F496192

General Info

Members Datasets Scaffolds Average Seq Length
1980 695 3960 104

Family's Representative Sequence

Representative Sequence 3300049127|Ga0501306_050997|Ga0501306_050997_264_653
Length 129
Sequence VTRELRTEKFMKIVSLAPEVLYGVAMDKIRKNDEVIVLAGKDKGKRGVVSRRVDAEHVIVEGVNVAKKAVKPNPMTGVQGGIVDKTMPIHVSNVALFNAATGKADRVGFKDQDGKKVRVYKSSGEEVKV

Samples

Sample ID Description Type Environment
1 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002863 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_12 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300002864 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003157 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003159 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
43 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
45 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
63 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
130 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
144 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
145 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
149 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
150 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
151 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
170 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
175 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
176 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
185 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
186 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
187 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
188 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
191 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
192 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
248 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
254 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
256 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
260 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
261 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
262 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
263 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
264 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
265 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
266 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
267 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
268 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
274 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
275 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
276 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
277 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
280 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
283 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
284 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
285 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
288 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
289 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
290 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
291 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
303 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
304 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
305 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
306 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
307 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
308 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
309 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
310 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
311 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
312 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
313 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
314 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
315 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
316 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
317 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
318 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
319 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
322 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
323 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
324 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
325 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
326 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
327 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
328 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
329 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
330 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
331 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
332 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
333 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
336 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
337 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
338 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
339 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
340 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
341 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
342 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
343 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
344 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
345 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
346 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
347 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
348 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
349 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
350 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
351 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
352 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
353 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
354 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
355 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
356 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
357 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
358 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
359 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
360 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
361 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
362 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
363 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
364 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
365 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
366 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
369 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
370 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
371 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
372 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
373 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
374 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
375 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
376 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
377 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
378 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
379 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
380 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
381 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
382 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
383 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
384 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
385 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
386 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
387 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
388 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
389 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
390 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
391 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
392 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
393 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
396 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
397 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
398 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
399 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
400 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
401 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
402 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
403 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
404 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
405 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
406 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
407 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
408 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
409 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
410 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
411 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
412 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
413 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
414 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
415 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
416 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
417 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
418 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
419 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
420 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
425 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
426 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
427 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
428 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
429 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
430 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
431 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
432 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
433 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
434 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
435 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
436 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
437 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
438 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
439 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
440 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
441 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
442 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
443 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
444 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
445 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
446 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
447 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
448 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
449 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
450 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
451 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
452 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
453 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
454 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
455 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
456 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
457 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
458 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
459 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
460 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
461 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
462 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
463 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
464 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
465 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
466 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
467 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
468 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
469 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
470 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
471 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
472 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
473 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
474 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
475 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
476 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
477 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
480 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
481 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
482 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
483 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
484 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
485 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
486 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
487 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
488 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
489 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
490 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
491 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
502 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
503 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
504 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
505 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
506 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
507 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
508 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
547 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
548 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
549 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
550 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
551 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
552 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
553 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
554 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
555 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
556 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
557 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
558 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
559 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
560 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
561 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
562 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
563 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
564 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
565 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
566 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
567 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
568 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
569 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
570 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
571 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
572 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
575 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
576 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
577 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
578 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
579 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
580 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
581 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
582 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
583 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
584 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
585 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
586 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
587 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
588 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
589 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
590 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
591 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
592 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
593 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
594 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
595 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
596 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
597 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
598 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
599 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
600 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
601 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
602 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
603 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
604 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
605 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
606 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
607 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
608 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
609 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
610 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
611 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
612 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
613 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
614 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
615 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
616 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
617 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
618 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
619 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
620 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
621 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
622 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
623 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
624 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
625 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
626 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
643 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
667 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
668 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
669 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
670 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
671 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
672 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
673 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
674 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
675 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
676 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
677 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
678 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
679 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
680 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
681 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
682 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
683 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
684 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
685 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
690 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
691 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
692 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
693 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
694 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
695 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 68.28
Metatranscriptomes 31.41
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.65
Nodule 0.3
Rhizoplane 4.09
Rhizosphere 81.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501306_050997 3300049127 Bacteria 663
2 JGI24737J22298_10004492 3300001990 Bacteria 4859
3 JGI25154J39366_1001042 3300002738 Bacteria 11063
4 JGI25158J39367_1000542 3300002739 Bacteria 7614
