metagRoot

F496105

General Info

Members	Datasets	Scaffolds	Average Seq Length
1939	604	3878	125

Family's Representative Sequence

Representative Sequence	3300013307\|Ga0157372_10026761\|Ga0157372_100267618
Length	154
Sequence	MNLADTPQTNHPRLLRPSALQALNKRNLMARIAGVDVPNNKQVRVGLTYIFGIGDSRAAKILAEANVDPHAKAGTLDEDALNRIRHVIETQGQIEGDLRKDVSLNIKRLIEIQSYRGLRHRRSLPVRGQRTHTNARTRKGPRKGTVAGKKKATK

Samples

	Sample ID	Description	Type	Environment
1	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
2	3300000545	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled	Metagenome	Rhizosphere
3	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
4	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
5	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
6	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
7	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
8	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
9	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
10	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
11	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
12	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
13	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
14	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
15	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
16	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
17	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
18	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
19	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
20	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
21	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
22	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
23	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
24	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
25	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
26	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
27	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
28	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
29	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
30	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
31	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
32	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
33	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
34	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
35	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
36	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
37	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
38	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
39	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
40	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
41	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
42	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
43	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
44	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
47	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
48	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
49	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
50	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
51	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
52	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
53	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
54	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
55	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
56	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
57	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
58	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
59	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
60	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
61	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
62	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
63	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
64	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
65	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
66	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
67	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
68	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
69	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
70	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
71	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
72	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
73	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
74	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
75	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
76	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
77	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
78	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
79	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
80	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
81	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
82	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
83	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
84	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
85	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
86	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
87	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
88	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
89	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
90	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
91	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
92	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
93	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
94	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
95	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
96	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
97	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
98	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
99	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
100	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
101	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
102	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
103	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
104	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
105	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
106	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
107	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
108	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
109	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
110	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
111	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
112	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
114	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
115	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
116	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
117	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
118	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
119	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
120	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
121	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
122	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
123	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
124	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
125	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
126	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
127	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
128	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
129	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
130	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
131	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
132	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
133	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
134	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
135	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
136	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
137	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
138	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
139	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
140	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
141	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
142	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
143	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
144	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
145	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
146	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
147	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
148	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
149	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
150	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
151	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
152	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
153	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
154	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
155	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
156	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
157	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
158	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
159	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
160	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
161	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
162	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
163	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
164	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
241	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
242	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
246	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
247	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
248	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
249	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
250	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
251	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
252	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
253	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
254	3300030963	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
255	3300031010	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
256	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
257	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
258	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
259	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
260	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
261	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
262	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
263	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
264	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
265	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
266	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
267	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
268	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
269	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
270	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
271	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
272	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
273	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
274	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
275	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
276	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
277	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
278	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
279	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
280	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
281	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
282	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
283	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
284	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
285	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
286	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
287	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
288	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
289	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
290	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
291	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
292	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
293	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
294	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
295	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
296	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
297	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
298	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
299	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
300	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
301	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
302	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
303	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
304	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
305	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
306	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
307	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
308	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
309	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
310	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
311	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
312	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
313	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
314	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
315	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
316	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
317	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
318	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
319	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
320	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
321	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
322	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
323	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
324	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
325	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
326	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
327	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
328	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
329	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
330	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
331	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
332	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
333	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
334	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
335	3300041442	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT	Metatranscriptome	Rhizoplane
336	3300041444	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT	Metatranscriptome	Rhizoplane
337	3300041446	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT	Metatranscriptome	Rhizoplane
338	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
339	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
340	3300041457	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT	Metatranscriptome	Rhizoplane
341	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
342	3300041464	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT	Metatranscriptome	Rhizoplane
343	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
344	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
345	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
346	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
347	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
348	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
349	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
350	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
351	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
352	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
353	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
354	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
355	3300042118	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156	Metagenome	Rhizosphere
356	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
357	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
358	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
359	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
360	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
361	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
362	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
363	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
364	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
365	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
366	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
367	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
368	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
369	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
370	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
371	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
372	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
373	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
374	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
375	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
376	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
377	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
378	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
379	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
380	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
381	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
382	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
383	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
384	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
385	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
386	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
387	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
388	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
389	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
390	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
391	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
392	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
393	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
394	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
395	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
396	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
397	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
398	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
399	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
400	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
401	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
402	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
403	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
404	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
405	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
406	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
407	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
408	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
409	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
410	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
411	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
412	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
413	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
414	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
415	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
416	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
417	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
418	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
419	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
420	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
421	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
422	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
423	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
424	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
425	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
