 528 |
| 1870 | Ga0587113_000311 | 3300059625 | Bacteria | 2411 |
| 1871 | Ga0587113_006187 | 3300059625 | Bacteria | 1010 |
| 1872 | Ga0587113_018749 | 3300059625 | Bacteria | 712 |
| 1873 | Ga0587115_002966 | 3300059626 | Bacteria | 1742 |
| 1874 | Ga0587115_004133 | 3300059626 | Bacteria | 1571 |
| 1875 | Ga0587117_000748 | 3300059627 | Bacteria | 2418 |
| 1876 | Ga0587117_000981 | 3300059627 | Bacteria | 2248 |
| 1877 | Ga0587117_044136 | 3300059627 | Bacteria | 720 |
| 1878 | Ga0587122_014627 | 3300059628 | Bacteria | 793 |
| 1879 | Ga0587127_001579 | 3300059629 | Bacteria | 1297 |
| 1880 | Ga0587127_004190 | 3300059629 | Bacteria | 949 |
| 1881 | Ga0587128_001779 | 3300059630 | Bacteria | 2115 |
| 1882 | Ga0587128_002699 | 3300059630 | Bacteria | 1880 |
| 1883 | Ga0587130_003257 | 3300059631 | Bacteria | 1361 |
| 1884 | Ga0587130_014083 | 3300059631 | Bacteria | 814 |
| 1885 | Ga0587062_000153 | 3300059639 | Bacteria | 3794 |
| 1886 | Ga0587062_000195 | 3300059639 | Bacteria | 3564 |
| 1887 | Ga0587062_006619 | 3300059639 | Bacteria | 1324 |
| 1888 | Ga0587062_013939 | 3300059639 | Bacteria | 1054 |
| 1889 | Ga0587062_022912 | 3300059639 | Bacteria | 900 |
| 1890 | Ga0587062_112775 | 3300059639 | Bacteria | 542 |
| 1891 | Ga0587067_000932 | 3300059640 | Bacteria | 2934 |
| 1892 | Ga0587068_000002 | 3300059641 | Bacteria | 13671 |
| 1893 | Ga0587068_000350 | 3300059641 | Bacteria | 3976 |
| 1894 | Ga0587068_001305 | 3300059641 | Bacteria | 2742 |
| 1895 | Ga0587068_039055 | 3300059641 | Bacteria | 853 |
| 1896 | Ga0587068_101698 | 3300059641 | Bacteria | 604 |
| 1897 | Ga0587069_000016 | 3300059642 | Bacteria | 8774 |
| 1898 | Ga0587069_001975 | 3300059642 | Bacteria | 2000 |
| 1899 | Ga0587069_012065 | 3300059642 | Bacteria | 1165 |
| 1900 | Ga0587072_000243 | 3300059643 | Bacteria | 4970 |
| 1901 | Ga0587072_005559 | 3300059643 | Bacteria | 1887 |
| 1902 | Ga0587072_005813 | 3300059643 | Bacteria | 1855 |
| 1903 | Ga0587075_000415 | 3300059644 | Bacteria | 3323 |
| 1904 | Ga0587075_013252 | 3300059644 | Bacteria | 1131 |
| 1905 | Ga0587075_058867 | 3300059644 | Bacteria | 688 |
| 1906 | Ga0587076_002771 | 3300059645 | Bacteria | 2007 |
| 1907 | Ga0587076_002988 | 3300059645 | Bacteria | 1964 |
| 1908 | Ga0587076_014419 | 3300059645 | Bacteria | 1216 |
| 1909 | Ga0587076_021100 | 3300059645 | Bacteria | 1076 |
| 1910 | Ga0587076_106658 | 3300059645 | Bacteria | 632 |
| 1911 | Ga0587078_000244 | 3300059646 | Bacteria | 3622 |
| 1912 | Ga0587078_012895 | 3300059646 | Bacteria | 984 |
| 1913 | Ga0587078_037889 | 3300059646 | Bacteria | 672 |
| 1914 | Ga0587079_000033 | 3300059647 | Bacteria | 7318 |
| 1915 | Ga0587079_000584 | 3300059647 | Bacteria | 3398 |
| 1916 | Ga0587079_006516 | 3300059647 | Bacteria | 1705 |
| 1917 | Ga0587079_012865 | 3300059647 | Bacteria | 1376 |
| 1918 | Ga0587079_092121 | 3300059647 | Bacteria | 711 |
| 1919 | Ga0587100_000902 | 3300059648 | Bacteria | 1596 |
| 1920 | Ga0587102_000132 | 3300059649 | Bacteria | 3370 |
| 1921 | Ga0587102_001309 | 3300059649 | Bacteria | 1715 |
| 1922 | Ga0587102_001768 | 3300059649 | Bacteria | 1578 |
| 1923 | Ga0587102_019367 | 3300059649 | Bacteria | 756 |
| 1924 | Ga0587104_000049 | 3300059650 | Bacteria | 3143 |
| 1925 | Ga0587104_021262 | 3300059650 | Bacteria | 542 |
| 1926 | Ga0587105_000034 | 3300059651 | Bacteria | 3456 |
| 1927 | Ga0587105_000662 | 3300059651 | Bacteria | 1530 |
| 1928 | Ga0587107_000182 | 3300059652 | Bacteria | 3468 |
| 1929 | Ga0587107_007809 | 3300059652 | Bacteria | 1216 |
| 1930 | Ga0587107_021182 | 3300059652 | Bacteria | 909 |
| 1931 | Ga0587107_108298 | 3300059652 | Bacteria | 559 |
| 1932 | Ga0587108_000210 | 3300059653 | Bacteria | 2694 |
| 1933 | Ga0587108_002115 | 3300059653 | Bacteria | 1301 |
| 1934 | Ga0587110_002612 | 3300059654 | Bacteria | 1444 |
| 1935 | Ga0587110_011354 | 3300059654 | Bacteria | 903 |
| 1936 | Ga0587114_000232 | 3300059655 | Bacteria | 3283 |
| 1937 | Ga0587114_003206 | 3300059655 | Bacteria | 1606 |
| 1938 | Ga0587116_00707 | 3300059656 | Bacteria | 1420 |
| 1939 | Ga0587116_08269 | 3300059656 | Bacteria | 671 |
| 1940 | Ga0587118_00408 | 3300059657 | Bacteria | 2109 |
| 1941 | Ga0587118_10377 | 3300059657 | Bacteria | 709 |
| 1942 | Ga0587119_002359 | 3300059658 | Bacteria | 1690 |
| 1943 | Ga0587119_003321 | 3300059658 | Bacteria | 1522 |
| 1944 | Ga0587120_001451 | 3300059659 | Bacteria | 1481 |
| 1945 | Ga0587120_002256 | 3300059659 | Bacteria | 1296 |
| 1946 | Ga0587120_024873 | 3300059659 | Bacteria | 588 |
| 1947 | Ga0587124_000978 | 3300059660 | Bacteria | 1755 |
| 1948 | Ga0587124_007578 | 3300059660 | Bacteria | 916 |
| 1949 | Ga0587124_017743 | 3300059660 | Bacteria | 704 |
| 1950 | Ga0587060_002032 | 3300060243 | Bacteria | 1388 |
| 1951 | Ga0587060_006033 | 3300060243 | Bacteria | 957 |
| 1952 | Ga0587065_01425 | 3300060245 | Bacteria | 1196 |
| 1953 | Ga0587081_02283 | 3300060246 | Bacteria | 1155 |
| 1954 | Ga0587096_00164 | 3300060247 | Bacteria | 1457 |
| 1955 | Ga0587096_02023 | 3300060247 | Bacteria | 738 |
| 1956 | Ga0587071_001255 | 3300060344 | Bacteria | 3088 |
| 1957 | Ga0587071_001373 | 3300060344 | Bacteria | 3016 |
| 1958 | Ga0587071_005333 | 3300060344 | Bacteria | 1962 |
| 1959 | Ga0587071_007249 | 3300060344 | Bacteria | 1762 |
| 1960 | Ga0587071_033378 | 3300060344 | Bacteria | 1002 |
| 1961 | Ga0587111_0000116 | 3300060346 | Bacteria | 5398 |
| 1962 | Ga0587111_0000229 | 3300060346 | Bacteria | 4601 |
| 1963 | Ga0587111_0000781 | 3300060346 | Bacteria | 3362 |
| 1964 | Ga0587111_0007805 | 3300060346 | Bacteria | 1752 |
| 1965 | Ga0587111_0009542 | 3300060346 | Bacteria | 1640 |
| 1966 | Ga0587111_0020018 | 3300060346 | Bacteria | 1276 |
| 1967 | Ga0587111_0021839 | 3300060346 | Bacteria | 1238 |
| 1968 | Ga0587111_0027306 | 3300060346 | Bacteria | 1143 |
| 1969 | Ga0587111_0037879 | 3300060346 | Bacteria | 1016 |
| 1970 | Ga0587111_0044090 | 3300060346 | Bacteria | 962 |
| 1971 | Ga0587111_0092093 | 3300060346 | Bacteria | 742 |
| 1972 | Ga0587111_0130804 | 3300060346 | Bacteria | 656 |
| 1973 | Ga0466962_0041637 | 3300061719 | Bacteria | 2197 |
| 1974 | Ga0466962_0081191 | 3300061719 | Bacteria | 1551 |
| 1975 | 2587725925 | 2585428057 | Bacteria | 6737412 |
| 1976 | 2587735576 | 2585428058 | Bacteria | 6853932 |
| 1977 | 2588292862 | 2588253510 | Bacteria | 6901809 |
| 1978 | 2643967971 | 2643221592 | Bacteria | 6608788 |
| 1979 | 2644143129 | 2643221625 | Bacteria | 6512927 |
| 1980 | 2644271783 | 2643221648 | Bacteria | 6521465 |
| 1981 | Ga0501306_050997 | |||
| 1982 | JGI24737J22298_10004492 | |||
| 1983 | JGI25154J39366_1001042 | |||
| 1984 | JGI25158J39367_1000542 | |||
| 1985 | JGI25157J39369_1015755 | |||
| 1986 | JGI25164J39214_1003736 | |||
| 1987 | JGI25152J39213_1001073 | |||
| 1988 | JGI25150J39212_1001923 | |||
| 1989 | JGI25150J39212_1003907 | |||
| 1990 | JGI25150J39212_1011120 | |||
| 1991 | JGI25150J39212_1030565 | |||
| 1992 | Ga0006769J43182_103907 | |||
| 1993 | Ga0006764J43180_105416 | |||
| 1994 | Ga0006761J43178_105065 | |||
| 1995 | Ga0006767J43181_105098 | |||
| 1996 | Ga0006767J43181_109868 | |||
| 1997 | Ga0006763J43179_104166 | |||
| 1998 | Ga0006762J43184_104373 | |||
| 1999 | JGI25159J45721_1016429 | |||
| 2000 | JGI25159J45721_1022081 | |||
| 2001 | JGI25159J45721_1043703 | |||
| 2002 | Ga0006774J45829_10836 | |||
| 2003 | Ga0006760J45825_101715 | |||
| 2004 | Ga0006760J45825_103029 | |||
| 2005 | Ga0006771J45828_104476 | |||
| 2006 | Ga0006779J45831_104820 | |||
| 2007 | Ga0006765J45826_105454 | |||
| 2008 | Ga0006765J45826_116824 | |||
| 2009 | Ga0006778J45830_1013714 | |||
| 2010 | Ga0006778J45830_1030895 | |||
| 2011 | Ga0006778J45830_1104448 | |||
| 2012 | Ga0006759J45824_1006644 | |||
| 2013 | Ga0006759J45824_1006645 | |||
| 2014 | Ga0006759J45824_1010973 | |||
| 2015 | Ga0006759J45824_1011122 | |||
| 2016 | Ga0006759J45824_1019946 | |||
| 2017 | Ga0006759J45824_1026362 | |||
| 2018 | Ga0006759J45824_1037247 | |||
| 2019 | Ga0006759J45824_1057424 | |||
| 2020 | Ga0006759J45824_1062806 | |||
| 2021 | JGI25151J46595_10026799 | |||
| 2022 | JGI25165J46597_1000239 | |||
| 2023 | JGI25153J46596_10002258 | |||
| 2024 | JGI25153J46596_10007740 | |||
| 2025 | JGI25153J46596_10024369 | |||
| 2026 | Ga0007428J48920_101526 | |||
| 2027 | Ga0007421J48921_104512 | |||
| 2028 | Ga0006758J48902_1003545 | |||
| 2029 | Ga0006758J48902_1003546 | |||
| 2030 | Ga0006758J48902_1008804 | |||
| 2031 | Ga0006758J48902_1008911 | |||
| 2032 | Ga0006758J48902_1015271 | |||
| 2033 | Ga0006758J48902_1015967 | |||
| 2034 | Ga0006758J48902_1016024 | |||
| 2035 | Ga0006758J48902_1016608 | |||
| 2036 | Ga0006758J48902_1016798 | |||
| 2037 | Ga0006758J48902_1029777 | |||
| 2038 | Ga0006770J48903_1010652 | |||
| 2039 | Ga0006770J48903_1021042 | |||
| 2040 | Ga0006770J48903_1024757 | |||
| 2041 | Ga0006770J48903_1030572 | |||
| 2042 | Ga0006770J48903_1033615 | |||
| 2043 | Ga0006770J48903_1040316 | |||
| 2044 | Ga0006777J48905_1009816 | |||
| 2045 | Ga0006777J48905_1042888 | |||
| 2046 | Ga0006777J48905_1043988 | |||
| 2047 | Ga0006777J48905_1047191 | |||
| 2048 | rootL2_10028224 | |||
| 2049 | JGI25160J50197_1001051 | |||
| 2050 | JGI25161J50226_1008067 | |||
| 2051 | Ga0007417J51691_1002612 | |||