5 JGI25157J39369_1015755 3300002741 Bacteria 929
6 JGI25164J39214_1003736 3300002772 Bacteria 1860
7 JGI25152J39213_1001073 3300002773 Bacteria 12895
8 JGI25150J39212_1001923 3300002774 Bacteria 5456
9 JGI25150J39212_1003907 3300002774 Bacteria 3415
10 JGI25150J39212_1011120 3300002774 Bacteria 1644
11 JGI25150J39212_1030565 3300002774 Bacteria 748
12 Ga0006769J43182_103907 3300002863 Bacteria 1733
13 Ga0006764J43180_105416 3300002864 Bacteria 2303
14 Ga0006761J43178_105065 3300002865 Bacteria 1679
15 Ga0006767J43181_105098 3300002868 Bacteria 2522
16 Ga0006767J43181_109868 3300002868 Bacteria 844
17 Ga0006763J43179_104166 3300002870 Bacteria 5040
18 Ga0006762J43184_104373 3300002872 Bacteria 1440
19 JGI25159J45721_1016429 3300002987 Bacteria 1576
20 JGI25159J45721_1022081 3300002987 Bacteria 1184
21 JGI25159J45721_1043703 3300002987 Bacteria 642
22 Ga0006774J45829_10836 3300003157 Bacteria 1242
23 Ga0006760J45825_101715 3300003158 Bacteria 2437
24 Ga0006760J45825_103029 3300003158 Bacteria 14292
25 Ga0006771J45828_104476 3300003159 Bacteria 1300
26 Ga0006779J45831_104820 3300003160 Bacteria 2487
27 Ga0006765J45826_105454 3300003161 Bacteria 4839
28 Ga0006765J45826_116824 3300003161 Bacteria 875
29 Ga0006778J45830_1013714 3300003162 Bacteria 8778
30 Ga0006778J45830_1030895 3300003162 Bacteria 960
31 Ga0006778J45830_1104448 3300003162 Bacteria 902
32 Ga0006759J45824_1006644 3300003163 Bacteria 1579
33 Ga0006759J45824_1006645 3300003163 Bacteria 4182
34 Ga0006759J45824_1010973 3300003163 Bacteria 1154
35 Ga0006759J45824_1011122 3300003163 Bacteria 15613
36 Ga0006759J45824_1019946 3300003163 Bacteria 12757
37 Ga0006759J45824_1026362 3300003163 Bacteria 8907
38 Ga0006759J45824_1037247 3300003163 Bacteria 729
39 Ga0006759J45824_1057424 3300003163 Bacteria 748
40 Ga0006759J45824_1062806 3300003163 Bacteria 789
41 JGI25151J46595_10026799 3300003187 Bacteria 2320
42 JGI25165J46597_1000239 3300003214 Bacteria 75240
43 JGI25153J46596_10002258 3300003215 Bacteria 11225
44 JGI25153J46596_10007740 3300003215 Bacteria 5229
45 JGI25153J46596_10024369 3300003215 Bacteria 2183
46 Ga0007428J48920_101526 3300003288 Bacteria 3934
47 Ga0007421J48921_104512 3300003291 Bacteria 6358
48 Ga0006758J48902_1003545 3300003300 Bacteria 8441
49 Ga0006758J48902_1003546 3300003300 Bacteria 6400
50 Ga0006758J48902_1008804 3300003300 Bacteria 15348
51 Ga0006758J48902_1008911 3300003300 Bacteria 7674
52 Ga0006758J48902_1015271 3300003300 Bacteria 2328
53 Ga0006758J48902_1015967 3300003300 Bacteria 4965
54 Ga0006758J48902_1016024 3300003300 Bacteria 1731
55 Ga0006758J48902_1016608 3300003300 Bacteria 2081
56 Ga0006758J48902_1016798 3300003300 Bacteria 862
57 Ga0006758J48902_1029777 3300003300 Bacteria 900
58 Ga0006770J48903_1010652 3300003305 Bacteria 1486
59 Ga0006770J48903_1021042 3300003305 Bacteria 2673
60 Ga0006770J48903_1024757 3300003305 Bacteria 880
61 Ga0006770J48903_1030572 3300003305 Bacteria 742
62 Ga0006770J48903_1033615 3300003305 Bacteria 748
63 Ga0006770J48903_1040316 3300003305 Bacteria 4936
64 Ga0006777J48905_1009816 3300003308 Bacteria 3090
65 Ga0006777J48905_1042888 3300003308 Bacteria 2543
66 Ga0006777J48905_1043988 3300003308 Bacteria 1148
67 Ga0006777J48905_1047191 3300003308 Bacteria 998
68 rootL2_10028224 3300003322 Bacteria 1983
69 JGI25160J50197_1001051 3300003354 Bacteria 14224
70 JGI25161J50226_1008067 3300003374 Bacteria 1667
71 Ga0007417J51691_1002612 3300003544 Bacteria 14201
72 Ga0007417J51691_1007850 3300003544 Bacteria 19719
73 Ga0007417J51691_1011781 3300003544 Bacteria 8032
74 Ga0007417J51691_1014485 3300003544 Bacteria 716
75 Ga0007417J51691_1022403 3300003544 Bacteria 2809
76 Ga0007417J51691_1024669 3300003544 Bacteria 1438
77 Ga0007427J51700_104411 3300003559 Bacteria 3323
78 Ga0007427J51700_113492 3300003559 Bacteria 2911
79 Ga0007427J51700_117468 3300003559 Bacteria 1942
80 Ga0006781J51513_1010997 3300003568 Bacteria 3463
81 Ga0007410J51695_1002373 3300003574 Bacteria 2540
82 Ga0007410J51695_1004597 3300003574 Bacteria 14339
83 Ga0007410J51695_1005374 3300003574 Bacteria 15855
84 Ga0007410J51695_1012689 3300003574 Bacteria 12724
85 Ga0007410J51695_1020776 3300003574 Bacteria 2365
86 Ga0007410J51695_1025455 3300003574 Bacteria 2936
87 Ga0007410J51695_1042924 3300003574 Bacteria 983
88 Ga0007409J51694_1000684 3300003575 Bacteria 1425
89 Ga0007409J51694_1002576 3300003575 Bacteria 16363
90 Ga0007409J51694_1020347 3300003575 Bacteria 2058
91 Ga0007409J51694_1020348 3300003575 Bacteria 2313
92 Ga0007409J51694_1027019 3300003575 Bacteria 1636
93 Ga0007409J51694_1029751 3300003575 Bacteria 1903
94 Ga0007409J51694_1032549 3300003575 Bacteria 1530
95 Ga0007409J51694_1069872 3300003575 Bacteria 1698
96 Ga0007409J51694_1071440 3300003575 Bacteria 641
97 Ga0007416J51690_1002712 3300003577 Bacteria 1549
98 Ga0007416J51690_1004870 3300003577 Bacteria 16169
99 Ga0007416J51690_1010696 3300003577 Bacteria 1937
100 Ga0007416J51690_1019156 3300003577 Bacteria 6450
101 Ga0007416J51690_1023149 3300003577 Bacteria 4016
102 Ga0007416J51690_1028700 3300003577 Bacteria 634
103 Ga0007416J51690_1030690 3300003577 Bacteria 1156
104 Ga0007416J51690_1049107 3300003577 Bacteria 871
105 Ga0007429J51699_1007754 3300003579 Bacteria 1077
106 Ga0007429J51699_1031025 3300003579 Bacteria 1503
107 Ga0007429J51699_1050371 3300003579 Bacteria 1543
108 Ga0007411J51799_103551 3300003611 Bacteria 13349
109 Ga0007411J51799_103780 3300003611 Bacteria 16516
110 Ga0007411J51799_104897 3300003611 Bacteria 1525
111 Ga0007411J51799_110137 3300003611 Bacteria 1041
112 Ga0007415J51800_102854 3300003613 Bacteria 5009
113 Ga0007415J51800_104265 3300003613 Bacteria 1228
114 Ga0007415J51800_106957 3300003613 Bacteria 14800
115 Ga0007415J51800_109527 3300003613 Bacteria 1274
116 Ga0007415J51800_115272 3300003613 Bacteria 759
117 Ga0032354_1003171 3300003693 Bacteria 2717
118 Ga0032354_1003173 3300003693 Bacteria 3128
119 Ga0032354_1010694 3300003693 Bacteria 15995
120 Ga0032354_1011582 3300003693 Bacteria 1078
121 Ga0032354_1028048 3300003693 Bacteria 2080
122 Ga0032354_1033344 3300003693 Bacteria 1370
123 Ga0032354_1045145 3300003693 Bacteria 2372
124 Ga0032354_1061607 3300003693 Bacteria 627
125 Ga0006766_111745 3300003717 Bacteria 2278
126 Ga0006766_113576 3300003717 Bacteria 2845
127 Ga0006780_1003428 3300003735 Bacteria 4512
128 Ga0006780_1013040 3300003735 Bacteria 1768
129 Ga0055538_1000094 3300003751 Bacteria 75240
130 Ga0055538_1000138 3300003751 Bacteria 51369
131 Ga0055539_1000136 3300003752 Bacteria 76284
132 Ga0055539_1000187 3300003752 Bacteria 51369
133 Ga0055533_1000143 3300003756 Bacteria 75240
134 Ga0055533_1000189 3300003756 Bacteria 51369
135 Ga0055525_1000018 3300003759 Bacteria 393974
136 Ga0055525_1000188 3300003759 Bacteria 75240
137 Ga0055525_1000254 3300003759 Bacteria 51369
138 Ga0055542_1019379 3300003762 Bacteria 1017
139 Ga0055529_1000079 3300003763 Bacteria 149370
140 Ga0055526_1000791 3300003771 Bacteria 23567
141 Ga0055526_1006085 3300003771 Bacteria 6666
142 Ga0055526_1091554 3300003771 Bacteria 573
143 Ga0055526_1091670 3300003771 Bacteria 572
144 Ga0055537_1008487 3300003773 Bacteria 2366
145 Ga0055524_1003212 3300003775 Bacteria 8017
146 Ga0055524_1009814 3300003775 Bacteria 3861
147 Ga0055534_1006739 3300003784 Bacteria 2847
148 Ga0055534_1030376 3300003784 Bacteria 835
149 Ga0055528_1039396 3300003790 Bacteria 1080
150 Ga0055528_1041929 3300003790 Bacteria 1014
151 Ga0055528_1064545 3300003790 Bacteria 679
152 Ga0055530_10013385 3300003791 Bacteria 2803
153 Ga0055530_10019398 3300003791 Bacteria 2061
154 Ga0055531_10006076 3300003794 Bacteria 6916
155 Ga0055541_1000092 3300003841 Bacteria 75240
156 Ga0055541_1000122 3300003841 Bacteria 51369
157 Ga0055543_1050694 3300004625 Bacteria 680
158 Ga0058858_1025387 3300004785 Bacteria 767
159 Ga0058858_1044898 3300004785 Bacteria 1684
160 Ga0058858_1357897 3300004785 Bacteria 668
161 Ga0058858_1365258 3300004785 Bacteria 818
162 Ga0058858_1437652 3300004785 Bacteria 1459
163 Ga0058859_10052933 3300004798 Bacteria 1647
164 Ga0058859_10157838 3300004798 Bacteria 1459
165 Ga0058859_11479387 3300004798 Bacteria 907
166 Ga0058859_11797660 3300004798 Bacteria 1044
167 Ga0058863_10085600 3300004799 Bacteria 3459
168 Ga0058863_11897775 3300004799 Bacteria 1362
169 Ga0058861_10000050 3300004800 Bacteria 1287
170 Ga0058861_10025764 3300004800 Bacteria 1145
171 Ga0058861_10123833 3300004800 Bacteria 1216
172 Ga0058860_10186761 3300004801 Bacteria 1353
173 Ga0058862_10030562 3300004803 Bacteria 611
174 Ga0058862_10086046 3300004803 Bacteria 2163
175 Ga0058862_10117947 3300004803 Bacteria 991
176 Ga0058862_12858774 3300004803 Bacteria 1953
177 Ga0065165_1007979 3300005262 Bacteria 5065
178 Ga0065165_1045530 3300005262 Bacteria 1277
179 Ga0065165_1109781 3300005262 Bacteria 680
180 Ga0065714_10003225 3300005288 Bacteria 8263
181 Ga0065714_10030331 3300005288 Bacteria 1114
182 Ga0065714_10081698 3300005288 Bacteria 2356
183 Ga0065704_10033996 3300005289 Bacteria 1164
184 Ga0065704_10109441 3300005289 Bacteria 1994
185 Ga0065715_10029350 3300005293 Bacteria 1109
186 Ga0065707_10395474 3300005295 Bacteria 859
187 Ga0065707_10423369 3300005295 Bacteria 828
188 Ga0070676_10056596 3300005328 Bacteria 2318
189 Ga0070683_100088965 3300005329 Bacteria 2897
190 Ga0070670_100298688 3300005331 Bacteria 1408
191 Ga0068869_100399932 3300005334 Bacteria 1130
192 Ga0068869_100512863 3300005334 Bacteria 1003
193 Ga0070666_10594539 3300005335 Bacteria 807
194 Ga0070680_100156061 3300005336 Bacteria 1917
195 Ga0070680_100350879 3300005336 Bacteria 1254
196 Ga0070682_100289738 3300005337 Bacteria 1197
197 Ga0070660_100033862 3300005339 Bacteria 3855
198 Ga0070660_100450254 3300005339 Bacteria 1068
199 Ga0070661_100008785 3300005344 Bacteria 6991
200 Ga0070661_100240283 3300005344 Bacteria 1394
201 Ga0070692_10298703 3300005345 Bacteria 983
202 Ga0070692_10930305 3300005345 Bacteria 603
203 Ga0070675_100262088 3300005354 Bacteria 1515
204 Ga0070675_100617780 3300005354 Bacteria 984
205 Ga0070674_100422527 3300005356 Bacteria 1094
206 Ga0070674_101181066 3300005356 Bacteria 679
207 Ga0070673_100718252 3300005364 Bacteria 918
208 Ga0070688_100739901 3300005365 Bacteria 765
209 Ga0070659_100004652 3300005366 Bacteria 9804
210 Ga0070659_100548477 3300005366 Bacteria 989
211 Ga0070667_101147951 3300005367 Bacteria 727
212 Ga0070714_100277699 3300005435 Bacteria 1555
213 Ga0070705_101938002 3300005440 Bacteria 502
214 Ga0070694_100271604 3300005444 Bacteria 1289
215 Ga0070694_101396819 3300005444 Bacteria 591
216 Ga0070708_100853085 3300005445 Bacteria 856
217 Ga0070663_100474735 3300005455 Bacteria 1034
218 Ga0070678_100931172 3300005456 Bacteria 796
219 Ga0070678_101967645 3300005456 Bacteria 553
220 Ga0070662_100158386 3300005457 Bacteria 1769
221 Ga0070662_100795971 3300005457 Bacteria 803
222 Ga0070681_10288080 3300005458 Bacteria 1553
223 Ga0070681_11616310 3300005458 Bacteria 574
224 Ga0068867_100105263 3300005459 Bacteria 2160
225 Ga0070699_100350041 3300005518 Bacteria 1331
226 Ga0068853_100029320 3300005539 Bacteria 4637
227 Ga0068853_100284609 3300005539 Bacteria 1524
228 Ga0068853_100398896 3300005539 Bacteria 1287
229 Ga0070695_100618785 3300005545 Bacteria 852
230 Ga0070693_100948056 3300005547 Bacteria 648
231 Ga0070665_101901578 3300005548 Bacteria 601
232 Ga0070704_100761978 3300005549 Bacteria 862
233 Ga0068855_100166634 3300005563 Bacteria 2497
234 Ga0068855_100247815 3300005563 Bacteria 1988
235 Ga0068855_100431713 3300005563 Bacteria 1440
236 Ga0068855_101136806 3300005563 Bacteria 815
237 Ga0068855_102593924 3300005563 Bacteria 503
238 Ga0070664_100027769 3300005564 Bacteria 4705
239 Ga0068857_100009923 3300005577 Bacteria 8264
240 Ga0068854_100016031 3300005578 Bacteria 4985
241 Ga0068854_100368679 3300005578 Bacteria 1180
242 Ga0068854_100677887 3300005578 Bacteria 888
243 Ga0068856_100049792 3300005614 Bacteria 4130
244 Ga0068856_100266346 3300005614 Bacteria 1729
245 Ga0068856_100477995 3300005614 Bacteria 1267
246 Ga0070702_100090534 3300005615 Bacteria 1854
247 Ga0070702_101599888 3300005615 Bacteria 539
248 Ga0068852_100838091 3300005616 Bacteria 935
249 Ga0068864_100982145 3300005618 Bacteria 837
250 Ga0068861_102016474 3300005719 Bacteria 576
251 Ga0068851_10001517 3300005834 Bacteria 10195
252 Ga0068851_10034122 3300005834 Bacteria 2539
253 Ga0068870_10444775 3300005840 Bacteria 853
254 Ga0068863_100705757 3300005841 Bacteria 1003
255 Ga0068862_100722442 3300005844 Bacteria 967
256 Ga0068862_101325660 3300005844 Bacteria 722
257 Ga0070717_10765390 3300006028 Bacteria 878
258 Ga0075368_10189666 3300006042 Bacteria 868
259 Ga0075363_100005889 3300006048 Bacteria 5519
260 Ga0075363_100805349 3300006048 Bacteria 571
261 Ga0075364_10032491 3300006051 Bacteria 3355
262 Ga0075364_10092282 3300006051 Bacteria 2010
263 Ga0075362_10000222 3300006177 Bacteria 15765
264 Ga0075362_10000565 3300006177 Bacteria 10784
265 Ga0075367_10000855 3300006178 Bacteria 12145
266 Ga0075369_10005325 3300006186 Bacteria 4797
267 Ga0075366_10023561 3300006195 Bacteria 3587
268 Ga0075366_10033384 3300006195 Bacteria 3031
269 Ga0075366_10199541 3300006195 Bacteria 1216
270 Ga0075366_10218034 3300006195 Bacteria 1162
271 Ga0075366_10820726 3300006195 Bacteria 579
272 Ga0097621_100021406 3300006237 Bacteria 5001
273 Ga0075370_10001150 3300006353 Bacteria 11110
274 Ga0075370_10064344 3300006353 Bacteria 2091
275 Ga0075370_10104070 3300006353 Bacteria 1645
276 Ga0075370_10152303 3300006353 Bacteria 1355
277 Ga0068871_100015656 3300006358 Bacteria 5684
278 Ga0075433_10202721 3300006852 Bacteria 1764
279 Ga0068865_100074639 3300006881 Bacteria 2416
280 Ga0068865_100140074 3300006881 Bacteria 1823
281 Ga0068865_100921340 3300006881 Bacteria 761
282 Ga0079104_1004078 3300006946 Bacteria 6424
283 Ga0079104_1104358 3300006946 Bacteria 565
284 Ga0099826_10000010 3300006948 Bacteria 314346
285 Ga0075435_100367572 3300007076 Bacteria 1234
286 Ga0099794_10383343 3300007265 Bacteria 733
287 Ga0105244_10023517 3300009036 Bacteria 3377
288 Ga0105244_10028871 3300009036 Bacteria 2972
289 Ga0105244_10045359 3300009036 Bacteria 2262
290 Ga0105244_10084777 3300009036 Bacteria 1564
291 Ga0105244_10463019 3300009036 Bacteria 583
292 Ga0105240_10005705 3300009093 Bacteria 18471
293 Ga0105240_10009383 3300009093 Bacteria 13863
294 Ga0105240_10327528 3300009093 Bacteria 1744
295 Ga0105240_10523357 3300009093 Bacteria 1316
296 Ga0105245_10023078 3300009098 Bacteria 5460
297 Ga0105243_10006860 3300009148 Bacteria 8779
298 Ga0105243_10499114 3300009148 Bacteria 1153
299 Ga0105243_12034967 3300009148 Bacteria 609
300 Ga0105241_10057980 3300009174 Bacteria 2972
301 Ga0105242_10007953 3300009176 Bacteria 8168
302 Ga0105242_12640934 3300009176 Bacteria 551
303 Ga0105248_10539440 3300009177 Bacteria 1316
304 Ga0105237_10134008 3300009545 Bacteria 2472
305 Ga0105237_10460777 3300009545 Bacteria 1277
306 Ga0105238_10000255 3300009551 Bacteria 59531
307 Ga0105238_10162679 3300009551 Bacteria 2208
308 Ga0105238_10455386 3300009551 Bacteria 1277
309 Ga0105249_10303710 3300009553 Bacteria 1602
310 Ga0105249_13417083 3300009553 Bacteria 511
311 Ga0130087_1030513 3300009828 Bacteria 1078
312 Ga0130087_1090781 3300009828 Bacteria 1165
313 Ga0130087_1095535 3300009828 Bacteria 1211
314 Ga0130086_1025653 3300009829 Bacteria 1165
315 Ga0130086_1025943 3300009829 Bacteria 1211
316 Ga0130086_1026814 3300009829 Bacteria 1078
317 Ga0130085_1073923 3300009850 Bacteria 1165
318 Ga0130085_1083711 3300009850 Bacteria 1078
319 Ga0130085_1132233 3300009850 Bacteria 1211
320 Ga0105239_10001561 3300010375 Bacteria 30314
321 Ga0105246_10744899 3300011119 Bacteria 864
322 Ga0105246_12194323 3300011119 Bacteria 537
323 Ga0157321_1010116 3300012487 Bacteria 714
324 Ga0157319_1007161 3300012497 Bacteria 820
325 Ga0157327_1057832 3300012512 Bacteria 570
326 Ga0154014_155471 3300013052 Bacteria 1050
327 Ga0157373_10015732 3300013100 Bacteria 5524
328 Ga0157373_10154902 3300013100 Bacteria 1612
329 Ga0157373_10459447 3300013100 Bacteria 917
330 Ga0157371_10001564 3300013102 Bacteria 23533
331 Ga0157371_10250157 3300013102 Bacteria 1276
332 Ga0157371_10501027 3300013102 Bacteria 897
333 Ga0157370_10325401 3300013104 Bacteria 1418
334 Ga0157370_11707859 3300013104 Bacteria 565
335 Ga0157369_10315337 3300013105 Bacteria 1626
336 Ga0157374_10009298 3300013296 Bacteria 8429
337 Ga0157374_10143777 3300013296 Bacteria 2316
338 Ga0157378_10027087 3300013297 Bacteria 5057
339 Ga0157378_10248653 3300013297 Bacteria 1701
340 Ga0157378_11242214 3300013297 Bacteria 785
341 Ga0163162_10060438 3300013306 Bacteria 3825
342 Ga0163162_10103155 3300013306 Bacteria 2946
343 Ga0163162_10139871 3300013306 Bacteria 2533
344 Ga0157372_10991197 3300013307 Bacteria 973
345 Ga0157375_11430153 3300013308 Bacteria 815
346 Ga0157375_11776352 3300013308 Bacteria 731
347 Ga0182008_10001808 3300014497 Bacteria 13967
348 Ga0182008_10003186 3300014497 Bacteria 10028
349 Ga0182008_10039266 3300014497 Bacteria 2366
350 Ga0182008_10329668 3300014497 Bacteria 805
351 Ga0157377_10259659 3300014745 Bacteria 1130
352 Ga0157377_10637996 3300014745 Bacteria 765
353 Ga0157376_11698828 3300014969 Bacteria 666
354 Ga0182006_1000240 3300015261 Bacteria 51334
355 Ga0182006_1000274 3300015261 Bacteria 46140
356 Ga0182006_1048484 3300015261 Bacteria 1643
357 Ga0182006_1293840 3300015261 Bacteria 533
358 Ga0182007_10000196 3300015262 Bacteria 40434
359 Ga0182007_10014439 3300015262 Bacteria 2977
360 Ga0182007_10044315 3300015262 Bacteria 1476
361 Ga0182007_10098690 3300015262 Bacteria 966
362 Ga0182005_1000016 3300015265 Bacteria 346889
363 Ga0182005_1000163 3300015265 Bacteria 46142
364 Ga0182005_1000370 3300015265 Bacteria 24872
365 Ga0163161_10007196 3300017792 Bacteria 7692
366 Ga0163161_10039119 3300017792 Bacteria 3403
367 Ga0197907_10298599 3300020069 Bacteria 556
368 Ga0197907_10941484 3300020069 Bacteria 887
369 Ga0206355_1235934 3300020076 Bacteria 791
370 Ga0206352_10695704 3300020078 Bacteria 659
371 Ga0206352_11129984 3300020078 Bacteria 815
372 Ga0206354_11576217 3300020081 Bacteria 925
373 Ga0206353_10105939 3300020082 Bacteria 750
374 Ga0154015_1381451 3300020610 Bacteria 1317
375 Ga0213872_10000307 3300021361 Bacteria 41810
376 Ga0213872_10003461 3300021361 Bacteria 8770
377 Ga0213872_10041234 3300021361 Bacteria 2107
378 Ga0213872_10070274 3300021361 Bacteria 1578
379 Ga0213872_10070360 3300021361 Bacteria 1577
380 Ga0213872_10215334 3300021361 Bacteria 819
381 Ga0256744_118715 3300023309 Bacteria 1400
382 Ga0209760_109176 3300025207 Bacteria 688
383 Ga0209436_100401 3300025208 Bacteria 19545
384 Ga0209784_100010 3300025224 Bacteria 683664
385 Ga0209784_100035 3300025224 Bacteria 299760
386 Ga0209566_100008 3300025225 Bacteria 683664
387 Ga0209566_100040 3300025225 Bacteria 299760
388 Ga0209674_100019 3300025226 Bacteria 683664
389 Ga0209674_100057 3300025226 Bacteria 299760
390 Ga0209672_105905 3300025228 Bacteria 2050
391 Ga0209563_100011 3300025230 Bacteria 1187808
392 Ga0209563_100021 3300025230 Bacteria 683764
393 Ga0209563_100059 3300025230 Bacteria 299760
394 Ga0207427_100342 3300025231 Bacteria 30270
395 Ga0209437_100019 3300025233 Bacteria 683764
396 Ga0209437_103125 3300025233 Bacteria 3048
397 Ga0207425_1000021 3300025245 Bacteria 367537
398 Ga0207425_1000680 3300025245 Bacteria 18554
399 Ga0207425_1000845 3300025245 Bacteria 15112
400 Ga0207425_1000932 3300025245 Bacteria 13905
401 Ga0207425_1049412 3300025245 Bacteria 773
402 Ga0209646_1000068 3300025246 Bacteria 233765
403 Ga0209026_1003315 3300025250 Bacteria 5361
404 Ga0209677_100011 3300025253 Bacteria 683664
405 Ga0209677_100036 3300025253 Bacteria 299760
406 Ga0209677_102227 3300025253 Bacteria 7521
407 Ga0209148_1000444 3300025254 Bacteria 45400
408 Ga0209129_1000020 3300025258 Bacteria 457053
409 Ga0209129_1000158 3300025258 Bacteria 103711
410 Ga0209129_1052977 3300025258 Bacteria 615
411 Ga0209233_1000025 3300025261 Bacteria 683764
412 Ga0209565_1001042 3300025263 Bacteria 14043
413 Ga0209565_1006230 3300025263 Bacteria 3374
414 Ga0209565_1011005 3300025263 Bacteria 2222
415 Ga0209565_1077228 3300025263 Bacteria 553
416 Ga0209455_1000070 3300025272 Bacteria 307867
417 Ga0209455_1001216 3300025272 Bacteria 12270
418 Ga0209673_1000730 3300025273 Bacteria 45590