426	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
427	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
428	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
429	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
430	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
431	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
432	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
433	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
434	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
435	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
436	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
437	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
438	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
439	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
440	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
441	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
442	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
443	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
444	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
445	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
446	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
447	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
448	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
449	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
450	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
451	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
452	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
453	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
454	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
455	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
456	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
457	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
458	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
459	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
460	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
461	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
462	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
463	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
464	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
465	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
466	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
467	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
468	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
469	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
470	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
471	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
472	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
473	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
474	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
475	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
476	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
477	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
478	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
479	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
480	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
481	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
482	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
483	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
484	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
485	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
486	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
487	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
488	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
489	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
490	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
491	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
492	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
493	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
494	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
495	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
496	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
497	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
498	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
499	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
500	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
501	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
502	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
503	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
504	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
505	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
506	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
507	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
508	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
509	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
510	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
511	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
512	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
513	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
514	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
515	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
516	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
517	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
518	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
519	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
520	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
521	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
522	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
523	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
524	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
525	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
526	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
527	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
528	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
529	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
530	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
531	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
532	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
533	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
534	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
535	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
536	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
537	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
538	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
539	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
540	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
541	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
542	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
543	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
544	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
545	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
546	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
547	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
548	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
549	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
550	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
551	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
552	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
553	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
554	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
555	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
556	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
557	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
558	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
559	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
560	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
561	3300059478	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
562	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
563	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
564	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
565	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
566	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
567	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
568	3300059507	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
569	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
570	3300059509	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
571	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
572	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
573	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
574	3300059513	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
575	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
576	3300059607	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
577	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
578	3300059626	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
579	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
580	3300059631	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
581	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
582	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
583	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
584	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
585	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
586	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
587	3300059646	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
588	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
589	3300059651	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
590	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
591	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
592	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
593	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
594	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
595	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
596	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
597	2643221580	Devosia sp. Root635	Isolate	Unclassified
598	2643221591	Devosia sp. Root685	Isolate	Unclassified
599	2643221629	Devosia sp. Root105	Isolate	Unclassified
600	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
601	2643221674	Devosia sp. Root436	Isolate	Unclassified
602	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
603	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
604	2932401849	Devosia sp. 2618	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.12
Metatranscriptomes	5.47
Isolates	0.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.09
Nodule	0
Rhizoplane	3.35
Rhizosphere	91.03
Stem	0
Stem Tuber	0
Unclassified	0.26

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0157372_10026761	3300013307	Bacteria	6278
2	CNXas_1011685	3300000545	Bacteria	623
3	LJNas_1002616	3300000546	Bacteria	2146
4	JGI24740J21852_10036215	3300001979	Bacteria	1535
5	JGI24743J22301_10002084	3300001991	Bacteria	2947
6	JGI24748J21848_1024664	3300002074	Bacteria	733
7	JGI24749J21850_1016908	3300002076	Bacteria	1025
8	JGI24034J26672_10008005	3300002239	Bacteria	1540
9	JGI24751J29686_10002130	3300002459	Bacteria	4020
10	Ga0006759J45824_1053808	3300003163	Bacteria	782
11	JGI25165J46597_1000961	3300003214	Bacteria	19619
12	Ga0007416J51690_1044303	3300003577	Bacteria	635
13	JGI25405J52794_10102733	3300003911	Bacteria	638
14	Ga0058863_10003447	3300004799	Bacteria	1420
15	Ga0058863_11669580	3300004799	Bacteria	1019
16	Ga0058863_11772365	3300004799	Bacteria	661
17	Ga0058861_11909859	3300004800	Bacteria	1119
18	Ga0058860_11998827	3300004801	Bacteria	2204
19	Ga0058862_12631473	3300004803	Bacteria	661
20	Ga0058862_12891395	3300004803	Bacteria	1111
21	Ga0065704_10208913	3300005289	Bacteria	1116
22	Ga0065712_10117849	3300005290	Bacteria	1714
23	Ga0065715_10104408	3300005293	Bacteria	2965
24	Ga0065707_10304249	3300005295	Bacteria	998
25	Ga0070658_10003455	3300005327	Bacteria	12992
26	Ga0070658_10007072	3300005327	Bacteria	9057
27	Ga0070658_10012043	3300005327	Bacteria	6946
28	Ga0070658_10039203	3300005327	Bacteria	3821
29	Ga0070658_10070625	3300005327	Bacteria	2859
30	Ga0070658_10236536	3300005327	Bacteria	1548
31	Ga0070658_10331954	3300005327	Bacteria	1300
32	Ga0070658_10349410	3300005327	Bacteria	1266
33	Ga0070658_10392978	3300005327	Bacteria	1191
34	Ga0070658_10420259	3300005327	Bacteria	1150
35	Ga0070658_10424637	3300005327	Bacteria	1143
36	Ga0070658_10690804	3300005327	Bacteria	886
37	Ga0070658_10799525	3300005327	Bacteria	819
38	Ga0070658_10976831	3300005327	Bacteria	736
39	Ga0070676_10509320	3300005328	Bacteria	856
40	Ga0070683_100048913	3300005329	Bacteria	3909
41	Ga0070683_100084749	3300005329	Bacteria	2969
42	Ga0070683_100409420	3300005329	Bacteria	1293
43	Ga0070683_100488018	3300005329	Bacteria	1176
44	Ga0070683_101064349	3300005329	Bacteria	777
45	Ga0070683_101643572	3300005329	Bacteria	618
46	Ga0070690_100000550	3300005330	Bacteria	18744
47	Ga0070690_100186523	3300005330	Bacteria	1436
48	Ga0070670_100716187	3300005331	Bacteria	900
49	Ga0070670_100717091	3300005331	Bacteria	900
50	Ga0070670_100896582	3300005331	Bacteria	804
51	Ga0070670_101878411	3300005331	Bacteria	551
52	Ga0070677_10018326	3300005333	Bacteria	2520
53	Ga0068869_100008437	3300005334	Bacteria	6643
54	Ga0068869_100048439	3300005334	Bacteria	3073
55	Ga0068869_100544084	3300005334	Bacteria	974
56	Ga0070666_10032358	3300005335	Bacteria	3454
57	Ga0070680_100187314	3300005336	Bacteria	1743
58	Ga0070680_100496078	3300005336	Bacteria	1044
59	Ga0070680_100730713	3300005336	Bacteria	852
60	Ga0070680_100747927	3300005336	Bacteria	842
61	Ga0070682_100352429	3300005337	Bacteria	1098
62	Ga0070682_102009131	3300005337	Bacteria	509
63	Ga0068868_100011852	3300005338	Bacteria	6357
64	Ga0068868_100029525	3300005338	Bacteria	4199
65	Ga0068868_100039004	3300005338	Bacteria	3688
66	Ga0068868_100125269	3300005338	Bacteria	2098
67	Ga0068868_101235521	3300005338	Bacteria	692
68	Ga0070660_100002901	3300005339	Bacteria	11803
69	Ga0070660_100009153	3300005339	Bacteria	6952
70	Ga0070660_100035951	3300005339	Bacteria	3750
71	Ga0070660_100070020	3300005339	Bacteria	2737
72	Ga0070660_100099623	3300005339	Bacteria	2301
73	Ga0070660_100254384	3300005339	Bacteria	1433
74	Ga0070660_100510429	3300005339	Bacteria	1000
75	Ga0070660_100698104	3300005339	Bacteria	851
76	Ga0070660_100804488	3300005339	Bacteria	791
77	Ga0070689_100048981	3300005340	Bacteria	3260
78	Ga0070689_100378050	3300005340	Bacteria	1193
79	Ga0070689_100552827	3300005340	Bacteria	992
80	Ga0070687_100000493	3300005343	Bacteria	13161
81	Ga0070687_100385025	3300005343	Bacteria	915
82	Ga0070661_100001887	3300005344	Bacteria	14515
83	Ga0070661_100012073	3300005344	Bacteria	6037
84	Ga0070661_100066444	3300005344	Bacteria	2649
85	Ga0070661_100224559	3300005344	Bacteria	1442
86	Ga0070661_100329042	3300005344	Bacteria	1195
87	Ga0070661_100337652	3300005344	Bacteria	1180
88	Ga0070661_100381304	3300005344	Bacteria	1111
89	Ga0070661_100452568	3300005344	Bacteria	1022
90	Ga0070661_101559614	3300005344	Bacteria	558
91	Ga0070668_100092896	3300005347	Bacteria	2381
92	Ga0070668_100443671	3300005347	Bacteria	1114
93	Ga0070669_100537020	3300005353	Bacteria	974
94	Ga0070669_100552897	3300005353	Bacteria	960
95	Ga0070669_100788429	3300005353	Bacteria	807
96	Ga0070675_100004817	3300005354	Bacteria	10298
97	Ga0070675_100065182	3300005354	Bacteria	3011
98	Ga0070675_100250982	3300005354	Bacteria	1548
99	Ga0070675_100560733	3300005354	Bacteria	1034
100	Ga0070671_100001676	3300005355	Bacteria	16774
101	Ga0070671_100596275	3300005355	Bacteria	954
102	Ga0070671_101138914	3300005355	Bacteria	686
103	Ga0070674_100010705	3300005356	Bacteria	5557
104	Ga0070674_100013740	3300005356	Bacteria	5011
105	Ga0070674_101825790	3300005356	Bacteria	551
106	Ga0070673_100042360	3300005364	Bacteria	3510
107	Ga0070673_100150421	3300005364	Bacteria	1971
108	Ga0070673_100194351	3300005364	Bacteria	1744
109	Ga0070688_100049229	3300005365	Bacteria	2621
110	Ga0070688_100187724	3300005365	Bacteria	1438
111	Ga0070659_100001021	3300005366	Bacteria	20542
112	Ga0070659_100064943	3300005366	Bacteria	2890
113	Ga0070659_100112213	3300005366	Bacteria	2201
114	Ga0070659_100122521	3300005366	Bacteria	2107
115	Ga0070659_100133943	3300005366	Bacteria	2014
116	Ga0070659_100220130	3300005366	Bacteria	1566
117	Ga0070667_100048961	3300005367	Bacteria	3559
118	Ga0070667_100060575	3300005367	Bacteria	3202
119	Ga0070667_100209903	3300005367	Bacteria	1730
120	Ga0070667_100962700	3300005367	Bacteria	796
121	Ga0070709_10162337	3300005434	Bacteria	1555
122	Ga0070709_10171344	3300005434	Bacteria	1517
123	Ga0070709_10217549	3300005434	Bacteria	1361
124	Ga0070709_11370311	3300005434	Bacteria	572
125	Ga0070709_11802265	3300005434	Bacteria	501
126	Ga0070714_100026258	3300005435	Bacteria	4812
127	Ga0070714_100238649	3300005435	Bacteria	1677
128	Ga0070714_100620192	3300005435	Bacteria	1040
129	Ga0070714_100909003	3300005435	Bacteria	855
130	Ga0070714_101024054	3300005435	Bacteria	804
131	Ga0070713_100032572	3300005436	Bacteria	4164
132	Ga0070713_100094116	3300005436	Bacteria	2582
133	Ga0070713_100169884	3300005436	Bacteria	1953
134	Ga0070713_100293459	3300005436	Bacteria	1495
135	Ga0070713_100667890	3300005436	Bacteria	991
136	Ga0070713_100685033	3300005436	Bacteria	978
137	Ga0070710_10090487	3300005437	Bacteria	1804
138	Ga0070710_10388263	3300005437	Bacteria	933
139	Ga0070710_10794174	3300005437	Bacteria	676
140	Ga0070710_10947956	3300005437	Bacteria	624
141	Ga0070701_10005263	3300005438	Bacteria	5327
142	Ga0070701_10120492	3300005438	Bacteria	1478
143	Ga0070701_10976138	3300005438	Unclassified	589
144	Ga0070711_100371221	3300005439	Bacteria	1154
145	Ga0070711_100560270	3300005439	Bacteria	949
146	Ga0070705_100168920	3300005440	Bacteria	1470
147	Ga0070705_100773850	3300005440	Bacteria	761
148	Ga0070694_100064353	3300005444	Bacteria	2510
149	Ga0070694_100296844	3300005444	Bacteria	1237
150	Ga0070694_100429245	3300005444	Bacteria	1039
151	Ga0070694_100986492	3300005444	Bacteria	699
152	Ga0070694_101256980	3300005444	Bacteria	622
153	Ga0070708_100039269	3300005445	Bacteria	4141
154	Ga0070708_100146273	3300005445	Bacteria	2195
155	Ga0070708_100210339	3300005445	Bacteria	1822
156	Ga0070708_100241005	3300005445	Bacteria	1698
157	Ga0070708_100336255	3300005445	Bacteria	1423
158	Ga0070708_100394848	3300005445	Bacteria	1304
159	Ga0070708_100574698	3300005445	Bacteria	1063
160	Ga0070708_100605913	3300005445	Unclassified	1033
161	Ga0070708_100788046	3300005445	Bacteria	894
162	Ga0070663_100019510	3300005455	Bacteria	4470
163	Ga0070663_100068174	3300005455	Bacteria	2582
164	Ga0070663_100302625	3300005455	Bacteria	1280
165	Ga0070663_100618704	3300005455	Bacteria	913
166	Ga0070663_100940248	3300005455	Bacteria	749
167	Ga0070678_100031498	3300005456	Bacteria	3659
168	Ga0070678_100053154	3300005456	Bacteria	2944
169	Ga0070662_100020616	3300005457	Bacteria	4493
170	Ga0070662_100141547	3300005457	Bacteria	1865
171	Ga0070662_100559357	3300005457	Bacteria	959
172	Ga0070662_100623001	3300005457	Bacteria	909
173	Ga0070662_100997790	3300005457	Bacteria	717
174	Ga0070681_10045035	3300005458	Bacteria	4416
175	Ga0070681_10047402	3300005458	Bacteria	4296
176	Ga0070681_10071358	3300005458	Bacteria	3437
177	Ga0070681_10452012	3300005458	Bacteria	1197
178	Ga0070681_10528668	3300005458	Bacteria	1093
179	Ga0070681_10575931	3300005458	Bacteria	1039
180	Ga0070681_10813255	3300005458	Bacteria	852
181	Ga0070681_10859594	3300005458	Unclassified	825
182	Ga0068867_100009657	3300005459	Bacteria	6801
183	Ga0068867_100074744	3300005459	Bacteria	2541
184	Ga0068867_100165226	3300005459	Bacteria	1748
185	Ga0068867_101156751	3300005459	Bacteria	709
186	Ga0070685_10001292	3300005466	Bacteria	13193
187	Ga0070685_10267156	3300005466	Bacteria	1140
188	Ga0070706_100005771	3300005467	Bacteria	11760
189	Ga0070706_100063300	3300005467	Bacteria	3418
190	Ga0070706_100153275	3300005467	Bacteria	2151
191	Ga0070706_100384602	3300005467	Bacteria	1307
192	Ga0070706_100924009	3300005467	Bacteria	806
193	Ga0070707_100006596	3300005468	Bacteria	10769
194	Ga0070707_100121554	3300005468	Bacteria	2536
195	Ga0070707_100350579	3300005468	Bacteria	1434
196	Ga0070707_100475779	3300005468	Bacteria	1210
197	Ga0070707_100704407	3300005468	Bacteria	973
198	Ga0070707_101879891	3300005468	Bacteria	566
199	Ga0070698_100007447	3300005471	Bacteria	11844
200	Ga0070698_100144843	3300005471	Bacteria	2326
201	Ga0070698_100941613	3300005471	Bacteria	810
202	Ga0070698_101204297	3300005471	Bacteria	707
203	Ga0070699_100693193	3300005518	Bacteria	930