| 2052 | Ga0007417J51691_1007850 | |||
| 2053 | Ga0007417J51691_1011781 | |||
| 2054 | Ga0007417J51691_1014485 | |||
| 2055 | Ga0007417J51691_1022403 | |||
| 2056 | Ga0007417J51691_1024669 | |||
| 2057 | Ga0007427J51700_104411 | |||
| 2058 | Ga0007427J51700_113492 | |||
| 2059 | Ga0007427J51700_117468 | |||
| 2060 | Ga0006781J51513_1010997 | |||
| 2061 | Ga0007410J51695_1002373 | |||
| 2062 | Ga0007410J51695_1004597 | |||
| 2063 | Ga0007410J51695_1005374 | |||
| 2064 | Ga0007410J51695_1012689 | |||
| 2065 | Ga0007410J51695_1020776 | |||
| 2066 | Ga0007410J51695_1025455 | |||
| 2067 | Ga0007410J51695_1042924 | |||
| 2068 | Ga0007409J51694_1000684 | |||
| 2069 | Ga0007409J51694_1002576 | |||
| 2070 | Ga0007409J51694_1020347 | |||
| 2071 | Ga0007409J51694_1020348 | |||
| 2072 | Ga0007409J51694_1027019 | |||
| 2073 | Ga0007409J51694_1029751 | |||
| 2074 | Ga0007409J51694_1032549 | |||
| 2075 | Ga0007409J51694_1069872 | |||
| 2076 | Ga0007409J51694_1071440 | |||
| 2077 | Ga0007416J51690_1002712 | |||
| 2078 | Ga0007416J51690_1004870 | |||
| 2079 | Ga0007416J51690_1010696 | |||
| 2080 | Ga0007416J51690_1019156 | |||
| 2081 | Ga0007416J51690_1023149 | |||
| 2082 | Ga0007416J51690_1028700 | |||
| 2083 | Ga0007416J51690_1030690 | |||
| 2084 | Ga0007416J51690_1049107 | |||
| 2085 | Ga0007429J51699_1007754 | |||
| 2086 | Ga0007429J51699_1031025 | |||
| 2087 | Ga0007429J51699_1050371 | |||
| 2088 | Ga0007411J51799_103551 | |||
| 2089 | Ga0007411J51799_103780 | |||
| 2090 | Ga0007411J51799_104897 | |||
| 2091 | Ga0007411J51799_110137 | |||
| 2092 | Ga0007415J51800_102854 | |||
| 2093 | Ga0007415J51800_104265 | |||
| 2094 | Ga0007415J51800_106957 | |||
| 2095 | Ga0007415J51800_109527 | |||
| 2096 | Ga0007415J51800_115272 | |||
| 2097 | Ga0032354_1003171 | |||
| 2098 | Ga0032354_1003173 | |||
| 2099 | Ga0032354_1010694 | |||
| 2100 | Ga0032354_1011582 | |||
| 2101 | Ga0032354_1028048 | |||
| 2102 | Ga0032354_1033344 | |||
| 2103 | Ga0032354_1045145 | |||
| 2104 | Ga0032354_1061607 | |||
| 2105 | Ga0006766_111745 | |||
| 2106 | Ga0006766_113576 | |||
| 2107 | Ga0006780_1003428 | |||
| 2108 | Ga0006780_1013040 | |||
| 2109 | Ga0055538_1000094 | |||
| 2110 | Ga0055538_1000138 | |||
| 2111 | Ga0055539_1000136 | |||
| 2112 | Ga0055539_1000187 | |||
| 2113 | Ga0055533_1000143 | |||
| 2114 | Ga0055533_1000189 | |||
| 2115 | Ga0055525_1000018 | |||
| 2116 | Ga0055525_1000188 | |||
| 2117 | Ga0055525_1000254 | |||
| 2118 | Ga0055542_1019379 | |||
| 2119 | Ga0055529_1000079 | |||
| 2120 | Ga0055526_1000791 | |||
| 2121 | Ga0055526_1006085 | |||
| 2122 | Ga0055526_1091554 | |||
| 2123 | Ga0055526_1091670 | |||
| 2124 | Ga0055537_1008487 | |||
| 2125 | Ga0055524_1003212 | |||
| 2126 | Ga0055524_1009814 | |||
| 2127 | Ga0055534_1006739 | |||
| 2128 | Ga0055534_1030376 | |||
| 2129 | Ga0055528_1039396 | |||
| 2130 | Ga0055528_1041929 | |||
| 2131 | Ga0055528_1064545 | |||
| 2132 | Ga0055530_10013385 | |||
| 2133 | Ga0055530_10019398 | |||
| 2134 | Ga0055531_10006076 | |||
| 2135 | Ga0055541_1000092 | |||
| 2136 | Ga0055541_1000122 | |||
| 2137 | Ga0055543_1050694 | |||
| 2138 | Ga0058858_1025387 | |||
| 2139 | Ga0058858_1044898 | |||
| 2140 | Ga0058858_1357897 | |||
| 2141 | Ga0058858_1365258 | |||
| 2142 | Ga0058858_1437652 | |||
| 2143 | Ga0058859_10052933 | |||
| 2144 | Ga0058859_10157838 | |||
| 2145 | Ga0058859_11479387 | |||
| 2146 | Ga0058859_11797660 | |||
| 2147 | Ga0058863_10085600 | |||
| 2148 | Ga0058863_11897775 | |||
| 2149 | Ga0058861_10000050 | |||
| 2150 | Ga0058861_10025764 | |||
| 2151 | Ga0058861_10123833 | |||
| 2152 | Ga0058860_10186761 | |||
| 2153 | Ga0058862_10030562 | |||
| 2154 | Ga0058862_10086046 | |||
| 2155 | Ga0058862_10117947 | |||
| 2156 | Ga0058862_12858774 | |||
| 2157 | Ga0065165_1007979 | |||
| 2158 | Ga0065165_1045530 | |||
| 2159 | Ga0065165_1109781 | |||
| 2160 | Ga0065714_10003225 | |||
| 2161 | Ga0065714_10030331 | |||
| 2162 | Ga0065714_10081698 | |||
| 2163 | Ga0065704_10033996 | |||
| 2164 | Ga0065704_10109441 | |||
| 2165 | Ga0065715_10029350 | |||
| 2166 | Ga0065707_10395474 | |||
| 2167 | Ga0065707_10423369 | |||
| 2168 | Ga0070676_10056596 | |||
| 2169 | Ga0070683_100088965 | |||
| 2170 | Ga0070670_100298688 | |||
| 2171 | Ga0068869_100399932 | |||
| 2172 | Ga0068869_100512863 | |||
| 2173 | Ga0070666_10594539 | |||
| 2174 | Ga0070680_100156061 | |||
| 2175 | Ga0070680_100350879 | |||
| 2176 | Ga0070682_100289738 | |||
| 2177 | Ga0070660_100033862 | |||
| 2178 | Ga0070660_100450254 | |||
| 2179 | Ga0070661_100008785 | |||
| 2180 | Ga0070661_100240283 | |||
| 2181 | Ga0070692_10298703 | |||
| 2182 | Ga0070692_10930305 | |||
| 2183 | Ga0070675_100262088 | |||
| 2184 | Ga0070675_100617780 | |||
| 2185 | Ga0070674_100422527 | |||
| 2186 | Ga0070674_101181066 | |||
| 2187 | Ga0070673_100718252 | |||
| 2188 | Ga0070688_100739901 | |||
| 2189 | Ga0070659_100004652 | |||
| 2190 | Ga0070659_100548477 | |||
| 2191 | Ga0070667_101147951 | |||
| 2192 | Ga0070714_100277699 | |||
| 2193 | Ga0070705_101938002 | |||
| 2194 | Ga0070694_100271604 | |||
| 2195 | Ga0070694_101396819 | |||
| 2196 | Ga0070708_100853085 | |||
| 2197 | Ga0070663_100474735 | |||
| 2198 | Ga0070678_100931172 | |||
| 2199 | Ga0070678_101967645 | |||
| 2200 | Ga0070662_100158386 | |||
| 2201 | Ga0070662_100795971 | |||
| 2202 | Ga0070681_10288080 | |||
| 2203 | Ga0070681_11616310 | |||
| 2204 | Ga0068867_100105263 | |||
| 2205 | Ga0070699_100350041 | |||
| 2206 | Ga0068853_100029320 | |||
| 2207 | Ga0068853_100284609 | |||
| 2208 | Ga0068853_100398896 | |||
| 2209 | Ga0070695_100618785 | |||
| 2210 | Ga0070693_100948056 | |||
| 2211 | Ga0070665_101901578 | |||
| 2212 | Ga0070704_100761978 | |||
| 2213 | Ga0068855_100166634 | |||
| 2214 | Ga0068855_100247815 | |||
| 2215 | Ga0068855_100431713 | |||
| 2216 | Ga0068855_101136806 | |||
| 2217 | Ga0068855_102593924 | |||
| 2218 | Ga0070664_100027769 | |||
| 2219 | Ga0068857_100009923 | |||
| 2220 | Ga0068854_100016031 | |||
| 2221 | Ga0068854_100368679 | |||
| 2222 | Ga0068854_100677887 | |||
| 2223 | Ga0068856_100049792 | |||
| 2224 | Ga0068856_100266346 | |||
| 2225 | Ga0068856_100477995 | |||
| 2226 | Ga0070702_100090534 | |||
| 2227 | Ga0070702_101599888 | |||
| 2228 | Ga0068852_100838091 | |||
| 2229 | Ga0068864_100982145 | |||
| 2230 | Ga0068861_102016474 | |||
| 2231 | Ga0068851_10001517 | |||
| 2232 | Ga0068851_10034122 | |||
| 2233 | Ga0068870_10444775 | |||
| 2234 | Ga0068863_100705757 | |||
| 2235 | Ga0068862_100722442 | |||
| 2236 | Ga0068862_101325660 | |||
| 2237 | Ga0070717_10765390 | |||
| 2238 | Ga0075368_10189666 | |||
| 2239 | Ga0075363_100005889 | |||
| 2240 | Ga0075363_100805349 | |||
| 2241 | Ga0075364_10032491 | |||
| 2242 | Ga0075364_10092282 | |||
| 2243 | Ga0075362_10000222 | |||
| 2244 | Ga0075362_10000565 | |||
| 2245 | Ga0075367_10000855 | |||
| 2246 | Ga0075369_10005325 | |||
| 2247 | Ga0075366_10023561 | |||
| 2248 | Ga0075366_10033384 | |||
| 2249 | Ga0075366_10199541 | |||
| 2250 | Ga0075366_10218034 | |||
| 2251 | Ga0075366_10820726 | |||
| 2252 | Ga0097621_100021406 | |||
| 2253 | Ga0075370_10001150 | |||
| 2254 | Ga0075370_10064344 | |||
| 2255 | Ga0075370_10104070 | |||
| 2256 | Ga0075370_10152303 | |||
| 2257 | Ga0068871_100015656 | |||
| 2258 | Ga0075433_10202721 | |||
| 2259 | Ga0068865_100074639 | |||
| 2260 | Ga0068865_100140074 | |||
| 2261 | Ga0068865_100921340 | |||
| 2262 | Ga0079104_1004078 | |||
| 2263 | Ga0079104_1104358 | |||
| 2264 | Ga0099826_10000010 | |||
| 2265 | Ga0075435_100367572 | |||
| 2266 | Ga0099794_10383343 | |||
| 2267 | Ga0105244_10023517 | |||
| 2268 | Ga0105244_10028871 | |||
| 2269 | Ga0105244_10045359 | |||
| 2270 | Ga0105244_10084777 | |||
| 2271 | Ga0105244_10463019 | |||
| 2272 | Ga0105240_10005705 | |||
| 2273 | Ga0105240_10009383 | |||
| 2274 | Ga0105240_10327528 | |||
| 2275 | Ga0105240_10523357 | |||
| 2276 | Ga0105245_10023078 | |||
| 2277 | Ga0105243_10006860 | |||
| 2278 | Ga0105243_10499114 | |||
| 2279 | Ga0105243_12034967 | |||
| 2280 | Ga0105241_10057980 | |||
| 2281 | Ga0105242_10007953 | |||
| 2282 | Ga0105242_12640934 | |||
| 2283 | Ga0105248_10539440 | |||
| 2284 | Ga0105237_10134008 | |||
| 2285 | Ga0105237_10460777 | |||
| 2286 | Ga0105238_10000255 | |||
| 2287 | Ga0105238_10162679 | |||
| 2288 | Ga0105238_10455386 | |||
| 2289 | Ga0105249_10303710 | |||
| 2290 | Ga0105249_13417083 | |||
| 2291 | Ga0130087_1030513 | |||
| 2292 | Ga0130087_1090781 | |||
| 2293 | Ga0130087_1095535 | |||
| 2294 | Ga0130086_1025653 | |||
| 2295 | Ga0130086_1025943 | |||
| 2296 | Ga0130086_1026814 | |||
| 2297 | Ga0130085_1073923 | |||
| 2298 | Ga0130085_1083711 | |||
| 2299 | Ga0130085_1132233 | |||
| 2300 | Ga0105239_10001561 | |||
| 2301 | Ga0105246_10744899 | |||
| 2302 | Ga0105246_12194323 | |||
| 2303 | Ga0157321_1010116 | |||
| 2304 | Ga0157319_1007161 | |||
| 2305 | Ga0157327_1057832 | |||
| 2306 | Ga0154014_155471 | |||
| 2307 | Ga0157373_10015732 | |||
| 2308 | Ga0157373_10154902 | |||
| 2309 | Ga0157373_10459447 | |||
| 2310 | Ga0157371_10001564 | |||
| 2311 | Ga0157371_10250157 | |||
| 2312 | Ga0157371_10501027 | |||
| 2313 | Ga0157370_10325401 | |||
| 2314 | Ga0157370_11707859 | |||
| 2315 | Ga0157369_10315337 | |||
| 2316 | Ga0157374_10009298 | |||