419 Ga0209673_1004093 3300025273 Bacteria 8026
420 Ga0209673_1004985 3300025273 Bacteria 6882
421 Ga0209673_1010299 3300025273 Bacteria 3948
422 Ga0209130_1010313 3300025284 Bacteria 2584
423 Ga0209675_1012428 3300025291 Bacteria 2743
424 Ga0209675_1046147 3300025291 Bacteria 922
425 Ga0209025_1006398 3300025294 Bacteria 9163
426 Ga0209564_1000027 3300025295 Bacteria 518458
427 Ga0209564_1000047 3300025295 Bacteria 368031
428 Ga0209564_1000282 3300025295 Bacteria 103837
429 Ga0209564_1002740 3300025295 Bacteria 13260
430 Ga0209564_1037233 3300025295 Bacteria 1375
431 Ga0209758_1000077 3300025297 Bacteria 268195
432 Ga0209758_1000322 3300025297 Bacteria 92458
433 Ga0209758_1000910 3300025297 Bacteria 40059
434 Ga0209758_1011080 3300025297 Bacteria 5275
435 Ga0209050_1000050 3300025298 Bacteria 362578
436 Ga0209050_1000223 3300025298 Bacteria 125465
437 Ga0209050_1002922 3300025298 Bacteria 13390
438 Ga0209256_1000054 3300025299 Bacteria 298431
439 Ga0209256_1002719 3300025299 Bacteria 13723
440 Ga0209256_1004416 3300025299 Bacteria 8844
441 Ga0209256_1009680 3300025299 Bacteria 4174
442 Ga0209256_1095645 3300025299 Bacteria 624
443 Ga0207426_1000802 3300025302 Bacteria 34010
444 Ga0209051_1018074 3300025303 Bacteria 3132
445 Ga0209051_1026168 3300025303 Bacteria 2358
446 Ga0209257_1000075 3300025304 Bacteria 324855
447 Ga0209257_1043589 3300025304 Bacteria 1315
448 Ga0207656_10040557 3300025321 Bacteria 1974
449 Ga0207656_10058704 3300025321 Bacteria 1682
450 Ga0207655_1000499 3300025728 Bacteria 50341
451 Ga0207655_1024949 3300025728 Bacteria 2916
452 Ga0207655_1028515 3300025728 Bacteria 2632
453 Ga0207655_1031488 3300025728 Bacteria 2443
454 Ga0207680_10310463 3300025903 Bacteria 1101
455 Ga0207647_10029480 3300025904 Bacteria 3551
456 Ga0207685_10411976 3300025905 Bacteria 695
457 Ga0207645_10064364 3300025907 Bacteria 2343
458 Ga0207643_10369110 3300025908 Bacteria 903
459 Ga0207705_10016800 3300025909 Bacteria 5240
460 Ga0207654_10109708 3300025911 Bacteria 1715
461 Ga0207695_10001345 3300025913 Bacteria 41663
462 Ga0207695_10174538 3300025913 Bacteria 2072
463 Ga0207695_10283352 3300025913 Bacteria 1551
464 Ga0207671_10007790 3300025914 Bacteria 9221
465 Ga0207671_10013783 3300025914 Bacteria 6419
466 Ga0207660_10096089 3300025917 Bacteria 2205
467 Ga0207657_10001495 3300025919 Bacteria 25015
468 Ga0207657_10030110 3300025919 Bacteria 4931
469 Ga0207657_10110762 3300025919 Bacteria 2268
470 Ga0207649_10086318 3300025920 Bacteria 2045
471 Ga0207652_10278953 3300025921 Bacteria 1507
472 Ga0207652_11458011 3300025921 Bacteria 588
473 Ga0207694_10000193 3300025924 Bacteria 61887
474 Ga0207694_10049485 3300025924 Bacteria 3254
475 Ga0207694_10633585 3300025924 Bacteria 900
476 Ga0207650_10051822 3300025925 Bacteria 3038
477 Ga0207659_10170020 3300025926 Bacteria 1719
478 Ga0207659_10205388 3300025926 Bacteria 1576
479 Ga0207687_10038586 3300025927 Bacteria 3265
480 Ga0207664_10675927 3300025929 Bacteria 928
481 Ga0207690_10000959 3300025932 Bacteria 18469
482 Ga0207690_10141151 3300025932 Bacteria 1775
483 Ga0207706_10008025 3300025933 Bacteria 9741
484 Ga0207706_10190592 3300025933 Bacteria 1800
485 Ga0207686_10344068 3300025934 Bacteria 1121
486 Ga0207686_10998987 3300025934 Bacteria 679
487 Ga0207686_11763727 3300025934 Bacteria 512
488 Ga0207709_10019899 3300025935 Bacteria 3780
489 Ga0207709_11186340 3300025935 Bacteria 629
490 Ga0207669_10288508 3300025937 Bacteria 1241
491 Ga0207669_10439485 3300025937 Bacteria 1031
492 Ga0207704_10041905 3300025938 Bacteria 2689
493 Ga0207704_11504908 3300025938 Bacteria 578
494 Ga0207665_10328579 3300025939 Bacteria 1149
495 Ga0207691_10977588 3300025940 Bacteria 707
496 Ga0207711_10196937 3300025941 Bacteria 1838
497 Ga0207689_10023710 3300025942 Bacteria 5147
498 Ga0207689_11576762 3300025942 Bacteria 547
499 Ga0207679_10002718 3300025945 Bacteria 10935
500 Ga0207667_10006290 3300025949 Bacteria 14403
501 Ga0207667_10100133 3300025949 Bacteria 2989
502 Ga0207667_10234580 3300025949 Bacteria 1878
503 Ga0207667_10465494 3300025949 Bacteria 1284
504 Ga0207667_11705803 3300025949 Bacteria 596
505 Ga0207651_10155920 3300025960 Bacteria 1784
506 Ga0207640_10004199 3300025981 Bacteria 7793
507 Ga0207640_10384480 3300025981 Bacteria 1138
508 Ga0207640_10393025 3300025981 Bacteria 1127
509 Ga0207639_10048176 3300026041 Bacteria 3224
510 Ga0207639_10485780 3300026041 Bacteria 1126
511 Ga0207678_10003236 3300026067 Bacteria 14714
512 Ga0207702_10043312 3300026078 Bacteria 3779
513 Ga0207702_10629001 3300026078 Bacteria 1055
514 Ga0207702_10905349 3300026078 Bacteria 874
515 Ga0207648_10166766 3300026089 Bacteria 1946
516 Ga0207674_10005520 3300026116 Bacteria 15020
517 Ga0207674_10033169 3300026116 Bacteria 5406
518 Ga0207674_11711104 3300026116 Bacteria 597
519 Ga0207675_101347115 3300026118 Bacteria 734
520 Ga0207683_10519516 3300026121 Bacteria 1100
521 Ga0207683_11336632 3300026121 Bacteria 663
522 Ga0207698_10180633 3300026142 Bacteria 1869
523 Ga0207698_10579895 3300026142 Bacteria 1103
524 Ga0207698_10973984 3300026142 Bacteria 858
525 Ga0207698_12351927 3300026142 Bacteria 544
526 Ga0209281_1002282 3300027111 Bacteria 8082
527 Ga0209281_1004157 3300027111 Bacteria 4423
528 Ga0209969_1018620 3300027360 Bacteria 1027
529 Ga0209984_1005637 3300027424 Bacteria 1511
530 Ga0209995_1009327 3300027471 Bacteria 1586
531 Ga0210002_1016192 3300027617 Bacteria 1179
532 Ga0209983_1024556 3300027665 Bacteria 1269
533 Ga0209282_1000072 3300027666 Bacteria 81137
534 Ga0209971_1088753 3300027682 Bacteria 754
535 Ga0209813_10024775 3300027866 Bacteria 1720
536 Ga0209974_10050246 3300027876 Bacteria 1400
537 Ga0268266_10446814 3300028379 Bacteria 1228
538 Ga0268265_10330997 3300028380 Bacteria 1383
539 Ga0307517_10103679 3300028786 Bacteria 2221
540 Ga0307515_10115015 3300028794 Bacteria 3104
541 Ga0307515_10288992 3300028794 Bacteria 1337
542 Ga0307515_10371984 3300028794 Bacteria 1065
543 Ga0307515_10485433 3300028794 Bacteria 847
544 Ga0265338_10293180 3300028800 Bacteria 1185
545 Ga0316177_1056223 3300030731 Bacteria 1049
546 Ga0316176_1064342 3300030732 Bacteria 1011
547 Ga0314311_1151902 3300030733 Bacteria 1608
548 Ga0314311_1236493 3300030733 Bacteria 568
549 Ga0316178_1001132 3300030735 Bacteria 2234
550 Ga0316180_1056555 3300030736 Bacteria 3840
551 Ga0316181_1006587 3300030744 Bacteria 1206
552 Ga0316181_1065259 3300030744 Bacteria 3733
553 Ga0265767_101870 3300030836 Bacteria 1076
554 Ga0265766_1000491 3300030863 Bacteria 1732
555 Ga0265766_1010647 3300030863 Bacteria 659
556 Ga0265766_1014427 3300030863 Bacteria 601
557 Ga0265769_105630 3300030888 Bacteria 767
558 Ga0265774_104728 3300031011 Bacteria 579
559 Ga0265779_102213 3300031043 Bacteria 919
560 Ga0265330_10000012 3300031235 Bacteria 180837
561 Ga0265332_10000012 3300031238 Bacteria 272641
562 Ga0265325_10006225 3300031241 Bacteria 7276
563 Ga0265316_10039600 3300031344 Bacteria 3784
564 Ga0307513_10019858 3300031456 Bacteria 7985
565 Ga0307513_10088393 3300031456 Bacteria 3167
566 Ga0307513_10663036 3300031456 Bacteria 750
567 Ga0307408_100013705 3300031548 Bacteria 5383
568 Ga0307408_100050653 3300031548 Bacteria 2987
569 Ga0307408_100181519 3300031548 Bacteria 1688
570 Ga0307408_100202378 3300031548 Bacteria 1608
571 Ga0307408_101120757 3300031548 Bacteria 731
572 Ga0307408_102297936 3300031548 Bacteria 522
573 Ga0265314_10000029 3300031711 Bacteria 272506
574 Ga0307405_12076467 3300031731 Bacteria 510
575 Ga0307413_10594475 3300031824 Bacteria 905
576 Ga0307413_11932844 3300031824 Bacteria 531
577 Ga0307518_10004256 3300031838 Bacteria 10276
578 Ga0326468_10029529 3300031889 Bacteria 717
579 Ga0307406_10116737 3300031901 Bacteria 1847
580 Ga0307406_10166340 3300031901 Bacteria 1591
581 Ga0307406_10603852 3300031901 Bacteria 905
582 Ga0307412_10198406 3300031911 Bacteria 1522
583 Ga0307412_10454576 3300031911 Bacteria 1056
584 Ga0307412_12200207 3300031911 Bacteria 513
585 Ga0307416_100002061 3300032002 Bacteria 11324
586 Ga0307416_100778036 3300032002 Bacteria 1051
587 Ga0307416_102262363 3300032002 Bacteria 644
588 Ga0307416_102582978 3300032002 Bacteria 606
589 Ga0307416_103007350 3300032002 Bacteria 564
590 Ga0307414_10047643 3300032004 Bacteria 2951
591 Ga0307414_10075764 3300032004 Bacteria 2442
592 Ga0307414_10283744 3300032004 Bacteria 1393
593 Ga0307414_10296273 3300032004 Bacteria 1366
594 Ga0307411_10480233 3300032005 Bacteria 1046
595 Ga0307411_10581881 3300032005 Bacteria 960
596 Ga0307411_10594037 3300032005 Bacteria 951
597 Ga0307411_11697426 3300032005 Bacteria 584
598 Ga0307415_100439096 3300032126 Bacteria 1125
599 Ga0307415_101534612 3300032126 Bacteria 638
600 Ga0307510_10271247 3300033180 Bacteria 1173
601 Ga0373928_0149585 3300035084 Bacteria 646
602 Ga0373939_0050899 3300035114 Bacteria 1286
603 Ga0265778_019850 3300036457 Bacteria 824
604 Ga0265778_056008 3300036457 Bacteria 546
605 Ga0395899_0326984 3300037312 Bacteria 1031
606 Ga0395900_0006501 3300037418 Bacteria 12183
607 Ga0395900_0063774 3300037418 Bacteria 3787
608 Ga0395900_0223727 3300037418 Bacteria 1896
609 Ga0395900_0810752 3300037418 Bacteria 863
610 Ga0395900_0838651 3300037418 Bacteria 845
611 Ga0395900_0890928 3300037418 Bacteria 813
612 Ga0395898_0182958 3300037466 Bacteria 2003
613 Ga0395898_0536365 3300037466 Bacteria 1112
614 Ga0395905_0000549 3300037471 Bacteria 51321
615 Ga0395905_0012898 3300037471 Bacteria 8034
616 Ga0395905_0043570 3300037471 Bacteria 4210
617 Ga0395905_0103307 3300037471 Bacteria 2675
618 Ga0395905_0228005 3300037471 Bacteria 1742
619 Ga0436364_0513076 3300037853 Bacteria 702
620 Ga0395901_0028412 3300038443 Bacteria 5751
621 Ga0395901_0036377 3300038443 Bacteria 5089
622 Ga0395901_0093407 3300038443 Bacteria 3150
623 Ga0395901_0112851 3300038443 Bacteria 2854
624 Ga0395901_0176537 3300038443 Bacteria 2240
625 Ga0395901_0347594 3300038443 Bacteria 1531
626 Ga0436361_0110739 3300039447 Bacteria 2796
627 Ga0436361_0209532 3300039447 Bacteria 1601
628 Ga0436361_0391791 3300039447 Bacteria 42494
629 Ga0436361_0797417 3300039447 Bacteria 1325
630 Ga0436361_0902855 3300039447 Bacteria 3267
631 Ga0436361_1016700 3300039447 Bacteria 56598
632 Ga0436361_1041947 3300039447 Bacteria 6318
633 Ga0439453_0001276 3300041408 Bacteria 3191
634 Ga0439465_0215707 3300041413 Bacteria 702
635 Ga0439465_0334429 3300041413 Bacteria 570
636 Ga0451787_207356 3300041441 Bacteria 1321
637 Ga0451788_14269 3300041442 Bacteria 666
638 Ga0451788_26491 3300041442 Bacteria 503
639 Ga0451789_0965253 3300041443 Bacteria 2538
640 Ga0451790_30858 3300041444 Bacteria 1457
641 Ga0451792_06578 3300041445 Bacteria 535
642 Ga0451794_03992 3300041446 Bacteria 648
643 Ga0451794_43844 3300041446 Bacteria 563
644 Ga0451794_56996 3300041446 Bacteria 834
645 Ga0451793_1842659 3300041452 Bacteria 1288
646 Ga0451799_25489 3300041454 Bacteria 1149
647 Ga0451799_25968 3300041454 Bacteria 1221
648 Ga0451799_35494 3300041454 Bacteria 749
649 Ga0451801_03902 3300041455 Bacteria 628
650 Ga0451801_05624 3300041455 Bacteria 1058
651 Ga0451795_0013989 3300041456 Bacteria 2986
652 Ga0451803_00380 3300041457 Bacteria 574
653 Ga0451798_0308085 3300041458 Bacteria 1147
654 Ga0451798_0595355 3300041458 Bacteria 816
655 Ga0451800_0613767 3300041459 Bacteria 869
656 Ga0451802_0433132 3300041460 Bacteria 1756
657 Ga0451802_0690103 3300041460 Bacteria 949
658 Ga0451805_059694 3300041461 Bacteria 1252
659 Ga0451805_117766 3300041461 Bacteria 550
660 Ga0451804_0350671 3300041463 Bacteria 3764
661 Ga0451808_27185 3300041464 Bacteria 621
662 Ga0451808_27571 3300041464 Bacteria 742
663 Ga0451807_0444576 3300041486 Bacteria 654
664 Ga0451807_1127722 3300041486 Bacteria 2271
665 Ga0451833_1024724 3300041491 Bacteria 645
666 Ga0451837_1802545 3300041494 Bacteria 543
667 Ga0451839_0712830 3300041496 Bacteria 1227
668 Ga0451841_0095596 3300041498 Bacteria 558
669 Ga0451845_0906783 3300041501 Bacteria 583
670 Ga0451849_1511665 3300041505 Bacteria 517
671 Ga0451850_46944 3300041506 Bacteria 1036
672 Ga0451843_0626631 3300041509 Bacteria 542
673 Ga0451855_1729568 3300041511 Bacteria 1205
674 Ga0451853_0176051 3300041512 Bacteria 891
675 Ga0452268_24915 3300041907 Bacteria 1251
676 Ga0439442_030241 3300042002 Bacteria 1131
677 Ga0439448_0091069 3300042005 Bacteria 1030
678 Ga0439432_109856 3300042006 Bacteria 821
679 Ga0439449_0003878 3300042007 Bacteria 5800
680 Ga0439449_0111033 3300042007 Bacteria 1016
681 Ga0439450_002944 3300042008 Bacteria 2753
682 Ga0439454_001689 3300042011 Bacteria 2184
683 Ga0439454_036314 3300042011 Bacteria 792
684 Ga0439455_0064096 3300042012 Bacteria 978
685 Ga0439455_0074073 3300042012 Bacteria 918
686 Ga0450911_005087 3300042115 Bacteria 2075
687 Ga0450890_040459 3300042127 Bacteria 688
688 Ga0450897_032275 3300042128 Bacteria 596
689 Ga0450898_003136 3300042134 Bacteria 2356
690 Ga0450898_029605 3300042134 Bacteria 999
691 Ga0450898_029717 3300042134 Bacteria 998
692 Ga0450904_000961 3300042139 Bacteria 4531
693 Ga0450906_030486 3300042145 Bacteria 954
694 Ga0450906_104913 3300042145 Bacteria 517
695 Ga0450910_105598 3300042147 Bacteria 508
696 Ga0439458_0031353 3300042157 Bacteria 1267
697 Ga0439434_0250235 3300042435 Bacteria 606
698 Ga0439459_0055055 3300042438 Bacteria 885
699 Ga0439464_0256052 3300042439 Bacteria 566
700 Ga0439460_0206241 3300042461 Bacteria 671
701 Ga0450893_0013738 3300042532 Bacteria 1352
702 Ga0450893_0026452 3300042532 Bacteria 1020
703 Ga0451577_0038506 3300042876 Bacteria 4301
704 Ga0466969_0312193 3300044656 Bacteria 711
705 Ga0466969_0572319 3300044656 Bacteria 517
706 Ga0466972_0020192 3300044658 Bacteria 3329
707 Ga0466972_0039363 3300044658 Bacteria 2307
708 Ga0466972_0098911 3300044658 Bacteria 1381
709 Ga0466972_0221359 3300044658 Bacteria 885
710 Ga0466972_0272724 3300044658 Bacteria 790
711 Ga0453683_0392256 3300044673 Bacteria 894
712 Ga0466965_0027577 3300044683 Bacteria 2757
713 Ga0466965_0036619 3300044683 Bacteria 2407
714 Ga0466965_0095415 3300044683 Bacteria 1516
715 Ga0466966_0032032 3300044684 Bacteria 3410
716 Ga0466966_0154067 3300044684 Bacteria 1400
717 Ga0466966_0510731 3300044684 Bacteria 723
718 Ga0466966_0630353 3300044684 Bacteria 645
719 Ga0466961_0059959 3300044693 Bacteria 2419
720 Ga0466963_0066574 3300044694 Bacteria 2416
721 Ga0466964_0177531 3300044706 Bacteria 1007
722 Ga0466964_0222909 3300044706 Bacteria 916
723 Ga0453684_0142976 3300044712 Bacteria 2853
724 Ga0466971_0355328 3300044719 Bacteria 709
725 Ga0466968_0024670 3300044735 Bacteria 2458
726 Ga0466968_0068221 3300044735 Bacteria 1543
727 Ga0466970_0695742 3300044765 Bacteria 592
728 Ga0466957_0173268 3300044842 Bacteria 1406
729 Ga0466957_0262826 3300044842 Bacteria 1150
730 Ga0466957_1007085 3300044842 Bacteria 598
731 Ga0466960_0134659 3300044901 Bacteria 1307
732 Ga0466960_0364078 3300044901 Bacteria 827
733 Ga0466960_0884225 3300044901 Bacteria 544
734 Ga0466959_0862059 3300045049 Bacteria 604
735 Ga0466959_1014431 3300045049 Bacteria 553
736 Ga0466959_1020608 3300045049 Bacteria 551
737 Ga0451576_0013761 3300045051 Bacteria 9038
738 Ga0451576_0083384 3300045051 Bacteria 3325
739 Ga0451576_0936124 3300045051 Bacteria 909
740 Ga0466958_0482820 3300045836 Bacteria 803
741 Ga0495617_000397 3300046452 Bacteria 24142
742 Ga0495617_000636 3300046452 Bacteria 17611
743 Ga0495617_000830 3300046452 Bacteria 14706
744 Ga0495617_031068 3300046452 Bacteria 1794
745 Ga0495627_000011 3300046453 Bacteria 354522
746 Ga0495627_008059 3300046453 Bacteria 3972
747 Ga0495627_014179 3300046453 Bacteria 2788
748 Ga0495627_019933 3300046453 Bacteria 2242
749 Ga0495592_0035699 3300046454 Bacteria 3745
750 Ga0495603_0001612 3300046455 Bacteria 13252
751 Ga0495603_0020924 3300046455 Bacteria 3960
752 Ga0495603_0409204 3300046455 Bacteria 777
753 Ga0495603_0415278 3300046455 Bacteria 771
754 Ga0495603_0726653 3300046455 Bacteria 567
755 Ga0495590_0000020 3300046457 Bacteria 212352
756 Ga0495590_0000632 3300046457 Bacteria 16341
757 Ga0495590_0001551 3300046457 Bacteria 9865
758 Ga0495590_0056853 3300046457 Bacteria 1367
759 Ga0495590_0251682 3300046457 Bacteria 657
760 Ga0495591_034720 3300046458 Bacteria 1481
761 Ga0495629_0007936 3300046459 Bacteria 7808
762 Ga0495629_0021816 3300046459 Bacteria 4570
763 Ga0495638_0000235 3300046460 Bacteria 75760
764 Ga0495638_0008741 3300046460 Bacteria 7157
765 Ga0495638_0090421 3300046460 Bacteria 1845
766 Ga0495638_0148740 3300046460 Bacteria 1360
767 Ga0495638_0181110 3300046460 Bacteria 1202
768 Ga0495638_0343610 3300046460 Bacteria 790
769 Ga0495638_0388315 3300046460 Bacteria 727
770 Ga0495638_0512403 3300046460 Bacteria 602
771 Ga0495651_0842696 3300046462 Bacteria 563
772 Ga0495653_0000067 3300046463 Bacteria 90116
773 Ga0495653_0004702 3300046463 Bacteria 11053
774 Ga0495653_0009522 3300046463 Bacteria 7946
775 Ga0495653_0175649 3300046463 Bacteria 1474
776 Ga0495653_0452357 3300046463 Bacteria 807
777 Ga0495650_0000200 3300046471 Bacteria 130223
778 Ga0495650_0001809 3300046471 Bacteria 19254
779 Ga0495650_0002469 3300046471 Bacteria 14877
780 Ga0495650_0014707 3300046471 Bacteria 4050
781 Ga0495650_0023728 3300046471 Bacteria 2914
782 Ga0495650_0026097 3300046471 Bacteria 2724
783 Ga0495580_0009003 3300046472 Bacteria 7881
784 Ga0495580_0314594 3300046472 Bacteria 1065
785 Ga0495580_0665811 3300046472 Bacteria 683
786 Ga0495582_0019511 3300046473 Bacteria 3707
787 Ga0495582_0063422 3300046473 Bacteria 2041
788 Ga0495582_0302408 3300046473 Bacteria 919
789 Ga0495605_0001330 3300046474 Bacteria 16349
790 Ga0495605_0001735 3300046474 Bacteria 13971
791 Ga0495605_0005449 3300046474 Bacteria 7411
792 Ga0495605_0010393 3300046474 Bacteria 5209
793 Ga0495605_0013769 3300046474 Bacteria 4445
794 Ga0495605_0061515 3300046474 Bacteria 1796
795 Ga0495605_0094007 3300046474 Bacteria 1385
796 Ga0495605_0162942 3300046474 Bacteria 989
797 Ga0495605_0328009 3300046474 Bacteria 644
798 Ga0495639_0088079 3300046475 Bacteria 1454
799 Ga0495639_0445425 3300046475 Bacteria 657
800 Ga0495664_0244637 3300046477 Bacteria 1085
801 Ga0495584_0000636 3300046491 Bacteria 23364
802 Ga0495584_0002002 3300046491 Bacteria 11717
803 Ga0495584_0022316 3300046491 Bacteria 3212
804 Ga0495584_0023314 3300046491 Bacteria 3138
805 Ga0495584_0030129 3300046491 Bacteria 2749
806 Ga0495584_0036677 3300046491 Bacteria 2476
807 Ga0495584_0041411 3300046491 Bacteria 2325
808 Ga0495584_0080454 3300046491 Bacteria 1639
809 Ga0495584_0088913 3300046491 Bacteria 1557
810 Ga0495584_0109915 3300046491 Bacteria 1394
811 Ga0495584_0150994 3300046491 Bacteria 1180
812 Ga0495584_0323231 3300046491 Bacteria 783
813 Ga0495584_0515190 3300046491 Bacteria 609
814 Ga0495584_0636787 3300046491 Bacteria 543
815 Ga0495585_0015948 3300046492 Bacteria 4357
816 Ga0495585_0022456 3300046492 Bacteria 3621
817 Ga0495585_0025799 3300046492 Bacteria 3361
818 Ga0495585_0036832 3300046492 Bacteria 2756
819 Ga0495585_0060017 3300046492 Bacteria 2094
820 Ga0495585_0061827 3300046492 Bacteria 2057
821 Ga0495585_0147891 3300046492 Bacteria 1226
822 Ga0495585_0171964 3300046492 Bacteria 1118
823 Ga0495585_0282346 3300046492 Bacteria 820
824 Ga0495585_0389221 3300046492 Bacteria 672
825 Ga0495585_0397963 3300046492 Bacteria 663
826 Ga0495585_0448161 3300046492 Bacteria 617
827 Ga0495585_0533323 3300046492 Bacteria 555
828 Ga0495594_0026606 3300046499 Bacteria 3113
829 Ga0495594_0050249 3300046499 Bacteria 2292
830 Ga0495594_0050658 3300046499 Bacteria 2284
831 Ga0495594_0139761 3300046499 Bacteria 1373
832 Ga0495594_0247101 3300046499 Bacteria 1016
833 Ga0495594_0549179 3300046499 Bacteria 655
834 Ga0495594_0626289 3300046499 Bacteria 609
835 Ga0495594_0652878 3300046499 Bacteria 595
836 Ga0495596_0001745 3300046500 Bacteria 12192
837 Ga0495596_0001963 3300046500 Bacteria 11349
838 Ga0495596_0040152 3300046500 Bacteria 1847
839 Ga0495596_0078041 3300046500 Bacteria 1285
840 Ga0495596_0126402 3300046500 Bacteria 992
841 Ga0495596_0196401 3300046500 Bacteria 784
842 Ga0495596_0349598 3300046500 Bacteria 575
843 Ga0495607_0042980 3300046501 Bacteria 2675
844 Ga0495607_0045844 3300046501 Bacteria 2569
845 Ga0495607_0148073 3300046501 Bacteria 1204
846 Ga0495607_0190403 3300046501 Bacteria 1022
847 Ga0495607_0199105 3300046501 Bacteria 992