204	Ga0070699_100726519	3300005518	Bacteria	908
205	Ga0070699_101001394	3300005518	Bacteria	766
206	Ga0070699_101612171	3300005518	Bacteria	595
207	Ga0070679_100001271	3300005530	Bacteria	22273
208	Ga0070679_100056981	3300005530	Bacteria	3894
209	Ga0070679_100084207	3300005530	Bacteria	3168
210	Ga0070679_100124904	3300005530	Bacteria	2556
211	Ga0070679_100432620	3300005530	Bacteria	1261
212	Ga0070679_100800675	3300005530	Bacteria	886
213	Ga0070679_100955432	3300005530	Bacteria	801
214	Ga0070684_100001423	3300005535	Bacteria	17232
215	Ga0070684_100222792	3300005535	Bacteria	1721
216	Ga0070684_100299904	3300005535	Bacteria	1474
217	Ga0070684_101720697	3300005535	Bacteria	592
218	Ga0070697_100019475	3300005536	Bacteria	5361
219	Ga0070697_100111457	3300005536	Bacteria	2281
220	Ga0070697_100284757	3300005536	Bacteria	1418
221	Ga0070697_100621133	3300005536	Bacteria	951
222	Ga0068853_100000054	3300005539	Bacteria	80837
223	Ga0068853_100000888	3300005539	Bacteria	20812
224	Ga0068853_100007192	3300005539	Bacteria	8911
225	Ga0068853_100051852	3300005539	Bacteria	3532
226	Ga0068853_100060862	3300005539	Bacteria	3263
227	Ga0068853_100131149	3300005539	Bacteria	2243
228	Ga0070672_100347782	3300005543	Bacteria	1263
229	Ga0070695_100311703	3300005545	Bacteria	1167
230	Ga0070695_100323023	3300005545	Bacteria	1148
231	Ga0070696_100285438	3300005546	Bacteria	1260
232	Ga0070696_100586910	3300005546	Bacteria	897
233	Ga0070665_100008632	3300005548	Bacteria	10311
234	Ga0070665_100023111	3300005548	Bacteria	6262
235	Ga0070665_100323781	3300005548	Bacteria	1546
236	Ga0070665_100686767	3300005548	Bacteria	1037
237	Ga0070665_100826554	3300005548	Bacteria	939
238	Ga0070665_100871077	3300005548	Bacteria	913
239	Ga0070704_100202765	3300005549	Bacteria	1602
240	Ga0070704_100253838	3300005549	Bacteria	1445
241	Ga0070704_100275487	3300005549	Bacteria	1392
242	Ga0070704_100660631	3300005549	Bacteria	924
243	Ga0068855_100000913	3300005563	Bacteria	36693
244	Ga0068855_100003825	3300005563	Bacteria	18405
245	Ga0068855_100012883	3300005563	Bacteria	10089
246	Ga0068855_100034672	3300005563	Bacteria	6015
247	Ga0068855_100041514	3300005563	Bacteria	5452
248	Ga0068855_100052697	3300005563	Bacteria	4789
249	Ga0068855_100075649	3300005563	Bacteria	3909
250	Ga0068855_100137813	3300005563	Bacteria	2783
251	Ga0068855_100297893	3300005563	Bacteria	1787
252	Ga0068855_100579058	3300005563	Bacteria	1212
253	Ga0068855_100811955	3300005563	Bacteria	993
254	Ga0068855_100889500	3300005563	Bacteria	941
255	Ga0068855_100917453	3300005563	Bacteria	924
256	Ga0068855_101146993	3300005563	Bacteria	810
257	Ga0070664_100380840	3300005564	Bacteria	1288
258	Ga0068857_100001133	3300005577	Bacteria	20806
259	Ga0068857_100002221	3300005577	Bacteria	15818
260	Ga0068857_100165278	3300005577	Bacteria	2009
261	Ga0068857_100364544	3300005577	Bacteria	1340
262	Ga0068857_100402067	3300005577	Bacteria	1274
263	Ga0068857_100459957	3300005577	Bacteria	1191
264	Ga0068854_100000137	3300005578	Bacteria	50696
265	Ga0068854_100015237	3300005578	Bacteria	5089
266	Ga0068854_100037159	3300005578	Bacteria	3416
267	Ga0068854_100159518	3300005578	Bacteria	1745
268	Ga0068854_100507191	3300005578	Bacteria	1017
269	Ga0068854_101173943	3300005578	Bacteria	687
270	Ga0068856_100033324	3300005614	Bacteria	5043
271	Ga0068856_100059597	3300005614	Bacteria	3770
272	Ga0068856_100113186	3300005614	Bacteria	2712
273	Ga0068856_100230364	3300005614	Bacteria	1868
274	Ga0068856_100435995	3300005614	Bacteria	1330
275	Ga0068856_100487598	3300005614	Bacteria	1253
276	Ga0068856_100531778	3300005614	Bacteria	1197
277	Ga0068856_100751022	3300005614	Bacteria	995
278	Ga0068856_100763790	3300005614	Bacteria	987
279	Ga0068856_101078654	3300005614	Bacteria	821
280	Ga0068856_101145674	3300005614	Bacteria	794
281	Ga0068856_101239722	3300005614	Bacteria	762
282	Ga0070702_100034939	3300005615	Bacteria	2774
283	Ga0068852_100001223	3300005616	Bacteria	17089
284	Ga0068852_100324806	3300005616	Bacteria	1495
285	Ga0068852_100338118	3300005616	Bacteria	1467
286	Ga0068852_100771106	3300005616	Bacteria	975
287	Ga0068852_100879372	3300005616	Bacteria	912
288	Ga0068852_100947828	3300005616	Bacteria	879
289	Ga0068852_101272828	3300005616	Bacteria	757
290	Ga0068852_102630651	3300005616	Bacteria	523
291	Ga0068859_100225844	3300005617	Bacteria	1960
292	Ga0068859_100498027	3300005617	Bacteria	1313
293	Ga0068859_100920191	3300005617	Bacteria	959
294	Ga0068864_100428538	3300005618	Bacteria	1261
295	Ga0068864_100511155	3300005618	Bacteria	1157
296	Ga0068864_100746797	3300005618	Bacteria	959
297	Ga0068864_101117333	3300005618	Bacteria	785
298	Ga0068866_10001380	3300005718	Bacteria	10468
299	Ga0068866_11156176	3300005718	Bacteria	557
300	Ga0068866_11233920	3300005718	Bacteria	541
301	Ga0068861_100022311	3300005719	Bacteria	4559
302	Ga0068861_100029913	3300005719	Bacteria	3988
303	Ga0068861_100168742	3300005719	Bacteria	1812
304	Ga0068851_10001352	3300005834	Bacteria	10700
305	Ga0068851_10002106	3300005834	Bacteria	8757
306	Ga0068851_10047137	3300005834	Bacteria	2182
307	Ga0068851_10375773	3300005834	Bacteria	832
308	Ga0068870_10011259	3300005840	Bacteria	4140
309	Ga0068863_100055571	3300005841	Bacteria	3748
310	Ga0068863_100341844	3300005841	Bacteria	1456
311	Ga0068863_100430438	3300005841	Bacteria	1293
312	Ga0068863_101054399	3300005841	Bacteria	817
313	Ga0068858_100012099	3300005842	Bacteria	8133
314	Ga0068860_100191761	3300005843	Bacteria	1978
315	Ga0068860_100204235	3300005843	Bacteria	1916
316	Ga0068860_100546302	3300005843	Bacteria	1160
317	Ga0068860_101124723	3300005843	Bacteria	805
318	Ga0068862_100010568	3300005844	Bacteria	7629
319	Ga0068862_100091660	3300005844	Bacteria	2648
320	Ga0068862_100190780	3300005844	Bacteria	1844
321	Ga0081455_10009196	3300005937	Bacteria	10183
322	Ga0081455_10172900	3300005937	Bacteria	1643
323	Ga0081455_10425206	3300005937	Bacteria	915
324	Ga0081455_10741562	3300005937	Bacteria	622
325	Ga0081539_10028584	3300005985	Bacteria	3502
326	Ga0070717_10586563	3300006028	Bacteria	1011
327	Ga0070717_10608162	3300006028	Bacteria	992
328	Ga0070717_10777698	3300006028	Bacteria	870
329	Ga0070717_11852410	3300006028	Bacteria	545
330	Ga0075368_10166475	3300006042	Bacteria	925
331	Ga0075368_10249714	3300006042	Bacteria	758
332	Ga0075363_100016090	3300006048	Bacteria	3690
333	Ga0075363_100108712	3300006048	Bacteria	1540
334	Ga0075364_10014487	3300006051	Bacteria	4873
335	Ga0075364_10050081	3300006051	Bacteria	2726
336	Ga0075432_10384949	3300006058	Bacteria	602
337	Ga0070715_10781796	3300006163	Bacteria	578
338	Ga0070716_100437193	3300006173	Bacteria	950
339	Ga0070716_100517184	3300006173	Bacteria	884
340	Ga0070716_101147029	3300006173	Bacteria	622
341	Ga0070712_100302994	3300006175	Bacteria	1294
342	Ga0075367_10042717	3300006178	Bacteria	2653
343	Ga0075367_10329217	3300006178	Bacteria	963
344	Ga0075366_10059905	3300006195	Bacteria	2261
345	Ga0075366_10519016	3300006195	Bacteria	737
346	Ga0075366_10584840	3300006195	Bacteria	692
347	Ga0097621_100011600	3300006237	Bacteria	6496
348	Ga0097621_100349548	3300006237	Bacteria	1314
349	Ga0097621_100590092	3300006237	Bacteria	1015
350	Ga0097621_100837701	3300006237	Bacteria	854
351	Ga0075370_10032179	3300006353	Bacteria	2930
352	Ga0075370_10147741	3300006353	Bacteria	1377
353	Ga0075370_10774232	3300006353	Bacteria	584
354	Ga0068871_100001728	3300006358	Bacteria	14706
355	Ga0068871_100061643	3300006358	Bacteria	3064
356	Ga0068871_100064267	3300006358	Bacteria	3004
357	Ga0068871_100375102	3300006358	Bacteria	1263
358	Ga0068871_100408469	3300006358	Bacteria	1210
359	Ga0068871_100553117	3300006358	Bacteria	1042
360	Ga0068871_100795044	3300006358	Bacteria	872
361	Ga0068871_101923231	3300006358	Bacteria	562
362	Ga0068871_102336206	3300006358	Bacteria	510
363	Ga0075428_100080876	3300006844	Bacteria	3547
364	Ga0075428_101167886	3300006844	Bacteria	812
365	Ga0075428_101679379	3300006844	Bacteria	663
366	Ga0075430_100544914	3300006846	Bacteria	957
367	Ga0075430_100688232	3300006846	Bacteria	843
368	Ga0075430_101224578	3300006846	Bacteria	618
369	Ga0075431_101182201	3300006847	Bacteria	728
370	Ga0075431_101476040	3300006847	Bacteria	639
371	Ga0075433_10004735	3300006852	Bacteria	10614
372	Ga0075433_10030331	3300006852	Bacteria	4613
373	Ga0075433_10195568	3300006852	Bacteria	1799
374	Ga0075433_10455435	3300006852	Bacteria	1128
375	Ga0075434_100002471	3300006871	Bacteria	16270
376	Ga0075434_100005131	3300006871	Bacteria	11896
377	Ga0075434_100419802	3300006871	Bacteria	1359
378	Ga0075434_100504575	3300006871	Bacteria	1230
379	Ga0075434_100630547	3300006871	Bacteria	1091
380	Ga0068865_100002505	3300006881	Bacteria	10873
381	Ga0068865_100118650	3300006881	Bacteria	1963
382	Ga0068865_100316868	3300006881	Bacteria	1253
383	Ga0068865_100626259	3300006881	Bacteria	912
384	Ga0068865_101441620	3300006881	Bacteria	616
385	Ga0097620_100225847	3300006931	Bacteria	1960
386	Ga0097620_100498026	3300006931	Bacteria	1313
387	Ga0097620_100920258	3300006931	Bacteria	959
388	Ga0075435_100072955	3300007076	Bacteria	2805
389	Ga0075435_100092879	3300007076	Bacteria	2492
390	Ga0075435_100340208	3300007076	Bacteria	1286
391	Ga0075435_100673136	3300007076	Bacteria	899
392	Ga0099794_10041745	3300007265	Bacteria	2185
393	Ga0099794_10206146	3300007265	Bacteria	1007
394	Ga0099795_10196185	3300007788	Bacteria	850
395	Ga0105250_10070498	3300009092	Bacteria	1411
396	Ga0105250_10522736	3300009092	Bacteria	541
397	Ga0105240_10000001	3300009093	Bacteria	2887840
398	Ga0105240_10004232	3300009093	Bacteria	21946
399	Ga0105240_10012027	3300009093	Bacteria	11997
400	Ga0105240_10012782	3300009093	Bacteria	11567
401	Ga0105240_10041857	3300009093	Bacteria	5842
402	Ga0105240_10045226	3300009093	Bacteria	5587
403	Ga0105240_10075852	3300009093	Bacteria	4146
404	Ga0105240_10402570	3300009093	Bacteria	1541
405	Ga0105240_10697019	3300009093	Bacteria	1109
406	Ga0105240_10824383	3300009093	Bacteria	1003
407	Ga0105240_11747633	3300009093	Bacteria	649
408	Ga0105240_11841845	3300009093	Bacteria	630
409	Ga0105240_11960776	3300009093	Bacteria	609
410	Ga0105240_11963319	3300009093	Bacteria	608
411	Ga0111539_10011813	3300009094	Bacteria	10947
412	Ga0111539_10107940	3300009094	Bacteria	3266
413	Ga0111539_10551272	3300009094	Bacteria	1343
414	Ga0111539_10570734	3300009094	Bacteria	1318
415	Ga0105245_10005029	3300009098	Bacteria	11625
416	Ga0105245_10052848	3300009098	Bacteria	3645
417	Ga0105245_10341012	3300009098	Bacteria	1482
418	Ga0105245_10491286	3300009098	Bacteria	1242
419	Ga0105245_10546906	3300009098	Bacteria	1179
420	Ga0105245_11010766	3300009098	Bacteria	876
421	Ga0105245_12019337	3300009098	Bacteria	630
422	Ga0105245_12597204	3300009098	Bacteria	560
423	Ga0105245_12730339	3300009098	Bacteria	547
424	Ga0105247_10122895	3300009101	Bacteria	1684
425	Ga0105247_10171249	3300009101	Bacteria	1444
426	Ga0105247_10881879	3300009101	Bacteria	689
427	Ga0114129_10000247	3300009147	Bacteria	60820
428	Ga0114129_10039327	3300009147	Bacteria	6667
429	Ga0114129_10052649	3300009147	Bacteria	5713
430	Ga0114129_10382542	3300009147	Bacteria	1858
431	Ga0105243_10561982	3300009148	Bacteria	1092
432	Ga0105243_10591939	3300009148	Bacteria	1066
433	Ga0105243_10596504	3300009148	Bacteria	1063
434	Ga0105243_11505309	3300009148	Bacteria	697
435	Ga0105243_12640194	3300009148	Bacteria	542
436	Ga0105241_10014226	3300009174	Bacteria	5829
437	Ga0105241_10046588	3300009174	Bacteria	3293
438	Ga0105241_10254278	3300009174	Bacteria	1491
439	Ga0105241_10267122	3300009174	Bacteria	1456
440	Ga0105241_10300632	3300009174	Bacteria	1377
441	Ga0105241_11260358	3300009174	Bacteria	702
442	Ga0105241_11534906	3300009174	Bacteria	642
443	Ga0105242_10141751	3300009176	Bacteria	2086
444	Ga0105242_10170719	3300009176	Bacteria	1911
445	Ga0105242_10386016	3300009176	Bacteria	1303
446	Ga0105242_10591197	3300009176	Bacteria	1071
447	Ga0105242_11505766	3300009176	Bacteria	704
448	Ga0105242_11578243	3300009176	Bacteria	689
449	Ga0105242_11624312	3300009176	Bacteria	681
450	Ga0105242_11681574	3300009176	Bacteria	670
451	Ga0105248_10010035	3300009177	Bacteria	10427
452	Ga0105248_10012842	3300009177	Bacteria	9238
453	Ga0105248_10013460	3300009177	Bacteria	9007
454	Ga0105248_10050861	3300009177	Bacteria	4649
455	Ga0105248_10089526	3300009177	Bacteria	3464
456	Ga0105248_10239747	3300009177	Bacteria	2041
457	Ga0105248_10352931	3300009177	Bacteria	1656
458	Ga0105248_10555050	3300009177	Bacteria	1296
459	Ga0105248_10939103	3300009177	Bacteria	977
460	Ga0105248_11244912	3300009177	Bacteria	842
461	Ga0105248_11850521	3300009177	Bacteria	685
462	Ga0105237_10004977	3300009545	Bacteria	15150
463	Ga0105237_10244594	3300009545	Bacteria	1795
464	Ga0105237_10311796	3300009545	Bacteria	1577
465	Ga0105237_10456840	3300009545	Bacteria	1283
466	Ga0105237_10461571	3300009545	Bacteria	1276
467	Ga0105237_10553635	3300009545	Bacteria	1157
468	Ga0105237_10771623	3300009545	Bacteria	968
469	Ga0105238_10007986	3300009551	Bacteria	10586
470	Ga0105238_10008485	3300009551	Bacteria	10286
471	Ga0105238_10033303	3300009551	Bacteria	5244
472	Ga0105238_10055969	3300009551	Bacteria	3958
473	Ga0105238_10114745	3300009551	Bacteria	2673
474	Ga0105238_10178796	3300009551	Bacteria	2098
475	Ga0105238_10231731	3300009551	Bacteria	1823
476	Ga0105238_10323701	3300009551	Bacteria	1528
477	Ga0105238_10362859	3300009551	Bacteria	1438
478	Ga0105238_10542197	3300009551	Bacteria	1167
479	Ga0105238_10567616	3300009551	Bacteria	1140
480	Ga0105238_10908241	3300009551	Bacteria	899
481	Ga0105238_11834780	3300009551	Bacteria	639
482	Ga0105238_12899594	3300009551	Bacteria	516
483	Ga0105249_10394663	3300009553	Bacteria	1413
484	Ga0105249_10398019	3300009553	Bacteria	1407
485	Ga0105249_11383317	3300009553	Bacteria	776
486	Ga0105249_11508622	3300009553	Bacteria	744
487	Ga0099796_10104506	3300010159	Bacteria	1070
488	Ga0105239_10029298	3300010375	Bacteria	6053
489	Ga0105239_10079369	3300010375	Bacteria	3611
490	Ga0105239_10166189	3300010375	Bacteria	2467
491	Ga0105239_10187845	3300010375	Bacteria	2313
492	Ga0105239_10217640	3300010375	Bacteria	2141
493	Ga0105239_10314636	3300010375	Bacteria	1765
494	Ga0105239_10464745	3300010375	Bacteria	1436
495	Ga0105239_10472511	3300010375	Bacteria	1424
496	Ga0105239_11398633	3300010375	Bacteria	808
497	Ga0105239_12016264	3300010375	Bacteria	670
498	Ga0105246_10002877	3300011119	Bacteria	10417
499	Ga0157319_1015912	3300012497	Bacteria	677
500	Ga0157373_10001758	3300013100	Bacteria	16488
501	Ga0157373_10429733	3300013100	Bacteria	949
502	Ga0157373_10755990	3300013100	Bacteria	715
503	Ga0157371_10002134	3300013102	Bacteria	19252
504	Ga0157371_10059160	3300013102	Bacteria	2717
505	Ga0157371_10365430	3300013102	Bacteria	1052
506	Ga0157371_10653169	3300013102	Bacteria	785
507	Ga0157370_10011397	3300013104	Bacteria	9301
508	Ga0157370_10016524	3300013104	Bacteria	7467
509	Ga0157370_10017703	3300013104	Bacteria	7183
510	Ga0157370_10017947	3300013104	Bacteria	7125
511	Ga0157370_10035941	3300013104	Bacteria	4811
512	Ga0157370_10064897	3300013104	Bacteria	3455
513	Ga0157370_10072284	3300013104	Bacteria	3255
514	Ga0157370_10188750	3300013104	Bacteria	1913
515	Ga0157370_10254768	3300013104	Bacteria	1623
516	Ga0157370_10396463	3300013104	Bacteria	1271
517	Ga0157370_10437923	3300013104	Bacteria	1202
518	Ga0157369_10025443	3300013105	Bacteria	6573
519	Ga0157369_10036798	3300013105	Bacteria	5361
520	Ga0157369_10038081	3300013105	Bacteria	5261
521	Ga0157369_10069128	3300013105	Bacteria	3794
522	Ga0157369_10196070	3300013105	Bacteria	2121
523	Ga0157369_10558670	3300013105	Bacteria	1183
524	Ga0157369_10945516	3300013105	Bacteria	883
525	Ga0157369_11175301	3300013105	Bacteria	783
526	Ga0157369_12423096	3300013105	Bacteria	531
527	Ga0157369_12499195	3300013105	Bacteria	523
528	Ga0157374_10014284	3300013296	Bacteria	6947
529	Ga0157374_10016453	3300013296	Bacteria	6502
530	Ga0157374_10095902	3300013296	Bacteria	2837
531	Ga0157374_10335421	3300013296	Bacteria	1500
532	Ga0157374_10360747	3300013296	Bacteria	1445
533	Ga0157374_10392366	3300013296	Bacteria	1384
534	Ga0157374_10422406	3300013296	Bacteria	1332
535	Ga0157374_10608516	3300013296	Bacteria	1103
536	Ga0157374_10612882	3300013296	Bacteria	1099
537	Ga0157374_10925420	3300013296	Bacteria	890
538	Ga0157374_11161995	3300013296	Bacteria	793
539	Ga0157374_11182972	3300013296	Bacteria	786
540	Ga0157374_11854101	3300013296	Bacteria	629
541	Ga0157374_12083644	3300013296	Bacteria	594
542	Ga0157374_12167026	3300013296	Bacteria	583
543	Ga0157378_10007877	3300013297	Bacteria	9298
544	Ga0157378_10322508	3300013297	Bacteria	1501
545	Ga0157378_11070689	3300013297	Bacteria	842
546	Ga0157378_11769486	3300013297	Bacteria	666
547	Ga0157378_12289723	3300013297	Bacteria	592
548	Ga0157378_12438194	3300013297	Bacteria	575
549	Ga0163162_10023636	3300013306	Bacteria	6068
550	Ga0163162_10068979	3300013306	Bacteria	3587
551	Ga0163162_10093076	3300013306	Bacteria	3098
552	Ga0163162_10132217	3300013306	Bacteria	2604
553	Ga0163162_10132864	3300013306	Bacteria	2598
554	Ga0163162_10151692	3300013306	Bacteria	2436
555	Ga0163162_11502835	3300013306	Bacteria	767
556	Ga0163162_11941598	3300013306	Bacteria	674
557	Ga0163162_12623948	3300013306	Bacteria	580
558	Ga0157372_10002154	3300013307	Bacteria	21421
559	Ga0157372_10042345	3300013307	Bacteria	5036
560	Ga0157372_10156109	3300013307	Bacteria	2636
561	Ga0157372_10160572	3300013307	Bacteria	2597
562	Ga0157372_10742027	3300013307	Bacteria	1142
563	Ga0157372_10839710	3300013307	Bacteria	1067
564	Ga0157372_10873619	3300013307	Bacteria	1044
565	Ga0157372_11265508	3300013307	Bacteria	852
566	Ga0157372_11364282	3300013307	Bacteria	817
567	Ga0157372_11682174	3300013307	Bacteria	730
568	Ga0157372_11730349	3300013307	Bacteria	719
569	Ga0157375_10642513	3300013308	Bacteria	1218
570	Ga0157375_10755087	3300013308	Bacteria	1124
571	Ga0157375_13040509	3300013308	Bacteria	560
572	Ga0163163_10000073	3300014325	Bacteria	111551
573	Ga0163163_10001073	3300014325	Bacteria	23224
574	Ga0163163_10002310	3300014325	Bacteria	16099
575	Ga0163163_10058152	3300014325	Bacteria	3823
576	Ga0163163_10524334	3300014325	Bacteria	1247
577	Ga0163163_10578718	3300014325	Bacteria	1186
578	Ga0157380_10081804	3300014326	Bacteria	2642
579	Ga0157380_10105288	3300014326	Bacteria	2358
580	Ga0157380_10403746	3300014326	Bacteria	1297
581	Ga0157380_10445347	3300014326	Bacteria	1242
582	Ga0157380_10562676	3300014326	Bacteria	1121
583	Ga0182008_10004904	3300014497	Bacteria	7714
584	Ga0182008_10154129	3300014497	Bacteria	1153
585	Ga0182008_10786046	3300014497	Bacteria	551
586	Ga0157377_10000768	3300014745	Bacteria	13272
587	Ga0157377_10194887	3300014745	Bacteria	1283
588	Ga0157377_10247814	3300014745	Bacteria	1153
589	Ga0157377_10505820	3300014745	Bacteria	845
590	Ga0157377_11362702	3300014745	Bacteria	557
591	Ga0157379_10005366	3300014968	Bacteria	11017
592	Ga0157379_10043144	3300014968	Bacteria	4027
593	Ga0157379_10114919	3300014968	Bacteria	2419
594	Ga0157379_10117175	3300014968	Bacteria	2396
595	Ga0157379_10122599	3300014968	Bacteria	2339
596	Ga0157379_10154910	3300014968	Bacteria	2067
597	Ga0157379_10206026	3300014968	Bacteria	1779
598	Ga0157379_10332538	3300014968	Bacteria	1388
599	Ga0157379_10641154	3300014968	Bacteria	994
600	Ga0157379_11214683	3300014968	Bacteria	725
601	Ga0157376_10011446	3300014969	Bacteria	6540
602	Ga0157376_10045847	3300014969	Bacteria	3602
603	Ga0157376_10151215	3300014969	Bacteria	2093
604	Ga0157376_10207100	3300014969	Bacteria	1808
605	Ga0157376_10402106	3300014969	Bacteria	1325
606	Ga0157376_10735561	3300014969	Bacteria	994
607	Ga0157376_10761630	3300014969	Bacteria	978
608	Ga0157376_11460677	3300014969	Bacteria	716
609	Ga0157376_12653490	3300014969	Bacteria	541
610	Ga0182006_1027623	3300015261	Bacteria	2314
611	Ga0182007_10006522	3300015262	Bacteria	5005
612	Ga0182005_1169035	3300015265	Bacteria	644
613	Ga0163161_10001969	3300017792	Bacteria	14895
614	Ga0163161_10058720	3300017792	Bacteria	2796
615	Ga0163161_11699914	3300017792	Bacteria	559
616	Ga0197907_10230926	3300020069	Bacteria	1267
617	Ga0197907_10239524	3300020069	Bacteria	529
618	Ga0197907_10967821	3300020069	Bacteria	1218
619	Ga0206356_10506683	3300020070	Bacteria	1108
620	Ga0206355_1041733	3300020076	Bacteria	1363
621	Ga0206355_1092081	3300020076	Bacteria	1467
622	Ga0206352_10589522	3300020078	Bacteria	737
623	Ga0206352_11018334	3300020078	Bacteria	644
624	Ga0206352_11268017	3300020078	Bacteria	1418
625	Ga0206350_10163808	3300020080	Bacteria	889
626	Ga0206354_10850187	3300020081	Bacteria	849
627	Ga0206353_11708252	3300020082	Bacteria	564
628	Ga0154015_1356153	3300020610	Bacteria	679
629	Ga0213872_10000174	3300021361	Bacteria	57332