| 2317 | Ga0157374_10143777 | |||
| 2318 | Ga0157378_10027087 | |||
| 2319 | Ga0157378_10248653 | |||
| 2320 | Ga0157378_11242214 | |||
| 2321 | Ga0163162_10060438 | |||
| 2322 | Ga0163162_10103155 | |||
| 2323 | Ga0163162_10139871 | |||
| 2324 | Ga0157372_10991197 | |||
| 2325 | Ga0157375_11430153 | |||
| 2326 | Ga0157375_11776352 | |||
| 2327 | Ga0182008_10001808 | |||
| 2328 | Ga0182008_10003186 | |||
| 2329 | Ga0182008_10039266 | |||
| 2330 | Ga0182008_10329668 | |||
| 2331 | Ga0157377_10259659 | |||
| 2332 | Ga0157377_10637996 | |||
| 2333 | Ga0157376_11698828 | |||
| 2334 | Ga0182006_1000240 | |||
| 2335 | Ga0182006_1000274 | |||
| 2336 | Ga0182006_1048484 | |||
| 2337 | Ga0182006_1293840 | |||
| 2338 | Ga0182007_10000196 | |||
| 2339 | Ga0182007_10014439 | |||
| 2340 | Ga0182007_10044315 | |||
| 2341 | Ga0182007_10098690 | |||
| 2342 | Ga0182005_1000016 | |||
| 2343 | Ga0182005_1000163 | |||
| 2344 | Ga0182005_1000370 | |||
| 2345 | Ga0163161_10007196 | |||
| 2346 | Ga0163161_10039119 | |||
| 2347 | Ga0197907_10298599 | |||
| 2348 | Ga0197907_10941484 | |||
| 2349 | Ga0206355_1235934 | |||
| 2350 | Ga0206352_10695704 | |||
| 2351 | Ga0206352_11129984 | |||
| 2352 | Ga0206354_11576217 | |||
| 2353 | Ga0206353_10105939 | |||
| 2354 | Ga0154015_1381451 | |||
| 2355 | Ga0213872_10000307 | |||
| 2356 | Ga0213872_10003461 | |||
| 2357 | Ga0213872_10041234 | |||
| 2358 | Ga0213872_10070274 | |||
| 2359 | Ga0213872_10070360 | |||
| 2360 | Ga0213872_10215334 | |||
| 2361 | Ga0256744_118715 | |||
| 2362 | Ga0209760_109176 | |||
| 2363 | Ga0209436_100401 | |||
| 2364 | Ga0209784_100010 | |||
| 2365 | Ga0209784_100035 | |||
| 2366 | Ga0209566_100008 | |||
| 2367 | Ga0209566_100040 | |||
| 2368 | Ga0209674_100019 | |||
| 2369 | Ga0209674_100057 | |||
| 2370 | Ga0209672_105905 | |||
| 2371 | Ga0209563_100011 | |||
| 2372 | Ga0209563_100021 | |||
| 2373 | Ga0209563_100059 | |||
| 2374 | Ga0207427_100342 | |||
| 2375 | Ga0209437_100019 | |||
| 2376 | Ga0209437_103125 | |||
| 2377 | Ga0207425_1000021 | |||
| 2378 | Ga0207425_1000680 | |||
| 2379 | Ga0207425_1000845 | |||
| 2380 | Ga0207425_1000932 | |||
| 2381 | Ga0207425_1049412 | |||
| 2382 | Ga0209646_1000068 | |||
| 2383 | Ga0209026_1003315 | |||
| 2384 | Ga0209677_100011 | |||
| 2385 | Ga0209677_100036 | |||
| 2386 | Ga0209677_102227 | |||
| 2387 | Ga0209148_1000444 | |||
| 2388 | Ga0209129_1000020 | |||
| 2389 | Ga0209129_1000158 | |||
| 2390 | Ga0209129_1052977 | |||
| 2391 | Ga0209233_1000025 | |||
| 2392 | Ga0209565_1001042 | |||
| 2393 | Ga0209565_1006230 | |||
| 2394 | Ga0209565_1011005 | |||
| 2395 | Ga0209565_1077228 | |||
| 2396 | Ga0209455_1000070 | |||
| 2397 | Ga0209455_1001216 | |||
| 2398 | Ga0209673_1000730 | |||
| 2399 | Ga0209673_1004093 | |||
| 2400 | Ga0209673_1004985 | |||
| 2401 | Ga0209673_1010299 | |||
| 2402 | Ga0209130_1010313 | |||
| 2403 | Ga0209675_1012428 | |||
| 2404 | Ga0209675_1046147 | |||
| 2405 | Ga0209025_1006398 | |||
| 2406 | Ga0209564_1000027 | |||
| 2407 | Ga0209564_1000047 | |||
| 2408 | Ga0209564_1000282 | |||
| 2409 | Ga0209564_1002740 | |||
| 2410 | Ga0209564_1037233 | |||
| 2411 | Ga0209758_1000077 | |||
| 2412 | Ga0209758_1000322 | |||
| 2413 | Ga0209758_1000910 | |||
| 2414 | Ga0209758_1011080 | |||
| 2415 | Ga0209050_1000050 | |||
| 2416 | Ga0209050_1000223 | |||
| 2417 | Ga0209050_1002922 | |||
| 2418 | Ga0209256_1000054 | |||
| 2419 | Ga0209256_1002719 | |||
| 2420 | Ga0209256_1004416 | |||
| 2421 | Ga0209256_1009680 | |||
| 2422 | Ga0209256_1095645 | |||
| 2423 | Ga0207426_1000802 | |||
| 2424 | Ga0209051_1018074 | |||
| 2425 | Ga0209051_1026168 | |||
| 2426 | Ga0209257_1000075 | |||
| 2427 | Ga0209257_1043589 | |||
| 2428 | Ga0207656_10040557 | |||
| 2429 | Ga0207656_10058704 | |||
| 2430 | Ga0207655_1000499 | |||
| 2431 | Ga0207655_1024949 | |||
| 2432 | Ga0207655_1028515 | |||
| 2433 | Ga0207655_1031488 | |||
| 2434 | Ga0207680_10310463 | |||
| 2435 | Ga0207647_10029480 | |||
| 2436 | Ga0207685_10411976 | |||
| 2437 | Ga0207645_10064364 | |||
| 2438 | Ga0207643_10369110 | |||
| 2439 | Ga0207705_10016800 | |||
| 2440 | Ga0207654_10109708 | |||
| 2441 | Ga0207695_10001345 | |||
| 2442 | Ga0207695_10174538 | |||
| 2443 | Ga0207695_10283352 | |||
| 2444 | Ga0207671_10007790 | |||
| 2445 | Ga0207671_10013783 | |||
| 2446 | Ga0207660_10096089 | |||
| 2447 | Ga0207657_10001495 | |||
| 2448 | Ga0207657_10030110 | |||
| 2449 | Ga0207657_10110762 | |||
| 2450 | Ga0207649_10086318 | |||
| 2451 | Ga0207652_10278953 | |||
| 2452 | Ga0207652_11458011 | |||
| 2453 | Ga0207694_10000193 | |||
| 2454 | Ga0207694_10049485 | |||
| 2455 | Ga0207694_10633585 | |||
| 2456 | Ga0207650_10051822 | |||
| 2457 | Ga0207659_10170020 | |||
| 2458 | Ga0207659_10205388 | |||
| 2459 | Ga0207687_10038586 | |||
| 2460 | Ga0207664_10675927 | |||
| 2461 | Ga0207690_10000959 | |||
| 2462 | Ga0207690_10141151 | |||
| 2463 | Ga0207706_10008025 | |||
| 2464 | Ga0207706_10190592 | |||
| 2465 | Ga0207686_10344068 | |||
| 2466 | Ga0207686_10998987 | |||
| 2467 | Ga0207686_11763727 | |||
| 2468 | Ga0207709_10019899 | |||
| 2469 | Ga0207709_11186340 | |||
| 2470 | Ga0207669_10288508 | |||
| 2471 | Ga0207669_10439485 | |||
| 2472 | Ga0207704_10041905 | |||
| 2473 | Ga0207704_11504908 | |||
| 2474 | Ga0207665_10328579 | |||
| 2475 | Ga0207691_10977588 | |||
| 2476 | Ga0207711_10196937 | |||
| 2477 | Ga0207689_10023710 | |||
| 2478 | Ga0207689_11576762 | |||
| 2479 | Ga0207679_10002718 | |||
| 2480 | Ga0207667_10006290 | |||
| 2481 | Ga0207667_10100133 | |||
| 2482 | Ga0207667_10234580 | |||
| 2483 | Ga0207667_10465494 | |||
| 2484 | Ga0207667_11705803 | |||
| 2485 | Ga0207651_10155920 | |||
| 2486 | Ga0207640_10004199 | |||
| 2487 | Ga0207640_10384480 | |||
| 2488 | Ga0207640_10393025 | |||
| 2489 | Ga0207639_10048176 | |||
| 2490 | Ga0207639_10485780 | |||
| 2491 | Ga0207678_10003236 | |||
| 2492 | Ga0207702_10043312 | |||
| 2493 | Ga0207702_10629001 | |||
| 2494 | Ga0207702_10905349 | |||
| 2495 | Ga0207648_10166766 | |||
| 2496 | Ga0207674_10005520 | |||
| 2497 | Ga0207674_10033169 | |||
| 2498 | Ga0207674_11711104 | |||
| 2499 | Ga0207675_101347115 | |||
| 2500 | Ga0207683_10519516 | |||
| 2501 | Ga0207683_11336632 | |||
| 2502 | Ga0207698_10180633 | |||
| 2503 | Ga0207698_10579895 | |||
| 2504 | Ga0207698_10973984 | |||
| 2505 | Ga0207698_12351927 | |||
| 2506 | Ga0209281_1002282 | |||
| 2507 | Ga0209281_1004157 | |||
| 2508 | Ga0209969_1018620 | |||
| 2509 | Ga0209984_1005637 | |||
| 2510 | Ga0209995_1009327 | |||
| 2511 | Ga0210002_1016192 | |||
| 2512 | Ga0209983_1024556 | |||
| 2513 | Ga0209282_1000072 | |||
| 2514 | Ga0209971_1088753 | |||
| 2515 | Ga0209813_10024775 | |||
| 2516 | Ga0209974_10050246 | |||
| 2517 | Ga0268266_10446814 | |||
| 2518 | Ga0268265_10330997 | |||
| 2519 | Ga0307517_10103679 | |||
| 2520 | Ga0307515_10115015 | |||
| 2521 | Ga0307515_10288992 | |||
| 2522 | Ga0307515_10371984 | |||
| 2523 | Ga0307515_10485433 | |||
| 2524 | Ga0265338_10293180 | |||
| 2525 | Ga0316177_1056223 | |||
| 2526 | Ga0316176_1064342 | |||
| 2527 | Ga0314311_1151902 | |||
| 2528 | Ga0314311_1236493 | |||
| 2529 | Ga0316178_1001132 | |||
| 2530 | Ga0316180_1056555 | |||
| 2531 | Ga0316181_1006587 | |||
| 2532 | Ga0316181_1065259 | |||
| 2533 | Ga0265767_101870 | |||
| 2534 | Ga0265766_1000491 | |||
| 2535 | Ga0265766_1010647 | |||
| 2536 | Ga0265766_1014427 | |||
| 2537 | Ga0265769_105630 | |||
| 2538 | Ga0265774_104728 | |||
| 2539 | Ga0265779_102213 | |||
| 2540 | Ga0265330_10000012 | |||
| 2541 | Ga0265332_10000012 | |||
| 2542 | Ga0265325_10006225 | |||
| 2543 | Ga0265316_10039600 | |||
| 2544 | Ga0307513_10019858 | |||
| 2545 | Ga0307513_10088393 | |||
| 2546 | Ga0307513_10663036 | |||
| 2547 | Ga0307408_100013705 | |||
| 2548 | Ga0307408_100050653 | |||
| 2549 | Ga0307408_100181519 | |||
| 2550 | Ga0307408_100202378 | |||
| 2551 | Ga0307408_101120757 | |||
| 2552 | Ga0307408_102297936 | |||
| 2553 | Ga0265314_10000029 | |||
| 2554 | Ga0307405_12076467 | |||
| 2555 | Ga0307413_10594475 | |||
| 2556 | Ga0307413_11932844 | |||
| 2557 | Ga0307518_10004256 | |||
| 2558 | Ga0326468_10029529 | |||
| 2559 | Ga0307406_10116737 | |||
| 2560 | Ga0307406_10166340 | |||
| 2561 | Ga0307406_10603852 | |||
| 2562 | Ga0307412_10198406 | |||
| 2563 | Ga0307412_10454576 | |||
| 2564 | Ga0307412_12200207 | |||
| 2565 | Ga0307416_100002061 | |||
| 2566 | Ga0307416_100778036 | |||
| 2567 | Ga0307416_102262363 | |||
| 2568 | Ga0307416_102582978 | |||
| 2569 | Ga0307416_103007350 | |||
| 2570 | Ga0307414_10047643 | |||
| 2571 | Ga0307414_10075764 | |||
| 2572 | Ga0307414_10283744 | |||
| 2573 | Ga0307414_10296273 | |||
| 2574 | Ga0307411_10480233 | |||
| 2575 | Ga0307411_10581881 | |||
| 2576 | Ga0307411_10594037 | |||
| 2577 | Ga0307411_11697426 | |||
| 2578 | Ga0307415_100439096 | |||
| 2579 | Ga0307415_101534612 | |||
| 2580 | Ga0307510_10271247 | |||
| 2581 | Ga0373928_0149585 | |||
| 2582 | Ga0373939_0050899 | |||
| 2583 | Ga0265778_019850 | |||
| 2584 | Ga0265778_056008 | |||
| 2585 | Ga0395899_0326984 | |||
| 2586 | Ga0395900_0006501 | |||
| 2587 | Ga0395900_0063774 | |||
| 2588 | Ga0395900_0223727 | |||
| 2589 | Ga0395900_0810752 | |||
| 2590 | Ga0395900_0838651 | |||
| 2591 | Ga0395900_0890928 | |||