848 Ga0495607_0277544 3300046501 Bacteria 796
849 Ga0495607_0345024 3300046501 Bacteria 688
850 Ga0495607_0392730 3300046501 Bacteria 632
851 Ga0495607_0479457 3300046501 Bacteria 554
852 Ga0495607_0521843 3300046501 Bacteria 524
853 Ga0495607_0559062 3300046501 Bacteria 501
854 Ga0495583_0000317 3300046506 Bacteria 76193
855 Ga0495583_0002046 3300046506 Bacteria 18350
856 Ga0495583_0003152 3300046506 Bacteria 13002
857 Ga0495583_0006153 3300046506 Bacteria 7904
858 Ga0495583_0029176 3300046506 Bacteria 2702
859 Ga0495583_0077755 3300046506 Bacteria 1446
860 Ga0495583_0129354 3300046506 Bacteria 1057
861 Ga0495583_0190547 3300046506 Bacteria 836
862 Ga0495583_0306402 3300046506 Bacteria 630
863 Ga0495606_0000433 3300046507 Bacteria 69506
864 Ga0495606_0004241 3300046507 Bacteria 14500
865 Ga0495606_0009821 3300046507 Bacteria 8038
866 Ga0495606_0013080 3300046507 Bacteria 6592
867 Ga0495606_0032750 3300046507 Bacteria 3595
868 Ga0495606_0035831 3300046507 Bacteria 3387
869 Ga0495606_0037395 3300046507 Bacteria 3297
870 Ga0495606_0058361 3300046507 Bacteria 2480
871 Ga0495606_0158420 3300046507 Bacteria 1323
872 Ga0495606_0248652 3300046507 Bacteria 987
873 Ga0495606_0335379 3300046507 Bacteria 807
874 Ga0495606_0374445 3300046507 Bacteria 748
875 Ga0495606_0388069 3300046507 Bacteria 730
876 Ga0495606_0536463 3300046507 Bacteria 584
877 Ga0495608_0037678 3300046511 Bacteria 3251
878 Ga0495610_0000017 3300046512 Bacteria 365675
879 Ga0495610_0004520 3300046512 Bacteria 10242
880 Ga0495610_0042199 3300046512 Bacteria 2283
881 Ga0495610_0048651 3300046512 Bacteria 2080
882 Ga0495610_0188392 3300046512 Bacteria 853
883 Ga0495616_0003800 3300046513 Bacteria 9623
884 Ga0495616_0004467 3300046513 Bacteria 8805
885 Ga0495616_0018110 3300046513 Bacteria 3874
886 Ga0495616_0028095 3300046513 Bacteria 2980
887 Ga0495616_0040567 3300046513 Bacteria 2377
888 Ga0495616_0053180 3300046513 Bacteria 2013
889 Ga0495616_0070526 3300046513 Bacteria 1691
890 Ga0495616_0090767 3300046513 Bacteria 1446
891 Ga0495616_0153679 3300046513 Bacteria 1039
892 Ga0495616_0183476 3300046513 Bacteria 928
893 Ga0495620_0001543 3300046515 Bacteria 13683
894 Ga0495628_0089954 3300046516 Bacteria 2376
895 Ga0495628_0758225 3300046516 Bacteria 681
896 Ga0495630_0050068 3300046517 Bacteria 3126
897 Ga0495630_0214174 3300046517 Bacteria 1470
898 Ga0495631_0084495 3300046518 Bacteria 1367
899 Ga0495631_0109370 3300046518 Bacteria 1188
900 Ga0495631_0113533 3300046518 Bacteria 1165
901 Ga0495631_0141332 3300046518 Bacteria 1033
902 Ga0495631_0376151 3300046518 Bacteria 604
903 Ga0495632_0018868 3300046519 Bacteria 3770
904 Ga0495632_0035459 3300046519 Bacteria 2545
905 Ga0495632_0102867 3300046519 Bacteria 1345
906 Ga0495632_0269148 3300046519 Bacteria 760
907 Ga0495632_0402833 3300046519 Bacteria 597
908 Ga0495637_0001780 3300046520 Bacteria 12324
909 Ga0495637_0002190 3300046520 Bacteria 10923
910 Ga0495637_0006713 3300046520 Bacteria 5762
911 Ga0495637_0035119 3300046520 Bacteria 2191
912 Ga0495643_0002891 3300046522 Bacteria 13023
913 Ga0495643_0016892 3300046522 Bacteria 4279
914 Ga0495643_0026373 3300046522 Bacteria 3279
915 Ga0495643_0040909 3300046522 Bacteria 2529
916 Ga0495643_0092098 3300046522 Bacteria 1562
917 Ga0495643_0107363 3300046522 Bacteria 1423
918 Ga0495643_0117768 3300046522 Bacteria 1344
919 Ga0495643_0129407 3300046522 Bacteria 1268
920 Ga0495643_0231320 3300046522 Bacteria 871
921 Ga0495643_0276333 3300046522 Bacteria 774
922 Ga0495643_0291310 3300046522 Bacteria 747
923 Ga0495643_0313202 3300046522 Bacteria 711
924 Ga0495643_0406296 3300046522 Bacteria 600
925 Ga0495643_0486618 3300046522 Bacteria 532
926 Ga0495644_0012857 3300046523 Bacteria 3218
927 Ga0495644_0029052 3300046523 Bacteria 2090
928 Ga0495644_0085048 3300046523 Bacteria 1192
929 Ga0495644_0107321 3300046523 Bacteria 1058
930 Ga0495644_0117781 3300046523 Bacteria 1009
931 Ga0495644_0140519 3300046523 Bacteria 922
932 Ga0495644_0159870 3300046523 Bacteria 863
933 Ga0495644_0213997 3300046523 Bacteria 744
934 Ga0495644_0247801 3300046523 Bacteria 691
935 Ga0495648_0003167 3300046524 Bacteria 14648
936 Ga0495648_0009195 3300046524 Bacteria 7688
937 Ga0495648_0011794 3300046524 Bacteria 6557
938 Ga0495648_0118352 3300046524 Bacteria 1428
939 Ga0495648_0133789 3300046524 Bacteria 1314
940 Ga0495648_0209844 3300046524 Bacteria 968
941 Ga0495648_0213620 3300046524 Bacteria 956
942 Ga0495663_0015755 3300046525 Bacteria 2132
943 Ga0495663_0037423 3300046525 Bacteria 1463
944 Ga0495663_0056569 3300046525 Bacteria 1225
945 Ga0495663_0097365 3300046525 Bacteria 965
946 Ga0495666_0002326 3300046526 Bacteria 9474
947 Ga0495666_0009599 3300046526 Bacteria 4837
948 Ga0495666_0096128 3300046526 Bacteria 1396
949 Ga0495666_0316509 3300046526 Bacteria 705
950 Ga0495666_0388536 3300046526 Bacteria 627
951 Ga0495642_0005824 3300046528 Bacteria 4726
952 Ga0495642_0007068 3300046528 Bacteria 4306
953 Ga0495642_0010689 3300046528 Bacteria 3515
954 Ga0495642_0052967 3300046528 Bacteria 1671
955 Ga0495642_0114350 3300046528 Bacteria 1155
956 Ga0495642_0127484 3300046528 Bacteria 1094
957 Ga0495642_0286284 3300046528 Bacteria 721
958 Ga0495642_0294808 3300046528 Bacteria 710
959 Ga0495642_0567772 3300046528 Bacteria 503
960 Ga0495652_0019185 3300046529 Bacteria 6091
961 Ga0495652_0095835 3300046529 Bacteria 2417
962 Ga0495652_0183867 3300046529 Bacteria 1601
963 Ga0495654_0000060 3300046530 Bacteria 134307
964 Ga0495654_0018887 3300046530 Bacteria 3607
965 Ga0495654_0063474 3300046530 Bacteria 1768
966 Ga0495654_0073901 3300046530 Bacteria 1611
967 Ga0495654_0105944 3300046530 Bacteria 1288
968 Ga0495654_0126676 3300046530 Bacteria 1150
969 Ga0495654_0170706 3300046530 Bacteria 948
970 Ga0495654_0399106 3300046530 Bacteria 546
971 Ga0495665_0005868 3300046531 Bacteria 6620
972 Ga0495665_0026128 3300046531 Bacteria 3136
973 Ga0495665_0026164 3300046531 Bacteria 3134
974 Ga0495665_0053041 3300046531 Bacteria 2145
975 Ga0495665_0089182 3300046531 Bacteria 1620
976 Ga0495665_0550280 3300046531 Bacteria 579
977 Ga0495665_0681242 3300046531 Bacteria 510
978 Ga0495640_0537766 3300046533 Bacteria 709
979 Ga0495586_0006554 3300046535 Bacteria 6219
980 Ga0495586_0007592 3300046535 Bacteria 5789
981 Ga0495586_0010558 3300046535 Bacteria 4913
982 Ga0495586_0233786 3300046535 Bacteria 1046
983 Ga0495587_0028480 3300046536 Bacteria 3396
984 Ga0495587_0037432 3300046536 Bacteria 2913
985 Ga0495598_0076189 3300046537 Bacteria 1067
986 Ga0495609_0001840 3300046538 Bacteria 13593
987 Ga0495609_0005522 3300046538 Bacteria 6610
988 Ga0495609_0018793 3300046538 Bacteria 3201
989 Ga0495609_0019006 3300046538 Bacteria 3181
990 Ga0495609_0026758 3300046538 Bacteria 2639
991 Ga0495609_0026889 3300046538 Bacteria 2631
992 Ga0495609_0064148 3300046538 Bacteria 1620
993 Ga0495609_0099256 3300046538 Bacteria 1262
994 Ga0495609_0114491 3300046538 Bacteria 1162
995 Ga0495609_0273136 3300046538 Bacteria 692
996 Ga0495609_0417573 3300046538 Bacteria 535
997 Ga0495621_0015352 3300046539 Bacteria 2441
998 Ga0495621_0084944 3300046539 Bacteria 1186
999 Ga0495597_0004273 3300046542 Bacteria 7899
1000 Ga0495597_0007533 3300046542 Bacteria 5520
1001 Ga0495597_0013129 3300046542 Bacteria 3975
1002 Ga0495597_0021380 3300046542 Bacteria 3008
1003 Ga0495597_0025313 3300046542 Bacteria 2732
1004 Ga0495597_0049072 3300046542 Bacteria 1866
1005 Ga0495597_0059514 3300046542 Bacteria 1668
1006 Ga0495597_0085111 3300046542 Bacteria 1347
1007 Ga0495597_0096517 3300046542 Bacteria 1249
1008 Ga0495597_0112149 3300046542 Bacteria 1142
1009 Ga0495597_0124240 3300046542 Bacteria 1074
1010 Ga0495597_0198836 3300046542 Bacteria 803
1011 Ga0495597_0220377 3300046542 Bacteria 753
1012 Ga0495597_0227659 3300046542 Bacteria 738
1013 Ga0495597_0240810 3300046542 Bacteria 713
1014 Ga0495597_0259120 3300046542 Bacteria 681
1015 Ga0495645_0181667 3300046543 Bacteria 1441
1016 Ga0495645_0821012 3300046543 Bacteria 556
1017 Ga0495622_0002906 3300046557 Bacteria 8173
1018 Ga0495622_0003244 3300046557 Bacteria 7699
1019 Ga0495622_0010858 3300046557 Bacteria 4202
1020 Ga0495622_0016244 3300046557 Bacteria 3466
1021 Ga0495622_0033985 3300046557 Bacteria 2379
1022 Ga0495622_0061317 3300046557 Bacteria 1741
1023 Ga0495622_0191348 3300046557 Bacteria 914
1024 Ga0495622_0352903 3300046557 Bacteria 636
1025 Ga0495633_0010195 3300046558 Bacteria 5140
1026 Ga0495633_0017696 3300046558 Bacteria 3636
1027 Ga0495633_0032840 3300046558 Bacteria 2505
1028 Ga0495633_0051460 3300046558 Bacteria 1940
1029 Ga0495633_0099041 3300046558 Bacteria 1353
1030 Ga0495633_0105604 3300046558 Bacteria 1306
1031 Ga0495633_0190322 3300046558 Bacteria 943
1032 Ga0495633_0342535 3300046558 Bacteria 677
1033 Ga0495633_0353490 3300046558 Bacteria 665
1034 Ga0495633_0496025 3300046558 Bacteria 550
1035 Ga0495633_0524675 3300046558 Bacteria 533
1036 Ga0495667_0042014 3300046559 Bacteria 3031
1037 Ga0495656_0010822 3300046615 Bacteria 3330
1038 Ga0495656_0040826 3300046615 Bacteria 1935
1039 Ga0495656_0100242 3300046615 Bacteria 1338
1040 Ga0495656_0107150 3300046615 Bacteria 1301
1041 Ga0495656_0115998 3300046615 Bacteria 1258
1042 Ga0495668_0002640 3300046616 Bacteria 14406
1043 Ga0495668_0005163 3300046616 Bacteria 8962
1044 Ga0495668_0008733 3300046616 Bacteria 6291
1045 Ga0495668_0011342 3300046616 Bacteria 5343
1046 Ga0495668_0063066 3300046616 Bacteria 2041
1047 Ga0495668_0092399 3300046616 Bacteria 1657
1048 Ga0495668_0129828 3300046616 Bacteria 1379
1049 Ga0495668_0174806 3300046616 Bacteria 1176
1050 Ga0495668_0195544 3300046616 Bacteria 1107
1051 Ga0495668_0284779 3300046616 Bacteria 905
1052 Ga0495668_0309249 3300046616 Bacteria 867
1053 Ga0495668_0447727 3300046616 Bacteria 710
1054 Ga0495668_0831789 3300046616 Bacteria 511
1055 Ga0495634_0014598 3300046642 Bacteria 5659
1056 Ga0495634_0400610 3300046642 Bacteria 815
1057 Ga0495611_0001662 3300046648 Bacteria 10778
1058 Ga0495611_0002069 3300046648 Bacteria 9442
1059 Ga0495611_0005909 3300046648 Bacteria 5219
1060 Ga0495611_0007454 3300046648 Bacteria 4643
1061 Ga0495611_0011467 3300046648 Bacteria 3757
1062 Ga0495611_0020577 3300046648 Bacteria 2841
1063 Ga0495611_0041368 3300046648 Bacteria 2055
1064 Ga0495611_0305916 3300046648 Bacteria 732
1065 Ga0495625_0005454 3300046660 Bacteria 11594
1066 Ga0495625_0018357 3300046660 Bacteria 5463
1067 Ga0495625_0042626 3300046660 Bacteria 3296
1068 Ga0495625_0056429 3300046660 Bacteria 2795
1069 Ga0495625_0090743 3300046660 Bacteria 2113
1070 Ga0495625_0095414 3300046660 Bacteria 2050
1071 Ga0495625_0214661 3300046660 Bacteria 1263
1072 Ga0495625_0223273 3300046660 Bacteria 1233
1073 Ga0495625_0388500 3300046660 Bacteria 874
1074 Ga0495625_0550096 3300046660 Bacteria 699
1075 Ga0495635_0026620 3300046663 Bacteria 4022
1076 Ga0495635_0181994 3300046663 Bacteria 1428
1077 Ga0495635_0904837 3300046663 Bacteria 565
1078 Ga0495659_0002211 3300046664 Bacteria 6333
1079 Ga0495659_0037680 3300046664 Bacteria 1713
1080 Ga0495659_0041386 3300046664 Bacteria 1645
1081 Ga0495659_0092967 3300046664 Bacteria 1160
1082 Ga0495659_0093772 3300046664 Bacteria 1155
1083 Ga0495659_0105752 3300046664 Bacteria 1094
1084 Ga0495659_0393753 3300046664 Bacteria 597
1085 Ga0495661_0018525 3300046665 Bacteria 4577
1086 Ga0495661_0022142 3300046665 Bacteria 4136
1087 Ga0495661_0048413 3300046665 Bacteria 2582
1088 Ga0495661_0060113 3300046665 Bacteria 2258
1089 Ga0495661_0061371 3300046665 Bacteria 2231
1090 Ga0495661_0068457 3300046665 Bacteria 2082
1091 Ga0495661_0071076 3300046665 Bacteria 2034
1092 Ga0495661_0127892 3300046665 Bacteria 1395
1093 Ga0495661_0128906 3300046665 Bacteria 1388
1094 Ga0495661_0169133 3300046665 Bacteria 1167
1095 Ga0495661_0206455 3300046665 Bacteria 1025
1096 Ga0495661_0208125 3300046665 Bacteria 1020
1097 Ga0495661_0324453 3300046665 Bacteria 764
1098 Ga0495661_0413168 3300046665 Bacteria 654
1099 Ga0495661_0417194 3300046665 Bacteria 650
1100 Ga0495661_0623059 3300046665 Bacteria 506
1101 Ga0495588_0000091 3300046674 Bacteria 183183
1102 Ga0495588_0009876 3300046674 Bacteria 4424
1103 Ga0495588_0022754 3300046674 Bacteria 3099
1104 Ga0495588_0032819 3300046674 Bacteria 2618
1105 Ga0495588_0038295 3300046674 Bacteria 2438
1106 Ga0495588_0075112 3300046674 Bacteria 1760
1107 Ga0495588_0126891 3300046674 Bacteria 1345
1108 Ga0495588_0167032 3300046674 Bacteria 1163
1109 Ga0495588_0219939 3300046674 Bacteria 1002
1110 Ga0495588_0258362 3300046674 Bacteria 918
1111 Ga0495657_0046439 3300046675 Bacteria 2940
1112 Ga0495599_0001590 3300046678 Bacteria 13082
1113 Ga0495599_0061532 3300046678 Bacteria 2346
1114 Ga0495599_0569109 3300046678 Bacteria 662
1115 Ga0495623_0008893 3300046679 Bacteria 6519
1116 Ga0495623_0020652 3300046679 Bacteria 4257
1117 Ga0495623_0228894 3300046679 Bacteria 1055
1118 Ga0495646_0063908 3300046680 Bacteria 2183
1119 Ga0495646_0403601 3300046680 Bacteria 710
1120 Ga0495669_0001596 3300046684 Bacteria 9305
1121 Ga0495669_0015677 3300046684 Bacteria 3245
1122 Ga0495669_0084861 3300046684 Bacteria 1456
1123 Ga0495669_0091582 3300046684 Bacteria 1404
1124 Ga0495669_0157656 3300046684 Bacteria 1076
1125 Ga0495669_0420575 3300046684 Bacteria 648
1126 Ga0495613_0337429 3300046689 Bacteria 1037
1127 Ga0495624_0036411 3300046690 Bacteria 3172
1128 Ga0495624_0069735 3300046690 Bacteria 2189
1129 Ga0495670_0004991 3300046691 Bacteria 6522
1130 Ga0495670_0010742 3300046691 Bacteria 4499
1131 Ga0495670_0015412 3300046691 Bacteria 3755
1132 Ga0495670_0019932 3300046691 Bacteria 3304
1133 Ga0495670_0031340 3300046691 Bacteria 2641
1134 Ga0495670_0081921 3300046691 Bacteria 1644
1135 Ga0495670_0135699 3300046691 Bacteria 1284
1136 Ga0495670_0381420 3300046691 Bacteria 760
1137 Ga0495670_0448993 3300046691 Bacteria 698
1138 Ga0495670_0488228 3300046691 Bacteria 668
1139 Ga0495671_0000037 3300046692 Bacteria 177605
1140 Ga0495671_0085680 3300046692 Bacteria 1543
1141 Ga0495671_0118753 3300046692 Bacteria 1290
1142 Ga0495671_0198747 3300046692 Bacteria 972
1143 Ga0495671_0325797 3300046692 Bacteria 737
1144 Ga0495649_0012662 3300046694 Bacteria 4895
1145 Ga0495649_0027792 3300046694 Bacteria 3137
1146 Ga0495649_0073185 3300046694 Bacteria 1836
1147 Ga0495649_0098580 3300046694 Bacteria 1554
1148 Ga0495649_0118681 3300046694 Bacteria 1399
1149 Ga0495649_0387844 3300046694 Bacteria 702
1150 Ga0495649_0600575 3300046694 Bacteria 543
1151 Ga0495649_0691454 3300046694 Bacteria 500
1152 Ga0495589_0014264 3300046794 Bacteria 4094
1153 Ga0495589_0029351 3300046794 Bacteria 2772
1154 Ga0495589_0030733 3300046794 Bacteria 2704
1155 Ga0495589_0037560 3300046794 Bacteria 2426
1156 Ga0495589_0072308 3300046794 Bacteria 1684
1157 Ga0495589_0101699 3300046794 Bacteria 1390
1158 Ga0495589_0114336 3300046794 Bacteria 1301
1159 Ga0495589_0183245 3300046794 Bacteria 992
1160 Ga0495589_0472950 3300046794 Bacteria 573
1161 Ga0495600_0004009 3300046809 Bacteria 8753
1162 Ga0495600_0006486 3300046809 Bacteria 7122
1163 Ga0495600_0423937 3300046809 Bacteria 825
1164 Ga0495600_0754054 3300046809 Bacteria 582
1165 Ga0495660_0001966 3300046810 Bacteria 13364
1166 Ga0495660_0007547 3300046810 Bacteria 6384
1167 Ga0495660_0010186 3300046810 Bacteria 5468
1168 Ga0495660_0030532 3300046810 Bacteria 3035
1169 Ga0495660_0034825 3300046810 Bacteria 2815
1170 Ga0495660_0296308 3300046810 Bacteria 734
1171 Ga0495660_0498638 3300046810 Bacteria 521
1172 Ga0495581_0018479 3300047315 Bacteria 4049
1173 Ga0495581_0095106 3300047315 Bacteria 1729
1174 Ga0495581_0203954 3300047315 Bacteria 1156
1175 Ga0495581_0354421 3300047315 Bacteria 856
1176 Ga0495604_0003421 3300047317 Bacteria 12655
1177 Ga0495604_0010101 3300047317 Bacteria 7477
1178 Ga0495604_0010804 3300047317 Bacteria 7251
1179 Ga0495604_0063319 3300047317 Bacteria 2821
1180 Ga0495604_0738025 3300047317 Bacteria 623
1181 Ga0495636_0001434 3300047318 Bacteria 9014
1182 Ga0495636_0002112 3300047318 Bacteria 7637
1183 Ga0495636_0003788 3300047318 Bacteria 5890
1184 Ga0495636_0013181 3300047318 Bacteria 3279
1185 Ga0495636_0545651 3300047318 Bacteria 563
1186 Ga0495674_0009303 3300047319 Bacteria 9338
1187 Ga0495674_0289372 3300047319 Bacteria 1340
1188 Ga0495672_0000013 3300047320 Bacteria 511827
1189 Ga0495672_0000157 3300047320 Bacteria 98544
1190 Ga0495672_0007686 3300047320 Bacteria 8079
1191 Ga0495672_0016220 3300047320 Bacteria 5030
1192 Ga0495672_0020286 3300047320 Bacteria 4361
1193 Ga0495672_0021784 3300047320 Bacteria 4174
1194 Ga0495672_0069849 3300047320 Bacteria 1992
1195 Ga0495672_0082508 3300047320 Bacteria 1787
1196 Ga0495672_0247872 3300047320 Bacteria 866
1197 Ga0495676_0004545 3300047321 Bacteria 12688
1198 Ga0495676_0031634 3300047321 Bacteria 4472
1199 Ga0495676_0135297 3300047321 Bacteria 1773
1200 Ga0495676_0157887 3300047321 Bacteria 1607
1201 Ga0495676_0167264 3300047321 Bacteria 1550
1202 Ga0495680_0272308 3300047322 Bacteria 1195
1203 Ga0495680_0398534 3300047322 Bacteria 950
1204 Ga0495680_0465911 3300047322 Bacteria 863
1205 Ga0495683_0003225 3300047323 Bacteria 9532
1206 Ga0495683_0014031 3300047323 Bacteria 4174
1207 Ga0495683_0015642 3300047323 Bacteria 3943
1208 Ga0495683_0043280 3300047323 Bacteria 2268
1209 Ga0495683_0081874 3300047323 Bacteria 1573
1210 Ga0495683_0148116 3300047323 Bacteria 1095
1211 Ga0495683_0228820 3300047323 Bacteria 825
1212 Ga0495683_0388285 3300047323 Bacteria 582
1213 Ga0495687_000342 3300047443 Bacteria 59692
1214 Ga0495687_001562 3300047443 Bacteria 20787
1215 Ga0495687_002781 3300047443 Bacteria 13521
1216 Ga0495687_002921 3300047443 Bacteria 12995
1217 Ga0495687_011455 3300047443 Bacteria 4768
1218 Ga0495687_023933 3300047443 Bacteria 2911
1219 Ga0495687_024921 3300047443 Bacteria 2836
1220 Ga0495687_055162 3300047443 Bacteria 1662
1221 Ga0495687_069898 3300047443 Bacteria 1411
1222 Ga0495687_089986 3300047443 Bacteria 1177
1223 Ga0495687_090176 3300047443 Bacteria 1175
1224 Ga0495675_0021158 3300047444 Bacteria 4140
1225 Ga0495675_0038185 3300047444 Bacteria 3057
1226 Ga0495675_0249845 3300047444 Bacteria 1065
1227 Ga0495675_0340054 3300047444 Bacteria 884
1228 Ga0495677_0001866 3300047445 Bacteria 8421
1229 Ga0495677_0016634 3300047445 Bacteria 2669
1230 Ga0495677_0032598 3300047445 Bacteria 1897
1231 Ga0495677_0035722 3300047445 Bacteria 1813
1232 Ga0495677_0084424 3300047445 Bacteria 1192
1233 Ga0495677_0102771 3300047445 Bacteria 1083
1234 Ga0495677_0107809 3300047445 Bacteria 1057
1235 Ga0495677_0125506 3300047445 Bacteria 980
1236 Ga0495677_0161241 3300047445 Bacteria 865
1237 Ga0495677_0166219 3300047445 Bacteria 852
1238 Ga0495677_0180237 3300047445 Bacteria 818
1239 Ga0495677_0270108 3300047445 Bacteria 666
1240 Ga0495679_005019 3300047446 Bacteria 5954
1241 Ga0495679_006474 3300047446 Bacteria 5030
1242 Ga0495679_025594 3300047446 Bacteria 1970
1243 Ga0495679_070561 3300047446 Bacteria 1007
1244 Ga0495679_160771 3300047446 Bacteria 600
1245 Ga0495685_000474 3300047447 Bacteria 12514
1246 Ga0495685_009709 3300047447 Bacteria 3221
1247 Ga0495685_069325 3300047447 Bacteria 1182
1248 Ga0495685_095624 3300047447 Bacteria 982
1249 Ga0495685_099061 3300047447 Bacteria 963
1250 Ga0495685_221769 3300047447 Bacteria 603
1251 Ga0495673_0000248 3300047469 Bacteria 75224
1252 Ga0495673_0010480 3300047469 Bacteria 5036
1253 Ga0495673_0017349 3300047469 Bacteria 3660
1254 Ga0495681_0012224 3300047470 Bacteria 5057
1255 Ga0495681_0043132 3300047470 Bacteria 2177
1256 Ga0495681_0053354 3300047470 Bacteria 1893
1257 Ga0495681_0072599 3300047470 Bacteria 1556
1258 Ga0495681_0089523 3300047470 Bacteria 1361
1259 Ga0495681_0113480 3300047470 Bacteria 1170
1260 Ga0495681_0146985 3300047470 Bacteria 991
1261 Ga0495681_0160248 3300047470 Bacteria 937
1262 Ga0495681_0176785 3300047470 Bacteria 879
1263 Ga0495681_0290220 3300047470 Bacteria 635
1264 Ga0495681_0401191 3300047470 Bacteria 512
1265 Ga0495686_0007683 3300047472 Bacteria 8051
1266 Ga0495686_0012785 3300047472 Bacteria 5856
1267 Ga0495686_0018441 3300047472 Bacteria 4684
1268 Ga0495686_0021073 3300047472 Bacteria 4336
1269 Ga0495686_0062817 3300047472 Bacteria 2302
1270 Ga0495686_0070207 3300047472 Bacteria 2158
1271 Ga0495686_0617336 3300047472 Bacteria 560
1272 Ga0495593_0002955 3300047673 Bacteria 10225