630	Ga0213876_10106992	3300021384	Bacteria	1484
631	Ga0224712_10260588	3300022467	Bacteria	803
632	Ga0224572_1034293	3300024225	Bacteria	964
633	Ga0228598_1001862	3300024227	Bacteria	4590
634	Ga0228598_1004988	3300024227	Bacteria	2791
635	Ga0228598_1041883	3300024227	Bacteria	904
636	Ga0207672_1005151	3300025223	Bacteria	742
637	Ga0207427_101221	3300025231	Bacteria	9946
638	Ga0207427_104861	3300025231	Bacteria	2078
639	Ga0209233_1000013	3300025261	Bacteria	1013785
640	Ga0209233_1000293	3300025261	Bacteria	63470
641	Ga0209025_1137514	3300025294	Bacteria	698
642	Ga0209758_1108360	3300025297	Bacteria	774
643	Ga0207697_10002087	3300025315	Bacteria	10514
644	Ga0207656_10001058	3300025321	Bacteria	9002
645	Ga0207656_10007877	3300025321	Bacteria	3901
646	Ga0207656_10030934	3300025321	Bacteria	2214
647	Ga0207656_10073458	3300025321	Bacteria	1524
648	Ga0207696_1062939	3300025711	Bacteria	1041
649	Ga0207653_10045851	3300025885	Bacteria	1445
650	Ga0207692_10061624	3300025898	Bacteria	1945
651	Ga0207642_10016366	3300025899	Bacteria	2791
652	Ga0207710_10464081	3300025900	Bacteria	655
653	Ga0207688_10005204	3300025901	Bacteria	7069
654	Ga0207680_10001756	3300025903	Bacteria	10229
655	Ga0207680_10193851	3300025903	Bacteria	1381
656	Ga0207647_10004803	3300025904	Bacteria	10004
657	Ga0207647_10012233	3300025904	Bacteria	5980
658	Ga0207647_10300682	3300025904	Bacteria	914
659	Ga0207647_10433414	3300025904	Bacteria	738
660	Ga0207685_10026241	3300025905	Bacteria	2023
661	Ga0207685_10412670	3300025905	Bacteria	694
662	Ga0207685_10482692	3300025905	Bacteria	649
663	Ga0207699_10142107	3300025906	Bacteria	1579
664	Ga0207699_10394303	3300025906	Bacteria	985
665	Ga0207699_10428454	3300025906	Bacteria	946
666	Ga0207699_10526276	3300025906	Bacteria	855
667	Ga0207699_10626823	3300025906	Bacteria	784
668	Ga0207645_10001180	3300025907	Bacteria	21585
669	Ga0207645_10027676	3300025907	Bacteria	3659
670	Ga0207645_11069598	3300025907	Bacteria	545
671	Ga0207643_10001067	3300025908	Bacteria	16207
672	Ga0207705_10000048	3300025909	Bacteria	171848
673	Ga0207705_10003420	3300025909	Bacteria	12069
674	Ga0207705_10009158	3300025909	Bacteria	7213
675	Ga0207705_10020427	3300025909	Bacteria	4732
676	Ga0207705_10035314	3300025909	Bacteria	3576
677	Ga0207705_10035805	3300025909	Bacteria	3551
678	Ga0207705_10069066	3300025909	Bacteria	2559
679	Ga0207705_10071391	3300025909	Bacteria	2517
680	Ga0207705_10193195	3300025909	Bacteria	1540
681	Ga0207705_10315218	3300025909	Bacteria	1201
682	Ga0207705_10409878	3300025909	Bacteria	1048
683	Ga0207705_10835416	3300025909	Bacteria	714
684	Ga0207705_11521589	3300025909	Bacteria	506
685	Ga0207684_10047342	3300025910	Bacteria	3646
686	Ga0207684_10054281	3300025910	Bacteria	3399
687	Ga0207684_10501203	3300025910	Bacteria	1041
688	Ga0207654_10088882	3300025911	Bacteria	1878
689	Ga0207654_10096796	3300025911	Bacteria	1811
690	Ga0207654_10263402	3300025911	Bacteria	1160
691	Ga0207654_10461569	3300025911	Bacteria	892
692	Ga0207654_10547427	3300025911	Bacteria	822
693	Ga0207654_10655961	3300025911	Bacteria	752
694	Ga0207707_10074527	3300025912	Bacteria	2960
695	Ga0207707_10108640	3300025912	Bacteria	2425
696	Ga0207707_10141365	3300025912	Bacteria	2104
697	Ga0207707_10156822	3300025912	Bacteria	1991
698	Ga0207707_10230470	3300025912	Bacteria	1611
699	Ga0207707_10434832	3300025912	Bacteria	1124
700	Ga0207707_10484945	3300025912	Bacteria	1056
701	Ga0207707_10515789	3300025912	Bacteria	1018
702	Ga0207707_10579354	3300025912	Bacteria	951
703	Ga0207707_11271572	3300025912	Bacteria	592
704	Ga0207695_10000001	3300025913	Bacteria	2888630
705	Ga0207695_10000354	3300025913	Bacteria	105275
706	Ga0207695_10040345	3300025913	Bacteria	5007
707	Ga0207695_10043881	3300025913	Bacteria	4760
708	Ga0207695_10065193	3300025913	Bacteria	3745
709	Ga0207695_10145327	3300025913	Bacteria	2316
710	Ga0207695_10259669	3300025913	Bacteria	1635
711	Ga0207695_10273468	3300025913	Bacteria	1584
712	Ga0207695_10458807	3300025913	Bacteria	1157
713	Ga0207695_10716883	3300025913	Bacteria	881
714	Ga0207695_10732238	3300025913	Bacteria	869
715	Ga0207695_10792414	3300025913	Bacteria	828
716	Ga0207695_10879630	3300025913	Bacteria	776
717	Ga0207695_10955307	3300025913	Bacteria	737
718	Ga0207695_10991885	3300025913	Bacteria	720
719	Ga0207695_11252770	3300025913	Bacteria	622
720	Ga0207695_11278626	3300025913	Bacteria	614
721	Ga0207671_10108938	3300025914	Bacteria	2105
722	Ga0207671_10254384	3300025914	Bacteria	1381
723	Ga0207671_10344051	3300025914	Bacteria	1182
724	Ga0207671_10388000	3300025914	Bacteria	1110
725	Ga0207671_11091765	3300025914	Bacteria	627
726	Ga0207693_10185329	3300025915	Bacteria	1638
727	Ga0207663_10095331	3300025916	Bacteria	1985
728	Ga0207663_11071044	3300025916	Bacteria	648
729	Ga0207660_10066489	3300025917	Bacteria	2608
730	Ga0207660_10155049	3300025917	Bacteria	1763
731	Ga0207660_10175969	3300025917	Bacteria	1659
732	Ga0207660_10369603	3300025917	Bacteria	1151
733	Ga0207660_10641413	3300025917	Bacteria	866
734	Ga0207662_10001544	3300025918	Bacteria	11236
735	Ga0207657_10000823	3300025919	Bacteria	32798
736	Ga0207657_10004069	3300025919	Bacteria	15518
737	Ga0207657_10017050	3300025919	Bacteria	6985
738	Ga0207657_10017767	3300025919	Bacteria	6809
739	Ga0207657_10044882	3300025919	Bacteria	3882
740	Ga0207657_10076211	3300025919	Bacteria	2830
741	Ga0207657_10100998	3300025919	Bacteria	2394
742	Ga0207657_10181479	3300025919	Bacteria	1701
743	Ga0207657_10248015	3300025919	Bacteria	1420
744	Ga0207657_10367972	3300025919	Bacteria	1133
745	Ga0207649_10001087	3300025920	Bacteria	16517
746	Ga0207649_10001226	3300025920	Bacteria	15405
747	Ga0207649_10068990	3300025920	Bacteria	2249
748	Ga0207649_10093984	3300025920	Bacteria	1969
749	Ga0207649_10129618	3300025920	Bacteria	1711
750	Ga0207649_10213844	3300025920	Bacteria	1369
751	Ga0207649_10265312	3300025920	Bacteria	1242
752	Ga0207649_10337743	3300025920	Bacteria	1111
753	Ga0207649_10486439	3300025920	Bacteria	937
754	Ga0207649_10515223	3300025920	Bacteria	911
755	Ga0207649_10627675	3300025920	Bacteria	828
756	Ga0207649_11398278	3300025920	Bacteria	554
757	Ga0207652_10026611	3300025921	Bacteria	4820
758	Ga0207652_10115125	3300025921	Bacteria	2388
759	Ga0207652_10116633	3300025921	Bacteria	2372
760	Ga0207652_11453338	3300025921	Bacteria	589
761	Ga0207646_10029900	3300025922	Bacteria	4945
762	Ga0207646_10080282	3300025922	Bacteria	2916
763	Ga0207646_10255682	3300025922	Bacteria	1583
764	Ga0207646_10301972	3300025922	Bacteria	1446
765	Ga0207646_10306418	3300025922	Bacteria	1435
766	Ga0207646_10378491	3300025922	Bacteria	1279
767	Ga0207646_11236185	3300025922	Bacteria	654
768	Ga0207681_10070214	3300025923	Bacteria	2438
769	Ga0207681_10321778	3300025923	Bacteria	1230
770	Ga0207681_10511162	3300025923	Bacteria	985
771	Ga0207681_10856448	3300025923	Bacteria	760
772	Ga0207681_11255357	3300025923	Bacteria	622
773	Ga0207681_11284402	3300025923	Bacteria	615
774	Ga0207694_10008555	3300025924	Bacteria	7728
775	Ga0207694_10010372	3300025924	Bacteria	7023
776	Ga0207694_10172425	3300025924	Bacteria	1752
777	Ga0207694_10206363	3300025924	Bacteria	1600
778	Ga0207694_10257212	3300025924	Bacteria	1430
779	Ga0207694_10263055	3300025924	Bacteria	1413
780	Ga0207694_10378196	3300025924	Bacteria	1175
781	Ga0207694_10417555	3300025924	Bacteria	1117
782	Ga0207694_10534575	3300025924	Bacteria	983
783	Ga0207694_10549358	3300025924	Bacteria	969
784	Ga0207694_10803538	3300025924	Bacteria	794
785	Ga0207694_11696344	3300025924	Bacteria	532
786	Ga0207650_10000152	3300025925	Bacteria	83134
787	Ga0207650_10044745	3300025925	Bacteria	3254
788	Ga0207650_10612383	3300025925	Bacteria	916
789	Ga0207650_11043917	3300025925	Bacteria	695
790	Ga0207659_10003498	3300025926	Bacteria	9434
791	Ga0207659_10273630	3300025926	Bacteria	1378
792	Ga0207659_10709575	3300025926	Bacteria	861
793	Ga0207687_10087186	3300025927	Bacteria	2268
794	Ga0207687_10155570	3300025927	Bacteria	1749
795	Ga0207687_10429214	3300025927	Bacteria	1092
796	Ga0207687_10625466	3300025927	Bacteria	909
797	Ga0207687_11319066	3300025927	Bacteria	620
798	Ga0207687_11951195	3300025927	Bacteria	501
799	Ga0207700_10003657	3300025928	Bacteria	8964
800	Ga0207700_10068069	3300025928	Bacteria	2728
801	Ga0207700_10144662	3300025928	Bacteria	1958
802	Ga0207700_10209826	3300025928	Bacteria	1646
803	Ga0207700_10570143	3300025928	Bacteria	1006
804	Ga0207700_11071692	3300025928	Bacteria	721
805	Ga0207700_11193773	3300025928	Bacteria	679
806	Ga0207664_10192934	3300025929	Bacteria	1754
807	Ga0207664_10331538	3300025929	Bacteria	1344
808	Ga0207664_10667546	3300025929	Bacteria	934
809	Ga0207664_10841805	3300025929	Bacteria	825
810	Ga0207664_11266223	3300025929	Bacteria	656
811	Ga0207664_11669184	3300025929	Bacteria	559
812	Ga0207644_10003335	3300025931	Bacteria	10358
813	Ga0207644_10004726	3300025931	Bacteria	8849
814	Ga0207644_10078687	3300025931	Bacteria	2431
815	Ga0207690_10000628	3300025932	Bacteria	22822
816	Ga0207690_10022141	3300025932	Bacteria	3949
817	Ga0207690_10078928	3300025932	Bacteria	2292
818	Ga0207690_10089309	3300025932	Bacteria	2173
819	Ga0207690_10221881	3300025932	Bacteria	1447
820	Ga0207690_10294292	3300025932	Bacteria	1268
821	Ga0207690_10748401	3300025932	Bacteria	806
822	Ga0207690_11106313	3300025932	Bacteria	660
823	Ga0207690_11186207	3300025932	Bacteria	637
824	Ga0207706_10000740	3300025933	Bacteria	34067
825	Ga0207706_10205402	3300025933	Bacteria	1727
826	Ga0207706_10535152	3300025933	Bacteria	1009
827	Ga0207686_10052073	3300025934	Bacteria	2553
828	Ga0207686_10116085	3300025934	Bacteria	1814
829	Ga0207686_10327161	3300025934	Bacteria	1147
830	Ga0207686_10410104	3300025934	Bacteria	1034
831	Ga0207686_10613372	3300025934	Bacteria	857
832	Ga0207686_10766268	3300025934	Bacteria	771
833	Ga0207686_10846148	3300025934	Bacteria	736
834	Ga0207686_10983607	3300025934	Bacteria	684
835	Ga0207709_10007982	3300025935	Bacteria	5862
836	Ga0207709_11552380	3300025935	Bacteria	550
837	Ga0207670_10161221	3300025936	Bacteria	1674
838	Ga0207670_10218185	3300025936	Bacteria	1459
839	Ga0207669_10087780	3300025937	Bacteria	2015
840	Ga0207669_10408142	3300025937	Bacteria	1066
841	Ga0207704_10014351	3300025938	Bacteria	3997
842	Ga0207704_10132650	3300025938	Bacteria	1728
843	Ga0207704_10218243	3300025938	Bacteria	1409
844	Ga0207704_10472569	3300025938	Bacteria	1005
845	Ga0207704_10480673	3300025938	Bacteria	997
846	Ga0207704_10548010	3300025938	Bacteria	939
847	Ga0207665_10220776	3300025939	Bacteria	1389
848	Ga0207665_10269521	3300025939	Bacteria	1264
849	Ga0207665_10569554	3300025939	Bacteria	882
850	Ga0207665_10630734	3300025939	Unclassified	839
851	Ga0207665_10631231	3300025939	Bacteria	838
852	Ga0207665_11536985	3300025939	Bacteria	528
853	Ga0207691_10000308	3300025940	Bacteria	48637
854	Ga0207691_10003340	3300025940	Bacteria	15620
855	Ga0207691_11082745	3300025940	Bacteria	667
856	Ga0207711_10003068	3300025941	Bacteria	14584
857	Ga0207711_10007764	3300025941	Bacteria	8964
858	Ga0207711_10036970	3300025941	Bacteria	4144
859	Ga0207711_10039221	3300025941	Bacteria	4028
860	Ga0207711_10116524	3300025941	Bacteria	2382
861	Ga0207711_10206860	3300025941	Bacteria	1792
862	Ga0207711_10388325	3300025941	Bacteria	1296
863	Ga0207711_10932239	3300025941	Bacteria	807
864	Ga0207689_10000618	3300025942	Bacteria	33979
865	Ga0207689_10013634	3300025942	Bacteria	6930
866	Ga0207689_10018614	3300025942	Bacteria	5859
867	Ga0207689_10138408	3300025942	Bacteria	2005
868	Ga0207689_10442129	3300025942	Bacteria	1086
869	Ga0207689_11652591	3300025942	Bacteria	532
870	Ga0207661_10007082	3300025944	Bacteria	7965
871	Ga0207661_10058611	3300025944	Bacteria	3099
872	Ga0207661_10137272	3300025944	Bacteria	2101
873	Ga0207661_10519997	3300025944	Bacteria	1088
874	Ga0207661_10712531	3300025944	Bacteria	923
875	Ga0207661_10898149	3300025944	Bacteria	816
876	Ga0207679_10000298	3300025945	Bacteria	37205
877	Ga0207679_12145735	3300025945	Bacteria	507
878	Ga0207667_10000647	3300025949	Bacteria	45083
879	Ga0207667_10000877	3300025949	Bacteria	38435
880	Ga0207667_10008444	3300025949	Bacteria	12232
881	Ga0207667_10016311	3300025949	Bacteria	8396
882	Ga0207667_10019501	3300025949	Bacteria	7568
883	Ga0207667_10108232	3300025949	Bacteria	2868
884	Ga0207667_10161727	3300025949	Bacteria	2303
885	Ga0207667_10248995	3300025949	Bacteria	1817
886	Ga0207667_10330969	3300025949	Bacteria	1555
887	Ga0207667_10591694	3300025949	Bacteria	1119
888	Ga0207667_11102000	3300025949	Bacteria	777
889	Ga0207667_11111632	3300025949	Bacteria	773
890	Ga0207667_11423224	3300025949	Bacteria	666
891	Ga0207667_11816877	3300025949	Bacteria	573
892	Ga0207667_11940304	3300025949	Bacteria	550
893	Ga0207651_10027205	3300025960	Bacteria	3588
894	Ga0207651_10051410	3300025960	Bacteria	2803
895	Ga0207651_10201339	3300025960	Bacteria	1596
896	Ga0207651_11730477	3300025960	Bacteria	563
897	Ga0207712_10234324	3300025961	Bacteria	1475
898	Ga0207712_11032209	3300025961	Bacteria	730
899	Ga0207712_12018615	3300025961	Bacteria	516
900	Ga0207668_10009850	3300025972	Bacteria	5742
901	Ga0207668_10079642	3300025972	Bacteria	2370
902	Ga0207668_10594988	3300025972	Bacteria	963
903	Ga0207640_10000023	3300025981	Bacteria	160979
904	Ga0207640_10016034	3300025981	Bacteria	4349
905	Ga0207640_10046887	3300025981	Bacteria	2784
906	Ga0207640_10112501	3300025981	Bacteria	1933
907	Ga0207640_10350362	3300025981	Bacteria	1186
908	Ga0207640_10603775	3300025981	Bacteria	929
909	Ga0207640_11006460	3300025981	Bacteria	733
910	Ga0207658_10003391	3300025986	Bacteria	11277
911	Ga0207658_10040041	3300025986	Bacteria	3385
912	Ga0207658_10107764	3300025986	Bacteria	2196
913	Ga0207658_10403718	3300025986	Bacteria	1202
914	Ga0207658_12164924	3300025986	Bacteria	505
915	Ga0207677_10010267	3300026023	Bacteria	5295
916	Ga0207677_10028273	3300026023	Bacteria	3543
917	Ga0207677_10032062	3300026023	Bacteria	3374
918	Ga0207677_10101363	3300026023	Bacteria	2120
919	Ga0207677_10305480	3300026023	Bacteria	1316
920	Ga0207677_10739836	3300026023	Bacteria	876
921	Ga0207703_10098364	3300026035	Bacteria	2474
922	Ga0207703_10124896	3300026035	Bacteria	2214
923	Ga0207703_10486385	3300026035	Bacteria	1157
924	Ga0207639_10000034	3300026041	Bacteria	154355
925	Ga0207639_10003445	3300026041	Bacteria	10647
926	Ga0207639_10004515	3300026041	Bacteria	9386
927	Ga0207639_10007867	3300026041	Bacteria	7280
928	Ga0207639_10029135	3300026041	Bacteria	4039
929	Ga0207639_10061199	3300026041	Bacteria	2906
930	Ga0207639_10383880	3300026041	Bacteria	1262
931	Ga0207639_10794787	3300026041	Bacteria	881
932	Ga0207639_10970613	3300026041	Bacteria	795
933	Ga0207639_11124636	3300026041	Bacteria	737
934	Ga0207678_10001362	3300026067	Bacteria	22534
935	Ga0207678_10001665	3300026067	Bacteria	20379
936	Ga0207678_10003018	3300026067	Bacteria	15226
937	Ga0207678_10004699	3300026067	Bacteria	12252
938	Ga0207678_10194692	3300026067	Bacteria	1733
939	Ga0207678_10201693	3300026067	Bacteria	1701
940	Ga0207678_10395078	3300026067	Bacteria	1197
941	Ga0207678_10908299	3300026067	Bacteria	779
942	Ga0207678_10965719	3300026067	Bacteria	754
943	Ga0207678_11171167	3300026067	Bacteria	681
944	Ga0207708_10050429	3300026075	Bacteria	3168
945	Ga0207708_10095654	3300026075	Bacteria	2294
946	Ga0207702_10067712	3300026078	Bacteria	3065
947	Ga0207702_10205972	3300026078	Bacteria	1826
948	Ga0207702_10459283	3300026078	Bacteria	1237
949	Ga0207702_10481428	3300026078	Bacteria	1208
950	Ga0207702_10525092	3300026078	Bacteria	1156
951	Ga0207702_10890425	3300026078	Bacteria	882
952	Ga0207702_11025538	3300026078	Bacteria	819
953	Ga0207702_11184927	3300026078	Bacteria	758
954	Ga0207702_11602410	3300026078	Bacteria	644
955	Ga0207702_12316776	3300026078	Bacteria	525
956	Ga0207641_10000052	3300026088	Bacteria	173672
957	Ga0207641_10007294	3300026088	Bacteria	9214
958	Ga0207641_10151206	3300026088	Bacteria	2102
959	Ga0207641_10415102	3300026088	Bacteria	1295
960	Ga0207641_10472628	3300026088	Bacteria	1214
961	Ga0207648_10003962	3300026089	Bacteria	15393
962	Ga0207648_10025631	3300026089	Bacteria	5250
963	Ga0207648_10094614	3300026089	Bacteria	2613
964	Ga0207648_10108160	3300026089	Bacteria	2441
965	Ga0207648_10539524	3300026089	Bacteria	1070
966	Ga0207648_11007131	3300026089	Bacteria	780
967	Ga0207648_11267945	3300026089	Bacteria	692
968	Ga0207648_11371945	3300026089	Bacteria	664
969	Ga0207648_11577568	3300026089	Bacteria	617
970	Ga0207676_10000176	3300026095	Bacteria	56110
971	Ga0207676_10066704	3300026095	Bacteria	2872
972	Ga0207676_10239737	3300026095	Bacteria	1626
973	Ga0207676_10457817	3300026095	Bacteria	1204
974	Ga0207676_11399043	3300026095	Bacteria	695
975	Ga0207676_11489451	3300026095	Bacteria	673
976	Ga0207674_10000532	3300026116	Bacteria	49916
977	Ga0207674_10000561	3300026116	Bacteria	48618
978	Ga0207674_10045512	3300026116	Bacteria	4513
979	Ga0207674_10070606	3300026116	Bacteria	3511
980	Ga0207674_10566971	3300026116	Bacteria	1097
981	Ga0207674_12112848	3300026116	Bacteria	527
982	Ga0207675_100005443	3300026118	Bacteria	12201
983	Ga0207675_100022568	3300026118	Bacteria	5859
984	Ga0207675_100038814	3300026118	Bacteria	4443
985	Ga0207675_101620280	3300026118	Bacteria	668
986	Ga0207675_101898116	3300026118	Bacteria	614
987	Ga0207683_10001978	3300026121	Bacteria	18120
988	Ga0207683_10144480	3300026121	Bacteria	2144
989	Ga0207683_10144767	3300026121	Bacteria	2142
990	Ga0207683_10406905	3300026121	Bacteria	1252
991	Ga0207683_10522017	3300026121	Bacteria	1097
992	Ga0207698_10057598	3300026142	Bacteria	3007
993	Ga0207698_10140737	3300026142	Bacteria	2078
994	Ga0207698_10443331	3300026142	Bacteria	1251
995	Ga0207698_10522792	3300026142	Bacteria	1158
996	Ga0207698_10645203	3300026142	Bacteria	1048
997	Ga0207698_10786905	3300026142	Bacteria	952
998	Ga0207698_11364796	3300026142	Bacteria	724
999	Ga0207698_11646404	3300026142	Bacteria	657
1000	Ga0207698_11819242	3300026142	Bacteria	624
1001	Ga0207698_12543446	3300026142	Bacteria	522
1002	Ga0207698_12615276	3300026142	Bacteria	514
1003	Ga0209983_1009332	3300027665	Bacteria	2005
1004	Ga0209971_1013953	3300027682	Bacteria	1905
1005	Ga0209966_1049746	3300027695	Bacteria	890
1006	Ga0209813_10348970	3300027866	Bacteria	586
1007	Ga0207428_10013294	3300027907	Bacteria	7197
1008	Ga0268266_10000557	3300028379	Bacteria	51935
1009	Ga0268266_10001266	3300028379	Bacteria	30870
1010	Ga0268266_10007930	3300028379	Bacteria	9500
1011	Ga0268266_10166413	3300028379	Bacteria	1998
1012	Ga0268266_10178394	3300028379	Bacteria	1932
1013	Ga0268266_10686342	3300028379	Bacteria	987
1014	Ga0268266_10875157	3300028379	Bacteria	868
1015	Ga0268265_10090344	3300028380	Bacteria	2446
1016	Ga0268265_10363638	3300028380	Bacteria	1325
1017	Ga0268264_10005269	3300028381	Bacteria	10950
1018	Ga0268264_10111165	3300028381	Bacteria	2400
1019	Ga0268264_10960467	3300028381	Bacteria	860
1020	Ga0265319_1090473	3300028563	Bacteria	966
1021	Ga0265318_10008175	3300028577	Bacteria	4675
1022	Ga0265318_10025073	3300028577	Bacteria	2359
1023	Ga0265336_10171077	3300028666	Bacteria	646
1024	Ga0265338_10069830	3300028800	Bacteria	3016
1025	Ga0265338_10097304	3300028800	Bacteria	2411
1026	Ga0265338_10342082	3300028800	Bacteria	1078
1027	Ga0265324_10063838	3300029957	Bacteria	1257
1028	Ga0316177_1003034	3300030731	Bacteria	690
1029	Ga0316182_1342954	3300030745	Bacteria	832
1030	Ga0265762_1019970	3300030760	Bacteria	1230
1031	Ga0265762_1020374	3300030760	Bacteria	1219
1032	Ga0265763_1024974	3300030763	Bacteria	650
1033	Ga0265768_109684	3300030963	Bacteria	611
1034	Ga0265771_1003671	3300031010	Bacteria	898
1035	Ga0265760_10012291	3300031090	Bacteria	2447
1036	Ga0265330_10096766	3300031235	Bacteria	1265
1037	Ga0265332_10052450	3300031238	Bacteria	1751
1038	Ga0265332_10065930	3300031238	Bacteria	1546
1039	Ga0265328_10168491	3300031239	Bacteria	827
1040	Ga0265320_10060485	3300031240	Bacteria	1808
1041	Ga0265325_10000449	3300031241	Bacteria	29667
1042	Ga0265325_10015728	3300031241	Bacteria	4247
1043	Ga0265325_10214901	3300031241	Bacteria	882
1044	Ga0265329_10014266	3300031242	Bacteria	2808
1045	Ga0265340_10139581	3300031247	Bacteria	1109
1046	Ga0265340_10219034	3300031247	Bacteria	853
1047	Ga0265340_10235019	3300031247	Bacteria	819
1048	Ga0265340_10550110	3300031247	Bacteria	508
1049	Ga0265339_10008349	3300031249	Bacteria	6595
1050	Ga0265339_10013124	3300031249	Bacteria	5031
1051	Ga0265339_10026466	3300031249	Bacteria	3322
1052	Ga0265339_10075531	3300031249	Bacteria	1789
1053	Ga0265339_10081437	3300031249	Bacteria	1711
1054	Ga0265331_10024618	3300031250	Bacteria	3044
1055	Ga0265331_10090366	3300031250	Bacteria	1416
1056	Ga0265331_10096344	3300031250	Bacteria	1365
1057	Ga0265331_10115490	3300031250	Bacteria	1229