| 2592 | Ga0395898_0182958 | |||
| 2593 | Ga0395898_0536365 | |||
| 2594 | Ga0395905_0000549 | |||
| 2595 | Ga0395905_0012898 | |||
| 2596 | Ga0395905_0043570 | |||
| 2597 | Ga0395905_0103307 | |||
| 2598 | Ga0395905_0228005 | |||
| 2599 | Ga0436364_0513076 | |||
| 2600 | Ga0395901_0028412 | |||
| 2601 | Ga0395901_0036377 | |||
| 2602 | Ga0395901_0093407 | |||
| 2603 | Ga0395901_0112851 | |||
| 2604 | Ga0395901_0176537 | |||
| 2605 | Ga0395901_0347594 | |||
| 2606 | Ga0436361_0110739 | |||
| 2607 | Ga0436361_0209532 | |||
| 2608 | Ga0436361_0391791 | |||
| 2609 | Ga0436361_0797417 | |||
| 2610 | Ga0436361_0902855 | |||
| 2611 | Ga0436361_1016700 | |||
| 2612 | Ga0436361_1041947 | |||
| 2613 | Ga0439453_0001276 | |||
| 2614 | Ga0439465_0215707 | |||
| 2615 | Ga0439465_0334429 | |||
| 2616 | Ga0451787_207356 | |||
| 2617 | Ga0451788_14269 | |||
| 2618 | Ga0451788_26491 | |||
| 2619 | Ga0451789_0965253 | |||
| 2620 | Ga0451790_30858 | |||
| 2621 | Ga0451792_06578 | |||
| 2622 | Ga0451794_03992 | |||
| 2623 | Ga0451794_43844 | |||
| 2624 | Ga0451794_56996 | |||
| 2625 | Ga0451793_1842659 | |||
| 2626 | Ga0451799_25489 | |||
| 2627 | Ga0451799_25968 | |||
| 2628 | Ga0451799_35494 | |||
| 2629 | Ga0451801_03902 | |||
| 2630 | Ga0451801_05624 | |||
| 2631 | Ga0451795_0013989 | |||
| 2632 | Ga0451803_00380 | |||
| 2633 | Ga0451798_0308085 | |||
| 2634 | Ga0451798_0595355 | |||
| 2635 | Ga0451800_0613767 | |||
| 2636 | Ga0451802_0433132 | |||
| 2637 | Ga0451802_0690103 | |||
| 2638 | Ga0451805_059694 | |||
| 2639 | Ga0451805_117766 | |||
| 2640 | Ga0451804_0350671 | |||
| 2641 | Ga0451808_27185 | |||
| 2642 | Ga0451808_27571 | |||
| 2643 | Ga0451807_0444576 | |||
| 2644 | Ga0451807_1127722 | |||
| 2645 | Ga0451833_1024724 | |||
| 2646 | Ga0451837_1802545 | |||
| 2647 | Ga0451839_0712830 | |||
| 2648 | Ga0451841_0095596 | |||
| 2649 | Ga0451845_0906783 | |||
| 2650 | Ga0451849_1511665 | |||
| 2651 | Ga0451850_46944 | |||
| 2652 | Ga0451843_0626631 | |||
| 2653 | Ga0451855_1729568 | |||
| 2654 | Ga0451853_0176051 | |||
| 2655 | Ga0452268_24915 | |||
| 2656 | Ga0439442_030241 | |||
| 2657 | Ga0439448_0091069 | |||
| 2658 | Ga0439432_109856 | |||
| 2659 | Ga0439449_0003878 | |||
| 2660 | Ga0439449_0111033 | |||
| 2661 | Ga0439450_002944 | |||
| 2662 | Ga0439454_001689 | |||
| 2663 | Ga0439454_036314 | |||
| 2664 | Ga0439455_0064096 | |||
| 2665 | Ga0439455_0074073 | |||
| 2666 | Ga0450911_005087 | |||
| 2667 | Ga0450890_040459 | |||
| 2668 | Ga0450897_032275 | |||
| 2669 | Ga0450898_003136 | |||
| 2670 | Ga0450898_029605 | |||
| 2671 | Ga0450898_029717 | |||
| 2672 | Ga0450904_000961 | |||
| 2673 | Ga0450906_030486 | |||
| 2674 | Ga0450906_104913 | |||
| 2675 | Ga0450910_105598 | |||
| 2676 | Ga0439458_0031353 | |||
| 2677 | Ga0439434_0250235 | |||
| 2678 | Ga0439459_0055055 | |||
| 2679 | Ga0439464_0256052 | |||
| 2680 | Ga0439460_0206241 | |||
| 2681 | Ga0450893_0013738 | |||
| 2682 | Ga0450893_0026452 | |||
| 2683 | Ga0451577_0038506 | |||
| 2684 | Ga0466969_0312193 | |||
| 2685 | Ga0466969_0572319 | |||
| 2686 | Ga0466972_0020192 | |||
| 2687 | Ga0466972_0039363 | |||
| 2688 | Ga0466972_0098911 | |||
| 2689 | Ga0466972_0221359 | |||
| 2690 | Ga0466972_0272724 | |||
| 2691 | Ga0453683_0392256 | |||
| 2692 | Ga0466965_0027577 | |||
| 2693 | Ga0466965_0036619 | |||
| 2694 | Ga0466965_0095415 | |||
| 2695 | Ga0466966_0032032 | |||
| 2696 | Ga0466966_0154067 | |||
| 2697 | Ga0466966_0510731 | |||
| 2698 | Ga0466966_0630353 | |||
| 2699 | Ga0466961_0059959 | |||
| 2700 | Ga0466963_0066574 | |||
| 2701 | Ga0466964_0177531 | |||
| 2702 | Ga0466964_0222909 | |||
| 2703 | Ga0453684_0142976 | |||
| 2704 | Ga0466971_0355328 | |||
| 2705 | Ga0466968_0024670 | |||
| 2706 | Ga0466968_0068221 | |||
| 2707 | Ga0466970_0695742 | |||
| 2708 | Ga0466957_0173268 | |||
| 2709 | Ga0466957_0262826 | |||
| 2710 | Ga0466957_1007085 | |||
| 2711 | Ga0466960_0134659 | |||
| 2712 | Ga0466960_0364078 | |||
| 2713 | Ga0466960_0884225 | |||
| 2714 | Ga0466959_0862059 | |||
| 2715 | Ga0466959_1014431 | |||
| 2716 | Ga0466959_1020608 | |||
| 2717 | Ga0451576_0013761 | |||
| 2718 | Ga0451576_0083384 | |||
| 2719 | Ga0451576_0936124 | |||
| 2720 | Ga0466958_0482820 | |||
| 2721 | Ga0495617_000397 | |||
| 2722 | Ga0495617_000636 | |||
| 2723 | Ga0495617_000830 | |||
| 2724 | Ga0495617_031068 | |||
| 2725 | Ga0495627_000011 | |||
| 2726 | Ga0495627_008059 | |||
| 2727 | Ga0495627_014179 | |||
| 2728 | Ga0495627_019933 | |||
| 2729 | Ga0495592_0035699 | |||
| 2730 | Ga0495603_0001612 | |||
| 2731 | Ga0495603_0020924 | |||
| 2732 | Ga0495603_0409204 | |||
| 2733 | Ga0495603_0415278 | |||
| 2734 | Ga0495603_0726653 | |||
| 2735 | Ga0495590_0000020 | |||
| 2736 | Ga0495590_0000632 | |||
| 2737 | Ga0495590_0001551 | |||
| 2738 | Ga0495590_0056853 | |||
| 2739 | Ga0495590_0251682 | |||
| 2740 | Ga0495591_034720 | |||
| 2741 | Ga0495629_0007936 | |||
| 2742 | Ga0495629_0021816 | |||
| 2743 | Ga0495638_0000235 | |||
| 2744 | Ga0495638_0008741 | |||
| 2745 | Ga0495638_0090421 | |||
| 2746 | Ga0495638_0148740 | |||
| 2747 | Ga0495638_0181110 | |||
| 2748 | Ga0495638_0343610 | |||
| 2749 | Ga0495638_0388315 | |||
| 2750 | Ga0495638_0512403 | |||
| 2751 | Ga0495651_0842696 | |||
| 2752 | Ga0495653_0000067 | |||
| 2753 | Ga0495653_0004702 | |||
| 2754 | Ga0495653_0009522 | |||
| 2755 | Ga0495653_0175649 | |||
| 2756 | Ga0495653_0452357 | |||
| 2757 | Ga0495650_0000200 | |||
| 2758 | Ga0495650_0001809 | |||
| 2759 | Ga0495650_0002469 | |||
| 2760 | Ga0495650_0014707 | |||
| 2761 | Ga0495650_0023728 | |||
| 2762 | Ga0495650_0026097 | |||
| 2763 | Ga0495580_0009003 | |||
| 2764 | Ga0495580_0314594 | |||
| 2765 | Ga0495580_0665811 | |||
| 2766 | Ga0495582_0019511 | |||
| 2767 | Ga0495582_0063422 | |||
| 2768 | Ga0495582_0302408 | |||
| 2769 | Ga0495605_0001330 | |||
| 2770 | Ga0495605_0001735 | |||
| 2771 | Ga0495605_0005449 | |||
| 2772 | Ga0495605_0010393 | |||
| 2773 | Ga0495605_0013769 | |||
| 2774 | Ga0495605_0061515 | |||
| 2775 | Ga0495605_0094007 | |||
| 2776 | Ga0495605_0162942 | |||
| 2777 | Ga0495605_0328009 | |||
| 2778 | Ga0495639_0088079 | |||
| 2779 | Ga0495639_0445425 | |||
| 2780 | Ga0495664_0244637 | |||
| 2781 | Ga0495584_0000636 | |||
| 2782 | Ga0495584_0002002 | |||
| 2783 | Ga0495584_0022316 | |||
| 2784 | Ga0495584_0023314 | |||
| 2785 | Ga0495584_0030129 | |||
| 2786 | Ga0495584_0036677 | |||
| 2787 | Ga0495584_0041411 | |||
| 2788 | Ga0495584_0080454 | |||
| 2789 | Ga0495584_0088913 | |||
| 2790 | Ga0495584_0109915 | |||
| 2791 | Ga0495584_0150994 | |||
| 2792 | Ga0495584_0323231 | |||
| 2793 | Ga0495584_0515190 | |||
| 2794 | Ga0495584_0636787 | |||
| 2795 | Ga0495585_0015948 | |||
| 2796 | Ga0495585_0022456 | |||
| 2797 | Ga0495585_0025799 | |||
| 2798 | Ga0495585_0036832 | |||
| 2799 | Ga0495585_0060017 | |||
| 2800 | Ga0495585_0061827 | |||
| 2801 | Ga0495585_0147891 | |||
| 2802 | Ga0495585_0171964 | |||
| 2803 | Ga0495585_0282346 | |||
| 2804 | Ga0495585_0389221 | |||
| 2805 | Ga0495585_0397963 | |||
| 2806 | Ga0495585_0448161 | |||
| 2807 | Ga0495585_0533323 | |||
| 2808 | Ga0495594_0026606 | |||
| 2809 | Ga0495594_0050249 | |||
| 2810 | Ga0495594_0050658 | |||
| 2811 | Ga0495594_0139761 | |||
| 2812 | Ga0495594_0247101 | |||
| 2813 | Ga0495594_0549179 | |||
| 2814 | Ga0495594_0626289 | |||
| 2815 | Ga0495594_0652878 | |||
| 2816 | Ga0495596_0001745 | |||
| 2817 | Ga0495596_0001963 | |||
| 2818 | Ga0495596_0040152 | |||
| 2819 | Ga0495596_0078041 | |||
| 2820 | Ga0495596_0126402 | |||
| 2821 | Ga0495596_0196401 | |||
| 2822 | Ga0495596_0349598 | |||
| 2823 | Ga0495607_0042980 | |||
| 2824 | Ga0495607_0045844 | |||
| 2825 | Ga0495607_0148073 | |||
| 2826 | Ga0495607_0190403 | |||
| 2827 | Ga0495607_0199105 | |||
| 2828 | Ga0495607_0277544 | |||
| 2829 | Ga0495607_0345024 | |||
| 2830 | Ga0495607_0392730 | |||
| 2831 | Ga0495607_0479457 | |||
| 2832 | Ga0495607_0521843 | |||
| 2833 | Ga0495607_0559062 | |||
| 2834 | Ga0495583_0000317 | |||
| 2835 | Ga0495583_0002046 | |||
| 2836 | Ga0495583_0003152 | |||
| 2837 | Ga0495583_0006153 | |||
| 2838 | Ga0495583_0029176 | |||
| 2839 | Ga0495583_0077755 | |||
| 2840 | Ga0495583_0129354 | |||
| 2841 | Ga0495583_0190547 | |||
| 2842 | Ga0495583_0306402 | |||
| 2843 | Ga0495606_0000433 | |||
| 2844 | Ga0495606_0004241 | |||
| 2845 | Ga0495606_0009821 | |||
| 2846 | Ga0495606_0013080 | |||
| 2847 | Ga0495606_0032750 | |||
| 2848 | Ga0495606_0035831 | |||
| 2849 | Ga0495606_0037395 | |||
| 2850 | Ga0495606_0058361 | |||
| 2851 | Ga0495606_0158420 | |||
| 2852 | Ga0495606_0248652 | |||
| 2853 | Ga0495606_0335379 | |||
| 2854 | Ga0495606_0374445 | |||
| 2855 | Ga0495606_0388069 | |||
| 2856 | Ga0495606_0536463 | |||
| 2857 | Ga0495608_0037678 | |||
| 2858 | Ga0495610_0000017 | |||
| 2859 | Ga0495610_0004520 | |||
| 2860 | Ga0495610_0042199 | |||
| 2861 | Ga0495610_0048651 | |||
| 2862 | Ga0495610_0188392 | |||
| 2863 | Ga0495616_0003800 | |||
| 2864 | Ga0495616_0004467 | |||
| 2865 | Ga0495616_0018110 | |||
| 2866 | Ga0495616_0028095 | |||
| 2867 | Ga0495616_0040567 | |||
| 2868 | Ga0495616_0053180 | |||
| 2869 | Ga0495616_0070526 | |||
| 2870 | Ga0495616_0090767 | |||
| 2871 | Ga0495616_0153679 | |||
| 2872 | Ga0495616_0183476 | |||
| 2873 | Ga0495620_0001543 | |||