1273 Ga0495593_0015516 3300047673 Bacteria 4313
1274 Ga0495593_0016080 3300047673 Bacteria 4223
1275 Ga0495593_0304065 3300047673 Bacteria 797
1276 Ga0495602_0049802 3300048088 Bacteria 3748
1277 Ga0495602_0187032 3300048088 Bacteria 1591
1278 Ga0495602_0236904 3300048088 Bacteria 1367
1279 Ga0495614_0054658 3300048089 Bacteria 1712
1280 Ga0495614_0178530 3300048089 Bacteria 954
1281 Ga0495615_0038328 3300048090 Bacteria 1184
1282 Ga0495615_0287656 3300048090 Bacteria 529
1283 Ga0495626_0002147 3300048091 Bacteria 14252
1284 Ga0495626_0014493 3300048091 Bacteria 4062
1285 Ga0495626_0029462 3300048091 Bacteria 2656
1286 Ga0495626_0032266 3300048091 Bacteria 2515
1287 Ga0495626_0037979 3300048091 Bacteria 2285
1288 Ga0495626_0054009 3300048091 Bacteria 1846
1289 Ga0495626_0074354 3300048091 Bacteria 1520
1290 Ga0495626_0091062 3300048091 Bacteria 1340
1291 Ga0495626_0117815 3300048091 Bacteria 1144
1292 Ga0495626_0174463 3300048091 Bacteria 894
1293 Ga0495626_0379776 3300048091 Bacteria 548
1294 Ga0496100_0014114 3300048903 Bacteria 4630
1295 Ga0496100_0848752 3300048903 Bacteria 716
1296 Ga0496100_1570695 3300048903 Bacteria 520
1297 Ga0496101_0056958 3300048904 Bacteria 2825
1298 Ga0496101_0161155 3300048904 Bacteria 1720
1299 Ga0496101_0947987 3300048904 Bacteria 677
1300 Ga0496102_0022102 3300048905 Bacteria 5634
1301 Ga0496102_0315662 3300048905 Bacteria 1472
1302 Ga0496102_0447744 3300048905 Bacteria 1211
1303 Ga0496102_0499438 3300048905 Bacteria 1138
1304 Ga0496102_0823476 3300048905 Bacteria 850
1305 Ga0496102_1208221 3300048905 Bacteria 675
1306 Ga0496103_0010940 3300048906 Bacteria 5370
1307 Ga0496103_0014572 3300048906 Bacteria 4670
1308 Ga0496103_0020711 3300048906 Bacteria 3953
1309 Ga0496103_0100485 3300048906 Bacteria 1830
1310 Ga0496103_0420848 3300048906 Bacteria 857
1311 Ga0496103_0540278 3300048906 Bacteria 744
1312 Ga0496104_0224974 3300048907 Bacteria 1788
1313 Ga0496104_0392286 3300048907 Bacteria 1300
1314 Ga0496104_0562827 3300048907 Bacteria 1051
1315 Ga0496105_0090765 3300048908 Bacteria 2523
1316 Ga0496105_0731574 3300048908 Bacteria 757
1317 Ga0496106_0168970 3300048909 Bacteria 1732
1318 Ga0496106_0217913 3300048909 Bacteria 1521
1319 Ga0496106_0724466 3300048909 Bacteria 792
1320 Ga0496106_0738447 3300048909 Bacteria 783
1321 Ga0496107_0047151 3300048910 Bacteria 3103
1322 Ga0496107_0122539 3300048910 Bacteria 1916
1323 Ga0496107_0263854 3300048910 Bacteria 1281
1324 Ga0496107_0324055 3300048910 Bacteria 1146
1325 Ga0496108_0561420 3300048911 Bacteria 995
1326 Ga0496108_0597717 3300048911 Bacteria 961
1327 Ga0496108_1430065 3300048911 Bacteria 577
1328 Ga0496109_0584534 3300048912 Bacteria 1052
1329 Ga0496109_1574844 3300048912 Bacteria 591
1330 Ga0496110_0110339 3300048913 Bacteria 2471
1331 Ga0496110_0454328 3300048913 Bacteria 1168
1332 Ga0496110_1223550 3300048913 Bacteria 660
1333 Ga0496110_1819096 3300048913 Bacteria 519
1334 Ga0496111_0076448 3300048914 Bacteria 2440
1335 Ga0496111_0135130 3300048914 Bacteria 1826
1336 Ga0496112_1052819 3300048915 Bacteria 732
1337 Ga0496112_1832459 3300048915 Bacteria 518
1338 Ga0496114_0041004 3300048917 Bacteria 3836
1339 Ga0496114_0863153 3300048917 Bacteria 785
1340 Ga0496115_0050480 3300048918 Bacteria 3332
1341 Ga0496115_0137305 3300048918 Bacteria 2016
1342 Ga0496115_0202044 3300048918 Bacteria 1641
1343 Ga0496115_0337943 3300048918 Bacteria 1229
1344 Ga0496115_0575713 3300048918 Bacteria 897
1345 Ga0496115_1123949 3300048918 Bacteria 594
1346 Ga0496116_0078388 3300048919 Bacteria 2060
1347 Ga0496117_0000005 3300048920 Bacteria 777468
1348 Ga0496117_0323166 3300048920 Bacteria 808
1349 Ga0496118_0000031 3300048921 Bacteria 339329
1350 Ga0496118_0426591 3300048921 Bacteria 680
1351 Ga0496119_0071811 3300048922 Bacteria 2025
1352 Ga0496120_0160080 3300048923 Bacteria 1123
1353 Ga0496121_0004491 3300048924 Bacteria 18710
1354 Ga0496121_0018508 3300048924 Bacteria 7020
1355 Ga0496121_0023798 3300048924 Bacteria 5881
1356 Ga0496121_0042385 3300048924 Bacteria 3960
1357 Ga0496121_0114637 3300048924 Bacteria 2048
1358 Ga0496121_0508057 3300048924 Bacteria 763
1359 Ga0496122_0005873 3300048925 Bacteria 14382
1360 Ga0496122_0211557 3300048925 Bacteria 1122
1361 Ga0496122_0499701 3300048925 Bacteria 591
1362 Ga0496123_0005104 3300048926 Bacteria 13404
1363 Ga0496123_0020755 3300048926 Bacteria 5128
1364 Ga0496123_0048880 3300048926 Bacteria 2841
1365 Ga0496123_0273029 3300048926 Bacteria 821
1366 Ga0496124_0001830 3300048927 Bacteria 29398
1367 Ga0496124_0009077 3300048927 Bacteria 10283
1368 Ga0496124_0015482 3300048927 Bacteria 7307
1369 Ga0496124_0101682 3300048927 Bacteria 2328
1370 Ga0496124_0120196 3300048927 Bacteria 2100
1371 Ga0496124_0279288 3300048927 Bacteria 1218
1372 Ga0496124_0571215 3300048927 Bacteria 742
1373 Ga0496124_0618387 3300048927 Bacteria 701
1374 Ga0496125_0005905 3300048928 Bacteria 13422
1375 Ga0496125_0009685 3300048928 Bacteria 9840
1376 Ga0496125_0013937 3300048928 Bacteria 7862
1377 Ga0496125_0040516 3300048928 Bacteria 3995
1378 Ga0496125_0129144 3300048928 Bacteria 1783
1379 Ga0496125_0211435 3300048928 Bacteria 1259
1380 Ga0496125_0376596 3300048928 Bacteria 838
1381 Ga0496125_0405857 3300048928 Bacteria 795
1382 Ga0496126_0004622 3300048929 Bacteria 16312
1383 Ga0496126_0317516 3300048929 Bacteria 1281
1384 Ga0496126_0619610 3300048929 Bacteria 850
1385 Ga0501306_000005 3300049127 Bacteria 11576
1386 Ga0501306_000979 3300049127 Bacteria 2501
1387 Ga0501306_001799 3300049127 Bacteria 2089
1388 Ga0501306_003684 3300049127 Bacteria 1667
1389 Ga0501306_008516 3300049127 Bacteria 1253
1390 Ga0501306_018600 3300049127 Bacteria 951
1391 Ga0501306_030700 3300049127 Bacteria 797
1392 Ga0501306_038015 3300049127 Bacteria 738
1393 Ga0501306_038884 3300049127 Bacteria 732
1394 Ga0501306_087384 3300049127 Bacteria 544
1395 Ga0501308_000002 3300049128 Bacteria 13277
1396 Ga0501308_000177 3300049128 Bacteria 3494
1397 Ga0501308_000386 3300049128 Bacteria 2793
1398 Ga0501308_005794 3300049128 Bacteria 1245
1399 Ga0501308_008008 3300049128 Bacteria 1120
1400 Ga0501308_009740 3300049128 Bacteria 1055
1401 Ga0501308_020892 3300049128 Bacteria 818
1402 Ga0501308_025496 3300049128 Bacteria 766
1403 Ga0501308_028896 3300049128 Bacteria 735
1404 Ga0501308_029721 3300049128 Bacteria 727
1405 Ga0501308_056773 3300049128 Bacteria 584
1406 Ga0501308_069780 3300049128 Bacteria 544
1407 Ga0501309_000464 3300049129 Bacteria 3253
1408 Ga0501309_002567 3300049129 Bacteria 1972
1409 Ga0501309_003438 3300049129 Bacteria 1792
1410 Ga0501309_004776 3300049129 Bacteria 1590
1411 Ga0501309_013328 3300049129 Bacteria 1092
1412 Ga0501309_030503 3300049129 Bacteria 793
1413 Ga0501310_000065 3300049130 Bacteria 9861
1414 Ga0501310_002047 3300049130 Bacteria 1887
1415 Ga0501310_002676 3300049130 Bacteria 1701
1416 Ga0501310_004061 3300049130 Bacteria 1454
1417 Ga0501310_008997 3300049130 Bacteria 1093
1418 Ga0501310_009999 3300049130 Bacteria 1052
1419 Ga0501310_014411 3300049130 Bacteria 928
1420 Ga0501310_018690 3300049130 Bacteria 848
1421 Ga0501310_023172 3300049130 Bacteria 788
1422 Ga0501310_023895 3300049130 Bacteria 779
1423 Ga0501310_024232 3300049130 Bacteria 776
1424 Ga0501310_029314 3300049130 Bacteria 725
1425 Ga0501310_029604 3300049130 Bacteria 722
1426 Ga0501310_042297 3300049130 Bacteria 638
1427 Ga0501310_073912 3300049130 Bacteria 526
1428 Ga0501341_00897 3300049131 Bacteria 1384
1429 Ga0501341_05783 3300049131 Bacteria 747
1430 Ga0501341_07080 3300049131 Bacteria 698
1431 Ga0501341_15080 3300049131 Bacteria 540
1432 Ga0501343_000585 3300049132 Bacteria 2200
1433 Ga0501343_000946 3300049132 Bacteria 1870
1434 Ga0501343_002039 3300049132 Bacteria 1417
1435 Ga0501343_006485 3300049132 Bacteria 912
1436 Ga0501343_008083 3300049132 Bacteria 837
1437 Ga0501343_011815 3300049132 Bacteria 721
1438 Ga0501344_01065 3300049133 Bacteria 1284
1439 Ga0501344_04650 3300049133 Bacteria 759
1440 Ga0501344_05240 3300049133 Bacteria 728
1441 Ga0501345_00091 3300049134 Bacteria 2211
1442 Ga0501304_000001 3300049160 Bacteria 14569
1443 Ga0501304_000986 3300049160 Bacteria 1703
1444 Ga0501304_001750 3300049160 Bacteria 1434
1445 Ga0501304_002722 3300049160 Bacteria 1249
1446 Ga0501304_013411 3300049160 Bacteria 749
1447 Ga0501304_023108 3300049160 Bacteria 627
1448 Ga0501304_024999 3300049160 Bacteria 610
1449 Ga0501305_000399 3300049161 Bacteria 3488
1450 Ga0501305_000819 3300049161 Bacteria 2765
1451 Ga0501305_003101 3300049161 Bacteria 1859
1452 Ga0501305_004353 3300049161 Bacteria 1661
1453 Ga0501305_011851 3300049161 Bacteria 1184
1454 Ga0501305_012120 3300049161 Bacteria 1175
1455 Ga0501305_014715 3300049161 Bacteria 1098
1456 Ga0501305_034752 3300049161 Bacteria 800
1457 Ga0501305_066877 3300049161 Bacteria 627
1458 Ga0501305_082266 3300049161 Bacteria 580
1459 Ga0501307_000313 3300049162 Bacteria 3029
1460 Ga0501307_000583 3300049162 Bacteria 2593
1461 Ga0501307_000963 3300049162 Bacteria 2241
1462 Ga0501307_005419 3300049162 Bacteria 1344
1463 Ga0501307_006878 3300049162 Bacteria 1241
1464 Ga0501307_012923 3300049162 Bacteria 1001
1465 Ga0501307_016299 3300049162 Bacteria 925
1466 Ga0501307_016459 3300049162 Bacteria 922
1467 Ga0501307_038688 3300049162 Bacteria 686
1468 Ga0501307_051118 3300049162 Bacteria 622
1469 Ga0501307_082101 3300049162 Bacteria 528
1470 Ga0495678_000010 3300049459 Bacteria 357896
1471 Ga0495678_006909 3300049459 Bacteria 5955
1472 Ga0495678_013870 3300049459 Bacteria 3770
1473 Ga0495678_025294 3300049459 Bacteria 2551
1474 Ga0495678_058347 3300049459 Bacteria 1458
1475 Ga0495678_125922 3300049459 Bacteria 854
1476 Ga0495682_0004602 3300049460 Bacteria 5864
1477 Ga0495682_0039543 3300049460 Bacteria 1731
1478 Ga0495682_0040889 3300049460 Bacteria 1699
1479 Ga0495682_0057328 3300049460 Bacteria 1410
1480 Ga0501291_102997 3300049514 Bacteria 598
1481 Ga0501298_149702 3300049521 Bacteria 570
1482 Ga0501299_056087 3300049522 Bacteria 825
1483 Ga0501300_044609 3300049523 Bacteria 674
1484 Ga0501301_021515 3300049524 Bacteria 624
1485 Ga0501311_000002 3300049527 Bacteria 12093
1486 Ga0501311_004818 3300049527 Bacteria 1453
1487 Ga0501311_010684 3300049527 Bacteria 1118
1488 Ga0501311_012041 3300049527 Bacteria 1073
1489 Ga0501311_031969 3300049527 Bacteria 766
1490 Ga0501311_053518 3300049527 Bacteria 638
1491 Ga0501311_062752 3300049527 Bacteria 603
1492 Ga0501312_004364 3300049528 Bacteria 1663
1493 Ga0501312_005434 3300049528 Bacteria 1549
1494 Ga0501312_006206 3300049528 Bacteria 1484
1495 Ga0501312_012205 3300049528 Bacteria 1179
1496 Ga0501312_020539 3300049528 Bacteria 978
1497 Ga0501312_024758 3300049528 Bacteria 911
1498 Ga0501312_024759 3300049528 Bacteria 911
1499 Ga0501312_029738 3300049528 Bacteria 852
1500 Ga0501312_034907 3300049528 Bacteria 803
1501 Ga0501312_098925 3300049528 Bacteria 545
1502 Ga0501313_000012 3300049529 Bacteria 8507
1503 Ga0501313_000686 3300049529 Bacteria 2491
1504 Ga0501313_001951 3300049529 Bacteria 1893
1505 Ga0501313_007422 3300049529 Bacteria 1208
1506 Ga0501313_022404 3300049529 Bacteria 787
1507 Ga0501314_000622 3300049530 Bacteria 2258
1508 Ga0501314_001267 3300049530 Bacteria 1800
1509 Ga0501314_005240 3300049530 Bacteria 1099
1510 Ga0501314_014323 3300049530 Bacteria 776
1511 Ga0501314_027263 3300049530 Bacteria 621
1512 Ga0501314_029997 3300049530 Bacteria 601
1513 Ga0501314_043415 3300049530 Bacteria 529
1514 Ga0501315_000004 3300049531 Bacteria 11326
1515 Ga0501315_000082 3300049531 Bacteria 4574
1516 Ga0501315_001820 3300049531 Bacteria 1903
1517 Ga0501315_005197 3300049531 Bacteria 1400
1518 Ga0501315_006843 3300049531 Bacteria 1282
1519 Ga0501315_008816 3300049531 Bacteria 1181
1520 Ga0501315_020164 3300049531 Bacteria 893
1521 Ga0501315_021631 3300049531 Bacteria 872
1522 Ga0501315_032762 3300049531 Bacteria 756
1523 Ga0501315_061027 3300049531 Bacteria 610
1524 Ga0501315_070785 3300049531 Bacteria 578
1525 Ga0501315_076019 3300049531 Bacteria 564
1526 Ga0501316_000002 3300049532 Bacteria 13278
1527 Ga0501316_000608 3300049532 Bacteria 2595
1528 Ga0501316_011965 3300049532 Bacteria 1008
1529 Ga0501316_012649 3300049532 Bacteria 989
1530 Ga0501316_013073 3300049532 Bacteria 977
1531 Ga0501316_023380 3300049532 Bacteria 793
1532 Ga0501316_033072 3300049532 Bacteria 699
1533 Ga0501316_058934 3300049532 Bacteria 565
1534 Ga0501316_064078 3300049532 Bacteria 547
1535 Ga0501316_079238 3300049532 Bacteria 506
1536 Ga0501317_000565 3300049533 Bacteria 2707
1537 Ga0501317_001174 3300049533 Bacteria 2181
1538 Ga0501317_009930 3300049533 Bacteria 1128
1539 Ga0501317_024341 3300049533 Bacteria 842
1540 Ga0501317_043563 3300049533 Bacteria 693
1541 Ga0501317_045370 3300049533 Bacteria 683
1542 Ga0501317_048067 3300049533 Bacteria 670
1543 Ga0501317_049979 3300049533 Bacteria 662
1544 Ga0501318_000292 3300049534 Bacteria 2919
1545 Ga0501318_002062 3300049534 Bacteria 1690
1546 Ga0501318_002754 3300049534 Bacteria 1556
1547 Ga0501318_008537 3300049534 Bacteria 1097
1548 Ga0501318_015106 3300049534 Bacteria 918
1549 Ga0501318_088309 3300049534 Bacteria 511
1550 Ga0501319_000071 3300049535 Bacteria 3451
1551 Ga0501319_000080 3300049535 Bacteria 3309
1552 Ga0501319_002073 3300049535 Bacteria 1240
1553 Ga0501319_002652 3300049535 Bacteria 1148
1554 Ga0501319_006814 3300049535 Bacteria 853
1555 Ga0501319_010549 3300049535 Bacteria 736
1556 Ga0501319_027091 3300049535 Bacteria 539
1557 Ga0501320_000176 3300049536 Bacteria 3180
1558 Ga0501320_000935 3300049536 Bacteria 1940
1559 Ga0501320_003295 3300049536 Bacteria 1359
1560 Ga0501320_004743 3300049536 Bacteria 1211
1561 Ga0501320_005008 3300049536 Bacteria 1191
1562 Ga0501320_006579 3300049536 Bacteria 1094
1563 Ga0501320_007575 3300049536 Bacteria 1048
1564 Ga0501320_010965 3300049536 Bacteria 932
1565 Ga0501320_021334 3300049536 Bacteria 751
1566 Ga0501320_027177 3300049536 Bacteria 695
1567 Ga0501320_046170 3300049536 Bacteria 583
1568 Ga0501320_055096 3300049536 Bacteria 549
1569 Ga0501320_057117 3300049536 Bacteria 542
1570 Ga0501320_060230 3300049536 Bacteria 533
1571 Ga0501320_060558 3300049536 Bacteria 532
1572 Ga0501321_001325 3300049537 Bacteria 1944
1573 Ga0501321_001469 3300049537 Bacteria 1883
1574 Ga0501321_003832 3300049537 Bacteria 1405
1575 Ga0501321_010433 3300049537 Bacteria 1020
1576 Ga0501321_012219 3300049537 Bacteria 970
1577 Ga0501321_012554 3300049537 Bacteria 961
1578 Ga0501321_013256 3300049537 Bacteria 945
1579 Ga0501321_013278 3300049537 Bacteria 944
1580 Ga0501321_020595 3300049537 Bacteria 817
1581 Ga0501321_072790 3300049537 Bacteria 537
1582 Ga0501322_000544 3300049538 Bacteria 1815
1583 Ga0501322_000699 3300049538 Bacteria 1673
1584 Ga0501322_004204 3300049538 Bacteria 960
1585 Ga0501322_004747 3300049538 Bacteria 924
1586 Ga0501322_007469 3300049538 Bacteria 797
1587 Ga0501322_010011 3300049538 Bacteria 725
1588 Ga0501322_011712 3300049538 Bacteria 690
1589 Ga0501323_000169 3300049539 Bacteria 4034
1590 Ga0501323_000193 3300049539 Bacteria 3915
1591 Ga0501323_000710 3300049539 Bacteria 2614
1592 Ga0501323_001897 3300049539 Bacteria 1945
1593 Ga0501323_012054 3300049539 Bacteria 1052
1594 Ga0501323_025879 3300049539 Bacteria 801
1595 Ga0501323_029492 3300049539 Bacteria 764
1596 Ga0501323_046603 3300049539 Bacteria 648
1597 Ga0501323_055610 3300049539 Bacteria 609
1598 Ga0501323_077991 3300049539 Bacteria 538
1599 Ga0501324_000433 3300049540 Bacteria 2229
1600 Ga0501324_004674 3300049540 Bacteria 1098
1601 Ga0501324_005894 3300049540 Bacteria 1017
1602 Ga0501324_010339 3300049540 Bacteria 849
1603 Ga0501324_010831 3300049540 Bacteria 836
1604 Ga0501324_014280 3300049540 Bacteria 760
1605 Ga0501324_016549 3300049540 Bacteria 724
1606 Ga0501324_019768 3300049540 Bacteria 682
1607 Ga0501324_040499 3300049540 Bacteria 531
1608 Ga0501324_042627 3300049540 Bacteria 522
1609 Ga0501325_004347 3300049541 Bacteria 1080
1610 Ga0501325_015283 3300049541 Bacteria 756
1611 Ga0501325_017804 3300049541 Bacteria 723
1612 Ga0501325_020463 3300049541 Bacteria 694
1613 Ga0501325_034826 3300049541 Bacteria 592
1614 Ga0501326_00189 3300049542 Bacteria 2215
1615 Ga0501326_00267 3300049542 Bacteria 1941
1616 Ga0501326_11809 3300049542 Bacteria 533
1617 Ga0501327_00604 3300049543 Bacteria 1513
1618 Ga0501327_02933 3300049543 Bacteria 912
1619 Ga0501327_09272 3300049543 Bacteria 636
1620 Ga0501328_00400 3300049544 Bacteria 1431
1621 Ga0501328_09994 3300049544 Bacteria 532
1622 Ga0501329_02712 3300049545 Bacteria 865
1623 Ga0501329_05630 3300049545 Bacteria 698
1624 Ga0501329_13596 3300049545 Bacteria 537
1625 Ga0501330_002006 3300049546 Bacteria 1120
1626 Ga0501330_006947 3300049546 Bacteria 751
1627 Ga0501330_015962 3300049546 Bacteria 574
1628 Ga0501332_10413 3300049548 Bacteria 622
1629 Ga0501332_14445 3300049548 Bacteria 556
1630 Ga0501333_011666 3300049549 Bacteria 637
1631 Ga0501333_015352 3300049549 Bacteria 580
1632 Ga0501334_01394 3300049550 Bacteria 1329
1633 Ga0501334_05682 3300049550 Bacteria 827
1634 Ga0501334_07543 3300049550 Bacteria 751
1635 Ga0501334_12104 3300049550 Bacteria 638
1636 Ga0501335_000409 3300049551 Bacteria 2685
1637 Ga0501335_016359 3300049551 Bacteria 764
1638 Ga0501335_023262 3300049551 Bacteria 672
1639 Ga0501335_023611 3300049551 Bacteria 668
1640 Ga0501335_025828 3300049551 Bacteria 646
1641 Ga0501335_029274 3300049551 Bacteria 617
1642 Ga0501335_032355 3300049551 Bacteria 595
1643 Ga0501336_000167 3300049552 Bacteria 2751
1644 Ga0501336_001363 3300049552 Bacteria 1443
1645 Ga0501337_003001 3300049553 Bacteria 1058
1646 Ga0501337_005538 3300049553 Bacteria 848
1647 Ga0501337_006521 3300049553 Bacteria 798
1648 Ga0501337_010797 3300049553 Bacteria 669
1649 Ga0501337_010948 3300049553 Bacteria 667
1650 Ga0501337_014108 3300049553 Bacteria 608
1651 Ga0501337_015299 3300049553 Bacteria 592
1652 Ga0501338_00312 3300049554 Bacteria 2096
1653 Ga0501338_10404 3300049554 Bacteria 626
1654 Ga0501339_00948 3300049555 Bacteria 676
1655 Ga0501340_001367 3300049556 Bacteria 1307
1656 Ga0501340_002758 3300049556 Bacteria 1029
1657 Ga0501340_007553 3300049556 Bacteria 752
1658 Ga0501340_014173 3300049556 Bacteria 620
1659 Ga0501031_0477807 3300049568 Bacteria 804
1660 Ga0501031_0565482 3300049568 Bacteria 732
1661 Ga0501032_0005689 3300049569 Bacteria 9231
1662 Ga0501033_0001803 3300049570 Bacteria 18695
1663 Ga0501033_0706795 3300049570 Bacteria 685
1664 Ga0501034_0029030 3300049571 Bacteria 5623
1665 Ga0501036_0011113 3300049572 Bacteria 7445
1666 Ga0501037_0029069 3300049573 Bacteria 4082
1667 Ga0501037_0046758 3300049573 Bacteria 3173
1668 Ga0501038_0004562 3300049574 Bacteria 12890
1669 Ga0501038_0286054 3300049574 Bacteria 1297
1670 Ga0501038_0434049 3300049574 Bacteria 1012
1671 Ga0501039_0138984 3300049575 Bacteria 1908
1672 Ga0501043_0011146 3300049579 Bacteria 7040
1673 Ga0501043_0093617 3300049579 Bacteria 2362
1674 Ga0501043_0197840 3300049579 Bacteria 1561
1675 Ga0501046_0007619 3300049580 Bacteria 9496
1676 Ga0501047_0089170 3300049581 Bacteria 2961
1677 Ga0501047_0708154 3300049581 Bacteria 824
1678 Ga0501047_1156958 3300049581 Bacteria 587
1679 Ga0501048_0432662 3300049582 Bacteria 942
1680 Ga0501199_038701 3300049650 Bacteria 612
1681 Ga0501202_039928 3300049652 Bacteria 1010
1682 Ga0501207_084022 3300049654 Bacteria 617
1683 Ga0501211_021197 3300049658 Bacteria 684
1684 Ga0501222_036527 3300049662 Bacteria 687
1685 Ga0501227_015572 3300049665 Bacteria 1699
1686 Ga0501230_001749 3300049667 Bacteria 2651
1687 Ga0501233_025241 3300049668 Bacteria 1305
1688 Ga0501235_104667 3300049669 Bacteria 694
1689 Ga0501238_000213 3300049671 Bacteria 8393
1690 Ga0501238_011742 3300049671 Bacteria 1180
1691 Ga0501246_003814 3300049676 Bacteria 1227
1692 Ga0501249_216847 3300049679 Bacteria 508
1693 Ga0501221_006424 3300049704 Bacteria 1988
1694 Ga0501229_003004 3300049706 Bacteria 2006
1695 Ga0501234_034107 3300049707 Bacteria 825
1696 Ga0501241_033343 3300049758 Bacteria 978
1697 Ga0501262_000574 3300049759 Bacteria 4379
1698 Ga0501263_012109 3300049760 Bacteria 1079
1699 Ga0501265_002083 3300049762 Bacteria 2280
1700 Ga0501268_046021 3300049765 Bacteria 833
1701 Ga0501269_000003 3300049766 Bacteria 111299
1702 Ga0501269_002814 3300049766 Bacteria 2120
1703 Ga0501276_018743 3300049773 Bacteria 647