1058	Ga0265331_10166850	3300031250	Bacteria	997
1059	Ga0265316_10011341	3300031344	Bacteria	8048
1060	Ga0265316_10134898	3300031344	Bacteria	1857
1061	Ga0265316_10326681	3300031344	Bacteria	1113
1062	Ga0265316_10954284	3300031344	Bacteria	598
1063	Ga0307408_100238133	3300031548	Bacteria	1494
1064	Ga0265313_10002227	3300031595	Bacteria	17059
1065	Ga0265313_10041151	3300031595	Bacteria	2279
1066	Ga0265313_10144455	3300031595	Bacteria	1021
1067	Ga0307508_10417244	3300031616	Bacteria	934
1068	Ga0316575_10086324	3300031665	Bacteria	1268
1069	Ga0265314_10003075	3300031711	Bacteria	16448
1070	Ga0265314_10019611	3300031711	Bacteria	5236
1071	Ga0265314_10031281	3300031711	Bacteria	3932
1072	Ga0265314_10048943	3300031711	Bacteria	2962
1073	Ga0265314_10070383	3300031711	Bacteria	2344
1074	Ga0265314_10116887	3300031711	Bacteria	1686
1075	Ga0265314_10189304	3300031711	Bacteria	1226
1076	Ga0265342_10000677	3300031712	Bacteria	35579
1077	Ga0265342_10507064	3300031712	Bacteria	615
1078	Ga0265342_10648456	3300031712	Bacteria	530
1079	Ga0316576_10336793	3300031727	Bacteria	1124
1080	Ga0307516_10028240	3300031730	Bacteria	5679
1081	Ga0307405_10653065	3300031731	Bacteria	865
1082	Ga0307405_11367922	3300031731	Bacteria	618
1083	Ga0307413_10576209	3300031824	Bacteria	917
1084	Ga0307410_11516442	3300031852	Bacteria	591
1085	Ga0307406_10271008	3300031901	Bacteria	1290
1086	Ga0307406_11259170	3300031901	Bacteria	644
1087	Ga0307412_10241524	3300031911	Bacteria	1397
1088	Ga0307412_10279440	3300031911	Bacteria	1310
1089	Ga0307412_11531984	3300031911	Bacteria	607
1090	Ga0307412_12136839	3300031911	Bacteria	520
1091	Ga0307409_101340152	3300031995	Bacteria	741
1092	Ga0307416_100113353	3300032002	Bacteria	2396
1093	Ga0307416_101677692	3300032002	Bacteria	740
1094	Ga0307416_101809794	3300032002	Bacteria	715
1095	Ga0307414_10122495	3300032004	Bacteria	2002
1096	Ga0307414_10161264	3300032004	Bacteria	1781
1097	Ga0307414_10203250	3300032004	Bacteria	1613
1098	Ga0307414_10219357	3300032004	Bacteria	1560
1099	Ga0307414_10365082	3300032004	Bacteria	1243
1100	Ga0307414_10823884	3300032004	Bacteria	847
1101	Ga0307414_10882346	3300032004	Bacteria	819
1102	Ga0307415_101765117	3300032126	Bacteria	598
1103	Ga0316593_10104926	3300032168	Bacteria	1005
1104	Ga0307510_10168675	3300033180	Bacteria	1772
1105	Ga0307510_10263936	3300033180	Bacteria	1202
1106	Ga0307510_10322290	3300033180	Bacteria	1002
1107	Ga0307510_10432518	3300033180	Bacteria	758
1108	Ga0307510_10512279	3300033180	Bacteria	643
1109	Ga0316586_1032918	3300033527	Bacteria	894
1110	Ga0316588_1169042	3300033528	Bacteria	565
1111	Ga0316587_1053619	3300033529	Bacteria	741
1112	Ga0316212_1012268	3300033547	Bacteria	1221
1113	Ga0373930_0031471	3300034816	Bacteria	1094
1114	Ga0373930_0111830	3300034816	Bacteria	658
1115	Ga0373948_0178204	3300034817	Bacteria	544
1116	Ga0373950_0106468	3300034818	Bacteria	609
1117	Ga0373959_0069928	3300034820	Bacteria	792
1118	Ga0373938_0083288	3300034957	Bacteria	782
1119	Ga0373926_0070960	3300035083	Bacteria	1280
1120	Ga0373926_0263119	3300035083	Bacteria	670
1121	Ga0373926_0351700	3300035083	Bacteria	579
1122	Ga0373928_0016766	3300035084	Bacteria	1501
1123	Ga0373949_0087743	3300035090	Bacteria	837
1124	Ga0373923_0170208	3300035111	Bacteria	997
1125	Ga0373932_0057419	3300035112	Bacteria	1173
1126	Ga0373932_0095872	3300035112	Bacteria	959
1127	Ga0373936_0061312	3300035113	Bacteria	1536
1128	Ga0373936_0553090	3300035113	Bacteria	538
1129	Ga0373939_0016333	3300035114	Bacteria	1956
1130	Ga0373939_0035556	3300035114	Bacteria	1468
1131	Ga0373939_0099735	3300035114	Bacteria	995
1132	Ga0373945_0153069	3300035116	Bacteria	936
1133	Ga0373954_0143371	3300035118	Bacteria	1166
1134	Ga0373956_0028550	3300035119	Bacteria	2429
1135	Ga0373956_0184062	3300035119	Bacteria	988
1136	Ga0373957_0181874	3300035120	Bacteria	872
1137	Ga0373957_0543071	3300035120	Bacteria	508
1138	Ga0373957_0558391	3300035120	Bacteria	501
1139	Ga0373960_0062641	3300035121	Bacteria	1132
1140	Ga0373943_0073153	3300035170	Bacteria	1740
1141	Ga0373943_0103078	3300035170	Bacteria	1495
1142	Ga0373943_0140399	3300035170	Bacteria	1301
1143	Ga0373946_0013812	3300035171	Bacteria	3040
1144	Ga0373946_0272894	3300035171	Bacteria	830
1145	Ga0373955_0131732	3300035172	Bacteria	1460
1146	Ga0373955_0418564	3300035172	Bacteria	815
1147	Ga0373955_0420298	3300035172	Bacteria	813
1148	Ga0373955_0776633	3300035172	Bacteria	589
1149	Ga0373942_0002797	3300035207	Bacteria	4157
1150	Ga0316574_0005140	3300035398	Bacteria	6956
1151	Ga0373924_0013554	3300035410	Bacteria	3064
1152	Ga0373924_0323731	3300035410	Bacteria	686
1153	Ga0373924_0474191	3300035410	Bacteria	562
1154	Ga0373931_0174246	3300035691	Bacteria	1270
1155	Ga0373931_0197133	3300035691	Bacteria	1201
1156	Ga0373931_0237304	3300035691	Bacteria	1104
1157	Ga0373931_0644786	3300035691	Bacteria	695
1158	Ga0373935_0103141	3300035692	Bacteria	1883
1159	Ga0373935_0340799	3300035692	Bacteria	1067
1160	Ga0373935_0427737	3300035692	Bacteria	954
1161	Ga0373935_0608153	3300035692	Bacteria	800
1162	Ga0373935_1171302	3300035692	Bacteria	573
1163	Ga0373927_0188819	3300035695	Bacteria	1352
1164	Ga0373927_0327998	3300035695	Bacteria	1008
1165	Ga0373927_0534798	3300035695	Bacteria	775
1166	Ga0373927_0680548	3300035695	Bacteria	680
1167	Ga0373933_0005271	3300035724	Bacteria	7048
1168	Ga0373933_0475224	3300035724	Bacteria	818
1169	Ga0373933_0865248	3300035724	Bacteria	595
1170	Ga0373947_0040913	3300035725	Bacteria	2762
1171	Ga0373947_0052110	3300035725	Bacteria	2465
1172	Ga0373947_0414895	3300035725	Bacteria	909
1173	Ga0373947_0539617	3300035725	Bacteria	794
1174	Ga0373937_0029266	3300036401	Bacteria	4988
1175	Ga0373937_0103229	3300036401	Bacteria	2648
1176	Ga0373937_0319233	3300036401	Bacteria	1469
1177	Ga0373937_0575640	3300036401	Bacteria	1069
1178	Ga0265778_008224	3300036457	Bacteria	1157
1179	Ga0265778_008747	3300036457	Bacteria	1129
1180	Ga0316584_0100903	3300036712	Bacteria	2161
1181	Ga0373925_0060365	3300037068	Bacteria	2848
1182	Ga0373925_0119479	3300037068	Bacteria	2045
1183	Ga0373925_0415104	3300037068	Bacteria	1099
1184	Ga0373925_0417316	3300037068	Bacteria	1096
1185	Ga0373925_0626228	3300037068	Bacteria	886
1186	Ga0373925_1290813	3300037068	Bacteria	599
1187	Ga0373925_1581246	3300037068	Bacteria	536
1188	Ga0395899_0080705	3300037312	Bacteria	2367
1189	Ga0395900_0364995	3300037418	Bacteria	1415
1190	Ga0395900_0657099	3300037418	Bacteria	984
1191	Ga0395900_0770155	3300037418	Bacteria	892
1192	Ga0395900_1328145	3300037418	Bacteria	633
1193	Ga0395898_0130907	3300037466	Bacteria	2403
1194	Ga0395898_0203092	3300037466	Bacteria	1891
1195	Ga0395898_0597982	3300037466	Bacteria	1046
1196	Ga0395905_1321399	3300037471	Bacteria	625
1197	Ga0436364_0690631	3300037853	Bacteria	788
1198	Ga0436364_1229492	3300037853	Bacteria	572
1199	Ga0395901_0104038	3300038443	Bacteria	2979
1200	Ga0395901_0108247	3300038443	Bacteria	2917
1201	Ga0400483_137186	3300039062	Bacteria	1244
1202	Ga0400483_281905	3300039062	Bacteria	2950
1203	Ga0436365_0127171	3300039437	Bacteria	1969
1204	Ga0436365_0379899	3300039437	Bacteria	1223
1205	Ga0436365_0694739	3300039437	Bacteria	820
1206	Ga0436360_1182681	3300039438	Bacteria	1435
1207	Ga0436361_0066070	3300039447	Bacteria	725
1208	Ga0436361_0407713	3300039447	Bacteria	104420
1209	Ga0436361_1044254	3300039447	Bacteria	512
1210	Ga0436363_0472989	3300039450	Bacteria	533
1211	Ga0436363_1251895	3300039450	Bacteria	758
1212	Ga0439461_0027483	3300041410	Bacteria	1167
1213	Ga0439465_0055961	3300041413	Bacteria	1299
1214	Ga0439465_0060786	3300041413	Bacteria	1252
1215	Ga0439465_0211218	3300041413	Bacteria	709
1216	Ga0439465_0267362	3300041413	Bacteria	635
1217	Ga0451788_11546	3300041442	Bacteria	516
1218	Ga0451790_08269	3300041444	Bacteria	631
1219	Ga0451790_34773	3300041444	Bacteria	764
1220	Ga0451794_40463	3300041446	Bacteria	786
1221	Ga0451791_1101838	3300041451	Bacteria	567
1222	Ga0451795_1642630	3300041456	Bacteria	510
1223	Ga0451803_10912	3300041457	Bacteria	628
1224	Ga0451800_1598156	3300041459	Bacteria	630
1225	Ga0451808_15938	3300041464	Bacteria	535
1226	Ga0451839_0082609	3300041496	Bacteria	660
1227	Ga0451839_0743313	3300041496	Bacteria	509
1228	Ga0451843_0010337	3300041509	Bacteria	836
1229	Ga0451853_3604211	3300041512	Bacteria	662
1230	Ga0439441_082567	3300042001	Bacteria	702
1231	Ga0439445_0033058	3300042004	Bacteria	1350
1232	Ga0439448_0023590	3300042005	Bacteria	1920
1233	Ga0439432_181072	3300042006	Bacteria	614
1234	Ga0439449_0071350	3300042007	Bacteria	1280
1235	Ga0439450_216657	3300042008	Bacteria	515
1236	Ga0439452_118785	3300042010	Bacteria	563
1237	Ga0439456_071137	3300042013	Bacteria	771
1238	Ga0439462_0121496	3300042015	Bacteria	727
1239	Ga0450914_004341	3300042118	Bacteria	1145
1240	Ga0450900_016471	3300042136	Bacteria	1002
1241	Ga0439434_0192810	3300042435	Bacteria	685
1242	Ga0439435_0019796	3300042436	Bacteria	1729
1243	Ga0439435_0098651	3300042436	Bacteria	895
1244	Ga0439444_0058824	3300042437	Bacteria	798
1245	Ga0439444_0086519	3300042437	Bacteria	693
1246	Ga0439459_0074802	3300042438	Bacteria	790
1247	Ga0450916_003234	3300042530	Bacteria	1778
1248	Ga0450893_0039893	3300042532	Bacteria	858
1249	Ga0453683_0404306	3300044673	Bacteria	880
1250	Ga0466965_0062359	3300044683	Bacteria	1865
1251	Ga0466966_0050607	3300044684	Bacteria	2642
1252	Ga0466966_0072934	3300044684	Bacteria	2148
1253	Ga0466966_0381336	3300044684	Bacteria	847
1254	Ga0466963_0085217	3300044694	Bacteria	2145
1255	Ga0466963_1296345	3300044694	Bacteria	511
1256	Ga0453684_1230096	3300044712	Bacteria	785
1257	Ga0466971_0155085	3300044719	Bacteria	1070
1258	Ga0466960_0920339	3300044901	Bacteria	534
1259	Ga0451576_0055322	3300045051	Bacteria	4152
1260	Ga0451576_0259719	3300045051	Bacteria	1815
1261	Ga0451576_0635158	3300045051	Bacteria	1122
1262	Ga0451576_1309926	3300045051	Bacteria	755
1263	Ga0466958_0277112	3300045836	Bacteria	1075
1264	Ga0466967_0148237	3300045976	Bacteria	2190
1265	Ga0466967_0203466	3300045976	Bacteria	1876
1266	Ga0466967_0928017	3300045976	Bacteria	866
1267	Ga0466967_1428441	3300045976	Bacteria	689
1268	Ga0466967_1780395	3300045976	Bacteria	613
1269	Ga0466967_2068944	3300045976	Bacteria	566
1270	Ga0495617_055123	3300046452	Bacteria	1319
1271	Ga0495617_114742	3300046452	Bacteria	870
1272	Ga0495592_0014907	3300046454	Bacteria	5899
1273	Ga0495592_0286787	3300046454	Bacteria	1075
1274	Ga0495592_0424299	3300046454	Bacteria	838
1275	Ga0495603_0018160	3300046455	Bacteria	4255
1276	Ga0495603_0336936	3300046455	Bacteria	865
1277	Ga0495590_0112426	3300046457	Bacteria	972
1278	Ga0495590_0336416	3300046457	Bacteria	572
1279	Ga0495629_0098252	3300046459	Bacteria	2042
1280	Ga0495629_0099600	3300046459	Bacteria	2028
1281	Ga0495629_0411319	3300046459	Bacteria	919
1282	Ga0495638_0250076	3300046460	Bacteria	977
1283	Ga0495638_0320340	3300046460	Bacteria	829
1284	Ga0495651_0024911	3300046462	Bacteria	4655
1285	Ga0495651_0068875	3300046462	Bacteria	2697
1286	Ga0495651_0099555	3300046462	Bacteria	2168
1287	Ga0495653_0002196	3300046463	Bacteria	15433
1288	Ga0495650_0000010	3300046471	Bacteria	645599
1289	Ga0495650_0001875	3300046471	Bacteria	18731
1290	Ga0495580_0005582	3300046472	Bacteria	10367
1291	Ga0495580_0014792	3300046472	Bacteria	5913
1292	Ga0495580_0112799	3300046472	Bacteria	1888
1293	Ga0495580_0441500	3300046472	Bacteria	874
1294	Ga0495582_0016241	3300046473	Bacteria	4078
1295	Ga0495639_0003617	3300046475	Bacteria	6665
1296	Ga0495639_0060930	3300046475	Bacteria	1730
1297	Ga0495639_0128708	3300046475	Bacteria	1211
1298	Ga0495639_0152402	3300046475	Bacteria	1115
1299	Ga0495662_0008503	3300046476	Bacteria	5045
1300	Ga0495662_0123985	3300046476	Bacteria	1269
1301	Ga0495662_0231897	3300046476	Bacteria	910
1302	Ga0495662_0303265	3300046476	Bacteria	786
1303	Ga0495664_0005527	3300046477	Bacteria	6943
1304	Ga0495664_0122119	3300046477	Bacteria	1575
1305	Ga0495664_0297246	3300046477	Bacteria	975
1306	Ga0495664_0579328	3300046477	Bacteria	668
1307	Ga0495664_0907195	3300046477	Bacteria	515
1308	Ga0495585_0470979	3300046492	Bacteria	599
1309	Ga0495594_0060762	3300046499	Bacteria	2090
1310	Ga0495594_0433848	3300046499	Bacteria	747
1311	Ga0495596_0030795	3300046500	Bacteria	2146
1312	Ga0495607_0150408	3300046501	Bacteria	1192
1313	Ga0495606_0054290	3300046507	Bacteria	2595
1314	Ga0495606_0065547	3300046507	Bacteria	2307
1315	Ga0495606_0218993	3300046507	Bacteria	1074
1316	Ga0495608_0004188	3300046511	Bacteria	10337
1317	Ga0495608_0263462	3300046511	Bacteria	1073
1318	Ga0495608_0555526	3300046511	Bacteria	692
1319	Ga0495618_0184469	3300046514	Bacteria	1325
1320	Ga0495618_0589685	3300046514	Bacteria	662
1321	Ga0495628_0004868	3300046516	Bacteria	11820
1322	Ga0495628_0124179	3300046516	Bacteria	1978
1323	Ga0495628_0257527	3300046516	Bacteria	1301
1324	Ga0495628_1220035	3300046516	Bacteria	510
1325	Ga0495630_0010900	3300046517	Bacteria	6565
1326	Ga0495630_0066158	3300046517	Bacteria	2716
1327	Ga0495630_0073990	3300046517	Bacteria	2566
1328	Ga0495630_0198212	3300046517	Bacteria	1532
1329	Ga0495630_0278476	3300046517	Bacteria	1278
1330	Ga0495637_0367097	3300046520	Bacteria	503
1331	Ga0495644_0000153	3300046523	Bacteria	32645
1332	Ga0495648_0122205	3300046524	Bacteria	1397
1333	Ga0495666_0000717	3300046526	Bacteria	15137
1334	Ga0495642_0014031	3300046528	Bacteria	3105
1335	Ga0495652_0031352	3300046529	Bacteria	4655
1336	Ga0495652_0042661	3300046529	Bacteria	3911
1337	Ga0495652_0574996	3300046529	Bacteria	772
1338	Ga0495665_0013279	3300046531	Bacteria	4455
1339	Ga0495665_0166613	3300046531	Bacteria	1148
1340	Ga0495640_0025879	3300046533	Bacteria	4248
1341	Ga0495640_0028932	3300046533	Bacteria	3984
1342	Ga0495640_0134260	3300046533	Bacteria	1600
1343	Ga0495640_0524184	3300046533	Bacteria	720
1344	Ga0495586_0005179	3300046535	Bacteria	6976
1345	Ga0495586_0160359	3300046535	Bacteria	1268
1346	Ga0495586_0324331	3300046535	Bacteria	883
1347	Ga0495586_0527129	3300046535	Bacteria	682
1348	Ga0495587_0014749	3300046536	Bacteria	4894
1349	Ga0495587_0142724	3300046536	Bacteria	1366
1350	Ga0495587_0179567	3300046536	Bacteria	1201
1351	Ga0495587_0220987	3300046536	Bacteria	1068
1352	Ga0495609_0082687	3300046538	Bacteria	1402
1353	Ga0495621_0259099	3300046539	Bacteria	712
1354	Ga0495597_0289678	3300046542	Bacteria	637
1355	Ga0495645_0000464	3300046543	Bacteria	28008
1356	Ga0495645_0004427	3300046543	Bacteria	9593
1357	Ga0495645_0027506	3300046543	Bacteria	4132
1358	Ga0495645_0044776	3300046543	Bacteria	3227
1359	Ga0495645_0047516	3300046543	Bacteria	3127
1360	Ga0495645_0135151	3300046543	Bacteria	1725
1361	Ga0495622_0060296	3300046557	Bacteria	1757
1362	Ga0495622_0063952	3300046557	Bacteria	1702
1363	Ga0495622_0148254	3300046557	Bacteria	1062
1364	Ga0495633_0015801	3300046558	Bacteria	3909
1365	Ga0495667_0007451	3300046559	Bacteria	7419
1366	Ga0495667_0023465	3300046559	Bacteria	4157
1367	Ga0495667_0144434	3300046559	Bacteria	1533
1368	Ga0495667_0298925	3300046559	Bacteria	1020
1369	Ga0495667_0871592	3300046559	Bacteria	553
1370	Ga0495668_0031504	3300046616	Bacteria	2988
1371	Ga0495634_0001003	3300046642	Bacteria	26591
1372	Ga0495634_0071356	3300046642	Bacteria	2287
1373	Ga0495634_0131931	3300046642	Bacteria	1592
1374	Ga0495611_0022345	3300046648	Bacteria	2737
1375	Ga0495625_0003213	3300046660	Bacteria	16576
1376	Ga0495625_0058447	3300046660	Bacteria	2740
1377	Ga0495625_0094145	3300046660	Bacteria	2067
1378	Ga0495625_0127560	3300046660	Bacteria	1726
1379	Ga0495625_0623392	3300046660	Bacteria	645
1380	Ga0495635_0009262	3300046663	Bacteria	6877
1381	Ga0495635_0051293	3300046663	Bacteria	2843
1382	Ga0495635_0074135	3300046663	Bacteria	2331
1383	Ga0495635_0104808	3300046663	Bacteria	1933
1384	Ga0495659_0153265	3300046664	Bacteria	926
1385	Ga0495659_0282138	3300046664	Bacteria	698
1386	Ga0495661_0294039	3300046665	Bacteria	815
1387	Ga0495588_0290681	3300046674	Bacteria	861
1388	Ga0495588_0375971	3300046674	Bacteria	746
1389	Ga0495657_0135846	3300046675	Bacteria	1536
1390	Ga0495657_0152541	3300046675	Bacteria	1434
1391	Ga0495599_0013553	3300046678	Bacteria	5036
1392	Ga0495599_0024256	3300046678	Bacteria	3793
1393	Ga0495599_0307967	3300046678	Bacteria	955
1394	Ga0495599_0362040	3300046678	Bacteria	868
1395	Ga0495599_0404329	3300046678	Bacteria	813
1396	Ga0495623_0059574	3300046679	Bacteria	2397
1397	Ga0495623_0216815	3300046679	Bacteria	1093
1398	Ga0495623_0548726	3300046679	Bacteria	605
1399	Ga0495646_0002919	3300046680	Bacteria	10597
1400	Ga0495646_0065623	3300046680	Bacteria	2149
1401	Ga0495646_0260856	3300046680	Bacteria	926
1402	Ga0495646_0405022	3300046680	Bacteria	709
1403	Ga0495647_0244656	3300046681	Bacteria	797
1404	Ga0495647_0452689	3300046681	Bacteria	594
1405	Ga0495647_0496055	3300046681	Bacteria	568
1406	Ga0495658_0040929	3300046683	Bacteria	2578
1407	Ga0495658_0385660	3300046683	Bacteria	892
1408	Ga0495658_0445835	3300046683	Bacteria	827
1409	Ga0495669_0000560	3300046684	Bacteria	16456
1410	Ga0495669_0000955	3300046684	Bacteria	12075
1411	Ga0495669_0049474	3300046684	Bacteria	1882
1412	Ga0495669_0153858	3300046684	Bacteria	1090
1413	Ga0495669_0251571	3300046684	Bacteria	848
1414	Ga0495613_0013985	3300046689	Bacteria	5957
1415	Ga0495613_0018272	3300046689	Bacteria	5228
1416	Ga0495613_0118911	3300046689	Bacteria	1898
1417	Ga0495613_0203203	3300046689	Bacteria	1396
1418	Ga0495613_0213269	3300046689	Bacteria	1357
1419	Ga0495613_0359996	3300046689	Bacteria	998
1420	Ga0495624_0005609	3300046690	Bacteria	9009
1421	Ga0495670_0143234	3300046691	Bacteria	1251
1422	Ga0495670_0468742	3300046691	Bacteria	683
1423	Ga0495670_0523714	3300046691	Bacteria	644
1424	Ga0495670_0739401	3300046691	Bacteria	537
1425	Ga0495671_0085733	3300046692	Bacteria	1543
1426	Ga0495649_0035764	3300046694	Bacteria	2731
1427	Ga0495649_0133054	3300046694	Bacteria	1312
1428	Ga0495589_0062405	3300046794	Bacteria	1828
1429	Ga0495589_0148553	3300046794	Bacteria	1120
1430	Ga0495589_0260445	3300046794	Bacteria	809
1431	Ga0495600_0026905	3300046809	Bacteria	3715
1432	Ga0495600_0055099	3300046809	Bacteria	2597
1433	Ga0495600_0168531	3300046809	Bacteria	1414
1434	Ga0495600_0223142	3300046809	Bacteria	1205
1435	Ga0495600_0676063	3300046809	Bacteria	622
1436	Ga0495581_0000275	3300047315	Bacteria	24951
1437	Ga0495581_0852529	3300047315	Bacteria	521
1438	Ga0495604_0009860	3300047317	Bacteria	7560
1439	Ga0495604_0037021	3300047317	Bacteria	3844
1440	Ga0495604_0078473	3300047317	Bacteria	2478
1441	Ga0495604_0563502	3300047317	Bacteria	734
1442	Ga0495636_0471893	3300047318	Bacteria	604
1443	Ga0495636_0580376	3300047318	Bacteria	547
1444	Ga0495636_0618448	3300047318	Bacteria	530
1445	Ga0495674_0009564	3300047319	Bacteria	9205
1446	Ga0495674_0088249	3300047319	Bacteria	2653
1447	Ga0495674_0172413	3300047319	Bacteria	1805
1448	Ga0495674_0868776	3300047319	Bacteria	698
1449	Ga0495672_0005628	3300047320	Bacteria	9887
1450	Ga0495672_0016339	3300047320	Bacteria	5006
1451	Ga0495676_0014477	3300047321	Bacteria	7058
1452	Ga0495680_0030110	3300047322	Bacteria	4436
1453	Ga0495680_0167749	3300047322	Bacteria	1591
1454	Ga0495680_0234929	3300047322	Bacteria	1304
1455	Ga0495683_0107492	3300047323	Bacteria	1335
1456	Ga0495675_0011594	3300047444	Bacteria	5534
1457	Ga0495675_0222654	3300047444	Bacteria	1141
1458	Ga0495675_0292982	3300047444	Bacteria	968
1459	Ga0495677_0014034	3300047445	Bacteria	2917
1460	Ga0495677_0151302	3300047445	Bacteria	893
1461	Ga0495679_110233	3300047446	Bacteria	758
1462	Ga0495673_0067331	3300047469	Bacteria	1516
1463	Ga0495673_0253495	3300047469	Bacteria	642
1464	Ga0495681_0067479	3300047470	Bacteria	1630
1465	Ga0495684_0009393	3300047471	Bacteria	7549
1466	Ga0495684_0020605	3300047471	Bacteria	5082
1467	Ga0495684_0037444	3300047471	Bacteria	3720
1468	Ga0495684_0117368	3300047471	Bacteria	2006
1469	Ga0495684_0470667	3300047471	Bacteria	869
1470	Ga0495684_1079947	3300047471	Bacteria	505
1471	Ga0495686_0000545	3300047472	Bacteria	53866
1472	Ga0495686_0008767	3300047472	Bacteria	7371
1473	Ga0495686_0011954	3300047472	Bacteria	6100
1474	Ga0495686_0057787	3300047472	Bacteria	2420
1475	Ga0495686_0275738	3300047472	Bacteria	936
1476	Ga0495686_0434280	3300047472	Bacteria	700
1477	Ga0495686_0468375	3300047472	Bacteria	667
1478	Ga0495686_0487714	3300047472	Bacteria	650
1479	Ga0495593_0094552	3300047673	Bacteria	1537
1480	Ga0495593_0476916	3300047673	Bacteria	625
1481	Ga0495602_0041069	3300048088	Bacteria	4230
1482	Ga0495602_0058858	3300048088	Bacteria	3360
1483	Ga0495602_0130933	3300048088	Bacteria	2001
1484	Ga0495602_0177945	3300048088	Bacteria	1644
1485	Ga0495602_0361057	3300048088	Bacteria	1046
1486	Ga0495602_0683566	3300048088	Bacteria	698
1487	Ga0495614_0006159	3300048089	Bacteria	5391