| 2874 | Ga0495628_0089954 | |||
| 2875 | Ga0495628_0758225 | |||
| 2876 | Ga0495630_0050068 | |||
| 2877 | Ga0495630_0214174 | |||
| 2878 | Ga0495631_0084495 | |||
| 2879 | Ga0495631_0109370 | |||
| 2880 | Ga0495631_0113533 | |||
| 2881 | Ga0495631_0141332 | |||
| 2882 | Ga0495631_0376151 | |||
| 2883 | Ga0495632_0018868 | |||
| 2884 | Ga0495632_0035459 | |||
| 2885 | Ga0495632_0102867 | |||
| 2886 | Ga0495632_0269148 | |||
| 2887 | Ga0495632_0402833 | |||
| 2888 | Ga0495637_0001780 | |||
| 2889 | Ga0495637_0002190 | |||
| 2890 | Ga0495637_0006713 | |||
| 2891 | Ga0495637_0035119 | |||
| 2892 | Ga0495643_0002891 | |||
| 2893 | Ga0495643_0016892 | |||
| 2894 | Ga0495643_0026373 | |||
| 2895 | Ga0495643_0040909 | |||
| 2896 | Ga0495643_0092098 | |||
| 2897 | Ga0495643_0107363 | |||
| 2898 | Ga0495643_0117768 | |||
| 2899 | Ga0495643_0129407 | |||
| 2900 | Ga0495643_0231320 | |||
| 2901 | Ga0495643_0276333 | |||
| 2902 | Ga0495643_0291310 | |||
| 2903 | Ga0495643_0313202 | |||
| 2904 | Ga0495643_0406296 | |||
| 2905 | Ga0495643_0486618 | |||
| 2906 | Ga0495644_0012857 | |||
| 2907 | Ga0495644_0029052 | |||
| 2908 | Ga0495644_0085048 | |||
| 2909 | Ga0495644_0107321 | |||
| 2910 | Ga0495644_0117781 | |||
| 2911 | Ga0495644_0140519 | |||
| 2912 | Ga0495644_0159870 | |||
| 2913 | Ga0495644_0213997 | |||
| 2914 | Ga0495644_0247801 | |||
| 2915 | Ga0495648_0003167 | |||
| 2916 | Ga0495648_0009195 | |||
| 2917 | Ga0495648_0011794 | |||
| 2918 | Ga0495648_0118352 | |||
| 2919 | Ga0495648_0133789 | |||
| 2920 | Ga0495648_0209844 | |||
| 2921 | Ga0495648_0213620 | |||
| 2922 | Ga0495663_0015755 | |||
| 2923 | Ga0495663_0037423 | |||
| 2924 | Ga0495663_0056569 | |||
| 2925 | Ga0495663_0097365 | |||
| 2926 | Ga0495666_0002326 | |||
| 2927 | Ga0495666_0009599 | |||
| 2928 | Ga0495666_0096128 | |||
| 2929 | Ga0495666_0316509 | |||
| 2930 | Ga0495666_0388536 | |||
| 2931 | Ga0495642_0005824 | |||
| 2932 | Ga0495642_0007068 | |||
| 2933 | Ga0495642_0010689 | |||
| 2934 | Ga0495642_0052967 | |||
| 2935 | Ga0495642_0114350 | |||
| 2936 | Ga0495642_0127484 | |||
| 2937 | Ga0495642_0286284 | |||
| 2938 | Ga0495642_0294808 | |||
| 2939 | Ga0495642_0567772 | |||
| 2940 | Ga0495652_0019185 | |||
| 2941 | Ga0495652_0095835 | |||
| 2942 | Ga0495652_0183867 | |||
| 2943 | Ga0495654_0000060 | |||
| 2944 | Ga0495654_0018887 | |||
| 2945 | Ga0495654_0063474 | |||
| 2946 | Ga0495654_0073901 | |||
| 2947 | Ga0495654_0105944 | |||
| 2948 | Ga0495654_0126676 | |||
| 2949 | Ga0495654_0170706 | |||
| 2950 | Ga0495654_0399106 | |||
| 2951 | Ga0495665_0005868 | |||
| 2952 | Ga0495665_0026128 | |||
| 2953 | Ga0495665_0026164 | |||
| 2954 | Ga0495665_0053041 | |||
| 2955 | Ga0495665_0089182 | |||
| 2956 | Ga0495665_0550280 | |||
| 2957 | Ga0495665_0681242 | |||
| 2958 | Ga0495640_0537766 | |||
| 2959 | Ga0495586_0006554 | |||
| 2960 | Ga0495586_0007592 | |||
| 2961 | Ga0495586_0010558 | |||
| 2962 | Ga0495586_0233786 | |||
| 2963 | Ga0495587_0028480 | |||
| 2964 | Ga0495587_0037432 | |||
| 2965 | Ga0495598_0076189 | |||
| 2966 | Ga0495609_0001840 | |||
| 2967 | Ga0495609_0005522 | |||
| 2968 | Ga0495609_0018793 | |||
| 2969 | Ga0495609_0019006 | |||
| 2970 | Ga0495609_0026758 | |||
| 2971 | Ga0495609_0026889 | |||
| 2972 | Ga0495609_0064148 | |||
| 2973 | Ga0495609_0099256 | |||
| 2974 | Ga0495609_0114491 | |||
| 2975 | Ga0495609_0273136 | |||
| 2976 | Ga0495609_0417573 | |||
| 2977 | Ga0495621_0015352 | |||
| 2978 | Ga0495621_0084944 | |||
| 2979 | Ga0495597_0004273 | |||
| 2980 | Ga0495597_0007533 | |||
| 2981 | Ga0495597_0013129 | |||
| 2982 | Ga0495597_0021380 | |||
| 2983 | Ga0495597_0025313 | |||
| 2984 | Ga0495597_0049072 | |||
| 2985 | Ga0495597_0059514 | |||
| 2986 | Ga0495597_0085111 | |||
| 2987 | Ga0495597_0096517 | |||
| 2988 | Ga0495597_0112149 | |||
| 2989 | Ga0495597_0124240 | |||
| 2990 | Ga0495597_0198836 | |||
| 2991 | Ga0495597_0220377 | |||
| 2992 | Ga0495597_0227659 | |||
| 2993 | Ga0495597_0240810 | |||
| 2994 | Ga0495597_0259120 | |||
| 2995 | Ga0495645_0181667 | |||
| 2996 | Ga0495645_0821012 | |||
| 2997 | Ga0495622_0002906 | |||
| 2998 | Ga0495622_0003244 | |||
| 2999 | Ga0495622_0010858 | |||
| 3000 | Ga0495622_0016244 | |||
| 3001 | Ga0495622_0033985 | |||
| 3002 | Ga0495622_0061317 | |||
| 3003 | Ga0495622_0191348 | |||
| 3004 | Ga0495622_0352903 | |||
| 3005 | Ga0495633_0010195 | |||
| 3006 | Ga0495633_0017696 | |||
| 3007 | Ga0495633_0032840 | |||
| 3008 | Ga0495633_0051460 | |||
| 3009 | Ga0495633_0099041 | |||
| 3010 | Ga0495633_0105604 | |||
| 3011 | Ga0495633_0190322 | |||
| 3012 | Ga0495633_0342535 | |||
| 3013 | Ga0495633_0353490 | |||
| 3014 | Ga0495633_0496025 | |||
| 3015 | Ga0495633_0524675 | |||
| 3016 | Ga0495667_0042014 | |||
| 3017 | Ga0495656_0010822 | |||
| 3018 | Ga0495656_0040826 | |||
| 3019 | Ga0495656_0100242 | |||
| 3020 | Ga0495656_0107150 | |||
| 3021 | Ga0495656_0115998 | |||
| 3022 | Ga0495668_0002640 | |||
| 3023 | Ga0495668_0005163 | |||
| 3024 | Ga0495668_0008733 | |||
| 3025 | Ga0495668_0011342 | |||
| 3026 | Ga0495668_0063066 | |||
| 3027 | Ga0495668_0092399 | |||
| 3028 | Ga0495668_0129828 | |||
| 3029 | Ga0495668_0174806 | |||
| 3030 | Ga0495668_0195544 | |||
| 3031 | Ga0495668_0284779 | |||
| 3032 | Ga0495668_0309249 | |||
| 3033 | Ga0495668_0447727 | |||
| 3034 | Ga0495668_0831789 | |||
| 3035 | Ga0495634_0014598 | |||
| 3036 | Ga0495634_0400610 | |||
| 3037 | Ga0495611_0001662 | |||
| 3038 | Ga0495611_0002069 | |||
| 3039 | Ga0495611_0005909 | |||
| 3040 | Ga0495611_0007454 | |||
| 3041 | Ga0495611_0011467 | |||
| 3042 | Ga0495611_0020577 | |||
| 3043 | Ga0495611_0041368 | |||
| 3044 | Ga0495611_0305916 | |||
| 3045 | Ga0495625_0005454 | |||
| 3046 | Ga0495625_0018357 | |||
| 3047 | Ga0495625_0042626 | |||
| 3048 | Ga0495625_0056429 | |||
| 3049 | Ga0495625_0090743 | |||
| 3050 | Ga0495625_0095414 | |||
| 3051 | Ga0495625_0214661 | |||
| 3052 | Ga0495625_0223273 | |||
| 3053 | Ga0495625_0388500 | |||
| 3054 | Ga0495625_0550096 | |||
| 3055 | Ga0495635_0026620 | |||
| 3056 | Ga0495635_0181994 | |||
| 3057 | Ga0495635_0904837 | |||
| 3058 | Ga0495659_0002211 | |||
| 3059 | Ga0495659_0037680 | |||
| 3060 | Ga0495659_0041386 | |||
| 3061 | Ga0495659_0092967 | |||
| 3062 | Ga0495659_0093772 | |||
| 3063 | Ga0495659_0105752 | |||
| 3064 | Ga0495659_0393753 | |||
| 3065 | Ga0495661_0018525 | |||
| 3066 | Ga0495661_0022142 | |||
| 3067 | Ga0495661_0048413 | |||
| 3068 | Ga0495661_0060113 | |||
| 3069 | Ga0495661_0061371 | |||
| 3070 | Ga0495661_0068457 | |||
| 3071 | Ga0495661_0071076 | |||
| 3072 | Ga0495661_0127892 | |||
| 3073 | Ga0495661_0128906 | |||
| 3074 | Ga0495661_0169133 | |||
| 3075 | Ga0495661_0206455 | |||
| 3076 | Ga0495661_0208125 | |||
| 3077 | Ga0495661_0324453 | |||
| 3078 | Ga0495661_0413168 | |||
| 3079 | Ga0495661_0417194 | |||
| 3080 | Ga0495661_0623059 | |||
| 3081 | Ga0495588_0000091 | |||
| 3082 | Ga0495588_0009876 | |||
| 3083 | Ga0495588_0022754 | |||
| 3084 | Ga0495588_0032819 | |||
| 3085 | Ga0495588_0038295 | |||
| 3086 | Ga0495588_0075112 | |||
| 3087 | Ga0495588_0126891 | |||
| 3088 | Ga0495588_0167032 | |||
| 3089 | Ga0495588_0219939 | |||
| 3090 | Ga0495588_0258362 | |||
| 3091 | Ga0495657_0046439 | |||
| 3092 | Ga0495599_0001590 | |||
| 3093 | Ga0495599_0061532 | |||
| 3094 | Ga0495599_0569109 | |||
| 3095 | Ga0495623_0008893 | |||
| 3096 | Ga0495623_0020652 | |||
| 3097 | Ga0495623_0228894 | |||
| 3098 | Ga0495646_0063908 | |||
| 3099 | Ga0495646_0403601 | |||
| 3100 | Ga0495669_0001596 | |||
| 3101 | Ga0495669_0015677 | |||
| 3102 | Ga0495669_0084861 | |||
| 3103 | Ga0495669_0091582 | |||
| 3104 | Ga0495669_0157656 | |||
| 3105 | Ga0495669_0420575 | |||
| 3106 | Ga0495613_0337429 | |||
| 3107 | Ga0495624_0036411 | |||
| 3108 | Ga0495624_0069735 | |||
| 3109 | Ga0495670_0004991 | |||
| 3110 | Ga0495670_0010742 | |||
| 3111 | Ga0495670_0015412 | |||
| 3112 | Ga0495670_0019932 | |||
| 3113 | Ga0495670_0031340 | |||
| 3114 | Ga0495670_0081921 | |||
| 3115 | Ga0495670_0135699 | |||
| 3116 | Ga0495670_0381420 | |||
| 3117 | Ga0495670_0448993 | |||
| 3118 | Ga0495670_0488228 | |||
| 3119 | Ga0495671_0000037 | |||
| 3120 | Ga0495671_0085680 | |||
| 3121 | Ga0495671_0118753 | |||
| 3122 | Ga0495671_0198747 | |||
| 3123 | Ga0495671_0325797 | |||
| 3124 | Ga0495649_0012662 | |||
| 3125 | Ga0495649_0027792 | |||
| 3126 | Ga0495649_0073185 | |||
| 3127 | Ga0495649_0098580 | |||
| 3128 | Ga0495649_0118681 | |||
| 3129 | Ga0495649_0387844 | |||
| 3130 | Ga0495649_0600575 | |||
| 3131 | Ga0495649_0691454 | |||
| 3132 | Ga0495589_0014264 | |||
| 3133 | Ga0495589_0029351 | |||
| 3134 | Ga0495589_0030733 | |||
| 3135 | Ga0495589_0037560 | |||
| 3136 | Ga0495589_0072308 | |||
| 3137 | Ga0495589_0101699 | |||
| 3138 | Ga0495589_0114336 | |||
| 3139 | Ga0495589_0183245 | |||
| 3140 | Ga0495589_0472950 | |||
| 3141 | Ga0495600_0004009 | |||
| 3142 | Ga0495600_0006486 | |||
| 3143 | Ga0495600_0423937 | |||
| 3144 | Ga0495600_0754054 | |||
| 3145 | Ga0495660_0001966 | |||
| 3146 | Ga0495660_0007547 | |||
| 3147 | Ga0495660_0010186 | |||
| 3148 | Ga0495660_0030532 | |||
| 3149 | Ga0495660_0034825 | |||
| 3150 | Ga0495660_0296308 | |||
| 3151 | Ga0495660_0498638 | |||
| 3152 | Ga0495581_0018479 | |||
| 3153 | Ga0495581_0095106 | |||