1704 Ga0501279_000683 3300049775 Bacteria 4449
1705 Ga0501279_008680 3300049775 Bacteria 1358
1706 Ga0501035_0007388 3300049822 Bacteria 10272
1707 Ga0501035_0010452 3300049822 Bacteria 8602
1708 Ga0501035_0010523 3300049822 Bacteria 8572
1709 Ga0501035_0084650 3300049822 Bacteria 2796
1710 Ga0501035_1312417 3300049822 Bacteria 557
1711 Ga0501035_1376759 3300049822 Bacteria 541
1712 Ga0501035_1550089 3300049822 Bacteria 504
1713 Ga0501044_0000210 3300049823 Bacteria 74323
1714 Ga0501044_0007653 3300049823 Bacteria 11876
1715 Ga0501044_0025863 3300049823 Bacteria 6221
1716 Ga0501044_0241667 3300049823 Bacteria 1749
1717 Ga0501226_040218 3300049853 Bacteria 537
1718 nmdc:mga03683_192040_c1 3300050489 Bacteria 935
1719 nmdc:mga03683_22136_c1 3300050489 Bacteria 2461
1720 nmdc:mga03n38_4851_c1 3300050490 Bacteria 4507
1721 nmdc:mga03n38_59764_c1 3300050490 Bacteria 1731
1722 nmdc:mga00v17_25609_c1 3300050491 Bacteria 3430
1723 nmdc:mga00v17_630988_c1 3300050491 Bacteria 690
1724 nmdc:mga0yw44_371288_c1 3300050492 Bacteria 965
1725 nmdc:mga0k408_52239_c1 3300050493 Bacteria 2369
1726 nmdc:mga0k408_679800_c1 3300050493 Bacteria 604
1727 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
1728 nmdc:mga06z11_3023_c1 3300050494 Bacteria 6473
1729 nmdc:mga04h51_47659_c1 3300050495 Bacteria 1425
1730 nmdc:mga07m45_348122_c1 3300050496 Bacteria 861
1731 nmdc:mga07m45_67895_c1 3300050496 Bacteria 2027
1732 nmdc:mga07m45_691362_c1 3300050496 Bacteria 587
1733 nmdc:mga06r32_1149912_c1 3300050510 Bacteria 724
1734 nmdc:mga0n895_1079125_c1 3300050512 Bacteria 781
1735 nmdc:mga0rr50_1578394_c1 3300050513 Bacteria 554
1736 nmdc:mga0a205_104296_c1 3300050515 Bacteria 2734
1737 nmdc:mga0sz30_3989_c1 3300050516 Bacteria 5314
1738 Ga0495601_0117248 3300053077 Bacteria 1727
1739 Ga0495619_0772700 3300053085 Bacteria 651
1740 Ga0500578_0003978 3300053086 Bacteria 10700
1741 Ga0500643_134293 3300053087 Bacteria 665
1742 Ga0500646_0011171 3300053090 Bacteria 2306
1743 Ga0500651_0000274 3300053093 Bacteria 30518
1744 Ga0500650_0072451 3300053098 Bacteria 1610
1745 Ga0500556_0257267 3300053104 Bacteria 687
1746 Ga0500562_016703 3300053108 Bacteria 1888
1747 Ga0500562_151087 3300053108 Bacteria 632
1748 Ga0500569_001743 3300053109 Bacteria 4166
1749 Ga0500572_221041 3300053111 Bacteria 619
1750 Ga0500593_257026 3300053117 Bacteria 587
1751 Ga0500594_0063615 3300053118 Bacteria 1069
1752 Ga0500594_0086002 3300053118 Bacteria 947
1753 Ga0500595_008416 3300053119 Bacteria 4214
1754 Ga0500618_002645 3300053125 Bacteria 6592
1755 Ga0500621_177758 3300053126 Bacteria 774
1756 Ga0500628_048117 3300053129 Bacteria 1001
1757 Ga0500642_0002530 3300053130 Bacteria 5383
1758 Ga0500652_000400 3300053131 Bacteria 15538
1759 Ga0500655_119690 3300053133 Bacteria 558
1760 Ga0500561_0020973 3300053137 Bacteria 1534
1761 Ga0500561_0067768 3300053137 Bacteria 1014
1762 Ga0500568_0013644 3300053139 Bacteria 3696
1763 Ga0500573_0295304 3300053140 Bacteria 813
1764 Ga0500574_000403 3300053141 Bacteria 5436
1765 Ga0500574_028175 3300053141 Bacteria 1488
1766 Ga0500577_0006134 3300053142 Bacteria 3292
1767 Ga0500577_0202515 3300053142 Bacteria 857
1768 Ga0500586_006873 3300053145 Bacteria 2993
1769 Ga0500586_053986 3300053145 Bacteria 1389
1770 Ga0500588_0219596 3300053146 Bacteria 708
1771 Ga0500604_0033502 3300053151 Bacteria 1519
1772 Ga0500616_0028067 3300053153 Bacteria 3105
1773 Ga0500619_089331 3300053154 Bacteria 1040
1774 Ga0500622_0000198 3300053156 Bacteria 63633
1775 Ga0500624_004964 3300053157 Bacteria 1761
1776 Ga0500627_0121237 3300053158 Bacteria 1180
1777 Ga0500627_0246273 3300053158 Bacteria 792
1778 Ga0500634_0000642 3300053161 Bacteria 11826
1779 Ga0500636_0464995 3300053177 Bacteria 568
1780 Ga0500637_0321398 3300053178 Bacteria 836
1781 Ga0500552_082609 3300053733 Bacteria 591
1782 Ga0500661_099610 3300055283 Bacteria 550
1783 Ga0587084_000213 3300059477 Bacteria 3885
1784 Ga0587084_000401 3300059477 Bacteria 3315
1785 Ga0587084_025419 3300059477 Bacteria 918
1786 Ga0587084_035365 3300059477 Bacteria 825
1787 Ga0587084_043931 3300059477 Bacteria 769
1788 Ga0587093_000380 3300059478 Bacteria 2980
1789 Ga0587093_001062 3300059478 Bacteria 2196
1790 Ga0587093_052406 3300059478 Bacteria 647
1791 Ga0587093_060912 3300059478 Bacteria 616
1792 Ga0587093_092837 3300059478 Bacteria 536
1793 Ga0587066_000001 3300059490 Bacteria 11779
1794 Ga0587066_001525 3300059490 Bacteria 2348
1795 Ga0587066_073625 3300059490 Bacteria 725
1796 Ga0587070_004333 3300059491 Bacteria 1783
1797 Ga0587070_030492 3300059491 Bacteria 974
1798 Ga0587070_116654 3300059491 Bacteria 633
1799 Ga0587073_0000035 3300059492 Bacteria 7203
1800 Ga0587073_0122107 3300059492 Bacteria 705
1801 Ga0587077_000648 3300059493 Bacteria 3182
1802 Ga0587077_007748 3300059493 Bacteria 1576
1803 Ga0587077_118437 3300059493 Bacteria 658
1804 Ga0587077_154127 3300059493 Bacteria 603
1805 Ga0587080_000038 3300059503 Bacteria 6744
1806 Ga0587080_012184 3300059503 Bacteria 1296
1807 Ga0587080_018572 3300059503 Bacteria 1118
1808 Ga0587080_021806 3300059503 Bacteria 1056
1809 Ga0587082_000027 3300059504 Bacteria 6899
1810 Ga0587082_008647 3300059504 Bacteria 1425
1811 Ga0587082_016254 3300059504 Bacteria 1159
1812 Ga0587082_050421 3300059504 Bacteria 792
1813 Ga0587083_0000039 3300059505 Bacteria 6410
1814 Ga0587083_0000305 3300059505 Bacteria 3960
1815 Ga0587083_0010072 3300059505 Bacteria 1523
1816 Ga0587083_0031320 3300059505 Bacteria 1060
1817 Ga0587083_0055289 3300059505 Bacteria 878
1818 Ga0587085_002630 3300059506 Bacteria 1853
1819 Ga0587085_002980 3300059506 Bacteria 1792
1820 Ga0587085_007329 3300059506 Bacteria 1373
1821 Ga0587085_057021 3300059506 Bacteria 728
1822 Ga0587086_000453 3300059507 Bacteria 2936
1823 Ga0587086_000753 3300059507 Bacteria 2555
1824 Ga0587088_000001 3300059508 Bacteria 14678
1825 Ga0587088_001117 3300059508 Bacteria 2664
1826 Ga0587088_169938 3300059508 Bacteria 540
1827 Ga0587089_000565 3300059509 Bacteria 2935
1828 Ga0587089_001052 3300059509 Bacteria 2434
1829 Ga0587090_001908 3300059510 Bacteria 2200
1830 Ga0587090_003259 3300059510 Bacteria 1872
1831 Ga0587090_011821 3300059510 Bacteria 1234
1832 Ga0587090_018838 3300059510 Bacteria 1059
1833 Ga0587091_002949 3300059511 Bacteria 2086
1834 Ga0587091_007570 3300059511 Bacteria 1572
1835 Ga0587091_010932 3300059511 Bacteria 1403
1836 Ga0587092_000969 3300059512 Bacteria 2624
1837 Ga0587092_003731 3300059512 Bacteria 1756
1838 Ga0587092_009204 3300059512 Bacteria 1323
1839 Ga0587092_069447 3300059512 Bacteria 675
1840 Ga0587092_159481 3300059512 Bacteria 509
1841 Ga0587094_008925 3300059513 Bacteria 1267
1842 Ga0587094_012910 3300059513 Bacteria 1122
1843 Ga0587095_002116 3300059514 Bacteria 1307
1844 Ga0587095_009187 3300059514 Bacteria 814
1845 Ga0587097_02013 3300059603 Bacteria 785
1846 Ga0587098_012861 3300059604 Bacteria 964
1847 Ga0587106_000122 3300059605 Bacteria 3963
1848 Ga0587106_001550 3300059605 Bacteria 2066
1849 Ga0587106_017006 3300059605 Bacteria 1035
1850 Ga0587121_00999 3300059606 Bacteria 1339
1851 Ga0587121_05107 3300059606 Bacteria 753
1852 Ga0587125_002765 3300059607 Bacteria 1439
1853 Ga0587125_012182 3300059607 Bacteria 914
1854 Ga0587125_017429 3300059607 Bacteria 816
1855 Ga0587125_036413 3300059607 Bacteria 649
1856 Ga0587125_057661 3300059607 Bacteria 561
1857 Ga0587129_000136 3300059608 Bacteria 2634
1858 Ga0587129_014311 3300059608 Bacteria 652
1859 Ga0587131_001141 3300059609 Bacteria 1253
1860 Ga0587131_015980 3300059609 Bacteria 584
1861 Ga0587099_000239 3300059622 Bacteria 2770
1862 Ga0587099_001284 3300059622 Bacteria 1763
1863 Ga0587101_000023 3300059623 Bacteria 7377
1864 Ga0587101_002644 3300059623 Bacteria 1735
1865 Ga0587101_092996 3300059623 Bacteria 589
1866 Ga0587109_004786 3300059624 Bacteria 1904
1867 Ga0587109_012058 3300059624 Bacteria 1409
1868 Ga0587109_013863 3300059624 Bacteria 1344
1869 Ga0587109_191445 3300059624 Bacteria 528
1870 Ga0587113_000311 3300059625 Bacteria 2411
1871 Ga0587113_006187 3300059625 Bacteria 1010
1872 Ga0587113_018749 3300059625 Bacteria 712
1873 Ga0587115_002966 3300059626 Bacteria 1742
1874 Ga0587115_004133 3300059626 Bacteria 1571
1875 Ga0587117_000748 3300059627 Bacteria 2418
1876 Ga0587117_000981 3300059627 Bacteria 2248
1877 Ga0587117_044136 3300059627 Bacteria 720
1878 Ga0587122_014627 3300059628 Bacteria 793
1879 Ga0587127_001579 3300059629 Bacteria 1297
1880 Ga0587127_004190 3300059629 Bacteria 949
1881 Ga0587128_001779 3300059630 Bacteria 2115
1882 Ga0587128_002699 3300059630 Bacteria 1880
1883 Ga0587130_003257 3300059631 Bacteria 1361
1884 Ga0587130_014083 3300059631 Bacteria 814
1885 Ga0587062_000153 3300059639 Bacteria 3794
1886 Ga0587062_000195 3300059639 Bacteria 3564
1887 Ga0587062_006619 3300059639 Bacteria 1324
1888 Ga0587062_013939 3300059639 Bacteria 1054
1889 Ga0587062_022912 3300059639 Bacteria 900
1890 Ga0587062_112775 3300059639 Bacteria 542
1891 Ga0587067_000932 3300059640 Bacteria 2934
1892 Ga0587068_000002 3300059641 Bacteria 13671
1893 Ga0587068_000350 3300059641 Bacteria 3976
1894 Ga0587068_001305 3300059641 Bacteria 2742
1895 Ga0587068_039055 3300059641 Bacteria 853
1896 Ga0587068_101698 3300059641 Bacteria 604
1897 Ga0587069_000016 3300059642 Bacteria 8774
1898 Ga0587069_001975 3300059642 Bacteria 2000
1899 Ga0587069_012065 3300059642 Bacteria 1165
1900 Ga0587072_000243 3300059643 Bacteria 4970
1901 Ga0587072_005559 3300059643 Bacteria 1887
1902 Ga0587072_005813 3300059643 Bacteria 1855
1903 Ga0587075_000415 3300059644 Bacteria 3323
1904 Ga0587075_013252 3300059644 Bacteria 1131
1905 Ga0587075_058867 3300059644 Bacteria 688
1906 Ga0587076_002771 3300059645 Bacteria 2007
1907 Ga0587076_002988 3300059645 Bacteria 1964
1908 Ga0587076_014419 3300059645 Bacteria 1216
1909 Ga0587076_021100 3300059645 Bacteria 1076
1910 Ga0587076_106658 3300059645 Bacteria 632
1911 Ga0587078_000244 3300059646 Bacteria 3622
1912 Ga0587078_012895 3300059646 Bacteria 984
1913 Ga0587078_037889 3300059646 Bacteria 672
1914 Ga0587079_000033 3300059647 Bacteria 7318
1915 Ga0587079_000584 3300059647 Bacteria 3398
1916 Ga0587079_006516 3300059647 Bacteria 1705
1917 Ga0587079_012865 3300059647 Bacteria 1376
1918 Ga0587079_092121 3300059647 Bacteria 711
1919 Ga0587100_000902 3300059648 Bacteria 1596
1920 Ga0587102_000132 3300059649 Bacteria 3370
1921 Ga0587102_001309 3300059649 Bacteria 1715
1922 Ga0587102_001768 3300059649 Bacteria 1578
1923 Ga0587102_019367 3300059649 Bacteria 756
1924 Ga0587104_000049 3300059650 Bacteria 3143
1925 Ga0587104_021262 3300059650 Bacteria 542
1926 Ga0587105_000034 3300059651 Bacteria 3456
1927 Ga0587105_000662 3300059651 Bacteria 1530
1928 Ga0587107_000182 3300059652 Bacteria 3468
1929 Ga0587107_007809 3300059652 Bacteria 1216
1930 Ga0587107_021182 3300059652 Bacteria 909
1931 Ga0587107_108298 3300059652 Bacteria 559
1932 Ga0587108_000210 3300059653 Bacteria 2694
1933 Ga0587108_002115 3300059653 Bacteria 1301
1934 Ga0587110_002612 3300059654 Bacteria 1444
1935 Ga0587110_011354 3300059654 Bacteria 903
1936 Ga0587114_000232 3300059655 Bacteria 3283
1937 Ga0587114_003206 3300059655 Bacteria 1606
1938 Ga0587116_00707 3300059656 Bacteria 1420
1939 Ga0587116_08269 3300059656 Bacteria 671
1940 Ga0587118_00408 3300059657 Bacteria 2109
1941 Ga0587118_10377 3300059657 Bacteria 709
1942 Ga0587119_002359 3300059658 Bacteria 1690
1943 Ga0587119_003321 3300059658 Bacteria 1522
1944 Ga0587120_001451 3300059659 Bacteria 1481
1945 Ga0587120_002256 3300059659 Bacteria 1296
1946 Ga0587120_024873 3300059659 Bacteria 588
1947 Ga0587124_000978 3300059660 Bacteria 1755
1948 Ga0587124_007578 3300059660 Bacteria 916
1949 Ga0587124_017743 3300059660 Bacteria 704
1950 Ga0587060_002032 3300060243 Bacteria 1388
1951 Ga0587060_006033 3300060243 Bacteria 957
1952 Ga0587065_01425 3300060245 Bacteria 1196
1953 Ga0587081_02283 3300060246 Bacteria 1155
1954 Ga0587096_00164 3300060247 Bacteria 1457
1955 Ga0587096_02023 3300060247 Bacteria 738
1956 Ga0587071_001255 3300060344 Bacteria 3088
1957 Ga0587071_001373 3300060344 Bacteria 3016
1958 Ga0587071_005333 3300060344 Bacteria 1962
1959 Ga0587071_007249 3300060344 Bacteria 1762
1960 Ga0587071_033378 3300060344 Bacteria 1002
1961 Ga0587111_0000116 3300060346 Bacteria 5398
1962 Ga0587111_0000229 3300060346 Bacteria 4601
1963 Ga0587111_0000781 3300060346 Bacteria 3362
1964 Ga0587111_0007805 3300060346 Bacteria 1752
1965 Ga0587111_0009542 3300060346 Bacteria 1640
1966 Ga0587111_0020018 3300060346 Bacteria 1276
1967 Ga0587111_0021839 3300060346 Bacteria 1238
1968 Ga0587111_0027306 3300060346 Bacteria 1143
1969 Ga0587111_0037879 3300060346 Bacteria 1016
1970 Ga0587111_0044090 3300060346 Bacteria 962
1971 Ga0587111_0092093 3300060346 Bacteria 742
1972 Ga0587111_0130804 3300060346 Bacteria 656
1973 Ga0466962_0041637 3300061719 Bacteria 2197
1974 Ga0466962_0081191 3300061719 Bacteria 1551
1975 2587725925 2585428057 Bacteria 6737412
1976 2587735576 2585428058 Bacteria 6853932
1977 2588292862 2588253510 Bacteria 6901809
1978 2643967971 2643221592 Bacteria 6608788
1979 2644143129 2643221625 Bacteria 6512927
1980 2644271783 2643221648 Bacteria 6521465
1981 Ga0501306_050997
1982 JGI24737J22298_10004492
1983 JGI25154J39366_1001042
1984 JGI25158J39367_1000542
1985 JGI25157J39369_1015755
1986 JGI25164J39214_1003736
1987 JGI25152J39213_1001073
1988 JGI25150J39212_1001923
1989 JGI25150J39212_1003907
1990 JGI25150J39212_1011120
1991 JGI25150J39212_1030565
1992 Ga0006769J43182_103907
1993 Ga0006764J43180_105416
1994 Ga0006761J43178_105065
1995 Ga0006767J43181_105098
1996 Ga0006767J43181_109868
1997 Ga0006763J43179_104166
1998 Ga0006762J43184_104373
1999 JGI25159J45721_1016429
2000 JGI25159J45721_1022081
2001 JGI25159J45721_1043703
2002 Ga0006774J45829_10836
2003 Ga0006760J45825_101715
2004 Ga0006760J45825_103029
2005 Ga0006771J45828_104476
2006 Ga0006779J45831_104820
2007 Ga0006765J45826_105454
2008 Ga0006765J45826_116824
2009 Ga0006778J45830_1013714
2010 Ga0006778J45830_1030895
2011 Ga0006778J45830_1104448
2012 Ga0006759J45824_1006644
2013 Ga0006759J45824_1006645
2014 Ga0006759J45824_1010973
2015 Ga0006759J45824_1011122
2016 Ga0006759J45824_1019946
2017 Ga0006759J45824_1026362
2018 Ga0006759J45824_1037247
2019 Ga0006759J45824_1057424
2020 Ga0006759J45824_1062806
2021 JGI25151J46595_10026799
2022 JGI25165J46597_1000239
2023 JGI25153J46596_10002258
2024 JGI25153J46596_10007740
2025 JGI25153J46596_10024369
2026 Ga0007428J48920_101526
2027 Ga0007421J48921_104512
2028 Ga0006758J48902_1003545
2029 Ga0006758J48902_1003546
2030 Ga0006758J48902_1008804
2031 Ga0006758J48902_1008911
2032 Ga0006758J48902_1015271
2033 Ga0006758J48902_1015967
2034 Ga0006758J48902_1016024
2035 Ga0006758J48902_1016608
2036 Ga0006758J48902_1016798
2037 Ga0006758J48902_1029777
2038 Ga0006770J48903_1010652
2039 Ga0006770J48903_1021042
2040 Ga0006770J48903_1024757
2041 Ga0006770J48903_1030572
2042 Ga0006770J48903_1033615
2043 Ga0006770J48903_1040316
2044 Ga0006777J48905_1009816
2045 Ga0006777J48905_1042888
2046 Ga0006777J48905_1043988
2047 Ga0006777J48905_1047191
2048 rootL2_10028224
2049 JGI25160J50197_1001051
2050 JGI25161J50226_1008067
2051 Ga0007417J51691_1002612
2052 Ga0007417J51691_1007850
2053 Ga0007417J51691_1011781
2054 Ga0007417J51691_1014485
2055 Ga0007417J51691_1022403
2056 Ga0007417J51691_1024669
2057 Ga0007427J51700_104411
2058 Ga0007427J51700_113492
2059 Ga0007427J51700_117468
2060 Ga0006781J51513_1010997
2061 Ga0007410J51695_1002373
2062 Ga0007410J51695_1004597
2063 Ga0007410J51695_1005374
2064 Ga0007410J51695_1012689
2065 Ga0007410J51695_1020776
2066 Ga0007410J51695_1025455
2067 Ga0007410J51695_1042924
2068 Ga0007409J51694_1000684
2069 Ga0007409J51694_1002576
2070 Ga0007409J51694_1020347
2071 Ga0007409J51694_1020348
2072 Ga0007409J51694_1027019
2073 Ga0007409J51694_1029751
2074 Ga0007409J51694_1032549
2075 Ga0007409J51694_1069872
2076 Ga0007409J51694_1071440
2077 Ga0007416J51690_1002712
2078 Ga0007416J51690_1004870
2079 Ga0007416J51690_1010696
2080 Ga0007416J51690_1019156
2081 Ga0007416J51690_1023149
2082 Ga0007416J51690_1028700
2083 Ga0007416J51690_1030690
2084 Ga0007416J51690_1049107
2085 Ga0007429J51699_1007754
2086 Ga0007429J51699_1031025
2087 Ga0007429J51699_1050371
2088 Ga0007411J51799_103551
2089 Ga0007411J51799_103780
2090 Ga0007411J51799_104897
2091 Ga0007411J51799_110137
2092 Ga0007415J51800_102854
2093 Ga0007415J51800_104265
2094 Ga0007415J51800_106957
2095 Ga0007415J51800_109527
2096 Ga0007415J51800_115272
2097 Ga0032354_1003171
2098 Ga0032354_1003173
2099 Ga0032354_1010694
2100 Ga0032354_1011582
2101 Ga0032354_1028048
2102 Ga0032354_1033344
2103 Ga0032354_1045145
2104 Ga0032354_1061607
2105 Ga0006766_111745
2106 Ga0006766_113576
2107 Ga0006780_1003428
2108 Ga0006780_1013040
2109 Ga0055538_1000094
2110 Ga0055538_1000138
2111 Ga0055539_1000136
2112 Ga0055539_1000187
2113 Ga0055533_1000143
2114 Ga0055533_1000189
2115 Ga0055525_1000018
2116 Ga0055525_1000188
2117 Ga0055525_1000254
2118 Ga0055542_1019379
2119 Ga0055529_1000079
2120 Ga0055526_1000791
2121 Ga0055526_1006085
2122 Ga0055526_1091554
2123 Ga0055526_1091670
2124 Ga0055537_1008487
2125 Ga0055524_1003212
2126 Ga0055524_1009814
2127 Ga0055534_1006739
2128 Ga0055534_1030376
2129 Ga0055528_1039396
2130 Ga0055528_1041929
2131 Ga0055528_1064545
2132 Ga0055530_10013385
2133 Ga0055530_10019398
2134 Ga0055531_10006076
2135 Ga0055541_1000092
2136 Ga0055541_1000122
2137 Ga0055543_1050694
2138 Ga0058858_1025387
2139 Ga0058858_1044898
2140 Ga0058858_1357897
2141 Ga0058858_1365258
2142 Ga0058858_1437652
2143 Ga0058859_10052933
2144 Ga0058859_10157838
2145 Ga0058859_11479387
2146 Ga0058859_11797660
2147 Ga0058863_10085600
2148 Ga0058863_11897775
2149 Ga0058861_10000050
2150 Ga0058861_10025764
2151 Ga0058861_10123833
2152 Ga0058860_10186761
2153 Ga0058862_10030562
2154 Ga0058862_10086046
2155 Ga0058862_10117947
2156 Ga0058862_12858774
2157 Ga0065165_1007979
2158 Ga0065165_1045530
2159 Ga0065165_1109781
2160 Ga0065714_10003225
2161 Ga0065714_10030331
2162 Ga0065714_10081698
2163 Ga0065704_10033996
2164 Ga0065704_10109441
2165 Ga0065715_10029350
2166 Ga0065707_10395474
2167 Ga0065707_10423369
2168 Ga0070676_10056596
2169 Ga0070683_100088965
2170 Ga0070670_100298688
2171 Ga0068869_100399932
2172 Ga0068869_100512863
2173 Ga0070666_10594539
2174 Ga0070680_100156061
2175 Ga0070680_100350879
2176 Ga0070682_100289738
2177 Ga0070660_100033862
2178 Ga0070660_100450254
2179 Ga0070661_100008785
2180 Ga0070661_100240283
2181 Ga0070692_10298703
2182 Ga0070692_10930305
2183 Ga0070675_100262088
2184 Ga0070675_100617780
2185 Ga0070674_100422527
2186 Ga0070674_101181066
2187 Ga0070673_100718252
2188 Ga0070688_100739901
2189 Ga0070659_100004652
2190 Ga0070659_100548477
2191 Ga0070667_101147951
2192 Ga0070714_100277699
2193 Ga0070705_101938002
2194 Ga0070694_100271604
2195 Ga0070694_101396819
2196 Ga0070708_100853085
2197 Ga0070663_100474735
2198 Ga0070678_100931172
2199 Ga0070678_101967645
2200 Ga0070662_100158386
2201 Ga0070662_100795971
2202 Ga0070681_10288080
2203 Ga0070681_11616310
2204 Ga0068867_100105263
2205 Ga0070699_100350041
2206 Ga0068853_100029320
2207 Ga0068853_100284609
2208 Ga0068853_100398896
2209 Ga0070695_100618785
2210 Ga0070693_100948056
2211 Ga0070665_101901578
2212 Ga0070704_100761978
2213 Ga0068855_100166634
2214 Ga0068855_100247815
2215 Ga0068855_100431713
2216 Ga0068855_101136806
2217 Ga0068855_102593924
2218 Ga0070664_100027769
2219 Ga0068857_100009923
2220 Ga0068854_100016031
2221 Ga0068854_100368679
2222 Ga0068854_100677887
2223 Ga0068856_100049792
2224 Ga0068856_100266346
2225 Ga0068856_100477995
2226 Ga0070702_100090534
2227 Ga0070702_101599888
2228 Ga0068852_100838091
2229 Ga0068864_100982145
2230 Ga0068861_102016474
2231 Ga0068851_10001517
2232 Ga0068851_10034122
2233 Ga0068870_10444775
2234 Ga0068863_100705757
2235 Ga0068862_100722442
2236 Ga0068862_101325660
2237 Ga0070717_10765390
2238 Ga0075368_10189666
2239 Ga0075363_100005889
2240 Ga0075363_100805349
2241 Ga0075364_10032491
2242 Ga0075364_10092282
2243 Ga0075362_10000222
2244 Ga0075362_10000565
2245 Ga0075367_10000855
2246 Ga0075369_10005325
2247 Ga0075366_10023561
2248 Ga0075366_10033384
2249 Ga0075366_10199541
2250 Ga0075366_10218034
2251 Ga0075366_10820726
2252 Ga0097621_100021406