1488	Ga0495614_0211941	3300048089	Bacteria	879
1489	Ga0495614_0358112	3300048089	Bacteria	681
1490	Ga0495626_0095515	3300048091	Bacteria	1302
1491	Ga0496100_0235804	3300048903	Bacteria	1348
1492	Ga0496100_0405406	3300048903	Bacteria	1039
1493	Ga0496100_0560149	3300048903	Bacteria	885
1494	Ga0496101_0087647	3300048904	Bacteria	2311
1495	Ga0496102_0021206	3300048905	Bacteria	5746
1496	Ga0496102_0348053	3300048905	Bacteria	1395
1497	Ga0496102_0435388	3300048905	Bacteria	1231
1498	Ga0496102_0783600	3300048905	Bacteria	876
1499	Ga0496102_1803233	3300048905	Bacteria	529
1500	Ga0496103_0042709	3300048906	Bacteria	2791
1501	Ga0496103_0504637	3300048906	Bacteria	774
1502	Ga0496104_0000247	3300048907	Bacteria	47765
1503	Ga0496104_0028161	3300048907	Bacteria	5206
1504	Ga0496104_1253303	3300048907	Bacteria	645
1505	Ga0496105_0034025	3300048908	Bacteria	4189
1506	Ga0496106_0033496	3300048909	Bacteria	3833
1507	Ga0496106_0098658	3300048909	Bacteria	2263
1508	Ga0496106_0189693	3300048909	Bacteria	1634
1509	Ga0496106_0436705	3300048909	Bacteria	1052
1510	Ga0496106_0644503	3300048909	Bacteria	847
1511	Ga0496106_1555134	3300048909	Bacteria	508
1512	Ga0496107_0366440	3300048910	Bacteria	1072
1513	Ga0496107_0401064	3300048910	Bacteria	1020
1514	Ga0496107_1051416	3300048910	Unclassified	589
1515	Ga0496108_0000242	3300048911	Bacteria	48793
1516	Ga0496108_0001133	3300048911	Bacteria	20819
1517	Ga0496108_0668368	3300048911	Bacteria	902
1518	Ga0496109_0000120	3300048912	Bacteria	81828
1519	Ga0496109_0000583	3300048912	Bacteria	30510
1520	Ga0496109_0105551	3300048912	Bacteria	2617
1521	Ga0496109_0514664	3300048912	Bacteria	1130
1522	Ga0496109_1086647	3300048912	Bacteria	737
1523	Ga0496110_0000795	3300048913	Bacteria	22036
1524	Ga0496110_0018375	3300048913	Bacteria	5862
1525	Ga0496110_0043591	3300048913	Bacteria	3917
1526	Ga0496110_0542264	3300048913	Bacteria	1057
1527	Ga0496111_0002980	3300048914	Bacteria	10376
1528	Ga0496111_0072224	3300048914	Bacteria	2512
1529	Ga0496111_0336016	3300048914	Bacteria	1118
1530	Ga0496112_0000198	3300048915	Bacteria	39413
1531	Ga0496112_0008550	3300048915	Bacteria	9174
1532	Ga0496112_0035136	3300048915	Bacteria	4879
1533	Ga0496112_0077705	3300048915	Bacteria	3283
1534	Ga0496112_0509096	3300048915	Bacteria	1139
1535	Ga0496113_0000111	3300048916	Bacteria	35094
1536	Ga0496113_0001829	3300048916	Bacteria	12109
1537	Ga0496113_1364611	3300048916	Bacteria	550
1538	Ga0496114_0098572	3300048917	Bacteria	2492
1539	Ga0496114_0411763	3300048917	Bacteria	1197
1540	Ga0496114_0676376	3300048917	Bacteria	906
1541	Ga0496114_0906021	3300048917	Bacteria	763
1542	Ga0496114_1032584	3300048917	Bacteria	706
1543	Ga0496115_0002193	3300048918	Bacteria	13992
1544	Ga0496115_0018551	3300048918	Bacteria	5344
1545	Ga0496115_0717573	3300048918	Bacteria	785
1546	Ga0496115_0758286	3300048918	Bacteria	758
1547	Ga0496117_0190708	3300048920	Bacteria	1168
1548	Ga0496117_0281168	3300048920	Bacteria	891
1549	Ga0496118_0121464	3300048921	Bacteria	1702
1550	Ga0496119_0407077	3300048922	Bacteria	648
1551	Ga0496120_0133304	3300048923	Bacteria	1270
1552	Ga0496121_0091176	3300048924	Bacteria	2380
1553	Ga0496121_0111944	3300048924	Bacteria	2080
1554	Ga0496124_0030584	3300048927	Bacteria	4777
1555	Ga0496124_0297344	3300048927	Bacteria	1168
1556	Ga0496124_0585748	3300048927	Bacteria	729
1557	Ga0496124_0636412	3300048927	Bacteria	687
1558	Ga0496125_0000815	3300048928	Bacteria	50702
1559	Ga0496125_0254919	3300048928	Bacteria	1104
1560	Ga0496126_0000209	3300048929	Bacteria	131440
1561	Ga0496126_0000560	3300048929	Bacteria	71370
1562	Ga0496126_0119659	3300048929	Bacteria	2285
1563	Ga0496126_0271543	3300048929	Bacteria	1407
1564	Ga0496126_0296124	3300048929	Bacteria	1337
1565	Ga0496126_0878236	3300048929	Bacteria	682
1566	Ga0501309_100690	3300049129	Bacteria	501
1567	Ga0501307_005955	3300049162	Bacteria	1301
1568	Ga0495682_0038383	3300049460	Bacteria	1760
1569	Ga0495682_0341369	3300049460	Bacteria	528
1570	Ga0501292_024459	3300049515	Bacteria	991
1571	Ga0501321_066104	3300049537	Bacteria	555
1572	Ga0501323_039560	3300049539	Bacteria	687
1573	Ga0501323_083823	3300049539	Bacteria	524
1574	Ga0501031_0035078	3300049568	Bacteria	3272
1575	Ga0501031_0046811	3300049568	Bacteria	2820
1576	Ga0501031_0125300	3300049568	Bacteria	1678
1577	Ga0501031_0257654	3300049568	Bacteria	1134
1578	Ga0501031_0353385	3300049568	Bacteria	951
1579	Ga0501031_0363505	3300049568	Bacteria	936
1580	Ga0501032_0016127	3300049569	Bacteria	5258
1581	Ga0501032_0064378	3300049569	Bacteria	2454
1582	Ga0501032_0291156	3300049569	Bacteria	1056
1583	Ga0501032_0322594	3300049569	Bacteria	997
1584	Ga0501032_0407962	3300049569	Bacteria	872
1585	Ga0501032_0878978	3300049569	Bacteria	565
1586	Ga0501033_0014522	3300049570	Bacteria	5978
1587	Ga0501033_0020210	3300049570	Bacteria	5033
1588	Ga0501033_0075855	3300049570	Bacteria	2467
1589	Ga0501033_0094339	3300049570	Bacteria	2188
1590	Ga0501033_0129530	3300049570	Bacteria	1828
1591	Ga0501033_0184568	3300049570	Bacteria	1494
1592	Ga0501033_0683427	3300049570	Bacteria	699
1593	Ga0501033_1097647	3300049570	Bacteria	529
1594	Ga0501034_0002663	3300049571	Bacteria	21116
1595	Ga0501034_0009019	3300049571	Bacteria	10475
1596	Ga0501034_0043755	3300049571	Bacteria	4529
1597	Ga0501034_0085750	3300049571	Bacteria	3150
1598	Ga0501034_0105047	3300049571	Bacteria	2817
1599	Ga0501034_0135097	3300049571	Bacteria	2447
1600	Ga0501034_0158436	3300049571	Bacteria	2236
1601	Ga0501034_0284044	3300049571	Bacteria	1594
1602	Ga0501034_0442043	3300049571	Bacteria	1219
1603	Ga0501034_0460689	3300049571	Bacteria	1188
1604	Ga0501034_0529635	3300049571	Bacteria	1089
1605	Ga0501034_0606783	3300049571	Bacteria	999
1606	Ga0501034_0694463	3300049571	Bacteria	916
1607	Ga0501034_0701425	3300049571	Bacteria	910
1608	Ga0501034_0944284	3300049571	Bacteria	748
1609	Ga0501036_0001574	3300049572	Bacteria	17653
1610	Ga0501036_0012008	3300049572	Bacteria	7179
1611	Ga0501036_0180373	3300049572	Bacteria	1778
1612	Ga0501036_0237253	3300049572	Bacteria	1530
1613	Ga0501036_0264289	3300049572	Bacteria	1441
1614	Ga0501036_0276980	3300049572	Bacteria	1404
1615	Ga0501036_0332300	3300049572	Bacteria	1270
1616	Ga0501036_0411357	3300049572	Bacteria	1128
1617	Ga0501036_0469710	3300049572	Bacteria	1047
1618	Ga0501036_0540679	3300049572	Bacteria	968
1619	Ga0501036_0938542	3300049572	Bacteria	709
1620	Ga0501036_1318919	3300049572	Bacteria	586
1621	Ga0501036_1462856	3300049572	Bacteria	553
1622	Ga0501037_0021388	3300049573	Bacteria	4779
1623	Ga0501037_0029947	3300049573	Bacteria	4021
1624	Ga0501037_0032419	3300049573	Bacteria	3858
1625	Ga0501037_0090684	3300049573	Bacteria	2210
1626	Ga0501037_0097996	3300049573	Bacteria	2118
1627	Ga0501037_0168587	3300049573	Bacteria	1558
1628	Ga0501037_0195584	3300049573	Bacteria	1430
1629	Ga0501037_0483718	3300049573	Bacteria	841
1630	Ga0501037_1041466	3300049573	Bacteria	532
1631	Ga0501038_0018024	3300049574	Bacteria	6377
1632	Ga0501038_0021851	3300049574	Bacteria	5738
1633	Ga0501038_0042562	3300049574	Bacteria	3955
1634	Ga0501038_0076553	3300049574	Bacteria	2826
1635	Ga0501038_0110462	3300049574	Bacteria	2278
1636	Ga0501038_0178672	3300049574	Bacteria	1714
1637	Ga0501038_0529838	3300049574	Bacteria	898
1638	Ga0501038_0632612	3300049574	Bacteria	807
1639	Ga0501038_0761638	3300049574	Bacteria	722
1640	Ga0501039_0049376	3300049575	Bacteria	3252
1641	Ga0501039_0091738	3300049575	Bacteria	2368
1642	Ga0501039_0131712	3300049575	Bacteria	1962
1643	Ga0501039_0410598	3300049575	Bacteria	1063
1644	Ga0501039_0484765	3300049575	Bacteria	971
1645	Ga0501039_0700535	3300049575	Bacteria	792
1646	Ga0501039_1262507	3300049575	Bacteria	570
1647	Ga0501040_0179484	3300049576	Bacteria	1501
1648	Ga0501040_0455585	3300049576	Bacteria	921
1649	Ga0501042_0020311	3300049578	Bacteria	4622
1650	Ga0501042_0228234	3300049578	Bacteria	1343
1651	Ga0501042_0264900	3300049578	Bacteria	1241
1652	Ga0501042_0794473	3300049578	Bacteria	689
1653	Ga0501042_0983536	3300049578	Bacteria	615
1654	Ga0501043_0002607	3300049579	Bacteria	15212
1655	Ga0501043_0008954	3300049579	Bacteria	7878
1656	Ga0501043_0041509	3300049579	Bacteria	3614
1657	Ga0501043_0102115	3300049579	Bacteria	2254
1658	Ga0501043_0210752	3300049579	Bacteria	1506
1659	Ga0501043_0479061	3300049579	Bacteria	932
1660	Ga0501043_0692207	3300049579	Bacteria	745
1661	Ga0501046_0000150	3300049580	Bacteria	72900
1662	Ga0501046_0194707	3300049580	Bacteria	1511
1663	Ga0501046_0212171	3300049580	Bacteria	1437
1664	Ga0501046_0329620	3300049580	Bacteria	1111
1665	Ga0501046_0342154	3300049580	Bacteria	1087
1666	Ga0501047_0010030	3300049581	Bacteria	8955
1667	Ga0501047_0023666	3300049581	Bacteria	5896
1668	Ga0501047_0037910	3300049581	Bacteria	4662
1669	Ga0501047_0043641	3300049581	Bacteria	4331
1670	Ga0501047_0072862	3300049581	Bacteria	3306
1671	Ga0501047_0108949	3300049581	Bacteria	2652
1672	Ga0501047_0164561	3300049581	Bacteria	2089
1673	Ga0501047_0283653	3300049581	Bacteria	1500
1674	Ga0501047_0327459	3300049581	Bacteria	1371
1675	Ga0501047_0419925	3300049581	Bacteria	1169
1676	Ga0501047_0527572	3300049581	Bacteria	1006
1677	Ga0501047_0545349	3300049581	Bacteria	984
1678	Ga0501048_0078492	3300049582	Bacteria	2330
1679	Ga0501048_0357007	3300049582	Bacteria	1042
1680	Ga0501048_0507189	3300049582	Bacteria	865
1681	Ga0501048_0995353	3300049582	Bacteria	603
1682	Ga0501067_0054856	3300049583	Bacteria	2208
1683	Ga0501067_0158465	3300049583	Bacteria	1261
1684	Ga0501068_0169317	3300049584	Bacteria	1378
1685	Ga0501068_0230531	3300049584	Bacteria	1178
1686	Ga0501068_0342801	3300049584	Bacteria	960
1687	Ga0501068_0389513	3300049584	Bacteria	898
1688	Ga0501068_0391383	3300049584	Bacteria	896
1689	Ga0501069_0056676	3300049585	Bacteria	2184
1690	Ga0501069_0729300	3300049585	Bacteria	599
1691	Ga0501070_0048130	3300049586	Bacteria	3542
1692	Ga0501070_0057104	3300049586	Bacteria	3235
1693	Ga0501070_0113722	3300049586	Bacteria	2236
1694	Ga0501070_0698012	3300049586	Bacteria	803
1695	Ga0501070_0714016	3300049586	Bacteria	792
1696	Ga0501070_1366893	3300049586	Bacteria	539
1697	Ga0501071_0024683	3300049587	Bacteria	4206
1698	Ga0501071_0976006	3300049587	Bacteria	654
1699	Ga0501072_0174349	3300049588	Bacteria	1716
1700	Ga0501072_0519189	3300049588	Bacteria	942
1701	Ga0501073_0039915	3300049589	Bacteria	3324
1702	Ga0501073_0070655	3300049589	Bacteria	2432
1703	Ga0501073_0084024	3300049589	Bacteria	2215
1704	Ga0501073_0183402	3300049589	Bacteria	1449
1705	Ga0501073_0290830	3300049589	Bacteria	1127
1706	Ga0501073_0400309	3300049589	Bacteria	948
1707	Ga0501073_0512194	3300049589	Bacteria	829
1708	Ga0501073_0702536	3300049589	Bacteria	698
1709	Ga0501073_0932468	3300049589	Bacteria	598
1710	Ga0501074_0146097	3300049590	Bacteria	1691
1711	Ga0501074_0296998	3300049590	Bacteria	1148
1712	Ga0501074_0373567	3300049590	Bacteria	1011
1713	Ga0501074_0380455	3300049590	Bacteria	1001
1714	Ga0501074_0879130	3300049590	Bacteria	631
1715	Ga0501075_0465583	3300049591	Bacteria	964
1716	Ga0501075_1165259	3300049591	Bacteria	585
1717	Ga0501076_0258840	3300049592	Bacteria	1424
1718	Ga0501076_0571639	3300049592	Bacteria	932
1719	Ga0501076_0609350	3300049592	Bacteria	901
1720	Ga0501077_0153818	3300049593	Bacteria	1460
1721	Ga0501077_0267363	3300049593	Bacteria	1088
1722	Ga0501235_109637	3300049669	Bacteria	682
1723	Ga0501238_079361	3300049671	Bacteria	516
1724	Ga0501243_034938	3300049675	Bacteria	869
1725	Ga0501225_0097801	3300049705	Bacteria	855
1726	Ga0501245_136737	3300049708	Bacteria	530
1727	Ga0501079_0096662	3300049741	Bacteria	2290
1728	Ga0501079_0424115	3300049741	Bacteria	1044
1729	Ga0501079_0455725	3300049741	Bacteria	1004
1730	Ga0501079_0804993	3300049741	Bacteria	740
1731	Ga0501079_0883183	3300049741	Bacteria	704
1732	Ga0501079_0894853	3300049741	Bacteria	699
1733	Ga0501079_1434692	3300049741	Bacteria	543
1734	Ga0501080_0043942	3300049742	Bacteria	4160
1735	Ga0501080_0051685	3300049742	Bacteria	3825
1736	Ga0501080_0052843	3300049742	Bacteria	3782
1737	Ga0501080_0220713	3300049742	Bacteria	1735
1738	Ga0501080_0239808	3300049742	Bacteria	1655
1739	Ga0501080_0267426	3300049742	Bacteria	1557
1740	Ga0501080_0295048	3300049742	Bacteria	1471
1741	Ga0501080_0414584	3300049742	Bacteria	1211
1742	Ga0501080_0593730	3300049742	Bacteria	983
1743	Ga0501081_0490394	3300049743	Bacteria	915
1744	Ga0501083_0076712	3300049744	Bacteria	2218
1745	Ga0501083_0099152	3300049744	Bacteria	1922
1746	Ga0501083_0172135	3300049744	Bacteria	1415
1747	Ga0501083_0390713	3300049744	Bacteria	905
1748	Ga0501083_0875508	3300049744	Bacteria	584
1749	Ga0501035_0004418	3300049822	Bacteria	13348
1750	Ga0501035_0004457	3300049822	Bacteria	13282
1751	Ga0501035_0030043	3300049822	Bacteria	4955
1752	Ga0501035_0049398	3300049822	Bacteria	3770
1753	Ga0501035_0050843	3300049822	Bacteria	3713
1754	Ga0501035_0060536	3300049822	Bacteria	3370
1755	Ga0501035_0089711	3300049822	Bacteria	2707
1756	Ga0501035_0106313	3300049822	Bacteria	2460
1757	Ga0501035_0387075	3300049822	Bacteria	1165
1758	Ga0501035_0486314	3300049822	Bacteria	1017
1759	Ga0501035_0769742	3300049822	Bacteria	771
1760	Ga0501035_0784251	3300049822	Bacteria	762
1761	Ga0501044_0013081	3300049823	Bacteria	8981
1762	Ga0501044_0029076	3300049823	Bacteria	5829
1763	Ga0501044_0030360	3300049823	Bacteria	5697
1764	Ga0501044_0047122	3300049823	Bacteria	4459
1765	Ga0501044_0067734	3300049823	Bacteria	3637
1766	Ga0501044_0126631	3300049823	Bacteria	2551
1767	Ga0501044_0133845	3300049823	Bacteria	2471
1768	Ga0501044_0189617	3300049823	Bacteria	2019
1769	Ga0501044_0275721	3300049823	Bacteria	1616
1770	Ga0501044_0280666	3300049823	Bacteria	1599
1771	Ga0501044_0291099	3300049823	Bacteria	1564
1772	Ga0501044_0405905	3300049823	Bacteria	1274
1773	Ga0501044_0435805	3300049823	Bacteria	1219
1774	Ga0501044_0462733	3300049823	Bacteria	1173
1775	Ga0501044_1058572	3300049823	Bacteria	681
1776	Ga0501045_0089628	3300049824	Bacteria	2272
1777	Ga0501045_0227912	3300049824	Bacteria	1387
1778	nmdc:mga03683_33662_c1	3300050489	Bacteria	2070
1779	nmdc:mga03n38_27914_c1	3300050490	Bacteria	2346
1780	nmdc:mga00v17_126638_c1	3300050491	Bacteria	1630
1781	nmdc:mga00v17_59684_c1	3300050491	Bacteria	2341
1782	nmdc:mga0yw44_959046_c1	3300050492	Bacteria	579
1783	nmdc:mga0k408_118591_c1	3300050493	Bacteria	1566
1784	nmdc:mga0k408_24799_c1	3300050493	Bacteria	3393
1785	nmdc:mga06z11_15472_c1	3300050494	Bacteria	3406
1786	nmdc:mga06z11_591317_c1	3300050494	Bacteria	675
1787	nmdc:mga04h51_188112_c1	3300050495	Bacteria	806
1788	nmdc:mga07m45_570077_c1	3300050496	Bacteria	654
1789	nmdc:mga07m45_734887_c1	3300050496	Bacteria	567
1790	nmdc:mga07m45_87006_c1	3300050496	Bacteria	1788
1791	nmdc:mga05p37_17150_c1	3300050507	Bacteria	8737
1792	nmdc:mga05p37_2405_c1	3300050507	Bacteria	21778
1793	nmdc:mga05p37_299549_c1	3300050507	Bacteria	1911
1794	nmdc:mga05p37_56603_c1	3300050507	Bacteria	4828
1795	nmdc:mga0qj67_1102782_c1	3300050509	Bacteria	620
1796	nmdc:mga0qj67_589911_c1	3300050509	Bacteria	889
1797	nmdc:mga06r32_198964_c1	3300050510	Bacteria	1991
1798	nmdc:mga06r32_638577_c1	3300050510	Bacteria	1033
1799	nmdc:mga08y16_2707_c1	3300050511	Bacteria	18190
1800	nmdc:mga08y16_478687_c1	3300050511	Bacteria	1267
1801	nmdc:mga0n895_1621823_c1	3300050512	Bacteria	611
1802	nmdc:mga0n895_21442_c1	3300050512	Bacteria	6042
1803	nmdc:mga0n895_364106_c1	3300050512	Bacteria	1464
1804	nmdc:mga0n895_376417_c1	3300050512	Bacteria	1437
1805	nmdc:mga0n895_401754_c1	3300050512	Bacteria	1386
1806	nmdc:mga0n895_51468_c1	3300050512	Bacteria	4040
1807	nmdc:mga0n895_829859_c1	3300050512	Bacteria	913
1808	nmdc:mga0rr50_1572718_c1	3300050513	Bacteria	555
1809	nmdc:mga0rr50_1883_c1	3300050513	Bacteria	11637
1810	nmdc:mga0rr50_21352_c1	3300050513	Bacteria	4418
1811	nmdc:mga08x19_117656_c1	3300050514	Bacteria	1778
1812	nmdc:mga08x19_553281_c1	3300050514	Bacteria	814
1813	nmdc:mga0a205_111045_c1	3300050515	Bacteria	2640
1814	nmdc:mga0a205_1243756_c1	3300050515	Bacteria	592
1815	nmdc:mga0a205_27065_c1	3300050515	Bacteria	5474
1816	nmdc:mga0a205_3344_c1	3300050515	Bacteria	14292
1817	nmdc:mga0a205_41113_c2	3300050515	Bacteria	2574
1818	nmdc:mga0a205_511527_c1	3300050515	Bacteria	1057
1819	Ga0495601_0095032	3300053077	Bacteria	1921
1820	Ga0495601_0126279	3300053077	Bacteria	1664
1821	Ga0495601_0473228	3300053077	Bacteria	809
1822	Ga0495601_0737399	3300053077	Bacteria	627
1823	Ga0495612_0122438	3300053078	Bacteria	1120
1824	Ga0495595_0030502	3300053084	Bacteria	2419
1825	Ga0495595_0187910	3300053084	Bacteria	1026
1826	Ga0495595_0218359	3300053084	Bacteria	951
1827	Ga0495619_0004075	3300053085	Bacteria	9360
1828	Ga0495619_0029701	3300053085	Bacteria	3534
1829	Ga0495619_0062284	3300053085	Bacteria	2483
1830	Ga0495619_0729861	3300053085	Bacteria	673
1831	Ga0495619_0749776	3300053085	Bacteria	662
1832	Ga0500643_020150	3300053087	Bacteria	2186
1833	Ga0500644_0143428	3300053088	Bacteria	951
1834	Ga0500646_0046194	3300053090	Bacteria	1242
1835	Ga0500651_0000049	3300053093	Bacteria	83361
1836	Ga0500650_0163284	3300053098	Bacteria	1027
1837	Ga0500554_093860	3300053102	Bacteria	999
1838	Ga0500595_000014	3300053119	Bacteria	247996
1839	Ga0500595_022261	3300053119	Bacteria	2247
1840	Ga0500595_035050	3300053119	Bacteria	1656
1841	Ga0500595_124019	3300053119	Bacteria	729
1842	Ga0500655_052835	3300053133	Bacteria	811
1843	Ga0500559_0045933	3300053136	Bacteria	1914
1844	Ga0500559_0240782	3300053136	Bacteria	853
1845	Ga0500559_0406507	3300053136	Bacteria	633
1846	Ga0500573_0000452	3300053140	Bacteria	17648
1847	Ga0500588_0023149	3300053146	Bacteria	1700
1848	Ga0500604_0000294	3300053151	Bacteria	13881
1849	Ga0500616_0036565	3300053153	Bacteria	2665
1850	Ga0500639_120431	3300053163	Bacteria	1261
1851	Ga0500637_0006121	3300053178	Bacteria	5894
1852	Ga0500637_0554652	3300053178	Bacteria	555
1853	Ga0500645_033336	3300053730	Bacteria	1542
1854	Ga0500645_045350	3300053730	Bacteria	1292
1855	Ga0500587_042756	3300053739	Bacteria	653
1856	Ga0501084_0145424	3300054114	Bacteria	1997
1857	Ga0501084_0184188	3300054114	Bacteria	1763
1858	Ga0501084_0186192	3300054114	Bacteria	1752
1859	Ga0501084_0228536	3300054114	Bacteria	1570
1860	Ga0501084_0237084	3300054114	Bacteria	1540
1861	Ga0501084_0412365	3300054114	Bacteria	1142
1862	Ga0500661_005486	3300055283	Bacteria	2368
1863	Ga0587084_046118	3300059477	Bacteria	757
1864	Ga0587093_098151	3300059478	Bacteria	526
1865	Ga0587070_054256	3300059491	Bacteria	810
1866	Ga0587073_0274223	3300059492	Bacteria	539
1867	Ga0587077_001444	3300059493	Bacteria	2552
1868	Ga0587077_001858	3300059493	Bacteria	2381
1869	Ga0587077_002494	3300059493	Bacteria	2191
1870	Ga0587077_110698	3300059493	Bacteria	672
1871	Ga0587077_135272	3300059493	Bacteria	629
1872	Ga0587082_001421	3300059504	Bacteria	2483
1873	Ga0587082_055052	3300059504	Bacteria	770
1874	Ga0587082_063732	3300059504	Bacteria	733
1875	Ga0587083_0067796	3300059505	Bacteria	821
1876	Ga0587085_049557	3300059506	Bacteria	761
1877	Ga0587085_084450	3300059506	Bacteria	645
1878	Ga0587086_009659	3300059507	Bacteria	1152
1879	Ga0587086_015268	3300059507	Bacteria	989
1880	Ga0587088_011507	3300059508	Bacteria	1319
1881	Ga0587089_069881	3300059509	Bacteria	594
1882	Ga0587090_030089	3300059510	Bacteria	903
1883	Ga0587090_030965	3300059510	Bacteria	894
1884	Ga0587090_062357	3300059510	Bacteria	710
1885	Ga0587090_073016	3300059510	Bacteria	674
1886	Ga0587091_046963	3300059511	Bacteria	873
1887	Ga0587091_092469	3300059511	Bacteria	697
1888	Ga0587091_134224	3300059511	Bacteria	614
1889	Ga0587091_153624	3300059511	Bacteria	586
1890	Ga0587092_077817	3300059512	Bacteria	650
1891	Ga0587094_050947	3300059513	Bacteria	701
1892	Ga0587098_013517	3300059604	Bacteria	951
1893	Ga0587098_061363	3300059604	Bacteria	591
1894	Ga0587125_004288	3300059607	Bacteria	1260
1895	Ga0587101_000419	3300059623	Bacteria	2969
1896	Ga0587115_020192	3300059626	Bacteria	922
1897	Ga0587128_042262	3300059630	Bacteria	802
1898	Ga0587128_081736	3300059630	Bacteria	648
1899	Ga0587128_087195	3300059630	Bacteria	635
1900	Ga0587128_103403	3300059630	Bacteria	600
1901	Ga0587130_028005	3300059631	Bacteria	638
1902	Ga0587062_000396	3300059639	Bacteria	2976
1903	Ga0587068_032060	3300059641	Bacteria	916
1904	Ga0587069_026285	3300059642	Bacteria	911
1905	Ga0587069_097738	3300059642	Bacteria	596
1906	Ga0587072_001969	3300059643	Bacteria	2674
1907	Ga0587072_075510	3300059643	Bacteria	719
1908	Ga0587072_124589	3300059643	Bacteria	601
1909	Ga0587075_143785	3300059644	Bacteria	511
1910	Ga0587076_001599	3300059645	Bacteria	2341
1911	Ga0587076_028546	3300059645	Bacteria	974
1912	Ga0587076_038267	3300059645	Bacteria	885
1913	Ga0587076_087727	3300059645	Bacteria	675