| 3154 | Ga0495581_0203954 | |||
| 3155 | Ga0495581_0354421 | |||
| 3156 | Ga0495604_0003421 | |||
| 3157 | Ga0495604_0010101 | |||
| 3158 | Ga0495604_0010804 | |||
| 3159 | Ga0495604_0063319 | |||
| 3160 | Ga0495604_0738025 | |||
| 3161 | Ga0495636_0001434 | |||
| 3162 | Ga0495636_0002112 | |||
| 3163 | Ga0495636_0003788 | |||
| 3164 | Ga0495636_0013181 | |||
| 3165 | Ga0495636_0545651 | |||
| 3166 | Ga0495674_0009303 | |||
| 3167 | Ga0495674_0289372 | |||
| 3168 | Ga0495672_0000013 | |||
| 3169 | Ga0495672_0000157 | |||
| 3170 | Ga0495672_0007686 | |||
| 3171 | Ga0495672_0016220 | |||
| 3172 | Ga0495672_0020286 | |||
| 3173 | Ga0495672_0021784 | |||
| 3174 | Ga0495672_0069849 | |||
| 3175 | Ga0495672_0082508 | |||
| 3176 | Ga0495672_0247872 | |||
| 3177 | Ga0495676_0004545 | |||
| 3178 | Ga0495676_0031634 | |||
| 3179 | Ga0495676_0135297 | |||
| 3180 | Ga0495676_0157887 | |||
| 3181 | Ga0495676_0167264 | |||
| 3182 | Ga0495680_0272308 | |||
| 3183 | Ga0495680_0398534 | |||
| 3184 | Ga0495680_0465911 | |||
| 3185 | Ga0495683_0003225 | |||
| 3186 | Ga0495683_0014031 | |||
| 3187 | Ga0495683_0015642 | |||
| 3188 | Ga0495683_0043280 | |||
| 3189 | Ga0495683_0081874 | |||
| 3190 | Ga0495683_0148116 | |||
| 3191 | Ga0495683_0228820 | |||
| 3192 | Ga0495683_0388285 | |||
| 3193 | Ga0495687_000342 | |||
| 3194 | Ga0495687_001562 | |||
| 3195 | Ga0495687_002781 | |||
| 3196 | Ga0495687_002921 | |||
| 3197 | Ga0495687_011455 | |||
| 3198 | Ga0495687_023933 | |||
| 3199 | Ga0495687_024921 | |||
| 3200 | Ga0495687_055162 | |||
| 3201 | Ga0495687_069898 | |||
| 3202 | Ga0495687_089986 | |||
| 3203 | Ga0495687_090176 | |||
| 3204 | Ga0495675_0021158 | |||
| 3205 | Ga0495675_0038185 | |||
| 3206 | Ga0495675_0249845 | |||
| 3207 | Ga0495675_0340054 | |||
| 3208 | Ga0495677_0001866 | |||
| 3209 | Ga0495677_0016634 | |||
| 3210 | Ga0495677_0032598 | |||
| 3211 | Ga0495677_0035722 | |||
| 3212 | Ga0495677_0084424 | |||
| 3213 | Ga0495677_0102771 | |||
| 3214 | Ga0495677_0107809 | |||
| 3215 | Ga0495677_0125506 | |||
| 3216 | Ga0495677_0161241 | |||
| 3217 | Ga0495677_0166219 | |||
| 3218 | Ga0495677_0180237 | |||
| 3219 | Ga0495677_0270108 | |||
| 3220 | Ga0495679_005019 | |||
| 3221 | Ga0495679_006474 | |||
| 3222 | Ga0495679_025594 | |||
| 3223 | Ga0495679_070561 | |||
| 3224 | Ga0495679_160771 | |||
| 3225 | Ga0495685_000474 | |||
| 3226 | Ga0495685_009709 | |||
| 3227 | Ga0495685_069325 | |||
| 3228 | Ga0495685_095624 | |||
| 3229 | Ga0495685_099061 | |||
| 3230 | Ga0495685_221769 | |||
| 3231 | Ga0495673_0000248 | |||
| 3232 | Ga0495673_0010480 | |||
| 3233 | Ga0495673_0017349 | |||
| 3234 | Ga0495681_0012224 | |||
| 3235 | Ga0495681_0043132 | |||
| 3236 | Ga0495681_0053354 | |||
| 3237 | Ga0495681_0072599 | |||
| 3238 | Ga0495681_0089523 | |||
| 3239 | Ga0495681_0113480 | |||
| 3240 | Ga0495681_0146985 | |||
| 3241 | Ga0495681_0160248 | |||
| 3242 | Ga0495681_0176785 | |||
| 3243 | Ga0495681_0290220 | |||
| 3244 | Ga0495681_0401191 | |||
| 3245 | Ga0495686_0007683 | |||
| 3246 | Ga0495686_0012785 | |||
| 3247 | Ga0495686_0018441 | |||
| 3248 | Ga0495686_0021073 | |||
| 3249 | Ga0495686_0062817 | |||
| 3250 | Ga0495686_0070207 | |||
| 3251 | Ga0495686_0617336 | |||
| 3252 | Ga0495593_0002955 | |||
| 3253 | Ga0495593_0015516 | |||
| 3254 | Ga0495593_0016080 | |||
| 3255 | Ga0495593_0304065 | |||
| 3256 | Ga0495602_0049802 | |||
| 3257 | Ga0495602_0187032 | |||
| 3258 | Ga0495602_0236904 | |||
| 3259 | Ga0495614_0054658 | |||
| 3260 | Ga0495614_0178530 | |||
| 3261 | Ga0495615_0038328 | |||
| 3262 | Ga0495615_0287656 | |||
| 3263 | Ga0495626_0002147 | |||
| 3264 | Ga0495626_0014493 | |||
| 3265 | Ga0495626_0029462 | |||
| 3266 | Ga0495626_0032266 | |||
| 3267 | Ga0495626_0037979 | |||
| 3268 | Ga0495626_0054009 | |||
| 3269 | Ga0495626_0074354 | |||
| 3270 | Ga0495626_0091062 | |||
| 3271 | Ga0495626_0117815 | |||
| 3272 | Ga0495626_0174463 | |||
| 3273 | Ga0495626_0379776 | |||
| 3274 | Ga0496100_0014114 | |||
| 3275 | Ga0496100_0848752 | |||
| 3276 | Ga0496100_1570695 | |||
| 3277 | Ga0496101_0056958 | |||
| 3278 | Ga0496101_0161155 | |||
| 3279 | Ga0496101_0947987 | |||
| 3280 | Ga0496102_0022102 | |||
| 3281 | Ga0496102_0315662 | |||
| 3282 | Ga0496102_0447744 | |||
| 3283 | Ga0496102_0499438 | |||
| 3284 | Ga0496102_0823476 | |||
| 3285 | Ga0496102_1208221 | |||
| 3286 | Ga0496103_0010940 | |||
| 3287 | Ga0496103_0014572 | |||
| 3288 | Ga0496103_0020711 | |||
| 3289 | Ga0496103_0100485 | |||
| 3290 | Ga0496103_0420848 | |||
| 3291 | Ga0496103_0540278 | |||
| 3292 | Ga0496104_0224974 | |||
| 3293 | Ga0496104_0392286 | |||
| 3294 | Ga0496104_0562827 | |||
| 3295 | Ga0496105_0090765 | |||
| 3296 | Ga0496105_0731574 | |||
| 3297 | Ga0496106_0168970 | |||
| 3298 | Ga0496106_0217913 | |||
| 3299 | Ga0496106_0724466 | |||
| 3300 | Ga0496106_0738447 | |||
| 3301 | Ga0496107_0047151 | |||
| 3302 | Ga0496107_0122539 | |||
| 3303 | Ga0496107_0263854 | |||
| 3304 | Ga0496107_0324055 | |||
| 3305 | Ga0496108_0561420 | |||
| 3306 | Ga0496108_0597717 | |||
| 3307 | Ga0496108_1430065 | |||
| 3308 | Ga0496109_0584534 | |||
| 3309 | Ga0496109_1574844 | |||
| 3310 | Ga0496110_0110339 | |||
| 3311 | Ga0496110_0454328 | |||
| 3312 | Ga0496110_1223550 | |||
| 3313 | Ga0496110_1819096 | |||
| 3314 | Ga0496111_0076448 | |||
| 3315 | Ga0496111_0135130 | |||
| 3316 | Ga0496112_1052819 | |||
| 3317 | Ga0496112_1832459 | |||
| 3318 | Ga0496114_0041004 | |||
| 3319 | Ga0496114_0863153 | |||
| 3320 | Ga0496115_0050480 | |||
| 3321 | Ga0496115_0137305 | |||
| 3322 | Ga0496115_0202044 | |||
| 3323 | Ga0496115_0337943 | |||
| 3324 | Ga0496115_0575713 | |||
| 3325 | Ga0496115_1123949 | |||
| 3326 | Ga0496116_0078388 | |||
| 3327 | Ga0496117_0000005 | |||
| 3328 | Ga0496117_0323166 | |||
| 3329 | Ga0496118_0000031 | |||
| 3330 | Ga0496118_0426591 | |||
| 3331 | Ga0496119_0071811 | |||
| 3332 | Ga0496120_0160080 | |||
| 3333 | Ga0496121_0004491 | |||
| 3334 | Ga0496121_0018508 | |||
| 3335 | Ga0496121_0023798 | |||
| 3336 | Ga0496121_0042385 | |||
| 3337 | Ga0496121_0114637 | |||
| 3338 | Ga0496121_0508057 | |||
| 3339 | Ga0496122_0005873 | |||
| 3340 | Ga0496122_0211557 | |||
| 3341 | Ga0496122_0499701 | |||
| 3342 | Ga0496123_0005104 | |||
| 3343 | Ga0496123_0020755 | |||
| 3344 | Ga0496123_0048880 | |||
| 3345 | Ga0496123_0273029 | |||
| 3346 | Ga0496124_0001830 | |||
| 3347 | Ga0496124_0009077 | |||
| 3348 | Ga0496124_0015482 | |||
| 3349 | Ga0496124_0101682 | |||
| 3350 | Ga0496124_0120196 | |||
| 3351 | Ga0496124_0279288 | |||
| 3352 | Ga0496124_0571215 | |||
| 3353 | Ga0496124_0618387 | |||
| 3354 | Ga0496125_0005905 | |||
| 3355 | Ga0496125_0009685 | |||
| 3356 | Ga0496125_0013937 | |||
| 3357 | Ga0496125_0040516 | |||
| 3358 | Ga0496125_0129144 | |||
| 3359 | Ga0496125_0211435 | |||
| 3360 | Ga0496125_0376596 | |||
| 3361 | Ga0496125_0405857 | |||
| 3362 | Ga0496126_0004622 | |||
| 3363 | Ga0496126_0317516 | |||
| 3364 | Ga0496126_0619610 | |||
| 3365 | Ga0501306_000005 | |||
| 3366 | Ga0501306_000979 | |||
| 3367 | Ga0501306_001799 | |||
| 3368 | Ga0501306_003684 | |||
| 3369 | Ga0501306_008516 | |||
| 3370 | Ga0501306_018600 | |||
| 3371 | Ga0501306_030700 | |||
| 3372 | Ga0501306_038015 | |||
| 3373 | Ga0501306_038884 | |||
| 3374 | Ga0501306_087384 | |||
| 3375 | Ga0501308_000002 | |||
| 3376 | Ga0501308_000177 | |||
| 3377 | Ga0501308_000386 | |||
| 3378 | Ga0501308_005794 | |||
| 3379 | Ga0501308_008008 | |||
| 3380 | Ga0501308_009740 | |||
| 3381 | Ga0501308_020892 | |||
| 3382 | Ga0501308_025496 | |||
| 3383 | Ga0501308_028896 | |||
| 3384 | Ga0501308_029721 | |||
| 3385 | Ga0501308_056773 | |||
| 3386 | Ga0501308_069780 | |||
| 3387 | Ga0501309_000464 | |||
| 3388 | Ga0501309_002567 | |||
| 3389 | Ga0501309_003438 | |||
| 3390 | Ga0501309_004776 | |||
| 3391 | Ga0501309_013328 | |||
| 3392 | Ga0501309_030503 | |||
| 3393 | Ga0501310_000065 | |||
| 3394 | Ga0501310_002047 | |||
| 3395 | Ga0501310_002676 | |||
| 3396 | Ga0501310_004061 | |||
| 3397 | Ga0501310_008997 | |||
| 3398 | Ga0501310_009999 | |||
| 3399 | Ga0501310_014411 | |||
| 3400 | Ga0501310_018690 | |||
| 3401 | Ga0501310_023172 | |||
| 3402 | Ga0501310_023895 | |||
| 3403 | Ga0501310_024232 | |||
| 3404 | Ga0501310_029314 | |||
| 3405 | Ga0501310_029604 | |||
| 3406 | Ga0501310_042297 | |||
| 3407 | Ga0501310_073912 | |||
| 3408 | Ga0501341_00897 | |||
| 3409 | Ga0501341_05783 | |||
| 3410 | Ga0501341_07080 | |||
| 3411 | Ga0501341_15080 | |||
| 3412 | Ga0501343_000585 | |||
| 3413 | Ga0501343_000946 | |||
| 3414 | Ga0501343_002039 | |||
| 3415 | Ga0501343_006485 | |||
| 3416 | Ga0501343_008083 | |||
| 3417 | Ga0501343_011815 | |||
| 3418 | Ga0501344_01065 | |||
| 3419 | Ga0501344_04650 | |||
| 3420 | Ga0501344_05240 | |||
| 3421 | Ga0501345_00091 | |||
| 3422 | Ga0501304_000001 | |||
| 3423 | Ga0501304_000986 | |||
| 3424 | Ga0501304_001750 | |||
| 3425 | Ga0501304_002722 | |||
| 3426 | Ga0501304_013411 | |||
| 3427 | Ga0501304_023108 | |||
| 3428 | Ga0501304_024999 | |||
| 3429 | Ga0501305_000399 | |||
| 3430 | Ga0501305_000819 | |||
| 3431 | Ga0501305_003101 | |||
| 3432 | Ga0501305_004353 | |||
| 3433 | Ga0501305_011851 | |||
| 3434 | Ga0501305_012120 | |||
| 3435 | Ga0501305_014715 | |||
| 3436 | Ga0501305_034752 | |||