2253 Ga0075370_10001150
2254 Ga0075370_10064344
2255 Ga0075370_10104070
2256 Ga0075370_10152303
2257 Ga0068871_100015656
2258 Ga0075433_10202721
2259 Ga0068865_100074639
2260 Ga0068865_100140074
2261 Ga0068865_100921340
2262 Ga0079104_1004078
2263 Ga0079104_1104358
2264 Ga0099826_10000010
2265 Ga0075435_100367572
2266 Ga0099794_10383343
2267 Ga0105244_10023517
2268 Ga0105244_10028871
2269 Ga0105244_10045359
2270 Ga0105244_10084777
2271 Ga0105244_10463019
2272 Ga0105240_10005705
2273 Ga0105240_10009383
2274 Ga0105240_10327528
2275 Ga0105240_10523357
2276 Ga0105245_10023078
2277 Ga0105243_10006860
2278 Ga0105243_10499114
2279 Ga0105243_12034967
2280 Ga0105241_10057980
2281 Ga0105242_10007953
2282 Ga0105242_12640934
2283 Ga0105248_10539440
2284 Ga0105237_10134008
2285 Ga0105237_10460777
2286 Ga0105238_10000255
2287 Ga0105238_10162679
2288 Ga0105238_10455386
2289 Ga0105249_10303710
2290 Ga0105249_13417083
2291 Ga0130087_1030513
2292 Ga0130087_1090781
2293 Ga0130087_1095535
2294 Ga0130086_1025653
2295 Ga0130086_1025943
2296 Ga0130086_1026814
2297 Ga0130085_1073923
2298 Ga0130085_1083711
2299 Ga0130085_1132233
2300 Ga0105239_10001561
2301 Ga0105246_10744899
2302 Ga0105246_12194323
2303 Ga0157321_1010116
2304 Ga0157319_1007161
2305 Ga0157327_1057832
2306 Ga0154014_155471
2307 Ga0157373_10015732
2308 Ga0157373_10154902
2309 Ga0157373_10459447
2310 Ga0157371_10001564
2311 Ga0157371_10250157
2312 Ga0157371_10501027
2313 Ga0157370_10325401
2314 Ga0157370_11707859
2315 Ga0157369_10315337
2316 Ga0157374_10009298
2317 Ga0157374_10143777
2318 Ga0157378_10027087
2319 Ga0157378_10248653
2320 Ga0157378_11242214
2321 Ga0163162_10060438
2322 Ga0163162_10103155
2323 Ga0163162_10139871
2324 Ga0157372_10991197
2325 Ga0157375_11430153
2326 Ga0157375_11776352
2327 Ga0182008_10001808
2328 Ga0182008_10003186
2329 Ga0182008_10039266
2330 Ga0182008_10329668
2331 Ga0157377_10259659
2332 Ga0157377_10637996
2333 Ga0157376_11698828
2334 Ga0182006_1000240
2335 Ga0182006_1000274
2336 Ga0182006_1048484
2337 Ga0182006_1293840
2338 Ga0182007_10000196
2339 Ga0182007_10014439
2340 Ga0182007_10044315
2341 Ga0182007_10098690
2342 Ga0182005_1000016
2343 Ga0182005_1000163
2344 Ga0182005_1000370
2345 Ga0163161_10007196
2346 Ga0163161_10039119
2347 Ga0197907_10298599
2348 Ga0197907_10941484
2349 Ga0206355_1235934
2350 Ga0206352_10695704
2351 Ga0206352_11129984
2352 Ga0206354_11576217
2353 Ga0206353_10105939
2354 Ga0154015_1381451
2355 Ga0213872_10000307
2356 Ga0213872_10003461
2357 Ga0213872_10041234
2358 Ga0213872_10070274
2359 Ga0213872_10070360
2360 Ga0213872_10215334
2361 Ga0256744_118715
2362 Ga0209760_109176
2363 Ga0209436_100401
2364 Ga0209784_100010
2365 Ga0209784_100035
2366 Ga0209566_100008
2367 Ga0209566_100040
2368 Ga0209674_100019
2369 Ga0209674_100057
2370 Ga0209672_105905
2371 Ga0209563_100011
2372 Ga0209563_100021
2373 Ga0209563_100059
2374 Ga0207427_100342
2375 Ga0209437_100019
2376 Ga0209437_103125
2377 Ga0207425_1000021
2378 Ga0207425_1000680
2379 Ga0207425_1000845
2380 Ga0207425_1000932
2381 Ga0207425_1049412
2382 Ga0209646_1000068
2383 Ga0209026_1003315
2384 Ga0209677_100011
2385 Ga0209677_100036
2386 Ga0209677_102227
2387 Ga0209148_1000444
2388 Ga0209129_1000020
2389 Ga0209129_1000158
2390 Ga0209129_1052977
2391 Ga0209233_1000025
2392 Ga0209565_1001042
2393 Ga0209565_1006230
2394 Ga0209565_1011005
2395 Ga0209565_1077228
2396 Ga0209455_1000070
2397 Ga0209455_1001216
2398 Ga0209673_1000730
2399 Ga0209673_1004093
2400 Ga0209673_1004985
2401 Ga0209673_1010299
2402 Ga0209130_1010313
2403 Ga0209675_1012428
2404 Ga0209675_1046147
2405 Ga0209025_1006398
2406 Ga0209564_1000027
2407 Ga0209564_1000047
2408 Ga0209564_1000282
2409 Ga0209564_1002740
2410 Ga0209564_1037233
2411 Ga0209758_1000077
2412 Ga0209758_1000322
2413 Ga0209758_1000910
2414 Ga0209758_1011080
2415 Ga0209050_1000050
2416 Ga0209050_1000223
2417 Ga0209050_1002922
2418 Ga0209256_1000054
2419 Ga0209256_1002719
2420 Ga0209256_1004416
2421 Ga0209256_1009680
2422 Ga0209256_1095645
2423 Ga0207426_1000802
2424 Ga0209051_1018074
2425 Ga0209051_1026168
2426 Ga0209257_1000075
2427 Ga0209257_1043589
2428 Ga0207656_10040557
2429 Ga0207656_10058704
2430 Ga0207655_1000499
2431 Ga0207655_1024949
2432 Ga0207655_1028515
2433 Ga0207655_1031488
2434 Ga0207680_10310463
2435 Ga0207647_10029480
2436 Ga0207685_10411976
2437 Ga0207645_10064364
2438 Ga0207643_10369110
2439 Ga0207705_10016800
2440 Ga0207654_10109708
2441 Ga0207695_10001345
2442 Ga0207695_10174538
2443 Ga0207695_10283352
2444 Ga0207671_10007790
2445 Ga0207671_10013783
2446 Ga0207660_10096089
2447 Ga0207657_10001495
2448 Ga0207657_10030110
2449 Ga0207657_10110762
2450 Ga0207649_10086318
2451 Ga0207652_10278953
2452 Ga0207652_11458011
2453 Ga0207694_10000193
2454 Ga0207694_10049485
2455 Ga0207694_10633585
2456 Ga0207650_10051822
2457 Ga0207659_10170020
2458 Ga0207659_10205388
2459 Ga0207687_10038586
2460 Ga0207664_10675927
2461 Ga0207690_10000959
2462 Ga0207690_10141151
2463 Ga0207706_10008025
2464 Ga0207706_10190592
2465 Ga0207686_10344068
2466 Ga0207686_10998987
2467 Ga0207686_11763727
2468 Ga0207709_10019899
2469 Ga0207709_11186340
2470 Ga0207669_10288508
2471 Ga0207669_10439485
2472 Ga0207704_10041905
2473 Ga0207704_11504908
2474 Ga0207665_10328579
2475 Ga0207691_10977588
2476 Ga0207711_10196937
2477 Ga0207689_10023710
2478 Ga0207689_11576762
2479 Ga0207679_10002718
2480 Ga0207667_10006290
2481 Ga0207667_10100133
2482 Ga0207667_10234580
2483 Ga0207667_10465494
2484 Ga0207667_11705803
2485 Ga0207651_10155920
2486 Ga0207640_10004199
2487 Ga0207640_10384480
2488 Ga0207640_10393025
2489 Ga0207639_10048176
2490 Ga0207639_10485780
2491 Ga0207678_10003236
2492 Ga0207702_10043312
2493 Ga0207702_10629001
2494 Ga0207702_10905349
2495 Ga0207648_10166766
2496 Ga0207674_10005520
2497 Ga0207674_10033169
2498 Ga0207674_11711104
2499 Ga0207675_101347115
2500 Ga0207683_10519516
2501 Ga0207683_11336632
2502 Ga0207698_10180633
2503 Ga0207698_10579895
2504 Ga0207698_10973984
2505 Ga0207698_12351927
2506 Ga0209281_1002282
2507 Ga0209281_1004157
2508 Ga0209969_1018620
2509 Ga0209984_1005637
2510 Ga0209995_1009327
2511 Ga0210002_1016192
2512 Ga0209983_1024556
2513 Ga0209282_1000072
2514 Ga0209971_1088753
2515 Ga0209813_10024775
2516 Ga0209974_10050246
2517 Ga0268266_10446814
2518 Ga0268265_10330997
2519 Ga0307517_10103679
2520 Ga0307515_10115015
2521 Ga0307515_10288992
2522 Ga0307515_10371984
2523 Ga0307515_10485433
2524 Ga0265338_10293180
2525 Ga0316177_1056223
2526 Ga0316176_1064342
2527 Ga0314311_1151902
2528 Ga0314311_1236493
2529 Ga0316178_1001132
2530 Ga0316180_1056555
2531 Ga0316181_1006587
2532 Ga0316181_1065259
2533 Ga0265767_101870
2534 Ga0265766_1000491
2535 Ga0265766_1010647
2536 Ga0265766_1014427
2537 Ga0265769_105630
2538 Ga0265774_104728
2539 Ga0265779_102213
2540 Ga0265330_10000012
2541 Ga0265332_10000012
2542 Ga0265325_10006225
2543 Ga0265316_10039600
2544 Ga0307513_10019858
2545 Ga0307513_10088393
2546 Ga0307513_10663036
2547 Ga0307408_100013705
2548 Ga0307408_100050653
2549 Ga0307408_100181519
2550 Ga0307408_100202378
2551 Ga0307408_101120757
2552 Ga0307408_102297936
2553 Ga0265314_10000029
2554 Ga0307405_12076467
2555 Ga0307413_10594475
2556 Ga0307413_11932844
2557 Ga0307518_10004256
2558 Ga0326468_10029529
2559 Ga0307406_10116737
2560 Ga0307406_10166340
2561 Ga0307406_10603852
2562 Ga0307412_10198406
2563 Ga0307412_10454576
2564 Ga0307412_12200207
2565 Ga0307416_100002061
2566 Ga0307416_100778036
2567 Ga0307416_102262363
2568 Ga0307416_102582978
2569 Ga0307416_103007350
2570 Ga0307414_10047643
2571 Ga0307414_10075764
2572 Ga0307414_10283744
2573 Ga0307414_10296273
2574 Ga0307411_10480233
2575 Ga0307411_10581881
2576 Ga0307411_10594037
2577 Ga0307411_11697426
2578 Ga0307415_100439096
2579 Ga0307415_101534612
2580 Ga0307510_10271247
2581 Ga0373928_0149585
2582 Ga0373939_0050899
2583 Ga0265778_019850
2584 Ga0265778_056008
2585 Ga0395899_0326984
2586 Ga0395900_0006501
2587 Ga0395900_0063774
2588 Ga0395900_0223727
2589 Ga0395900_0810752
2590 Ga0395900_0838651
2591 Ga0395900_0890928
2592 Ga0395898_0182958
2593 Ga0395898_0536365
2594 Ga0395905_0000549
2595 Ga0395905_0012898
2596 Ga0395905_0043570
2597 Ga0395905_0103307
2598 Ga0395905_0228005
2599 Ga0436364_0513076
2600 Ga0395901_0028412
2601 Ga0395901_0036377
2602 Ga0395901_0093407
2603 Ga0395901_0112851
2604 Ga0395901_0176537
2605 Ga0395901_0347594
2606 Ga0436361_0110739
2607 Ga0436361_0209532
2608 Ga0436361_0391791
2609 Ga0436361_0797417
2610 Ga0436361_0902855
2611 Ga0436361_1016700
2612 Ga0436361_1041947
2613 Ga0439453_0001276
2614 Ga0439465_0215707
2615 Ga0439465_0334429
2616 Ga0451787_207356
2617 Ga0451788_14269
2618 Ga0451788_26491
2619 Ga0451789_0965253
2620 Ga0451790_30858
2621 Ga0451792_06578
2622 Ga0451794_03992
2623 Ga0451794_43844
2624 Ga0451794_56996
2625 Ga0451793_1842659
2626 Ga0451799_25489
2627 Ga0451799_25968
2628 Ga0451799_35494
2629 Ga0451801_03902
2630 Ga0451801_05624
2631 Ga0451795_0013989
2632 Ga0451803_00380
2633 Ga0451798_0308085
2634 Ga0451798_0595355
2635 Ga0451800_0613767
2636 Ga0451802_0433132
2637 Ga0451802_0690103
2638 Ga0451805_059694
2639 Ga0451805_117766
2640 Ga0451804_0350671
2641 Ga0451808_27185
2642 Ga0451808_27571
2643 Ga0451807_0444576
2644 Ga0451807_1127722
2645 Ga0451833_1024724
2646 Ga0451837_1802545
2647 Ga0451839_0712830
2648 Ga0451841_0095596
2649 Ga0451845_0906783
2650 Ga0451849_1511665
2651 Ga0451850_46944
2652 Ga0451843_0626631
2653 Ga0451855_1729568
2654 Ga0451853_0176051
2655 Ga0452268_24915
2656 Ga0439442_030241
2657 Ga0439448_0091069
2658 Ga0439432_109856
2659 Ga0439449_0003878
2660 Ga0439449_0111033
2661 Ga0439450_002944
2662 Ga0439454_001689
2663 Ga0439454_036314
2664 Ga0439455_0064096
2665 Ga0439455_0074073
2666 Ga0450911_005087
2667 Ga0450890_040459
2668 Ga0450897_032275
2669 Ga0450898_003136
2670 Ga0450898_029605
2671 Ga0450898_029717
2672 Ga0450904_000961
2673 Ga0450906_030486
2674 Ga0450906_104913
2675 Ga0450910_105598
2676 Ga0439458_0031353
2677 Ga0439434_0250235
2678 Ga0439459_0055055
2679 Ga0439464_0256052
2680 Ga0439460_0206241
2681 Ga0450893_0013738
2682 Ga0450893_0026452
2683 Ga0451577_0038506
2684 Ga0466969_0312193
2685 Ga0466969_0572319
2686 Ga0466972_0020192
2687 Ga0466972_0039363
2688 Ga0466972_0098911
2689 Ga0466972_0221359
2690 Ga0466972_0272724
2691 Ga0453683_0392256
2692 Ga0466965_0027577
2693 Ga0466965_0036619
2694 Ga0466965_0095415
2695 Ga0466966_0032032
2696 Ga0466966_0154067
2697 Ga0466966_0510731
2698 Ga0466966_0630353
2699 Ga0466961_0059959
2700 Ga0466963_0066574
2701 Ga0466964_0177531
2702 Ga0466964_0222909
2703 Ga0453684_0142976
2704 Ga0466971_0355328
2705 Ga0466968_0024670
2706 Ga0466968_0068221
2707 Ga0466970_0695742
2708 Ga0466957_0173268
2709 Ga0466957_0262826
2710 Ga0466957_1007085
2711 Ga0466960_0134659
2712 Ga0466960_0364078
2713 Ga0466960_0884225
2714 Ga0466959_0862059
2715 Ga0466959_1014431
2716 Ga0466959_1020608
2717 Ga0451576_0013761
2718 Ga0451576_0083384
2719 Ga0451576_0936124
2720 Ga0466958_0482820
2721 Ga0495617_000397
2722 Ga0495617_000636
2723 Ga0495617_000830
2724 Ga0495617_031068
2725 Ga0495627_000011
2726 Ga0495627_008059
2727 Ga0495627_014179
2728 Ga0495627_019933
2729 Ga0495592_0035699
2730 Ga0495603_0001612
2731 Ga0495603_0020924
2732 Ga0495603_0409204
2733 Ga0495603_0415278
2734 Ga0495603_0726653
2735 Ga0495590_0000020
2736 Ga0495590_0000632
2737 Ga0495590_0001551
2738 Ga0495590_0056853
2739 Ga0495590_0251682
2740 Ga0495591_034720
2741 Ga0495629_0007936
2742 Ga0495629_0021816
2743 Ga0495638_0000235
2744 Ga0495638_0008741
2745 Ga0495638_0090421
2746 Ga0495638_0148740
2747 Ga0495638_0181110
2748 Ga0495638_0343610
2749 Ga0495638_0388315
2750 Ga0495638_0512403
2751 Ga0495651_0842696
2752 Ga0495653_0000067
2753 Ga0495653_0004702
2754 Ga0495653_0009522
2755 Ga0495653_0175649
2756 Ga0495653_0452357
2757 Ga0495650_0000200
2758 Ga0495650_0001809
2759 Ga0495650_0002469
2760 Ga0495650_0014707
2761 Ga0495650_0023728
2762 Ga0495650_0026097
2763 Ga0495580_0009003
2764 Ga0495580_0314594
2765 Ga0495580_0665811
2766 Ga0495582_0019511
2767 Ga0495582_0063422
2768 Ga0495582_0302408
2769 Ga0495605_0001330
2770 Ga0495605_0001735
2771 Ga0495605_0005449
2772 Ga0495605_0010393
2773 Ga0495605_0013769
2774 Ga0495605_0061515
2775 Ga0495605_0094007
2776 Ga0495605_0162942
2777 Ga0495605_0328009
2778 Ga0495639_0088079
2779 Ga0495639_0445425
2780 Ga0495664_0244637
2781 Ga0495584_0000636
2782 Ga0495584_0002002
2783 Ga0495584_0022316
2784 Ga0495584_0023314
2785 Ga0495584_0030129
2786 Ga0495584_0036677
2787 Ga0495584_0041411
2788 Ga0495584_0080454
2789 Ga0495584_0088913
2790 Ga0495584_0109915
2791 Ga0495584_0150994
2792 Ga0495584_0323231
2793 Ga0495584_0515190
2794 Ga0495584_0636787
2795 Ga0495585_0015948
2796 Ga0495585_0022456
2797 Ga0495585_0025799
2798 Ga0495585_0036832
2799 Ga0495585_0060017
2800 Ga0495585_0061827
2801 Ga0495585_0147891
2802 Ga0495585_0171964
2803 Ga0495585_0282346
2804 Ga0495585_0389221
2805 Ga0495585_0397963
2806 Ga0495585_0448161
2807 Ga0495585_0533323
2808 Ga0495594_0026606
2809 Ga0495594_0050249
2810 Ga0495594_0050658
2811 Ga0495594_0139761
2812 Ga0495594_0247101
2813 Ga0495594_0549179
2814 Ga0495594_0626289
2815 Ga0495594_0652878
2816 Ga0495596_0001745
2817 Ga0495596_0001963
2818 Ga0495596_0040152
2819 Ga0495596_0078041
2820 Ga0495596_0126402
2821 Ga0495596_0196401
2822 Ga0495596_0349598
2823 Ga0495607_0042980
2824 Ga0495607_0045844
2825 Ga0495607_0148073
2826 Ga0495607_0190403
2827 Ga0495607_0199105
2828 Ga0495607_0277544
2829 Ga0495607_0345024
2830 Ga0495607_0392730
2831 Ga0495607_0479457
2832 Ga0495607_0521843
2833 Ga0495607_0559062
2834 Ga0495583_0000317
2835 Ga0495583_0002046
2836 Ga0495583_0003152
2837 Ga0495583_0006153
2838 Ga0495583_0029176
2839 Ga0495583_0077755
2840 Ga0495583_0129354
2841 Ga0495583_0190547
2842 Ga0495583_0306402
2843 Ga0495606_0000433
2844 Ga0495606_0004241
2845 Ga0495606_0009821
2846 Ga0495606_0013080
2847 Ga0495606_0032750
2848 Ga0495606_0035831
2849 Ga0495606_0037395
2850 Ga0495606_0058361
2851 Ga0495606_0158420
2852 Ga0495606_0248652
2853 Ga0495606_0335379
2854 Ga0495606_0374445
2855 Ga0495606_0388069
2856 Ga0495606_0536463
2857 Ga0495608_0037678
2858 Ga0495610_0000017
2859 Ga0495610_0004520
2860 Ga0495610_0042199
2861 Ga0495610_0048651
2862 Ga0495610_0188392
2863 Ga0495616_0003800
2864 Ga0495616_0004467
2865 Ga0495616_0018110
2866 Ga0495616_0028095
2867 Ga0495616_0040567
2868 Ga0495616_0053180
2869 Ga0495616_0070526
2870 Ga0495616_0090767
2871 Ga0495616_0153679
2872 Ga0495616_0183476
2873 Ga0495620_0001543
2874 Ga0495628_0089954
2875 Ga0495628_0758225
2876 Ga0495630_0050068
2877 Ga0495630_0214174
2878 Ga0495631_0084495
2879 Ga0495631_0109370
2880 Ga0495631_0113533
2881 Ga0495631_0141332
2882 Ga0495631_0376151
2883 Ga0495632_0018868
2884 Ga0495632_0035459
2885 Ga0495632_0102867
2886 Ga0495632_0269148
2887 Ga0495632_0402833
2888 Ga0495637_0001780
2889 Ga0495637_0002190
2890 Ga0495637_0006713
2891 Ga0495637_0035119
2892 Ga0495643_0002891
2893 Ga0495643_0016892
2894 Ga0495643_0026373
2895 Ga0495643_0040909
2896 Ga0495643_0092098
2897 Ga0495643_0107363
2898 Ga0495643_0117768
2899 Ga0495643_0129407
2900 Ga0495643_0231320
2901 Ga0495643_0276333
2902 Ga0495643_0291310
2903 Ga0495643_0313202
2904 Ga0495643_0406296
2905 Ga0495643_0486618
2906 Ga0495644_0012857
2907 Ga0495644_0029052
2908 Ga0495644_0085048
2909 Ga0495644_0107321
2910 Ga0495644_0117781
2911 Ga0495644_0140519
2912 Ga0495644_0159870
2913 Ga0495644_0213997
2914 Ga0495644_0247801
2915 Ga0495648_0003167
2916 Ga0495648_0009195
2917 Ga0495648_0011794
2918 Ga0495648_0118352
2919 Ga0495648_0133789
2920 Ga0495648_0209844
2921 Ga0495648_0213620
2922 Ga0495663_0015755
2923 Ga0495663_0037423
2924 Ga0495663_0056569
2925 Ga0495663_0097365
2926 Ga0495666_0002326
2927 Ga0495666_0009599
2928 Ga0495666_0096128
2929 Ga0495666_0316509
2930 Ga0495666_0388536
2931 Ga0495642_0005824
2932 Ga0495642_0007068
2933 Ga0495642_0010689
2934 Ga0495642_0052967
2935 Ga0495642_0114350
2936 Ga0495642_0127484
2937 Ga0495642_0286284
2938 Ga0495642_0294808
2939 Ga0495642_0567772
2940 Ga0495652_0019185
2941 Ga0495652_0095835
2942 Ga0495652_0183867
2943 Ga0495654_0000060
2944 Ga0495654_0018887
2945 Ga0495654_0063474
2946 Ga0495654_0073901
2947 Ga0495654_0105944
2948 Ga0495654_0126676
2949 Ga0495654_0170706
2950 Ga0495654_0399106
2951 Ga0495665_0005868
2952 Ga0495665_0026128
2953 Ga0495665_0026164
2954 Ga0495665_0053041
2955 Ga0495665_0089182
2956 Ga0495665_0550280
2957 Ga0495665_0681242
2958 Ga0495640_0537766
2959 Ga0495586_0006554
2960 Ga0495586_0007592
2961 Ga0495586_0010558
2962 Ga0495586_0233786
2963 Ga0495587_0028480
2964 Ga0495587_0037432
2965 Ga0495598_0076189
2966 Ga0495609_0001840
2967 Ga0495609_0005522
2968 Ga0495609_0018793
2969 Ga0495609_0019006
2970 Ga0495609_0026758
2971 Ga0495609_0026889
2972 Ga0495609_0064148
2973 Ga0495609_0099256
2974 Ga0495609_0114491
2975 Ga0495609_0273136
2976 Ga0495609_0417573
2977 Ga0495621_0015352
2978 Ga0495621_0084944
2979 Ga0495597_0004273
2980 Ga0495597_0007533
2981 Ga0495597_0013129
2982 Ga0495597_0021380
2983 Ga0495597_0025313
2984 Ga0495597_0049072
2985 Ga0495597_0059514
2986 Ga0495597_0085111
2987 Ga0495597_0096517
2988 Ga0495597_0112149
2989 Ga0495597_0124240
2990 Ga0495597_0198836
2991 Ga0495597_0220377
2992 Ga0495597_0227659
2993 Ga0495597_0240810
2994 Ga0495597_0259120
2995 Ga0495645_0181667
2996 Ga0495645_0821012
2997 Ga0495622_0002906
2998 Ga0495622_0003244
2999 Ga0495622_0010858
3000 Ga0495622_0016244
3001 Ga0495622_0033985
3002 Ga0495622_0061317
3003 Ga0495622_0191348
3004 Ga0495622_0352903
3005 Ga0495633_0010195
3006 Ga0495633_0017696
3007 Ga0495633_0032840
3008 Ga0495633_0051460
3009 Ga0495633_0099041
3010 Ga0495633_0105604
3011 Ga0495633_0190322
3012 Ga0495633_0342535
3013 Ga0495633_0353490
3014 Ga0495633_0496025
3015 Ga0495633_0524675
3016 Ga0495667_0042014
3017 Ga0495656_0010822
3018 Ga0495656_0040826
3019 Ga0495656_0100242
3020 Ga0495656_0107150
3021 Ga0495656_0115998
3022 Ga0495668_0002640
3023 Ga0495668_0005163
3024 Ga0495668_0008733
3025 Ga0495668_0011342
3026 Ga0495668_0063066
3027 Ga0495668_0092399
3028 Ga0495668_0129828
3029 Ga0495668_0174806
3030 Ga0495668_0195544
3031 Ga0495668_0284779
3032 Ga0495668_0309249
3033 Ga0495668_0447727
3034 Ga0495668_0831789
3035 Ga0495634_0014598
3036 Ga0495634_0400610
3037 Ga0495611_0001662
3038 Ga0495611_0002069
3039 Ga0495611_0005909
3040 Ga0495611_0007454
3041 Ga0495611_0011467
3042 Ga0495611_0020577
3043 Ga0495611_0041368
3044 Ga0495611_0305916
3045 Ga0495625_0005454
3046 Ga0495625_0018357
3047 Ga0495625_0042626
3048 Ga0495625_0056429
3049 Ga0495625_0090743
3050 Ga0495625_0095414
3051 Ga0495625_0214661
3052 Ga0495625_0223273
3053 Ga0495625_0388500
3054 Ga0495625_0550096
3055 Ga0495635_0026620
3056 Ga0495635_0181994
3057 Ga0495635_0904837
3058 Ga0495659_0002211
3059 Ga0495659_0037680
3060 Ga0495659_0041386
3061 Ga0495659_0092967
3062 Ga0495659_0093772
3063 Ga0495659_0105752
3064 Ga0495659_0393753
3065 Ga0495661_0018525
3066 Ga0495661_0022142
3067 Ga0495661_0048413
3068 Ga0495661_0060113
3069 Ga0495661_0061371
3070 Ga0495661_0068457
3071 Ga0495661_0071076
3072 Ga0495661_0127892
3073 Ga0495661_0128906
3074 Ga0495661_0169133
3075 Ga0495661_0206455
3076 Ga0495661_0208125
3077 Ga0495661_0324453
3078 Ga0495661_0413168
3079 Ga0495661_0417194
3080 Ga0495661_0623059
3081 Ga0495588_0000091
3082 Ga0495588_0009876
3083 Ga0495588_0022754
3084 Ga0495588_0032819
3085 Ga0495588_0038295
3086 Ga0495588_0075112
3087 Ga0495588_0126891
3088 Ga0495588_0167032
3089 Ga0495588_0219939
3090 Ga0495588_0258362
3091 Ga0495657_0046439
3092 Ga0495599_0001590
3093 Ga0495599_0061532
3094 Ga0495599_0569109
3095 Ga0495623_0008893
3096 Ga0495623_0020652
3097 Ga0495623_0228894
3098 Ga0495646_0063908
3099 Ga0495646_0403601
3100 Ga0495669_0001596
3101 Ga0495669_0015677
3102 Ga0495669_0084861
3103 Ga0495669_0091582
3104 Ga0495669_0157656
3105 Ga0495669_0420575
3106 Ga0495613_0337429
3107 Ga0495624_0036411
3108 Ga0495624_0069735
3109 Ga0495670_0004991
3110 Ga0495670_0010742
3111 Ga0495670_0015412
3112 Ga0495670_0019932
3113 Ga0495670_0031340
3114 Ga0495670_0081921
3115 Ga0495670_0135699
3116 Ga0495670_0381420
3117 Ga0495670_0448993
3118 Ga0495670_0488228
3119 Ga0495671_0000037
3120 Ga0495671_0085680
3121 Ga0495671_0118753
3122 Ga0495671_0198747