1914	Ga0587078_009790	3300059646	Bacteria	1092
1915	Ga0587078_051425	3300059646	Bacteria	605
1916	Ga0587079_065518	3300059647	Bacteria	798
1917	Ga0587105_004150	3300059651	Bacteria	914
1918	Ga0587107_001723	3300059652	Bacteria	1834
1919	Ga0587124_004270	3300059660	Bacteria	1097
1920	Ga0587071_069473	3300060344	Bacteria	764
1921	Ga0587111_0000931	3300060346	Bacteria	3213
1922	Ga0587111_0032299	3300060346	Bacteria	1076
1923	Ga0501082_0181477	3300060353	Bacteria	1831
1924	Ga0501082_0329684	3300060353	Bacteria	1330
1925	Ga0501082_0650201	3300060353	Bacteria	923
1926	Ga0501082_1298774	3300060353	Bacteria	636
1927	Ga0501082_1328419	3300060353	Bacteria	628
1928	Ga0501082_1446147	3300060353	Bacteria	600
1929	Ga0466962_0189993	3300061719	Bacteria	1002
1930	Ga0530510_0154761	3300061734	Bacteria	1694
1931	Ga0530510_0690050	3300061734	Bacteria	778
1932	2643911602	2643221580	Bacteria	3816678
1933	2643963598	2643221591	Bacteria	4397626
1934	2644165880	2643221629	Bacteria	5850260
1935	2644347110	2643221662	Bacteria	5851492
1936	2644410394	2643221674	Bacteria	3919126
1937	2739347282	2738543031	Bacteria	5769731
1938	2842694300	2842694124	Bacteria	4063419
1939	2932403084	2932401849	Bacteria	4262978
1940	Ga0157372_10026761
1941	CNXas_1011685
1942	LJNas_1002616
1943	JGI24740J21852_10036215
1944	JGI24743J22301_10002084
1945	JGI24748J21848_1024664
1946	JGI24749J21850_1016908
1947	JGI24034J26672_10008005
1948	JGI24751J29686_10002130
1949	Ga0006759J45824_1053808
1950	JGI25165J46597_1000961
1951	Ga0007416J51690_1044303
1952	JGI25405J52794_10102733
1953	Ga0058863_10003447
1954	Ga0058863_11669580
1955	Ga0058863_11772365
1956	Ga0058861_11909859
1957	Ga0058860_11998827
1958	Ga0058862_12631473
1959	Ga0058862_12891395
1960	Ga0065704_10208913
1961	Ga0065712_10117849
1962	Ga0065715_10104408
1963	Ga0065707_10304249
1964	Ga0070658_10003455
1965	Ga0070658_10007072
1966	Ga0070658_10012043
1967	Ga0070658_10039203
1968	Ga0070658_10070625
1969	Ga0070658_10236536
1970	Ga0070658_10331954
1971	Ga0070658_10349410
1972	Ga0070658_10392978
1973	Ga0070658_10420259
1974	Ga0070658_10424637
1975	Ga0070658_10690804
1976	Ga0070658_10799525
1977	Ga0070658_10976831
1978	Ga0070676_10509320
1979	Ga0070683_100048913
1980	Ga0070683_100084749
1981	Ga0070683_100409420
1982	Ga0070683_100488018
1983	Ga0070683_101064349
1984	Ga0070683_101643572
1985	Ga0070690_100000550
1986	Ga0070690_100186523
1987	Ga0070670_100716187
1988	Ga0070670_100717091
1989	Ga0070670_100896582
1990	Ga0070670_101878411
1991	Ga0070677_10018326
1992	Ga0068869_100008437
1993	Ga0068869_100048439
1994	Ga0068869_100544084
1995	Ga0070666_10032358
1996	Ga0070680_100187314
1997	Ga0070680_100496078
1998	Ga0070680_100730713
1999	Ga0070680_100747927
2000	Ga0070682_100352429
2001	Ga0070682_102009131
2002	Ga0068868_100011852
2003	Ga0068868_100029525
2004	Ga0068868_100039004
2005	Ga0068868_100125269
2006	Ga0068868_101235521
2007	Ga0070660_100002901
2008	Ga0070660_100009153
2009	Ga0070660_100035951
2010	Ga0070660_100070020
2011	Ga0070660_100099623
2012	Ga0070660_100254384
2013	Ga0070660_100510429
2014	Ga0070660_100698104
2015	Ga0070660_100804488
2016	Ga0070689_100048981
2017	Ga0070689_100378050
2018	Ga0070689_100552827
2019	Ga0070687_100000493
2020	Ga0070687_100385025
2021	Ga0070661_100001887
2022	Ga0070661_100012073
2023	Ga0070661_100066444
2024	Ga0070661_100224559
2025	Ga0070661_100329042
2026	Ga0070661_100337652
2027	Ga0070661_100381304
2028	Ga0070661_100452568
2029	Ga0070661_101559614
2030	Ga0070668_100092896
2031	Ga0070668_100443671
2032	Ga0070669_100537020
2033	Ga0070669_100552897
2034	Ga0070669_100788429
2035	Ga0070675_100004817
2036	Ga0070675_100065182
2037	Ga0070675_100250982
2038	Ga0070675_100560733
2039	Ga0070671_100001676
2040	Ga0070671_100596275
2041	Ga0070671_101138914
2042	Ga0070674_100010705
2043	Ga0070674_100013740
2044	Ga0070674_101825790
2045	Ga0070673_100042360
2046	Ga0070673_100150421
2047	Ga0070673_100194351
2048	Ga0070688_100049229
2049	Ga0070688_100187724
2050	Ga0070659_100001021
2051	Ga0070659_100064943
2052	Ga0070659_100112213
2053	Ga0070659_100122521
2054	Ga0070659_100133943
2055	Ga0070659_100220130
2056	Ga0070667_100048961
2057	Ga0070667_100060575
2058	Ga0070667_100209903
2059	Ga0070667_100962700
2060	Ga0070709_10162337
2061	Ga0070709_10171344
2062	Ga0070709_10217549
2063	Ga0070709_11370311
2064	Ga0070709_11802265
2065	Ga0070714_100026258
2066	Ga0070714_100238649
2067	Ga0070714_100620192
2068	Ga0070714_100909003
2069	Ga0070714_101024054
2070	Ga0070713_100032572
2071	Ga0070713_100094116
2072	Ga0070713_100169884
2073	Ga0070713_100293459
2074	Ga0070713_100667890
2075	Ga0070713_100685033
2076	Ga0070710_10090487
2077	Ga0070710_10388263
2078	Ga0070710_10794174
2079	Ga0070710_10947956
2080	Ga0070701_10005263
2081	Ga0070701_10120492
2082	Ga0070701_10976138
2083	Ga0070711_100371221
2084	Ga0070711_100560270
2085	Ga0070705_100168920
2086	Ga0070705_100773850
2087	Ga0070694_100064353
2088	Ga0070694_100296844
2089	Ga0070694_100429245
2090	Ga0070694_100986492
2091	Ga0070694_101256980
2092	Ga0070708_100039269
2093	Ga0070708_100146273
2094	Ga0070708_100210339
2095	Ga0070708_100241005
2096	Ga0070708_100336255
2097	Ga0070708_100394848
2098	Ga0070708_100574698
2099	Ga0070708_100605913
2100	Ga0070708_100788046
2101	Ga0070663_100019510
2102	Ga0070663_100068174
2103	Ga0070663_100302625
2104	Ga0070663_100618704
2105	Ga0070663_100940248
2106	Ga0070678_100031498
2107	Ga0070678_100053154
2108	Ga0070662_100020616
2109	Ga0070662_100141547
2110	Ga0070662_100559357
2111	Ga0070662_100623001
2112	Ga0070662_100997790
2113	Ga0070681_10045035
2114	Ga0070681_10047402
2115	Ga0070681_10071358
2116	Ga0070681_10452012
2117	Ga0070681_10528668
2118	Ga0070681_10575931
2119	Ga0070681_10813255
2120	Ga0070681_10859594
2121	Ga0068867_100009657
2122	Ga0068867_100074744
2123	Ga0068867_100165226
2124	Ga0068867_101156751
2125	Ga0070685_10001292
2126	Ga0070685_10267156
2127	Ga0070706_100005771
2128	Ga0070706_100063300
2129	Ga0070706_100153275
2130	Ga0070706_100384602
2131	Ga0070706_100924009
2132	Ga0070707_100006596
2133	Ga0070707_100121554
2134	Ga0070707_100350579
2135	Ga0070707_100475779
2136	Ga0070707_100704407
2137	Ga0070707_101879891
2138	Ga0070698_100007447
2139	Ga0070698_100144843
2140	Ga0070698_100941613
2141	Ga0070698_101204297
2142	Ga0070699_100693193
2143	Ga0070699_100726519
2144	Ga0070699_101001394
2145	Ga0070699_101612171
2146	Ga0070679_100001271
2147	Ga0070679_100056981
2148	Ga0070679_100084207
2149	Ga0070679_100124904
2150	Ga0070679_100432620
2151	Ga0070679_100800675
2152	Ga0070679_100955432
2153	Ga0070684_100001423
2154	Ga0070684_100222792
2155	Ga0070684_100299904
2156	Ga0070684_101720697
2157	Ga0070697_100019475
2158	Ga0070697_100111457
2159	Ga0070697_100284757
2160	Ga0070697_100621133
2161	Ga0068853_100000054
2162	Ga0068853_100000888
2163	Ga0068853_100007192
2164	Ga0068853_100051852
2165	Ga0068853_100060862
2166	Ga0068853_100131149
2167	Ga0070672_100347782
2168	Ga0070695_100311703
2169	Ga0070695_100323023
2170	Ga0070696_100285438
2171	Ga0070696_100586910
2172	Ga0070665_100008632
2173	Ga0070665_100023111
2174	Ga0070665_100323781
2175	Ga0070665_100686767
2176	Ga0070665_100826554
2177	Ga0070665_100871077
2178	Ga0070704_100202765
2179	Ga0070704_100253838
2180	Ga0070704_100275487
2181	Ga0070704_100660631
2182	Ga0068855_100000913
2183	Ga0068855_100003825
2184	Ga0068855_100012883
2185	Ga0068855_100034672
2186	Ga0068855_100041514
2187	Ga0068855_100052697
2188	Ga0068855_100075649
2189	Ga0068855_100137813
2190	Ga0068855_100297893
2191	Ga0068855_100579058
2192	Ga0068855_100811955
2193	Ga0068855_100889500
2194	Ga0068855_100917453
2195	Ga0068855_101146993
2196	Ga0070664_100380840
2197	Ga0068857_100001133
2198	Ga0068857_100002221
2199	Ga0068857_100165278
2200	Ga0068857_100364544
2201	Ga0068857_100402067
2202	Ga0068857_100459957
2203	Ga0068854_100000137
2204	Ga0068854_100015237
2205	Ga0068854_100037159
2206	Ga0068854_100159518
2207	Ga0068854_100507191
2208	Ga0068854_101173943
2209	Ga0068856_100033324
2210	Ga0068856_100059597
2211	Ga0068856_100113186
2212	Ga0068856_100230364
2213	Ga0068856_100435995
2214	Ga0068856_100487598
2215	Ga0068856_100531778
2216	Ga0068856_100751022
2217	Ga0068856_100763790
2218	Ga0068856_101078654
2219	Ga0068856_101145674
2220	Ga0068856_101239722
2221	Ga0070702_100034939
2222	Ga0068852_100001223
2223	Ga0068852_100324806
2224	Ga0068852_100338118
2225	Ga0068852_100771106
2226	Ga0068852_100879372
2227	Ga0068852_100947828
2228	Ga0068852_101272828
2229	Ga0068852_102630651
2230	Ga0068859_100225844
2231	Ga0068859_100498027
2232	Ga0068859_100920191
2233	Ga0068864_100428538
2234	Ga0068864_100511155
2235	Ga0068864_100746797
2236	Ga0068864_101117333
2237	Ga0068866_10001380
2238	Ga0068866_11156176
2239	Ga0068866_11233920
2240	Ga0068861_100022311
2241	Ga0068861_100029913
2242	Ga0068861_100168742
2243	Ga0068851_10001352
2244	Ga0068851_10002106
2245	Ga0068851_10047137
2246	Ga0068851_10375773
2247	Ga0068870_10011259
2248	Ga0068863_100055571
2249	Ga0068863_100341844
2250	Ga0068863_100430438
2251	Ga0068863_101054399
2252	Ga0068858_100012099
2253	Ga0068860_100191761
2254	Ga0068860_100204235
2255	Ga0068860_100546302
2256	Ga0068860_101124723
2257	Ga0068862_100010568
2258	Ga0068862_100091660
2259	Ga0068862_100190780
2260	Ga0081455_10009196
2261	Ga0081455_10172900
2262	Ga0081455_10425206
2263	Ga0081455_10741562
2264	Ga0081539_10028584
2265	Ga0070717_10586563
2266	Ga0070717_10608162
2267	Ga0070717_10777698
2268	Ga0070717_11852410
2269	Ga0075368_10166475
2270	Ga0075368_10249714
2271	Ga0075363_100016090
2272	Ga0075363_100108712
2273	Ga0075364_10014487
2274	Ga0075364_10050081
2275	Ga0075432_10384949
2276	Ga0070715_10781796
2277	Ga0070716_100437193
2278	Ga0070716_100517184
2279	Ga0070716_101147029
2280	Ga0070712_100302994
2281	Ga0075367_10042717
2282	Ga0075367_10329217
2283	Ga0075366_10059905
2284	Ga0075366_10519016
2285	Ga0075366_10584840
2286	Ga0097621_100011600
2287	Ga0097621_100349548
2288	Ga0097621_100590092
2289	Ga0097621_100837701
2290	Ga0075370_10032179
2291	Ga0075370_10147741
2292	Ga0075370_10774232
2293	Ga0068871_100001728
2294	Ga0068871_100061643
2295	Ga0068871_100064267
2296	Ga0068871_100375102
2297	Ga0068871_100408469
2298	Ga0068871_100553117
2299	Ga0068871_100795044
2300	Ga0068871_101923231
2301	Ga0068871_102336206
2302	Ga0075428_100080876
2303	Ga0075428_101167886
2304	Ga0075428_101679379
2305	Ga0075430_100544914
2306	Ga0075430_100688232
2307	Ga0075430_101224578
2308	Ga0075431_101182201
2309	Ga0075431_101476040
2310	Ga0075433_10004735
2311	Ga0075433_10030331
2312	Ga0075433_10195568
2313	Ga0075433_10455435
2314	Ga0075434_100002471
2315	Ga0075434_100005131
2316	Ga0075434_100419802
2317	Ga0075434_100504575
2318	Ga0075434_100630547
2319	Ga0068865_100002505
2320	Ga0068865_100118650
2321	Ga0068865_100316868
2322	Ga0068865_100626259
2323	Ga0068865_101441620
2324	Ga0097620_100225847
2325	Ga0097620_100498026
2326	Ga0097620_100920258
2327	Ga0075435_100072955
2328	Ga0075435_100092879
2329	Ga0075435_100340208
2330	Ga0075435_100673136
2331	Ga0099794_10041745
2332	Ga0099794_10206146
2333	Ga0099795_10196185
2334	Ga0105250_10070498
2335	Ga0105250_10522736
2336	Ga0105240_10000001
2337	Ga0105240_10004232
2338	Ga0105240_10012027
2339	Ga0105240_10012782
2340	Ga0105240_10041857
2341	Ga0105240_10045226
2342	Ga0105240_10075852
2343	Ga0105240_10402570
2344	Ga0105240_10697019
2345	Ga0105240_10824383
2346	Ga0105240_11747633
2347	Ga0105240_11841845
2348	Ga0105240_11960776
2349	Ga0105240_11963319
2350	Ga0111539_10011813
2351	Ga0111539_10107940
2352	Ga0111539_10551272
2353	Ga0111539_10570734
2354	Ga0105245_10005029
2355	Ga0105245_10052848
2356	Ga0105245_10341012
2357	Ga0105245_10491286
2358	Ga0105245_10546906
2359	Ga0105245_11010766
2360	Ga0105245_12019337
2361	Ga0105245_12597204
2362	Ga0105245_12730339
2363	Ga0105247_10122895
2364	Ga0105247_10171249
2365	Ga0105247_10881879
2366	Ga0114129_10000247
2367	Ga0114129_10039327
2368	Ga0114129_10052649
2369	Ga0114129_10382542
2370	Ga0105243_10561982
2371	Ga0105243_10591939
2372	Ga0105243_10596504
2373	Ga0105243_11505309
2374	Ga0105243_12640194
2375	Ga0105241_10014226
2376	Ga0105241_10046588
2377	Ga0105241_10254278
2378	Ga0105241_10267122
2379	Ga0105241_10300632
2380	Ga0105241_11260358
2381	Ga0105241_11534906
2382	Ga0105242_10141751
2383	Ga0105242_10170719
2384	Ga0105242_10386016
2385	Ga0105242_10591197
2386	Ga0105242_11505766
2387	Ga0105242_11578243
2388	Ga0105242_11624312
2389	Ga0105242_11681574
2390	Ga0105248_10010035
2391	Ga0105248_10012842
2392	Ga0105248_10013460
2393	Ga0105248_10050861
2394	Ga0105248_10089526
2395	Ga0105248_10239747
2396	Ga0105248_10352931
2397	Ga0105248_10555050
2398	Ga0105248_10939103
2399	Ga0105248_11244912
2400	Ga0105248_11850521
2401	Ga0105237_10004977
2402	Ga0105237_10244594
2403	Ga0105237_10311796
2404	Ga0105237_10456840
2405	Ga0105237_10461571
2406	Ga0105237_10553635
2407	Ga0105237_10771623
2408	Ga0105238_10007986
2409	Ga0105238_10008485
2410	Ga0105238_10033303
2411	Ga0105238_10055969
2412	Ga0105238_10114745
2413	Ga0105238_10178796
2414	Ga0105238_10231731
2415	Ga0105238_10323701
2416	Ga0105238_10362859
2417	Ga0105238_10542197
2418	Ga0105238_10567616
2419	Ga0105238_10908241
2420	Ga0105238_11834780
2421	Ga0105238_12899594
2422	Ga0105249_10394663
2423	Ga0105249_10398019
2424	Ga0105249_11383317
2425	Ga0105249_11508622
2426	Ga0099796_10104506
2427	Ga0105239_10029298
2428	Ga0105239_10079369
2429	Ga0105239_10166189
2430	Ga0105239_10187845
2431	Ga0105239_10217640
2432	Ga0105239_10314636
2433	Ga0105239_10464745
2434	Ga0105239_10472511
2435	Ga0105239_11398633
2436	Ga0105239_12016264
2437	Ga0105246_10002877
2438	Ga0157319_1015912
2439	Ga0157373_10001758
2440	Ga0157373_10429733
2441	Ga0157373_10755990
2442	Ga0157371_10002134
2443	Ga0157371_10059160
2444	Ga0157371_10365430
2445	Ga0157371_10653169
2446	Ga0157370_10011397
2447	Ga0157370_10016524
2448	Ga0157370_10017703
2449	Ga0157370_10017947
2450	Ga0157370_10035941
2451	Ga0157370_10064897
2452	Ga0157370_10072284
2453	Ga0157370_10188750
2454	Ga0157370_10254768
2455	Ga0157370_10396463
2456	Ga0157370_10437923
2457	Ga0157369_10025443
2458	Ga0157369_10036798
2459	Ga0157369_10038081
2460	Ga0157369_10069128
2461	Ga0157369_10196070
2462	Ga0157369_10558670
2463	Ga0157369_10945516
2464	Ga0157369_11175301
2465	Ga0157369_12423096
2466	Ga0157369_12499195
2467	Ga0157374_10014284
2468	Ga0157374_10016453
2469	Ga0157374_10095902
2470	Ga0157374_10335421
2471	Ga0157374_10360747
2472	Ga0157374_10392366
2473	Ga0157374_10422406
2474	Ga0157374_10608516
2475	Ga0157374_10612882
2476	Ga0157374_10925420
2477	Ga0157374_11161995
2478	Ga0157374_11182972
2479	Ga0157374_11854101
2480	Ga0157374_12083644
2481	Ga0157374_12167026
2482	Ga0157378_10007877
2483	Ga0157378_10322508
2484	Ga0157378_11070689
2485	Ga0157378_11769486
2486	Ga0157378_12289723
2487	Ga0157378_12438194
2488	Ga0163162_10023636
2489	Ga0163162_10068979
2490	Ga0163162_10093076
2491	Ga0163162_10132217
2492	Ga0163162_10132864
2493	Ga0163162_10151692
2494	Ga0163162_11502835
2495	Ga0163162_11941598
2496	Ga0163162_12623948
2497	Ga0157372_10002154
2498	Ga0157372_10042345
2499	Ga0157372_10156109
2500	Ga0157372_10160572
2501	Ga0157372_10742027
2502	Ga0157372_10839710
2503	Ga0157372_10873619
2504	Ga0157372_11265508
2505	Ga0157372_11364282
2506	Ga0157372_11682174
2507	Ga0157372_11730349
2508	Ga0157375_10642513
2509	Ga0157375_10755087
2510	Ga0157375_13040509
2511	Ga0163163_10000073
2512	Ga0163163_10001073
2513	Ga0163163_10002310
2514	Ga0163163_10058152
2515	Ga0163163_10524334
2516	Ga0163163_10578718
2517	Ga0157380_10081804
2518	Ga0157380_10105288
2519	Ga0157380_10403746
2520	Ga0157380_10445347
2521	Ga0157380_10562676
2522	Ga0182008_10004904
2523	Ga0182008_10154129
2524	Ga0182008_10786046
2525	Ga0157377_10000768
2526	Ga0157377_10194887
2527	Ga0157377_10247814
2528	Ga0157377_10505820
2529	Ga0157377_11362702
2530	Ga0157379_10005366
2531	Ga0157379_10043144
2532	Ga0157379_10114919
2533	Ga0157379_10117175
2534	Ga0157379_10122599
2535	Ga0157379_10154910
2536	Ga0157379_10206026
2537	Ga0157379_10332538
2538	Ga0157379_10641154
2539	Ga0157379_11214683
2540	Ga0157376_10011446
2541	Ga0157376_10045847
2542	Ga0157376_10151215
2543	Ga0157376_10207100
2544	Ga0157376_10402106
2545	Ga0157376_10735561
2546	Ga0157376_10761630
2547	Ga0157376_11460677
2548	Ga0157376_12653490
2549	Ga0182006_1027623
2550	Ga0182007_10006522
2551	Ga0182005_1169035
2552	Ga0163161_10001969
2553	Ga0163161_10058720
2554	Ga0163161_11699914
2555	Ga0197907_10230926
2556	Ga0197907_10239524
2557	Ga0197907_10967821
2558	Ga0206356_10506683
2559	Ga0206355_1041733
2560	Ga0206355_1092081
2561	Ga0206352_10589522
2562	Ga0206352_11018334
2563	Ga0206352_11268017
2564	Ga0206350_10163808
2565	Ga0206354_10850187
2566	Ga0206353_11708252
2567	Ga0154015_1356153
2568	Ga0213872_10000174
2569	Ga0213876_10106992
2570	Ga0224712_10260588
2571	Ga0224572_1034293
2572	Ga0228598_1001862
2573	Ga0228598_1004988
2574	Ga0228598_1041883
2575	Ga0207672_1005151
2576	Ga0207427_101221
2577	Ga0207427_104861
2578	Ga0209233_1000013
2579	Ga0209233_1000293
2580	Ga0209025_1137514
2581	Ga0209758_1108360
2582	Ga0207697_10002087
2583	Ga0207656_10001058
2584	Ga0207656_10007877
2585	Ga0207656_10030934
2586	Ga0207656_10073458
2587	Ga0207696_1062939
2588	Ga0207653_10045851
2589	Ga0207692_10061624
2590	Ga0207642_10016366
2591	Ga0207710_10464081
2592	Ga0207688_10005204
2593	Ga0207680_10001756
2594	Ga0207680_10193851
2595	Ga0207647_10004803
2596	Ga0207647_10012233
2597	Ga0207647_10300682
2598	Ga0207647_10433414
2599	Ga0207685_10026241
2600	Ga0207685_10412670
2601	Ga0207685_10482692
2602	Ga0207699_10142107
2603	Ga0207699_10394303
2604	Ga0207699_10428454
2605	Ga0207699_10526276
2606	Ga0207699_10626823
2607	Ga0207645_10001180
2608	Ga0207645_10027676
2609	Ga0207645_11069598
2610	Ga0207643_10001067
2611	Ga0207705_10000048
2612	Ga0207705_10003420
2613	Ga0207705_10009158
2614	Ga0207705_10020427
2615	Ga0207705_10035314
2616	Ga0207705_10035805
2617	Ga0207705_10069066
2618	Ga0207705_10071391
2619	Ga0207705_10193195
2620	Ga0207705_10315218
2621	Ga0207705_10409878
2622	Ga0207705_10835416
2623	Ga0207705_11521589
2624	Ga0207684_10047342
2625	Ga0207684_10054281
2626	Ga0207684_10501203
2627	Ga0207654_10088882
2628	Ga0207654_10096796
2629	Ga0207654_10263402
2630	Ga0207654_10461569
2631	Ga0207654_10547427
2632	Ga0207654_10655961
2633	Ga0207707_10074527
2634	Ga0207707_10108640
2635	Ga0207707_10141365
2636	Ga0207707_10156822
2637	Ga0207707_10230470
2638	Ga0207707_10434832
2639	Ga0207707_10484945
2640	Ga0207707_10515789
2641	Ga0207707_10579354
2642	Ga0207707_11271572
2643	Ga0207695_10000001
2644	Ga0207695_10000354
2645	Ga0207695_10040345
2646	Ga0207695_10043881
2647	Ga0207695_10065193
2648	Ga0207695_10145327
2649	Ga0207695_10259669
2650	Ga0207695_10273468
2651	Ga0207695_10458807
2652	Ga0207695_10716883
2653	Ga0207695_10732238
2654	Ga0207695_10792414
2655	Ga0207695_10879630
2656	Ga0207695_10955307
2657	Ga0207695_10991885
2658	Ga0207695_11252770
2659	Ga0207695_11278626
2660	Ga0207671_10108938
2661	Ga0207671_10254384
2662	Ga0207671_10344051
2663	Ga0207671_10388000
2664	Ga0207671_11091765
2665	Ga0207693_10185329
2666	Ga0207663_10095331
2667	Ga0207663_11071044
2668	Ga0207660_10066489
2669	Ga0207660_10155049
2670	Ga0207660_10175969
2671	Ga0207660_10369603
2672	Ga0207660_10641413
2673	Ga0207662_10001544
2674	Ga0207657_10000823
2675	Ga0207657_10004069
2676	Ga0207657_10017050
2677	Ga0207657_10017767
2678	Ga0207657_10044882
2679	Ga0207657_10076211
2680	Ga0207657_10100998
2681	Ga0207657_10181479
2682	Ga0207657_10248015
2683	Ga0207657_10367972
2684	Ga0207649_10001087
2685	Ga0207649_10001226
2686	Ga0207649_10068990
2687	Ga0207649_10093984
2688	Ga0207649_10129618
2689	Ga0207649_10213844
2690	Ga0207649_10265312
2691	Ga0207649_10337743
2692	Ga0207649_10486439
2693	Ga0207649_10515223
2694	Ga0207649_10627675
2695	Ga0207649_11398278
2696	Ga0207652_10026611
2697	Ga0207652_10115125
2698	Ga0207652_10116633
2699	Ga0207652_11453338
2700	Ga0207646_10029900
2701	Ga0207646_10080282
2702	Ga0207646_10255682
2703	Ga0207646_10301972
2704	Ga0207646_10306418
2705	Ga0207646_10378491
2706	Ga0207646_11236185
2707	Ga0207681_10070214
2708	Ga0207681_10321778
2709	Ga0207681_10511162
2710	Ga0207681_10856448
2711	Ga0207681_11255357
2712	Ga0207681_11284402
2713	Ga0207694_10008555
2714	Ga0207694_10010372
2715	Ga0207694_10172425
2716	Ga0207694_10206363
2717	Ga0207694_10257212
2718	Ga0207694_10263055
2719	Ga0207694_10378196
2720	Ga0207694_10417555
2721	Ga0207694_10534575
2722	Ga0207694_10549358
2723	Ga0207694_10803538
2724	Ga0207694_11696344
2725	Ga0207650_10000152
2726	Ga0207650_10044745
2727	Ga0207650_10612383
2728	Ga0207650_11043917
2729	Ga0207659_10003498
2730	Ga0207659_10273630
2731	Ga0207659_10709575