| 3437 | Ga0501305_066877 | |||
| 3438 | Ga0501305_082266 | |||
| 3439 | Ga0501307_000313 | |||
| 3440 | Ga0501307_000583 | |||
| 3441 | Ga0501307_000963 | |||
| 3442 | Ga0501307_005419 | |||
| 3443 | Ga0501307_006878 | |||
| 3444 | Ga0501307_012923 | |||
| 3445 | Ga0501307_016299 | |||
| 3446 | Ga0501307_016459 | |||
| 3447 | Ga0501307_038688 | |||
| 3448 | Ga0501307_051118 | |||
| 3449 | Ga0501307_082101 | |||
| 3450 | Ga0495678_000010 | |||
| 3451 | Ga0495678_006909 | |||
| 3452 | Ga0495678_013870 | |||
| 3453 | Ga0495678_025294 | |||
| 3454 | Ga0495678_058347 | |||
| 3455 | Ga0495678_125922 | |||
| 3456 | Ga0495682_0004602 | |||
| 3457 | Ga0495682_0039543 | |||
| 3458 | Ga0495682_0040889 | |||
| 3459 | Ga0495682_0057328 | |||
| 3460 | Ga0501291_102997 | |||
| 3461 | Ga0501298_149702 | |||
| 3462 | Ga0501299_056087 | |||
| 3463 | Ga0501300_044609 | |||
| 3464 | Ga0501301_021515 | |||
| 3465 | Ga0501311_000002 | |||
| 3466 | Ga0501311_004818 | |||
| 3467 | Ga0501311_010684 | |||
| 3468 | Ga0501311_012041 | |||
| 3469 | Ga0501311_031969 | |||
| 3470 | Ga0501311_053518 | |||
| 3471 | Ga0501311_062752 | |||
| 3472 | Ga0501312_004364 | |||
| 3473 | Ga0501312_005434 | |||
| 3474 | Ga0501312_006206 | |||
| 3475 | Ga0501312_012205 | |||
| 3476 | Ga0501312_020539 | |||
| 3477 | Ga0501312_024758 | |||
| 3478 | Ga0501312_024759 | |||
| 3479 | Ga0501312_029738 | |||
| 3480 | Ga0501312_034907 | |||
| 3481 | Ga0501312_098925 | |||
| 3482 | Ga0501313_000012 | |||
| 3483 | Ga0501313_000686 | |||
| 3484 | Ga0501313_001951 | |||
| 3485 | Ga0501313_007422 | |||
| 3486 | Ga0501313_022404 | |||
| 3487 | Ga0501314_000622 | |||
| 3488 | Ga0501314_001267 | |||
| 3489 | Ga0501314_005240 | |||
| 3490 | Ga0501314_014323 | |||
| 3491 | Ga0501314_027263 | |||
| 3492 | Ga0501314_029997 | |||
| 3493 | Ga0501314_043415 | |||
| 3494 | Ga0501315_000004 | |||
| 3495 | Ga0501315_000082 | |||
| 3496 | Ga0501315_001820 | |||
| 3497 | Ga0501315_005197 | |||
| 3498 | Ga0501315_006843 | |||
| 3499 | Ga0501315_008816 | |||
| 3500 | Ga0501315_020164 | |||
| 3501 | Ga0501315_021631 | |||
| 3502 | Ga0501315_032762 | |||
| 3503 | Ga0501315_061027 | |||
| 3504 | Ga0501315_070785 | |||
| 3505 | Ga0501315_076019 | |||
| 3506 | Ga0501316_000002 | |||
| 3507 | Ga0501316_000608 | |||
| 3508 | Ga0501316_011965 | |||
| 3509 | Ga0501316_012649 | |||
| 3510 | Ga0501316_013073 | |||
| 3511 | Ga0501316_023380 | |||
| 3512 | Ga0501316_033072 | |||
| 3513 | Ga0501316_058934 | |||
| 3514 | Ga0501316_064078 | |||
| 3515 | Ga0501316_079238 | |||
| 3516 | Ga0501317_000565 | |||
| 3517 | Ga0501317_001174 | |||
| 3518 | Ga0501317_009930 | |||
| 3519 | Ga0501317_024341 | |||
| 3520 | Ga0501317_043563 | |||
| 3521 | Ga0501317_045370 | |||
| 3522 | Ga0501317_048067 | |||
| 3523 | Ga0501317_049979 | |||
| 3524 | Ga0501318_000292 | |||
| 3525 | Ga0501318_002062 | |||
| 3526 | Ga0501318_002754 | |||
| 3527 | Ga0501318_008537 | |||
| 3528 | Ga0501318_015106 | |||
| 3529 | Ga0501318_088309 | |||
| 3530 | Ga0501319_000071 | |||
| 3531 | Ga0501319_000080 | |||
| 3532 | Ga0501319_002073 | |||
| 3533 | Ga0501319_002652 | |||
| 3534 | Ga0501319_006814 | |||
| 3535 | Ga0501319_010549 | |||
| 3536 | Ga0501319_027091 | |||
| 3537 | Ga0501320_000176 | |||
| 3538 | Ga0501320_000935 | |||
| 3539 | Ga0501320_003295 | |||
| 3540 | Ga0501320_004743 | |||
| 3541 | Ga0501320_005008 | |||
| 3542 | Ga0501320_006579 | |||
| 3543 | Ga0501320_007575 | |||
| 3544 | Ga0501320_010965 | |||
| 3545 | Ga0501320_021334 | |||
| 3546 | Ga0501320_027177 | |||
| 3547 | Ga0501320_046170 | |||
| 3548 | Ga0501320_055096 | |||
| 3549 | Ga0501320_057117 | |||
| 3550 | Ga0501320_060230 | |||
| 3551 | Ga0501320_060558 | |||
| 3552 | Ga0501321_001325 | |||
| 3553 | Ga0501321_001469 | |||
| 3554 | Ga0501321_003832 | |||
| 3555 | Ga0501321_010433 | |||
| 3556 | Ga0501321_012219 | |||
| 3557 | Ga0501321_012554 | |||
| 3558 | Ga0501321_013256 | |||
| 3559 | Ga0501321_013278 | |||
| 3560 | Ga0501321_020595 | |||
| 3561 | Ga0501321_072790 | |||
| 3562 | Ga0501322_000544 | |||
| 3563 | Ga0501322_000699 | |||
| 3564 | Ga0501322_004204 | |||
| 3565 | Ga0501322_004747 | |||
| 3566 | Ga0501322_007469 | |||
| 3567 | Ga0501322_010011 | |||
| 3568 | Ga0501322_011712 | |||
| 3569 | Ga0501323_000169 | |||
| 3570 | Ga0501323_000193 | |||
| 3571 | Ga0501323_000710 | |||
| 3572 | Ga0501323_001897 | |||
| 3573 | Ga0501323_012054 | |||
| 3574 | Ga0501323_025879 | |||
| 3575 | Ga0501323_029492 | |||
| 3576 | Ga0501323_046603 | |||
| 3577 | Ga0501323_055610 | |||
| 3578 | Ga0501323_077991 | |||
| 3579 | Ga0501324_000433 | |||
| 3580 | Ga0501324_004674 | |||
| 3581 | Ga0501324_005894 | |||
| 3582 | Ga0501324_010339 | |||
| 3583 | Ga0501324_010831 | |||
| 3584 | Ga0501324_014280 | |||
| 3585 | Ga0501324_016549 | |||
| 3586 | Ga0501324_019768 | |||
| 3587 | Ga0501324_040499 | |||
| 3588 | Ga0501324_042627 | |||
| 3589 | Ga0501325_004347 | |||
| 3590 | Ga0501325_015283 | |||
| 3591 | Ga0501325_017804 | |||
| 3592 | Ga0501325_020463 | |||
| 3593 | Ga0501325_034826 | |||
| 3594 | Ga0501326_00189 | |||
| 3595 | Ga0501326_00267 | |||
| 3596 | Ga0501326_11809 | |||
| 3597 | Ga0501327_00604 | |||
| 3598 | Ga0501327_02933 | |||
| 3599 | Ga0501327_09272 | |||
| 3600 | Ga0501328_00400 | |||
| 3601 | Ga0501328_09994 | |||
| 3602 | Ga0501329_02712 | |||
| 3603 | Ga0501329_05630 | |||
| 3604 | Ga0501329_13596 | |||
| 3605 | Ga0501330_002006 | |||
| 3606 | Ga0501330_006947 | |||
| 3607 | Ga0501330_015962 | |||
| 3608 | Ga0501332_10413 | |||
| 3609 | Ga0501332_14445 | |||
| 3610 | Ga0501333_011666 | |||
| 3611 | Ga0501333_015352 | |||
| 3612 | Ga0501334_01394 | |||
| 3613 | Ga0501334_05682 | |||
| 3614 | Ga0501334_07543 | |||
| 3615 | Ga0501334_12104 | |||
| 3616 | Ga0501335_000409 | |||
| 3617 | Ga0501335_016359 | |||
| 3618 | Ga0501335_023262 | |||
| 3619 | Ga0501335_023611 | |||
| 3620 | Ga0501335_025828 | |||
| 3621 | Ga0501335_029274 | |||
| 3622 | Ga0501335_032355 | |||
| 3623 | Ga0501336_000167 | |||
| 3624 | Ga0501336_001363 | |||
| 3625 | Ga0501337_003001 | |||
| 3626 | Ga0501337_005538 | |||
| 3627 | Ga0501337_006521 | |||
| 3628 | Ga0501337_010797 | |||
| 3629 | Ga0501337_010948 | |||
| 3630 | Ga0501337_014108 | |||
| 3631 | Ga0501337_015299 | |||
| 3632 | Ga0501338_00312 | |||
| 3633 | Ga0501338_10404 | |||
| 3634 | Ga0501339_00948 | |||
| 3635 | Ga0501340_001367 | |||
| 3636 | Ga0501340_002758 | |||
| 3637 | Ga0501340_007553 | |||
| 3638 | Ga0501340_014173 | |||
| 3639 | Ga0501031_0477807 | |||
| 3640 | Ga0501031_0565482 | |||
| 3641 | Ga0501032_0005689 | |||
| 3642 | Ga0501033_0001803 | |||
| 3643 | Ga0501033_0706795 | |||
| 3644 | Ga0501034_0029030 | |||
| 3645 | Ga0501036_0011113 | |||
| 3646 | Ga0501037_0029069 | |||
| 3647 | Ga0501037_0046758 | |||
| 3648 | Ga0501038_0004562 | |||
| 3649 | Ga0501038_0286054 | |||
| 3650 | Ga0501038_0434049 | |||
| 3651 | Ga0501039_0138984 | |||
| 3652 | Ga0501043_0011146 | |||
| 3653 | Ga0501043_0093617 | |||
| 3654 | Ga0501043_0197840 | |||
| 3655 | Ga0501046_0007619 | |||
| 3656 | Ga0501047_0089170 | |||
| 3657 | Ga0501047_0708154 | |||
| 3658 | Ga0501047_1156958 | |||
| 3659 | Ga0501048_0432662 | |||
| 3660 | Ga0501199_038701 | |||
| 3661 | Ga0501202_039928 | |||
| 3662 | Ga0501207_084022 | |||
| 3663 | Ga0501211_021197 | |||
| 3664 | Ga0501222_036527 | |||
| 3665 | Ga0501227_015572 | |||
| 3666 | Ga0501230_001749 | |||
| 3667 | Ga0501233_025241 | |||
| 3668 | Ga0501235_104667 | |||
| 3669 | Ga0501238_000213 | |||
| 3670 | Ga0501238_011742 | |||
| 3671 | Ga0501246_003814 | |||
| 3672 | Ga0501249_216847 | |||
| 3673 | Ga0501221_006424 | |||
| 3674 | Ga0501229_003004 | |||
| 3675 | Ga0501234_034107 | |||
| 3676 | Ga0501241_033343 | |||
| 3677 | Ga0501262_000574 | |||
| 3678 | Ga0501263_012109 | |||
| 3679 | Ga0501265_002083 | |||
| 3680 | Ga0501268_046021 | |||
| 3681 | Ga0501269_000003 | |||
| 3682 | Ga0501269_002814 | |||
| 3683 | Ga0501276_018743 | |||
| 3684 | Ga0501279_000683 | |||
| 3685 | Ga0501279_008680 | |||
| 3686 | Ga0501035_0007388 | |||
| 3687 | Ga0501035_0010452 | |||
| 3688 | Ga0501035_0010523 | |||
| 3689 | Ga0501035_0084650 | |||
| 3690 | Ga0501035_1312417 | |||
| 3691 | Ga0501035_1376759 | |||
| 3692 | Ga0501035_1550089 | |||
| 3693 | Ga0501044_0000210 | |||
| 3694 | Ga0501044_0007653 | |||
| 3695 | Ga0501044_0025863 | |||
| 3696 | Ga0501044_0241667 | |||
| 3697 | Ga0501226_040218 | |||
| 3698 | nmdc:mga03683_192040_c1 | |||
| 3699 | nmdc:mga03683_22136_c1 | |||
| 3700 | nmdc:mga03n38_4851_c1 | |||
| 3701 | nmdc:mga03n38_59764_c1 | |||
| 3702 | nmdc:mga00v17_25609_c1 | |||
| 3703 | nmdc:mga00v17_630988_c1 | |||
| 3704 | nmdc:mga0yw44_371288_c1 | |||
| 3705 | nmdc:mga0k408_52239_c1 | |||
| 3706 | nmdc:mga0k408_679800_c1 | |||
| 3707 | nmdc:mga0k408_712_c1 | |||
| 3708 | nmdc:mga06z11_3023_c1 | |||
| 3709 | nmdc:mga04h51_47659_c1 | |||
| 3710 | nmdc:mga07m45_348122_c1 | |||
| 3711 | nmdc:mga07m45_67895_c1 | |||
| 3712 | nmdc:mga07m45_691362_c1 | |||
| 3713 | nmdc:mga06r32_1149912_c1 | |||
| 3714 | nmdc:mga0n895_1079125_c1 | |||
| 3715 | nmdc:mga0rr50_1578394_c1 | |||
| 3716 | nmdc:mga0a205_104296_c1 | |||
| 3717 | nmdc:mga0sz30_3989_c1 | |||
| 3718 | Ga0495601_0117248 | |||
| 3719 | Ga0495619_0772700 | |||
| 3720 | Ga0500578_0003978 | |||