3123 Ga0495671_0325797
3124 Ga0495649_0012662
3125 Ga0495649_0027792
3126 Ga0495649_0073185
3127 Ga0495649_0098580
3128 Ga0495649_0118681
3129 Ga0495649_0387844
3130 Ga0495649_0600575
3131 Ga0495649_0691454
3132 Ga0495589_0014264
3133 Ga0495589_0029351
3134 Ga0495589_0030733
3135 Ga0495589_0037560
3136 Ga0495589_0072308
3137 Ga0495589_0101699
3138 Ga0495589_0114336
3139 Ga0495589_0183245
3140 Ga0495589_0472950
3141 Ga0495600_0004009
3142 Ga0495600_0006486
3143 Ga0495600_0423937
3144 Ga0495600_0754054
3145 Ga0495660_0001966
3146 Ga0495660_0007547
3147 Ga0495660_0010186
3148 Ga0495660_0030532
3149 Ga0495660_0034825
3150 Ga0495660_0296308
3151 Ga0495660_0498638
3152 Ga0495581_0018479
3153 Ga0495581_0095106
3154 Ga0495581_0203954
3155 Ga0495581_0354421
3156 Ga0495604_0003421
3157 Ga0495604_0010101
3158 Ga0495604_0010804
3159 Ga0495604_0063319
3160 Ga0495604_0738025
3161 Ga0495636_0001434
3162 Ga0495636_0002112
3163 Ga0495636_0003788
3164 Ga0495636_0013181
3165 Ga0495636_0545651
3166 Ga0495674_0009303
3167 Ga0495674_0289372
3168 Ga0495672_0000013
3169 Ga0495672_0000157
3170 Ga0495672_0007686
3171 Ga0495672_0016220
3172 Ga0495672_0020286
3173 Ga0495672_0021784
3174 Ga0495672_0069849
3175 Ga0495672_0082508
3176 Ga0495672_0247872
3177 Ga0495676_0004545
3178 Ga0495676_0031634
3179 Ga0495676_0135297
3180 Ga0495676_0157887
3181 Ga0495676_0167264
3182 Ga0495680_0272308
3183 Ga0495680_0398534
3184 Ga0495680_0465911
3185 Ga0495683_0003225
3186 Ga0495683_0014031
3187 Ga0495683_0015642
3188 Ga0495683_0043280
3189 Ga0495683_0081874
3190 Ga0495683_0148116
3191 Ga0495683_0228820
3192 Ga0495683_0388285
3193 Ga0495687_000342
3194 Ga0495687_001562
3195 Ga0495687_002781
3196 Ga0495687_002921
3197 Ga0495687_011455
3198 Ga0495687_023933
3199 Ga0495687_024921
3200 Ga0495687_055162
3201 Ga0495687_069898
3202 Ga0495687_089986
3203 Ga0495687_090176
3204 Ga0495675_0021158
3205 Ga0495675_0038185
3206 Ga0495675_0249845
3207 Ga0495675_0340054
3208 Ga0495677_0001866
3209 Ga0495677_0016634
3210 Ga0495677_0032598
3211 Ga0495677_0035722
3212 Ga0495677_0084424
3213 Ga0495677_0102771
3214 Ga0495677_0107809
3215 Ga0495677_0125506
3216 Ga0495677_0161241
3217 Ga0495677_0166219
3218 Ga0495677_0180237
3219 Ga0495677_0270108
3220 Ga0495679_005019
3221 Ga0495679_006474
3222 Ga0495679_025594
3223 Ga0495679_070561
3224 Ga0495679_160771
3225 Ga0495685_000474
3226 Ga0495685_009709
3227 Ga0495685_069325
3228 Ga0495685_095624
3229 Ga0495685_099061
3230 Ga0495685_221769
3231 Ga0495673_0000248
3232 Ga0495673_0010480
3233 Ga0495673_0017349
3234 Ga0495681_0012224
3235 Ga0495681_0043132
3236 Ga0495681_0053354
3237 Ga0495681_0072599
3238 Ga0495681_0089523
3239 Ga0495681_0113480
3240 Ga0495681_0146985
3241 Ga0495681_0160248
3242 Ga0495681_0176785
3243 Ga0495681_0290220
3244 Ga0495681_0401191
3245 Ga0495686_0007683
3246 Ga0495686_0012785
3247 Ga0495686_0018441
3248 Ga0495686_0021073
3249 Ga0495686_0062817
3250 Ga0495686_0070207
3251 Ga0495686_0617336
3252 Ga0495593_0002955
3253 Ga0495593_0015516
3254 Ga0495593_0016080
3255 Ga0495593_0304065
3256 Ga0495602_0049802
3257 Ga0495602_0187032
3258 Ga0495602_0236904
3259 Ga0495614_0054658
3260 Ga0495614_0178530
3261 Ga0495615_0038328
3262 Ga0495615_0287656
3263 Ga0495626_0002147
3264 Ga0495626_0014493
3265 Ga0495626_0029462
3266 Ga0495626_0032266
3267 Ga0495626_0037979
3268 Ga0495626_0054009
3269 Ga0495626_0074354
3270 Ga0495626_0091062
3271 Ga0495626_0117815
3272 Ga0495626_0174463
3273 Ga0495626_0379776
3274 Ga0496100_0014114
3275 Ga0496100_0848752
3276 Ga0496100_1570695
3277 Ga0496101_0056958
3278 Ga0496101_0161155
3279 Ga0496101_0947987
3280 Ga0496102_0022102
3281 Ga0496102_0315662
3282 Ga0496102_0447744
3283 Ga0496102_0499438
3284 Ga0496102_0823476
3285 Ga0496102_1208221
3286 Ga0496103_0010940
3287 Ga0496103_0014572
3288 Ga0496103_0020711
3289 Ga0496103_0100485
3290 Ga0496103_0420848
3291 Ga0496103_0540278
3292 Ga0496104_0224974
3293 Ga0496104_0392286
3294 Ga0496104_0562827
3295 Ga0496105_0090765
3296 Ga0496105_0731574
3297 Ga0496106_0168970
3298 Ga0496106_0217913
3299 Ga0496106_0724466
3300 Ga0496106_0738447
3301 Ga0496107_0047151
3302 Ga0496107_0122539
3303 Ga0496107_0263854
3304 Ga0496107_0324055
3305 Ga0496108_0561420
3306 Ga0496108_0597717
3307 Ga0496108_1430065
3308 Ga0496109_0584534
3309 Ga0496109_1574844
3310 Ga0496110_0110339
3311 Ga0496110_0454328
3312 Ga0496110_1223550
3313 Ga0496110_1819096
3314 Ga0496111_0076448
3315 Ga0496111_0135130
3316 Ga0496112_1052819
3317 Ga0496112_1832459
3318 Ga0496114_0041004
3319 Ga0496114_0863153
3320 Ga0496115_0050480
3321 Ga0496115_0137305
3322 Ga0496115_0202044
3323 Ga0496115_0337943
3324 Ga0496115_0575713
3325 Ga0496115_1123949
3326 Ga0496116_0078388
3327 Ga0496117_0000005
3328 Ga0496117_0323166
3329 Ga0496118_0000031
3330 Ga0496118_0426591
3331 Ga0496119_0071811
3332 Ga0496120_0160080
3333 Ga0496121_0004491
3334 Ga0496121_0018508
3335 Ga0496121_0023798
3336 Ga0496121_0042385
3337 Ga0496121_0114637
3338 Ga0496121_0508057
3339 Ga0496122_0005873
3340 Ga0496122_0211557
3341 Ga0496122_0499701
3342 Ga0496123_0005104
3343 Ga0496123_0020755
3344 Ga0496123_0048880
3345 Ga0496123_0273029
3346 Ga0496124_0001830
3347 Ga0496124_0009077
3348 Ga0496124_0015482
3349 Ga0496124_0101682
3350 Ga0496124_0120196
3351 Ga0496124_0279288
3352 Ga0496124_0571215
3353 Ga0496124_0618387
3354 Ga0496125_0005905
3355 Ga0496125_0009685
3356 Ga0496125_0013937
3357 Ga0496125_0040516
3358 Ga0496125_0129144
3359 Ga0496125_0211435
3360 Ga0496125_0376596
3361 Ga0496125_0405857
3362 Ga0496126_0004622
3363 Ga0496126_0317516
3364 Ga0496126_0619610
3365 Ga0501306_000005
3366 Ga0501306_000979
3367 Ga0501306_001799
3368 Ga0501306_003684
3369 Ga0501306_008516
3370 Ga0501306_018600
3371 Ga0501306_030700
3372 Ga0501306_038015
3373 Ga0501306_038884
3374 Ga0501306_087384
3375 Ga0501308_000002
3376 Ga0501308_000177
3377 Ga0501308_000386
3378 Ga0501308_005794
3379 Ga0501308_008008
3380 Ga0501308_009740
3381 Ga0501308_020892
3382 Ga0501308_025496
3383 Ga0501308_028896
3384 Ga0501308_029721
3385 Ga0501308_056773
3386 Ga0501308_069780
3387 Ga0501309_000464
3388 Ga0501309_002567
3389 Ga0501309_003438
3390 Ga0501309_004776
3391 Ga0501309_013328
3392 Ga0501309_030503
3393 Ga0501310_000065
3394 Ga0501310_002047
3395 Ga0501310_002676
3396 Ga0501310_004061
3397 Ga0501310_008997
3398 Ga0501310_009999
3399 Ga0501310_014411
3400 Ga0501310_018690
3401 Ga0501310_023172
3402 Ga0501310_023895
3403 Ga0501310_024232
3404 Ga0501310_029314
3405 Ga0501310_029604
3406 Ga0501310_042297
3407 Ga0501310_073912
3408 Ga0501341_00897
3409 Ga0501341_05783
3410 Ga0501341_07080
3411 Ga0501341_15080
3412 Ga0501343_000585
3413 Ga0501343_000946
3414 Ga0501343_002039
3415 Ga0501343_006485
3416 Ga0501343_008083
3417 Ga0501343_011815
3418 Ga0501344_01065
3419 Ga0501344_04650
3420 Ga0501344_05240
3421 Ga0501345_00091
3422 Ga0501304_000001
3423 Ga0501304_000986
3424 Ga0501304_001750
3425 Ga0501304_002722
3426 Ga0501304_013411
3427 Ga0501304_023108
3428 Ga0501304_024999
3429 Ga0501305_000399
3430 Ga0501305_000819
3431 Ga0501305_003101
3432 Ga0501305_004353
3433 Ga0501305_011851
3434 Ga0501305_012120
3435 Ga0501305_014715
3436 Ga0501305_034752
3437 Ga0501305_066877
3438 Ga0501305_082266
3439 Ga0501307_000313
3440 Ga0501307_000583
3441 Ga0501307_000963
3442 Ga0501307_005419
3443 Ga0501307_006878
3444 Ga0501307_012923
3445 Ga0501307_016299
3446 Ga0501307_016459
3447 Ga0501307_038688
3448 Ga0501307_051118
3449 Ga0501307_082101
3450 Ga0495678_000010
3451 Ga0495678_006909
3452 Ga0495678_013870
3453 Ga0495678_025294
3454 Ga0495678_058347
3455 Ga0495678_125922
3456 Ga0495682_0004602
3457 Ga0495682_0039543
3458 Ga0495682_0040889
3459 Ga0495682_0057328
3460 Ga0501291_102997
3461 Ga0501298_149702
3462 Ga0501299_056087
3463 Ga0501300_044609
3464 Ga0501301_021515
3465 Ga0501311_000002
3466 Ga0501311_004818
3467 Ga0501311_010684
3468 Ga0501311_012041
3469 Ga0501311_031969
3470 Ga0501311_053518
3471 Ga0501311_062752
3472 Ga0501312_004364
3473 Ga0501312_005434
3474 Ga0501312_006206
3475 Ga0501312_012205
3476 Ga0501312_020539
3477 Ga0501312_024758
3478 Ga0501312_024759
3479 Ga0501312_029738
3480 Ga0501312_034907
3481 Ga0501312_098925
3482 Ga0501313_000012
3483 Ga0501313_000686
3484 Ga0501313_001951
3485 Ga0501313_007422
3486 Ga0501313_022404
3487 Ga0501314_000622
3488 Ga0501314_001267
3489 Ga0501314_005240
3490 Ga0501314_014323
3491 Ga0501314_027263
3492 Ga0501314_029997
3493 Ga0501314_043415
3494 Ga0501315_000004
3495 Ga0501315_000082
3496 Ga0501315_001820
3497 Ga0501315_005197
3498 Ga0501315_006843
3499 Ga0501315_008816
3500 Ga0501315_020164
3501 Ga0501315_021631
3502 Ga0501315_032762
3503 Ga0501315_061027
3504 Ga0501315_070785
3505 Ga0501315_076019
3506 Ga0501316_000002
3507 Ga0501316_000608
3508 Ga0501316_011965
3509 Ga0501316_012649
3510 Ga0501316_013073
3511 Ga0501316_023380
3512 Ga0501316_033072
3513 Ga0501316_058934
3514 Ga0501316_064078
3515 Ga0501316_079238
3516 Ga0501317_000565
3517 Ga0501317_001174
3518 Ga0501317_009930
3519 Ga0501317_024341
3520 Ga0501317_043563
3521 Ga0501317_045370
3522 Ga0501317_048067
3523 Ga0501317_049979
3524 Ga0501318_000292
3525 Ga0501318_002062
3526 Ga0501318_002754
3527 Ga0501318_008537
3528 Ga0501318_015106
3529 Ga0501318_088309
3530 Ga0501319_000071
3531 Ga0501319_000080
3532 Ga0501319_002073
3533 Ga0501319_002652
3534 Ga0501319_006814
3535 Ga0501319_010549
3536 Ga0501319_027091
3537 Ga0501320_000176
3538 Ga0501320_000935
3539 Ga0501320_003295
3540 Ga0501320_004743
3541 Ga0501320_005008
3542 Ga0501320_006579
3543 Ga0501320_007575
3544 Ga0501320_010965
3545 Ga0501320_021334
3546 Ga0501320_027177
3547 Ga0501320_046170
3548 Ga0501320_055096
3549 Ga0501320_057117
3550 Ga0501320_060230
3551 Ga0501320_060558
3552 Ga0501321_001325
3553 Ga0501321_001469
3554 Ga0501321_003832
3555 Ga0501321_010433
3556 Ga0501321_012219
3557 Ga0501321_012554
3558 Ga0501321_013256
3559 Ga0501321_013278
3560 Ga0501321_020595
3561 Ga0501321_072790
3562 Ga0501322_000544
3563 Ga0501322_000699
3564 Ga0501322_004204
3565 Ga0501322_004747
3566 Ga0501322_007469
3567 Ga0501322_010011
3568 Ga0501322_011712
3569 Ga0501323_000169
3570 Ga0501323_000193
3571 Ga0501323_000710
3572 Ga0501323_001897
3573 Ga0501323_012054
3574 Ga0501323_025879
3575 Ga0501323_029492
3576 Ga0501323_046603
3577 Ga0501323_055610
3578 Ga0501323_077991
3579 Ga0501324_000433
3580 Ga0501324_004674
3581 Ga0501324_005894
3582 Ga0501324_010339
3583 Ga0501324_010831
3584 Ga0501324_014280
3585 Ga0501324_016549
3586 Ga0501324_019768
3587 Ga0501324_040499
3588 Ga0501324_042627
3589 Ga0501325_004347
3590 Ga0501325_015283
3591 Ga0501325_017804
3592 Ga0501325_020463
3593 Ga0501325_034826
3594 Ga0501326_00189
3595 Ga0501326_00267
3596 Ga0501326_11809
3597 Ga0501327_00604
3598 Ga0501327_02933
3599 Ga0501327_09272
3600 Ga0501328_00400
3601 Ga0501328_09994
3602 Ga0501329_02712
3603 Ga0501329_05630
3604 Ga0501329_13596
3605 Ga0501330_002006
3606 Ga0501330_006947
3607 Ga0501330_015962
3608 Ga0501332_10413
3609 Ga0501332_14445
3610 Ga0501333_011666
3611 Ga0501333_015352
3612 Ga0501334_01394
3613 Ga0501334_05682
3614 Ga0501334_07543
3615 Ga0501334_12104
3616 Ga0501335_000409
3617 Ga0501335_016359
3618 Ga0501335_023262
3619 Ga0501335_023611
3620 Ga0501335_025828
3621 Ga0501335_029274
3622 Ga0501335_032355
3623 Ga0501336_000167
3624 Ga0501336_001363
3625 Ga0501337_003001
3626 Ga0501337_005538
3627 Ga0501337_006521
3628 Ga0501337_010797
3629 Ga0501337_010948
3630 Ga0501337_014108
3631 Ga0501337_015299
3632 Ga0501338_00312
3633 Ga0501338_10404
3634 Ga0501339_00948
3635 Ga0501340_001367
3636 Ga0501340_002758
3637 Ga0501340_007553
3638 Ga0501340_014173
3639 Ga0501031_0477807
3640 Ga0501031_0565482
3641 Ga0501032_0005689
3642 Ga0501033_0001803
3643 Ga0501033_0706795
3644 Ga0501034_0029030
3645 Ga0501036_0011113
3646 Ga0501037_0029069
3647 Ga0501037_0046758
3648 Ga0501038_0004562
3649 Ga0501038_0286054
3650 Ga0501038_0434049
3651 Ga0501039_0138984
3652 Ga0501043_0011146
3653 Ga0501043_0093617
3654 Ga0501043_0197840
3655 Ga0501046_0007619
3656 Ga0501047_0089170
3657 Ga0501047_0708154
3658 Ga0501047_1156958
3659 Ga0501048_0432662
3660 Ga0501199_038701
3661 Ga0501202_039928
3662 Ga0501207_084022
3663 Ga0501211_021197
3664 Ga0501222_036527
3665 Ga0501227_015572
3666 Ga0501230_001749
3667 Ga0501233_025241
3668 Ga0501235_104667
3669 Ga0501238_000213
3670 Ga0501238_011742
3671 Ga0501246_003814
3672 Ga0501249_216847
3673 Ga0501221_006424
3674 Ga0501229_003004
3675 Ga0501234_034107
3676 Ga0501241_033343
3677 Ga0501262_000574
3678 Ga0501263_012109
3679 Ga0501265_002083
3680 Ga0501268_046021
3681 Ga0501269_000003
3682 Ga0501269_002814
3683 Ga0501276_018743
3684 Ga0501279_000683
3685 Ga0501279_008680
3686 Ga0501035_0007388
3687 Ga0501035_0010452
3688 Ga0501035_0010523
3689 Ga0501035_0084650
3690 Ga0501035_1312417
3691 Ga0501035_1376759
3692 Ga0501035_1550089
3693 Ga0501044_0000210
3694 Ga0501044_0007653
3695 Ga0501044_0025863
3696 Ga0501044_0241667
3697 Ga0501226_040218
3698 nmdc:mga03683_192040_c1
3699 nmdc:mga03683_22136_c1
3700 nmdc:mga03n38_4851_c1
3701 nmdc:mga03n38_59764_c1
3702 nmdc:mga00v17_25609_c1
3703 nmdc:mga00v17_630988_c1
3704 nmdc:mga0yw44_371288_c1
3705 nmdc:mga0k408_52239_c1
3706 nmdc:mga0k408_679800_c1
3707 nmdc:mga0k408_712_c1
3708 nmdc:mga06z11_3023_c1
3709 nmdc:mga04h51_47659_c1
3710 nmdc:mga07m45_348122_c1
3711 nmdc:mga07m45_67895_c1
3712 nmdc:mga07m45_691362_c1
3713 nmdc:mga06r32_1149912_c1
3714 nmdc:mga0n895_1079125_c1
3715 nmdc:mga0rr50_1578394_c1
3716 nmdc:mga0a205_104296_c1
3717 nmdc:mga0sz30_3989_c1
3718 Ga0495601_0117248
3719 Ga0495619_0772700
3720 Ga0500578_0003978
3721 Ga0500643_134293
3722 Ga0500646_0011171
3723 Ga0500651_0000274
3724 Ga0500650_0072451
3725 Ga0500556_0257267
3726 Ga0500562_016703
3727 Ga0500562_151087
3728 Ga0500569_001743
3729 Ga0500572_221041
3730 Ga0500593_257026
3731 Ga0500594_0063615
3732 Ga0500594_0086002
3733 Ga0500595_008416
3734 Ga0500618_002645
3735 Ga0500621_177758
3736 Ga0500628_048117
3737 Ga0500642_0002530
3738 Ga0500652_000400
3739 Ga0500655_119690
3740 Ga0500561_0020973
3741 Ga0500561_0067768
3742 Ga0500568_0013644
3743 Ga0500573_0295304
3744 Ga0500574_000403
3745 Ga0500574_028175
3746 Ga0500577_0006134
3747 Ga0500577_0202515
3748 Ga0500586_006873
3749 Ga0500586_053986
3750 Ga0500588_0219596
3751 Ga0500604_0033502
3752 Ga0500616_0028067
3753 Ga0500619_089331
3754 Ga0500622_0000198
3755 Ga0500624_004964
3756 Ga0500627_0121237
3757 Ga0500627_0246273
3758 Ga0500634_0000642
3759 Ga0500636_0464995
3760 Ga0500637_0321398
3761 Ga0500552_082609
3762 Ga0500661_099610
3763 Ga0587084_000213
3764 Ga0587084_000401
3765 Ga0587084_025419
3766 Ga0587084_035365
3767 Ga0587084_043931
3768 Ga0587093_000380
3769 Ga0587093_001062
3770 Ga0587093_052406
3771 Ga0587093_060912
3772 Ga0587093_092837
3773 Ga0587066_000001
3774 Ga0587066_001525
3775 Ga0587066_073625
3776 Ga0587070_004333
3777 Ga0587070_030492
3778 Ga0587070_116654
3779 Ga0587073_0000035
3780 Ga0587073_0122107
3781 Ga0587077_000648
3782 Ga0587077_007748
3783 Ga0587077_118437
3784 Ga0587077_154127
3785 Ga0587080_000038
3786 Ga0587080_012184
3787 Ga0587080_018572
3788 Ga0587080_021806
3789 Ga0587082_000027
3790 Ga0587082_008647
3791 Ga0587082_016254
3792 Ga0587082_050421
3793 Ga0587083_0000039
3794 Ga0587083_0000305
3795 Ga0587083_0010072
3796 Ga0587083_0031320
3797 Ga0587083_0055289
3798 Ga0587085_002630
3799 Ga0587085_002980
3800 Ga0587085_007329
3801 Ga0587085_057021
3802 Ga0587086_000453
3803 Ga0587086_000753
3804 Ga0587088_000001
3805 Ga0587088_001117
3806 Ga0587088_169938
3807 Ga0587089_000565
3808 Ga0587089_001052
3809 Ga0587090_001908
3810 Ga0587090_003259
3811 Ga0587090_011821
3812 Ga0587090_018838
3813 Ga0587091_002949
3814 Ga0587091_007570
3815 Ga0587091_010932
3816 Ga0587092_000969
3817 Ga0587092_003731
3818 Ga0587092_009204
3819 Ga0587092_069447
3820 Ga0587092_159481
3821 Ga0587094_008925
3822 Ga0587094_012910
3823 Ga0587095_002116
3824 Ga0587095_009187
3825 Ga0587097_02013
3826 Ga0587098_012861
3827 Ga0587106_000122
3828 Ga0587106_001550
3829 Ga0587106_017006
3830 Ga0587121_00999
3831 Ga0587121_05107
3832 Ga0587125_002765
3833 Ga0587125_012182
3834 Ga0587125_017429
3835 Ga0587125_036413
3836 Ga0587125_057661
3837 Ga0587129_000136
3838 Ga0587129_014311
3839 Ga0587131_001141
3840 Ga0587131_015980
3841 Ga0587099_000239
3842 Ga0587099_001284
3843 Ga0587101_000023
3844 Ga0587101_002644
3845 Ga0587101_092996
3846 Ga0587109_004786
3847 Ga0587109_012058
3848 Ga0587109_013863
3849 Ga0587109_191445
3850 Ga0587113_000311
3851 Ga0587113_006187
3852 Ga0587113_018749
3853 Ga0587115_002966
3854 Ga0587115_004133
3855 Ga0587117_000748
3856 Ga0587117_000981
3857 Ga0587117_044136
3858 Ga0587122_014627
3859 Ga0587127_001579
3860 Ga0587127_004190
3861 Ga0587128_001779
3862 Ga0587128_002699
3863 Ga0587130_003257
3864 Ga0587130_014083
3865 Ga0587062_000153
3866 Ga0587062_000195
3867 Ga0587062_006619
3868 Ga0587062_013939
3869 Ga0587062_022912
3870 Ga0587062_112775
3871 Ga0587067_000932
3872 Ga0587068_000002
3873 Ga0587068_000350
3874 Ga0587068_001305
3875 Ga0587068_039055
3876 Ga0587068_101698
3877 Ga0587069_000016
3878 Ga0587069_001975
3879 Ga0587069_012065
3880 Ga0587072_000243
3881 Ga0587072_005559
3882 Ga0587072_005813
3883 Ga0587075_000415
3884 Ga0587075_013252
3885 Ga0587075_058867
3886 Ga0587076_002771
3887 Ga0587076_002988
3888 Ga0587076_014419
3889 Ga0587076_021100
3890 Ga0587076_106658
3891 Ga0587078_000244
3892 Ga0587078_012895
3893 Ga0587078_037889
3894 Ga0587079_000033
3895 Ga0587079_000584
3896 Ga0587079_006516
3897 Ga0587079_012865
3898 Ga0587079_092121
3899 Ga0587100_000902
3900 Ga0587102_000132
3901 Ga0587102_001309
3902 Ga0587102_001768
3903 Ga0587102_019367
3904 Ga0587104_000049
3905 Ga0587104_021262
3906 Ga0587105_000034
3907 Ga0587105_000662
3908 Ga0587107_000182
3909 Ga0587107_007809
3910 Ga0587107_021182
3911 Ga0587107_108298
3912 Ga0587108_000210
3913 Ga0587108_002115
3914 Ga0587110_002612
3915 Ga0587110_011354
3916 Ga0587114_000232
3917 Ga0587114_003206
3918 Ga0587116_00707
3919 Ga0587116_08269
3920 Ga0587118_00408
3921 Ga0587118_10377
3922 Ga0587119_002359
3923 Ga0587119_003321
3924 Ga0587120_001451
3925 Ga0587120_002256
3926 Ga0587120_024873
3927 Ga0587124_000978
3928 Ga0587124_007578
3929 Ga0587124_017743
3930 Ga0587060_002032
3931 Ga0587060_006033
3932 Ga0587065_01425
3933 Ga0587081_02283
3934 Ga0587096_00164
3935 Ga0587096_02023
3936 Ga0587071_001255
3937 Ga0587071_001373
3938 Ga0587071_005333
3939 Ga0587071_007249
3940 Ga0587071_033378
3941 Ga0587111_0000116
3942 Ga0587111_0000229
3943 Ga0587111_0000781
3944 Ga0587111_0007805
3945 Ga0587111_0009542
3946 Ga0587111_0020018
3947 Ga0587111_0021839
3948 Ga0587111_0027306
3949 Ga0587111_0037879
3950 Ga0587111_0044090
3951 Ga0587111_0092093
3952 Ga0587111_0130804
3953 Ga0466962_0041637
3954 Ga0466962_0081191
3955 2587725925
3956 2587735576
3957 2588292862
3958 2643967971
3959 2644143129
3960 2644271783

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

63

127

0.94

PF00467

KOW

KOW motif

31

61

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.9513 4 102
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9493 4 102
6vwn-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) 0.9465 3 102
6vwl-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9465 4 102
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9461 3 102
ID Description Score Start End Superfamily
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9034 4 100 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8991 1 99 2.30.30.30
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8802 4 99 2.30.30.30
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8692 4 36 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8673 4 101 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2X3CUS3-F1-model_v4 Large ribosomal subunit protein uL24 0.9628 1 69 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-T1CBJ6-F1-model_v4 50S ribosomal protein L24 0.9612 2 65 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-E0TJ37-F1-model_v4 Large ribosomal subunit protein uL24 0.949 1 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7V9INT9-F1-model_v4 Large ribosomal subunit protein uL24 0.9432 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2S8H2I7-F1-model_v4 deleted 0.9423 1 104

Map