| 3721 | Ga0500643_134293 | |||
| 3722 | Ga0500646_0011171 | |||
| 3723 | Ga0500651_0000274 | |||
| 3724 | Ga0500650_0072451 | |||
| 3725 | Ga0500556_0257267 | |||
| 3726 | Ga0500562_016703 | |||
| 3727 | Ga0500562_151087 | |||
| 3728 | Ga0500569_001743 | |||
| 3729 | Ga0500572_221041 | |||
| 3730 | Ga0500593_257026 | |||
| 3731 | Ga0500594_0063615 | |||
| 3732 | Ga0500594_0086002 | |||
| 3733 | Ga0500595_008416 | |||
| 3734 | Ga0500618_002645 | |||
| 3735 | Ga0500621_177758 | |||
| 3736 | Ga0500628_048117 | |||
| 3737 | Ga0500642_0002530 | |||
| 3738 | Ga0500652_000400 | |||
| 3739 | Ga0500655_119690 | |||
| 3740 | Ga0500561_0020973 | |||
| 3741 | Ga0500561_0067768 | |||
| 3742 | Ga0500568_0013644 | |||
| 3743 | Ga0500573_0295304 | |||
| 3744 | Ga0500574_000403 | |||
| 3745 | Ga0500574_028175 | |||
| 3746 | Ga0500577_0006134 | |||
| 3747 | Ga0500577_0202515 | |||
| 3748 | Ga0500586_006873 | |||
| 3749 | Ga0500586_053986 | |||
| 3750 | Ga0500588_0219596 | |||
| 3751 | Ga0500604_0033502 | |||
| 3752 | Ga0500616_0028067 | |||
| 3753 | Ga0500619_089331 | |||
| 3754 | Ga0500622_0000198 | |||
| 3755 | Ga0500624_004964 | |||
| 3756 | Ga0500627_0121237 | |||
| 3757 | Ga0500627_0246273 | |||
| 3758 | Ga0500634_0000642 | |||
| 3759 | Ga0500636_0464995 | |||
| 3760 | Ga0500637_0321398 | |||
| 3761 | Ga0500552_082609 | |||
| 3762 | Ga0500661_099610 | |||
| 3763 | Ga0587084_000213 | |||
| 3764 | Ga0587084_000401 | |||
| 3765 | Ga0587084_025419 | |||
| 3766 | Ga0587084_035365 | |||
| 3767 | Ga0587084_043931 | |||
| 3768 | Ga0587093_000380 | |||
| 3769 | Ga0587093_001062 | |||
| 3770 | Ga0587093_052406 | |||
| 3771 | Ga0587093_060912 | |||
| 3772 | Ga0587093_092837 | |||
| 3773 | Ga0587066_000001 | |||
| 3774 | Ga0587066_001525 | |||
| 3775 | Ga0587066_073625 | |||
| 3776 | Ga0587070_004333 | |||
| 3777 | Ga0587070_030492 | |||
| 3778 | Ga0587070_116654 | |||
| 3779 | Ga0587073_0000035 | |||
| 3780 | Ga0587073_0122107 | |||
| 3781 | Ga0587077_000648 | |||
| 3782 | Ga0587077_007748 | |||
| 3783 | Ga0587077_118437 | |||
| 3784 | Ga0587077_154127 | |||
| 3785 | Ga0587080_000038 | |||
| 3786 | Ga0587080_012184 | |||
| 3787 | Ga0587080_018572 | |||
| 3788 | Ga0587080_021806 | |||
| 3789 | Ga0587082_000027 | |||
| 3790 | Ga0587082_008647 | |||
| 3791 | Ga0587082_016254 | |||
| 3792 | Ga0587082_050421 | |||
| 3793 | Ga0587083_0000039 | |||
| 3794 | Ga0587083_0000305 | |||
| 3795 | Ga0587083_0010072 | |||
| 3796 | Ga0587083_0031320 | |||
| 3797 | Ga0587083_0055289 | |||
| 3798 | Ga0587085_002630 | |||
| 3799 | Ga0587085_002980 | |||
| 3800 | Ga0587085_007329 | |||
| 3801 | Ga0587085_057021 | |||
| 3802 | Ga0587086_000453 | |||
| 3803 | Ga0587086_000753 | |||
| 3804 | Ga0587088_000001 | |||
| 3805 | Ga0587088_001117 | |||
| 3806 | Ga0587088_169938 | |||
| 3807 | Ga0587089_000565 | |||
| 3808 | Ga0587089_001052 | |||
| 3809 | Ga0587090_001908 | |||
| 3810 | Ga0587090_003259 | |||
| 3811 | Ga0587090_011821 | |||
| 3812 | Ga0587090_018838 | |||
| 3813 | Ga0587091_002949 | |||
| 3814 | Ga0587091_007570 | |||
| 3815 | Ga0587091_010932 | |||
| 3816 | Ga0587092_000969 | |||
| 3817 | Ga0587092_003731 | |||
| 3818 | Ga0587092_009204 | |||
| 3819 | Ga0587092_069447 | |||
| 3820 | Ga0587092_159481 | |||
| 3821 | Ga0587094_008925 | |||
| 3822 | Ga0587094_012910 | |||
| 3823 | Ga0587095_002116 | |||
| 3824 | Ga0587095_009187 | |||
| 3825 | Ga0587097_02013 | |||
| 3826 | Ga0587098_012861 | |||
| 3827 | Ga0587106_000122 | |||
| 3828 | Ga0587106_001550 | |||
| 3829 | Ga0587106_017006 | |||
| 3830 | Ga0587121_00999 | |||
| 3831 | Ga0587121_05107 | |||
| 3832 | Ga0587125_002765 | |||
| 3833 | Ga0587125_012182 | |||
| 3834 | Ga0587125_017429 | |||
| 3835 | Ga0587125_036413 | |||
| 3836 | Ga0587125_057661 | |||
| 3837 | Ga0587129_000136 | |||
| 3838 | Ga0587129_014311 | |||
| 3839 | Ga0587131_001141 | |||
| 3840 | Ga0587131_015980 | |||
| 3841 | Ga0587099_000239 | |||
| 3842 | Ga0587099_001284 | |||
| 3843 | Ga0587101_000023 | |||
| 3844 | Ga0587101_002644 | |||
| 3845 | Ga0587101_092996 | |||
| 3846 | Ga0587109_004786 | |||
| 3847 | Ga0587109_012058 | |||
| 3848 | Ga0587109_013863 | |||
| 3849 | Ga0587109_191445 | |||
| 3850 | Ga0587113_000311 | |||
| 3851 | Ga0587113_006187 | |||
| 3852 | Ga0587113_018749 | |||
| 3853 | Ga0587115_002966 | |||
| 3854 | Ga0587115_004133 | |||
| 3855 | Ga0587117_000748 | |||
| 3856 | Ga0587117_000981 | |||
| 3857 | Ga0587117_044136 | |||
| 3858 | Ga0587122_014627 | |||
| 3859 | Ga0587127_001579 | |||
| 3860 | Ga0587127_004190 | |||
| 3861 | Ga0587128_001779 | |||
| 3862 | Ga0587128_002699 | |||
| 3863 | Ga0587130_003257 | |||
| 3864 | Ga0587130_014083 | |||
| 3865 | Ga0587062_000153 | |||
| 3866 | Ga0587062_000195 | |||
| 3867 | Ga0587062_006619 | |||
| 3868 | Ga0587062_013939 | |||
| 3869 | Ga0587062_022912 | |||
| 3870 | Ga0587062_112775 | |||
| 3871 | Ga0587067_000932 | |||
| 3872 | Ga0587068_000002 | |||
| 3873 | Ga0587068_000350 | |||
| 3874 | Ga0587068_001305 | |||
| 3875 | Ga0587068_039055 | |||
| 3876 | Ga0587068_101698 | |||
| 3877 | Ga0587069_000016 | |||
| 3878 | Ga0587069_001975 | |||
| 3879 | Ga0587069_012065 | |||
| 3880 | Ga0587072_000243 | |||
| 3881 | Ga0587072_005559 | |||
| 3882 | Ga0587072_005813 | |||
| 3883 | Ga0587075_000415 | |||
| 3884 | Ga0587075_013252 | |||
| 3885 | Ga0587075_058867 | |||
| 3886 | Ga0587076_002771 | |||
| 3887 | Ga0587076_002988 | |||
| 3888 | Ga0587076_014419 | |||
| 3889 | Ga0587076_021100 | |||
| 3890 | Ga0587076_106658 | |||
| 3891 | Ga0587078_000244 | |||
| 3892 | Ga0587078_012895 | |||
| 3893 | Ga0587078_037889 | |||
| 3894 | Ga0587079_000033 | |||
| 3895 | Ga0587079_000584 | |||
| 3896 | Ga0587079_006516 | |||
| 3897 | Ga0587079_012865 | |||
| 3898 | Ga0587079_092121 | |||
| 3899 | Ga0587100_000902 | |||
| 3900 | Ga0587102_000132 | |||
| 3901 | Ga0587102_001309 | |||
| 3902 | Ga0587102_001768 | |||
| 3903 | Ga0587102_019367 | |||
| 3904 | Ga0587104_000049 | |||
| 3905 | Ga0587104_021262 | |||
| 3906 | Ga0587105_000034 | |||
| 3907 | Ga0587105_000662 | |||
| 3908 | Ga0587107_000182 | |||
| 3909 | Ga0587107_007809 | |||
| 3910 | Ga0587107_021182 | |||
| 3911 | Ga0587107_108298 | |||
| 3912 | Ga0587108_000210 | |||
| 3913 | Ga0587108_002115 | |||
| 3914 | Ga0587110_002612 | |||
| 3915 | Ga0587110_011354 | |||
| 3916 | Ga0587114_000232 | |||
| 3917 | Ga0587114_003206 | |||
| 3918 | Ga0587116_00707 | |||
| 3919 | Ga0587116_08269 | |||
| 3920 | Ga0587118_00408 | |||
| 3921 | Ga0587118_10377 | |||
| 3922 | Ga0587119_002359 | |||
| 3923 | Ga0587119_003321 | |||
| 3924 | Ga0587120_001451 | |||
| 3925 | Ga0587120_002256 | |||
| 3926 | Ga0587120_024873 | |||
| 3927 | Ga0587124_000978 | |||
| 3928 | Ga0587124_007578 | |||
| 3929 | Ga0587124_017743 | |||
| 3930 | Ga0587060_002032 | |||
| 3931 | Ga0587060_006033 | |||
| 3932 | Ga0587065_01425 | |||
| 3933 | Ga0587081_02283 | |||
| 3934 | Ga0587096_00164 | |||
| 3935 | Ga0587096_02023 | |||
| 3936 | Ga0587071_001255 | |||
| 3937 | Ga0587071_001373 | |||
| 3938 | Ga0587071_005333 | |||
| 3939 | Ga0587071_007249 | |||
| 3940 | Ga0587071_033378 | |||
| 3941 | Ga0587111_0000116 | |||
| 3942 | Ga0587111_0000229 | |||
| 3943 | Ga0587111_0000781 | |||
| 3944 | Ga0587111_0007805 | |||
| 3945 | Ga0587111_0009542 | |||
| 3946 | Ga0587111_0020018 | |||
| 3947 | Ga0587111_0021839 | |||
| 3948 | Ga0587111_0027306 | |||
| 3949 | Ga0587111_0037879 | |||
| 3950 | Ga0587111_0044090 | |||
| 3951 | Ga0587111_0092093 | |||
| 3952 | Ga0587111_0130804 | |||
| 3953 | Ga0466962_0041637 | |||
| 3954 | Ga0466962_0081191 | |||
| 3955 | 2587725925 | |||
| 3956 | 2587735576 | |||
| 3957 | 2588292862 | |||
| 3958 | 2643967971 | |||
| 3959 | 2644143129 | |||
| 3960 | 2644271783 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgk-assembly1.cif.gz_t | lincomycin and avilamycin bound to the 50s subunit | 0.9513 | 4 | 102 |
| 8cgv-assembly1.cif.gz_t | tiamulin bound to the 50s subunit | 0.9493 | 4 | 102 |
| 6vwn-assembly1.cif.gz_S | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) | 0.9465 | 3 | 102 |
| 6vwl-assembly1.cif.gz_S | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) | 0.9465 | 4 | 102 |
| 8cam-assembly1.cif.gz_t | evernimicin bound to the 50s subunit | 0.9461 | 3 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9034 | 4 | 100 | 2.30.30.30 |
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8991 | 1 | 99 | 2.30.30.30 |
| af_C6SX56_4_111_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8802 | 4 | 99 | 2.30.30.30 |
| af_Q69T55_240_282_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8692 | 4 | 36 | 2.30.30.30 |
| af_Q96A35_47_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8673 | 4 | 101 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X3CUS3-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9628 | 1 | 69 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-T1CBJ6-F1-model_v4 | 50S ribosomal protein L24 | 0.9612 | 2 | 65 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-E0TJ37-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.949 | 1 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7V9INT9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9432 | 1 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2S8H2I7-F1-model_v4 | deleted | 0.9423 | 1 | 104 |
|