2732	Ga0207687_10087186
2733	Ga0207687_10155570
2734	Ga0207687_10429214
2735	Ga0207687_10625466
2736	Ga0207687_11319066
2737	Ga0207687_11951195
2738	Ga0207700_10003657
2739	Ga0207700_10068069
2740	Ga0207700_10144662
2741	Ga0207700_10209826
2742	Ga0207700_10570143
2743	Ga0207700_11071692
2744	Ga0207700_11193773
2745	Ga0207664_10192934
2746	Ga0207664_10331538
2747	Ga0207664_10667546
2748	Ga0207664_10841805
2749	Ga0207664_11266223
2750	Ga0207664_11669184
2751	Ga0207644_10003335
2752	Ga0207644_10004726
2753	Ga0207644_10078687
2754	Ga0207690_10000628
2755	Ga0207690_10022141
2756	Ga0207690_10078928
2757	Ga0207690_10089309
2758	Ga0207690_10221881
2759	Ga0207690_10294292
2760	Ga0207690_10748401
2761	Ga0207690_11106313
2762	Ga0207690_11186207
2763	Ga0207706_10000740
2764	Ga0207706_10205402
2765	Ga0207706_10535152
2766	Ga0207686_10052073
2767	Ga0207686_10116085
2768	Ga0207686_10327161
2769	Ga0207686_10410104
2770	Ga0207686_10613372
2771	Ga0207686_10766268
2772	Ga0207686_10846148
2773	Ga0207686_10983607
2774	Ga0207709_10007982
2775	Ga0207709_11552380
2776	Ga0207670_10161221
2777	Ga0207670_10218185
2778	Ga0207669_10087780
2779	Ga0207669_10408142
2780	Ga0207704_10014351
2781	Ga0207704_10132650
2782	Ga0207704_10218243
2783	Ga0207704_10472569
2784	Ga0207704_10480673
2785	Ga0207704_10548010
2786	Ga0207665_10220776
2787	Ga0207665_10269521
2788	Ga0207665_10569554
2789	Ga0207665_10630734
2790	Ga0207665_10631231
2791	Ga0207665_11536985
2792	Ga0207691_10000308
2793	Ga0207691_10003340
2794	Ga0207691_11082745
2795	Ga0207711_10003068
2796	Ga0207711_10007764
2797	Ga0207711_10036970
2798	Ga0207711_10039221
2799	Ga0207711_10116524
2800	Ga0207711_10206860
2801	Ga0207711_10388325
2802	Ga0207711_10932239
2803	Ga0207689_10000618
2804	Ga0207689_10013634
2805	Ga0207689_10018614
2806	Ga0207689_10138408
2807	Ga0207689_10442129
2808	Ga0207689_11652591
2809	Ga0207661_10007082
2810	Ga0207661_10058611
2811	Ga0207661_10137272
2812	Ga0207661_10519997
2813	Ga0207661_10712531
2814	Ga0207661_10898149
2815	Ga0207679_10000298
2816	Ga0207679_12145735
2817	Ga0207667_10000647
2818	Ga0207667_10000877
2819	Ga0207667_10008444
2820	Ga0207667_10016311
2821	Ga0207667_10019501
2822	Ga0207667_10108232
2823	Ga0207667_10161727
2824	Ga0207667_10248995
2825	Ga0207667_10330969
2826	Ga0207667_10591694
2827	Ga0207667_11102000
2828	Ga0207667_11111632
2829	Ga0207667_11423224
2830	Ga0207667_11816877
2831	Ga0207667_11940304
2832	Ga0207651_10027205
2833	Ga0207651_10051410
2834	Ga0207651_10201339
2835	Ga0207651_11730477
2836	Ga0207712_10234324
2837	Ga0207712_11032209
2838	Ga0207712_12018615
2839	Ga0207668_10009850
2840	Ga0207668_10079642
2841	Ga0207668_10594988
2842	Ga0207640_10000023
2843	Ga0207640_10016034
2844	Ga0207640_10046887
2845	Ga0207640_10112501
2846	Ga0207640_10350362
2847	Ga0207640_10603775
2848	Ga0207640_11006460
2849	Ga0207658_10003391
2850	Ga0207658_10040041
2851	Ga0207658_10107764
2852	Ga0207658_10403718
2853	Ga0207658_12164924
2854	Ga0207677_10010267
2855	Ga0207677_10028273
2856	Ga0207677_10032062
2857	Ga0207677_10101363
2858	Ga0207677_10305480
2859	Ga0207677_10739836
2860	Ga0207703_10098364
2861	Ga0207703_10124896
2862	Ga0207703_10486385
2863	Ga0207639_10000034
2864	Ga0207639_10003445
2865	Ga0207639_10004515
2866	Ga0207639_10007867
2867	Ga0207639_10029135
2868	Ga0207639_10061199
2869	Ga0207639_10383880
2870	Ga0207639_10794787
2871	Ga0207639_10970613
2872	Ga0207639_11124636
2873	Ga0207678_10001362
2874	Ga0207678_10001665
2875	Ga0207678_10003018
2876	Ga0207678_10004699
2877	Ga0207678_10194692
2878	Ga0207678_10201693
2879	Ga0207678_10395078
2880	Ga0207678_10908299
2881	Ga0207678_10965719
2882	Ga0207678_11171167
2883	Ga0207708_10050429
2884	Ga0207708_10095654
2885	Ga0207702_10067712
2886	Ga0207702_10205972
2887	Ga0207702_10459283
2888	Ga0207702_10481428
2889	Ga0207702_10525092
2890	Ga0207702_10890425
2891	Ga0207702_11025538
2892	Ga0207702_11184927
2893	Ga0207702_11602410
2894	Ga0207702_12316776
2895	Ga0207641_10000052
2896	Ga0207641_10007294
2897	Ga0207641_10151206
2898	Ga0207641_10415102
2899	Ga0207641_10472628
2900	Ga0207648_10003962
2901	Ga0207648_10025631
2902	Ga0207648_10094614
2903	Ga0207648_10108160
2904	Ga0207648_10539524
2905	Ga0207648_11007131
2906	Ga0207648_11267945
2907	Ga0207648_11371945
2908	Ga0207648_11577568
2909	Ga0207676_10000176
2910	Ga0207676_10066704
2911	Ga0207676_10239737
2912	Ga0207676_10457817
2913	Ga0207676_11399043
2914	Ga0207676_11489451
2915	Ga0207674_10000532
2916	Ga0207674_10000561
2917	Ga0207674_10045512
2918	Ga0207674_10070606
2919	Ga0207674_10566971
2920	Ga0207674_12112848
2921	Ga0207675_100005443
2922	Ga0207675_100022568
2923	Ga0207675_100038814
2924	Ga0207675_101620280
2925	Ga0207675_101898116
2926	Ga0207683_10001978
2927	Ga0207683_10144480
2928	Ga0207683_10144767
2929	Ga0207683_10406905
2930	Ga0207683_10522017
2931	Ga0207698_10057598
2932	Ga0207698_10140737
2933	Ga0207698_10443331
2934	Ga0207698_10522792
2935	Ga0207698_10645203
2936	Ga0207698_10786905
2937	Ga0207698_11364796
2938	Ga0207698_11646404
2939	Ga0207698_11819242
2940	Ga0207698_12543446
2941	Ga0207698_12615276
2942	Ga0209983_1009332
2943	Ga0209971_1013953
2944	Ga0209966_1049746
2945	Ga0209813_10348970
2946	Ga0207428_10013294
2947	Ga0268266_10000557
2948	Ga0268266_10001266
2949	Ga0268266_10007930
2950	Ga0268266_10166413
2951	Ga0268266_10178394
2952	Ga0268266_10686342
2953	Ga0268266_10875157
2954	Ga0268265_10090344
2955	Ga0268265_10363638
2956	Ga0268264_10005269
2957	Ga0268264_10111165
2958	Ga0268264_10960467
2959	Ga0265319_1090473
2960	Ga0265318_10008175
2961	Ga0265318_10025073
2962	Ga0265336_10171077
2963	Ga0265338_10069830
2964	Ga0265338_10097304
2965	Ga0265338_10342082
2966	Ga0265324_10063838
2967	Ga0316177_1003034
2968	Ga0316182_1342954
2969	Ga0265762_1019970
2970	Ga0265762_1020374
2971	Ga0265763_1024974
2972	Ga0265768_109684
2973	Ga0265771_1003671
2974	Ga0265760_10012291
2975	Ga0265330_10096766
2976	Ga0265332_10052450
2977	Ga0265332_10065930
2978	Ga0265328_10168491
2979	Ga0265320_10060485
2980	Ga0265325_10000449
2981	Ga0265325_10015728
2982	Ga0265325_10214901
2983	Ga0265329_10014266
2984	Ga0265340_10139581
2985	Ga0265340_10219034
2986	Ga0265340_10235019
2987	Ga0265340_10550110
2988	Ga0265339_10008349
2989	Ga0265339_10013124
2990	Ga0265339_10026466
2991	Ga0265339_10075531
2992	Ga0265339_10081437
2993	Ga0265331_10024618
2994	Ga0265331_10090366
2995	Ga0265331_10096344
2996	Ga0265331_10115490
2997	Ga0265331_10166850
2998	Ga0265316_10011341
2999	Ga0265316_10134898
3000	Ga0265316_10326681
3001	Ga0265316_10954284
3002	Ga0307408_100238133
3003	Ga0265313_10002227
3004	Ga0265313_10041151
3005	Ga0265313_10144455
3006	Ga0307508_10417244
3007	Ga0316575_10086324
3008	Ga0265314_10003075
3009	Ga0265314_10019611
3010	Ga0265314_10031281
3011	Ga0265314_10048943
3012	Ga0265314_10070383
3013	Ga0265314_10116887
3014	Ga0265314_10189304
3015	Ga0265342_10000677
3016	Ga0265342_10507064
3017	Ga0265342_10648456
3018	Ga0316576_10336793
3019	Ga0307516_10028240
3020	Ga0307405_10653065
3021	Ga0307405_11367922
3022	Ga0307413_10576209
3023	Ga0307410_11516442
3024	Ga0307406_10271008
3025	Ga0307406_11259170
3026	Ga0307412_10241524
3027	Ga0307412_10279440
3028	Ga0307412_11531984
3029	Ga0307412_12136839
3030	Ga0307409_101340152
3031	Ga0307416_100113353
3032	Ga0307416_101677692
3033	Ga0307416_101809794
3034	Ga0307414_10122495
3035	Ga0307414_10161264
3036	Ga0307414_10203250
3037	Ga0307414_10219357
3038	Ga0307414_10365082
3039	Ga0307414_10823884
3040	Ga0307414_10882346
3041	Ga0307415_101765117
3042	Ga0316593_10104926
3043	Ga0307510_10168675
3044	Ga0307510_10263936
3045	Ga0307510_10322290
3046	Ga0307510_10432518
3047	Ga0307510_10512279
3048	Ga0316586_1032918
3049	Ga0316588_1169042
3050	Ga0316587_1053619
3051	Ga0316212_1012268
3052	Ga0373930_0031471
3053	Ga0373930_0111830
3054	Ga0373948_0178204
3055	Ga0373950_0106468
3056	Ga0373959_0069928
3057	Ga0373938_0083288
3058	Ga0373926_0070960
3059	Ga0373926_0263119
3060	Ga0373926_0351700
3061	Ga0373928_0016766
3062	Ga0373949_0087743
3063	Ga0373923_0170208
3064	Ga0373932_0057419
3065	Ga0373932_0095872
3066	Ga0373936_0061312
3067	Ga0373936_0553090
3068	Ga0373939_0016333
3069	Ga0373939_0035556
3070	Ga0373939_0099735
3071	Ga0373945_0153069
3072	Ga0373954_0143371
3073	Ga0373956_0028550
3074	Ga0373956_0184062
3075	Ga0373957_0181874
3076	Ga0373957_0543071
3077	Ga0373957_0558391
3078	Ga0373960_0062641
3079	Ga0373943_0073153
3080	Ga0373943_0103078
3081	Ga0373943_0140399
3082	Ga0373946_0013812
3083	Ga0373946_0272894
3084	Ga0373955_0131732
3085	Ga0373955_0418564
3086	Ga0373955_0420298
3087	Ga0373955_0776633
3088	Ga0373942_0002797
3089	Ga0316574_0005140
3090	Ga0373924_0013554
3091	Ga0373924_0323731
3092	Ga0373924_0474191
3093	Ga0373931_0174246
3094	Ga0373931_0197133
3095	Ga0373931_0237304
3096	Ga0373931_0644786
3097	Ga0373935_0103141
3098	Ga0373935_0340799
3099	Ga0373935_0427737
3100	Ga0373935_0608153
3101	Ga0373935_1171302
3102	Ga0373927_0188819
3103	Ga0373927_0327998
3104	Ga0373927_0534798
3105	Ga0373927_0680548
3106	Ga0373933_0005271
3107	Ga0373933_0475224
3108	Ga0373933_0865248
3109	Ga0373947_0040913
3110	Ga0373947_0052110
3111	Ga0373947_0414895
3112	Ga0373947_0539617
3113	Ga0373937_0029266
3114	Ga0373937_0103229
3115	Ga0373937_0319233
3116	Ga0373937_0575640
3117	Ga0265778_008224
3118	Ga0265778_008747
3119	Ga0316584_0100903
3120	Ga0373925_0060365
3121	Ga0373925_0119479
3122	Ga0373925_0415104
3123	Ga0373925_0417316
3124	Ga0373925_0626228
3125	Ga0373925_1290813
3126	Ga0373925_1581246
3127	Ga0395899_0080705
3128	Ga0395900_0364995
3129	Ga0395900_0657099
3130	Ga0395900_0770155
3131	Ga0395900_1328145
3132	Ga0395898_0130907
3133	Ga0395898_0203092
3134	Ga0395898_0597982
3135	Ga0395905_1321399
3136	Ga0436364_0690631
3137	Ga0436364_1229492
3138	Ga0395901_0104038
3139	Ga0395901_0108247
3140	Ga0400483_137186
3141	Ga0400483_281905
3142	Ga0436365_0127171
3143	Ga0436365_0379899
3144	Ga0436365_0694739
3145	Ga0436360_1182681
3146	Ga0436361_0066070
3147	Ga0436361_0407713
3148	Ga0436361_1044254
3149	Ga0436363_0472989
3150	Ga0436363_1251895
3151	Ga0439461_0027483
3152	Ga0439465_0055961
3153	Ga0439465_0060786
3154	Ga0439465_0211218
3155	Ga0439465_0267362
3156	Ga0451788_11546
3157	Ga0451790_08269
3158	Ga0451790_34773
3159	Ga0451794_40463
3160	Ga0451791_1101838
3161	Ga0451795_1642630
3162	Ga0451803_10912
3163	Ga0451800_1598156
3164	Ga0451808_15938
3165	Ga0451839_0082609
3166	Ga0451839_0743313
3167	Ga0451843_0010337
3168	Ga0451853_3604211
3169	Ga0439441_082567
3170	Ga0439445_0033058
3171	Ga0439448_0023590
3172	Ga0439432_181072
3173	Ga0439449_0071350
3174	Ga0439450_216657
3175	Ga0439452_118785
3176	Ga0439456_071137
3177	Ga0439462_0121496
3178	Ga0450914_004341
3179	Ga0450900_016471
3180	Ga0439434_0192810
3181	Ga0439435_0019796
3182	Ga0439435_0098651
3183	Ga0439444_0058824
3184	Ga0439444_0086519
3185	Ga0439459_0074802
3186	Ga0450916_003234
3187	Ga0450893_0039893
3188	Ga0453683_0404306
3189	Ga0466965_0062359
3190	Ga0466966_0050607
3191	Ga0466966_0072934
3192	Ga0466966_0381336
3193	Ga0466963_0085217
3194	Ga0466963_1296345
3195	Ga0453684_1230096
3196	Ga0466971_0155085
3197	Ga0466960_0920339
3198	Ga0451576_0055322
3199	Ga0451576_0259719
3200	Ga0451576_0635158
3201	Ga0451576_1309926
3202	Ga0466958_0277112
3203	Ga0466967_0148237
3204	Ga0466967_0203466
3205	Ga0466967_0928017
3206	Ga0466967_1428441
3207	Ga0466967_1780395
3208	Ga0466967_2068944
3209	Ga0495617_055123
3210	Ga0495617_114742
3211	Ga0495592_0014907
3212	Ga0495592_0286787
3213	Ga0495592_0424299
3214	Ga0495603_0018160
3215	Ga0495603_0336936
3216	Ga0495590_0112426
3217	Ga0495590_0336416
3218	Ga0495629_0098252
3219	Ga0495629_0099600
3220	Ga0495629_0411319
3221	Ga0495638_0250076
3222	Ga0495638_0320340
3223	Ga0495651_0024911
3224	Ga0495651_0068875
3225	Ga0495651_0099555
3226	Ga0495653_0002196
3227	Ga0495650_0000010
3228	Ga0495650_0001875
3229	Ga0495580_0005582
3230	Ga0495580_0014792
3231	Ga0495580_0112799
3232	Ga0495580_0441500
3233	Ga0495582_0016241
3234	Ga0495639_0003617
3235	Ga0495639_0060930
3236	Ga0495639_0128708
3237	Ga0495639_0152402
3238	Ga0495662_0008503
3239	Ga0495662_0123985
3240	Ga0495662_0231897
3241	Ga0495662_0303265
3242	Ga0495664_0005527
3243	Ga0495664_0122119
3244	Ga0495664_0297246
3245	Ga0495664_0579328
3246	Ga0495664_0907195
3247	Ga0495585_0470979
3248	Ga0495594_0060762
3249	Ga0495594_0433848
3250	Ga0495596_0030795
3251	Ga0495607_0150408
3252	Ga0495606_0054290
3253	Ga0495606_0065547
3254	Ga0495606_0218993
3255	Ga0495608_0004188
3256	Ga0495608_0263462
3257	Ga0495608_0555526
3258	Ga0495618_0184469
3259	Ga0495618_0589685
3260	Ga0495628_0004868
3261	Ga0495628_0124179
3262	Ga0495628_0257527
3263	Ga0495628_1220035
3264	Ga0495630_0010900
3265	Ga0495630_0066158
3266	Ga0495630_0073990
3267	Ga0495630_0198212
3268	Ga0495630_0278476
3269	Ga0495637_0367097
3270	Ga0495644_0000153
3271	Ga0495648_0122205
3272	Ga0495666_0000717
3273	Ga0495642_0014031
3274	Ga0495652_0031352
3275	Ga0495652_0042661
3276	Ga0495652_0574996
3277	Ga0495665_0013279
3278	Ga0495665_0166613
3279	Ga0495640_0025879
3280	Ga0495640_0028932
3281	Ga0495640_0134260
3282	Ga0495640_0524184
3283	Ga0495586_0005179
3284	Ga0495586_0160359
3285	Ga0495586_0324331
3286	Ga0495586_0527129
3287	Ga0495587_0014749
3288	Ga0495587_0142724
3289	Ga0495587_0179567
3290	Ga0495587_0220987
3291	Ga0495609_0082687
3292	Ga0495621_0259099
3293	Ga0495597_0289678
3294	Ga0495645_0000464
3295	Ga0495645_0004427
3296	Ga0495645_0027506
3297	Ga0495645_0044776
3298	Ga0495645_0047516
3299	Ga0495645_0135151
3300	Ga0495622_0060296
3301	Ga0495622_0063952
3302	Ga0495622_0148254
3303	Ga0495633_0015801
3304	Ga0495667_0007451
3305	Ga0495667_0023465
3306	Ga0495667_0144434
3307	Ga0495667_0298925
3308	Ga0495667_0871592
3309	Ga0495668_0031504
3310	Ga0495634_0001003
3311	Ga0495634_0071356
3312	Ga0495634_0131931
3313	Ga0495611_0022345
3314	Ga0495625_0003213
3315	Ga0495625_0058447
3316	Ga0495625_0094145
3317	Ga0495625_0127560
3318	Ga0495625_0623392
3319	Ga0495635_0009262
3320	Ga0495635_0051293
3321	Ga0495635_0074135
3322	Ga0495635_0104808
3323	Ga0495659_0153265
3324	Ga0495659_0282138
3325	Ga0495661_0294039
3326	Ga0495588_0290681
3327	Ga0495588_0375971
3328	Ga0495657_0135846
3329	Ga0495657_0152541
3330	Ga0495599_0013553
3331	Ga0495599_0024256
3332	Ga0495599_0307967
3333	Ga0495599_0362040
3334	Ga0495599_0404329
3335	Ga0495623_0059574
3336	Ga0495623_0216815
3337	Ga0495623_0548726
3338	Ga0495646_0002919
3339	Ga0495646_0065623
3340	Ga0495646_0260856
3341	Ga0495646_0405022
3342	Ga0495647_0244656
3343	Ga0495647_0452689
3344	Ga0495647_0496055
3345	Ga0495658_0040929
3346	Ga0495658_0385660
3347	Ga0495658_0445835
3348	Ga0495669_0000560
3349	Ga0495669_0000955
3350	Ga0495669_0049474
3351	Ga0495669_0153858
3352	Ga0495669_0251571
3353	Ga0495613_0013985
3354	Ga0495613_0018272
3355	Ga0495613_0118911
3356	Ga0495613_0203203
3357	Ga0495613_0213269
3358	Ga0495613_0359996
3359	Ga0495624_0005609
3360	Ga0495670_0143234
3361	Ga0495670_0468742
3362	Ga0495670_0523714
3363	Ga0495670_0739401
3364	Ga0495671_0085733
3365	Ga0495649_0035764
3366	Ga0495649_0133054
3367	Ga0495589_0062405
3368	Ga0495589_0148553
3369	Ga0495589_0260445
3370	Ga0495600_0026905
3371	Ga0495600_0055099
3372	Ga0495600_0168531
3373	Ga0495600_0223142
3374	Ga0495600_0676063
3375	Ga0495581_0000275
3376	Ga0495581_0852529
3377	Ga0495604_0009860
3378	Ga0495604_0037021
3379	Ga0495604_0078473
3380	Ga0495604_0563502
3381	Ga0495636_0471893
3382	Ga0495636_0580376
3383	Ga0495636_0618448
3384	Ga0495674_0009564
3385	Ga0495674_0088249
3386	Ga0495674_0172413
3387	Ga0495674_0868776
3388	Ga0495672_0005628
3389	Ga0495672_0016339
3390	Ga0495676_0014477
3391	Ga0495680_0030110
3392	Ga0495680_0167749
3393	Ga0495680_0234929
3394	Ga0495683_0107492
3395	Ga0495675_0011594
3396	Ga0495675_0222654
3397	Ga0495675_0292982
3398	Ga0495677_0014034
3399	Ga0495677_0151302
3400	Ga0495679_110233
3401	Ga0495673_0067331
3402	Ga0495673_0253495
3403	Ga0495681_0067479
3404	Ga0495684_0009393
3405	Ga0495684_0020605
3406	Ga0495684_0037444
3407	Ga0495684_0117368
3408	Ga0495684_0470667
3409	Ga0495684_1079947
3410	Ga0495686_0000545
3411	Ga0495686_0008767
3412	Ga0495686_0011954
3413	Ga0495686_0057787
3414	Ga0495686_0275738
3415	Ga0495686_0434280
3416	Ga0495686_0468375
3417	Ga0495686_0487714
3418	Ga0495593_0094552
3419	Ga0495593_0476916
3420	Ga0495602_0041069
3421	Ga0495602_0058858
3422	Ga0495602_0130933
3423	Ga0495602_0177945
3424	Ga0495602_0361057
3425	Ga0495602_0683566
3426	Ga0495614_0006159
3427	Ga0495614_0211941
3428	Ga0495614_0358112
3429	Ga0495626_0095515
3430	Ga0496100_0235804
3431	Ga0496100_0405406
3432	Ga0496100_0560149
3433	Ga0496101_0087647
3434	Ga0496102_0021206
3435	Ga0496102_0348053
3436	Ga0496102_0435388
3437	Ga0496102_0783600
3438	Ga0496102_1803233
3439	Ga0496103_0042709
3440	Ga0496103_0504637
3441	Ga0496104_0000247
3442	Ga0496104_0028161
3443	Ga0496104_1253303
3444	Ga0496105_0034025
3445	Ga0496106_0033496
3446	Ga0496106_0098658
3447	Ga0496106_0189693
3448	Ga0496106_0436705
3449	Ga0496106_0644503
3450	Ga0496106_1555134
3451	Ga0496107_0366440
3452	Ga0496107_0401064
3453	Ga0496107_1051416
3454	Ga0496108_0000242
3455	Ga0496108_0001133
3456	Ga0496108_0668368
3457	Ga0496109_0000120
3458	Ga0496109_0000583
3459	Ga0496109_0105551
3460	Ga0496109_0514664
3461	Ga0496109_1086647
3462	Ga0496110_0000795
3463	Ga0496110_0018375
3464	Ga0496110_0043591
3465	Ga0496110_0542264
3466	Ga0496111_0002980
3467	Ga0496111_0072224
3468	Ga0496111_0336016
3469	Ga0496112_0000198
3470	Ga0496112_0008550
3471	Ga0496112_0035136
3472	Ga0496112_0077705
3473	Ga0496112_0509096
3474	Ga0496113_0000111
3475	Ga0496113_0001829
3476	Ga0496113_1364611
3477	Ga0496114_0098572
3478	Ga0496114_0411763
3479	Ga0496114_0676376
3480	Ga0496114_0906021
3481	Ga0496114_1032584
3482	Ga0496115_0002193
3483	Ga0496115_0018551
3484	Ga0496115_0717573
3485	Ga0496115_0758286
3486	Ga0496117_0190708
3487	Ga0496117_0281168
3488	Ga0496118_0121464
3489	Ga0496119_0407077
3490	Ga0496120_0133304
3491	Ga0496121_0091176
3492	Ga0496121_0111944
3493	Ga0496124_0030584
3494	Ga0496124_0297344
3495	Ga0496124_0585748
3496	Ga0496124_0636412
3497	Ga0496125_0000815
3498	Ga0496125_0254919
3499	Ga0496126_0000209
3500	Ga0496126_0000560
3501	Ga0496126_0119659
3502	Ga0496126_0271543
3503	Ga0496126_0296124
3504	Ga0496126_0878236
3505	Ga0501309_100690
3506	Ga0501307_005955
3507	Ga0495682_0038383
3508	Ga0495682_0341369
3509	Ga0501292_024459
3510	Ga0501321_066104
3511	Ga0501323_039560
3512	Ga0501323_083823
3513	Ga0501031_0035078
3514	Ga0501031_0046811
3515	Ga0501031_0125300
3516	Ga0501031_0257654
3517	Ga0501031_0353385
3518	Ga0501031_0363505
3519	Ga0501032_0016127
3520	Ga0501032_0064378
3521	Ga0501032_0291156
3522	Ga0501032_0322594
3523	Ga0501032_0407962
3524	Ga0501032_0878978
3525	Ga0501033_0014522
3526	Ga0501033_0020210
3527	Ga0501033_0075855
3528	Ga0501033_0094339
3529	Ga0501033_0129530
3530	Ga0501033_0184568
3531	Ga0501033_0683427
3532	Ga0501033_1097647
3533	Ga0501034_0002663
3534	Ga0501034_0009019
3535	Ga0501034_0043755
3536	Ga0501034_0085750
3537	Ga0501034_0105047
3538	Ga0501034_0135097
3539	Ga0501034_0158436
3540	Ga0501034_0284044
3541	Ga0501034_0442043
3542	Ga0501034_0460689
3543	Ga0501034_0529635
3544	Ga0501034_0606783
3545	Ga0501034_0694463
3546	Ga0501034_0701425
3547	Ga0501034_0944284
3548	Ga0501036_0001574
3549	Ga0501036_0012008
3550	Ga0501036_0180373
3551	Ga0501036_0237253
3552	Ga0501036_0264289
3553	Ga0501036_0276980
3554	Ga0501036_0332300
3555	Ga0501036_0411357
3556	Ga0501036_0469710
3557	Ga0501036_0540679
3558	Ga0501036_0938542
3559	Ga0501036_1318919
3560	Ga0501036_1462856
3561	Ga0501037_0021388
3562	Ga0501037_0029947
3563	Ga0501037_0032419
3564	Ga0501037_0090684
3565	Ga0501037_0097996
3566	Ga0501037_0168587
3567	Ga0501037_0195584
3568	Ga0501037_0483718
3569	Ga0501037_1041466
3570	Ga0501038_0018024
3571	Ga0501038_0021851
3572	Ga0501038_0042562
3573	Ga0501038_0076553
3574	Ga0501038_0110462
3575	Ga0501038_0178672
3576	Ga0501038_0529838
3577	Ga0501038_0632612
3578	Ga0501038_0761638
3579	Ga0501039_0049376
3580	Ga0501039_0091738
3581	Ga0501039_0131712
3582	Ga0501039_0410598
3583	Ga0501039_0484765
3584	Ga0501039_0700535
3585	Ga0501039_1262507
3586	Ga0501040_0179484
3587	Ga0501040_0455585
3588	Ga0501042_0020311
3589	Ga0501042_0228234
3590	Ga0501042_0264900
3591	Ga0501042_0794473
3592	Ga0501042_0983536
3593	Ga0501043_0002607
3594	Ga0501043_0008954
3595	Ga0501043_0041509
3596	Ga0501043_0102115
3597	Ga0501043_0210752
3598	Ga0501043_0479061
3599	Ga0501043_0692207
3600	Ga0501046_0000150
3601	Ga0501046_0194707
3602	Ga0501046_0212171
3603	Ga0501046_0329620
3604	Ga0501046_0342154
3605	Ga0501047_0010030
3606	Ga0501047_0023666
3607	Ga0501047_0037910
3608	Ga0501047_0043641
3609	Ga0501047_0072862
3610	Ga0501047_0108949
3611	Ga0501047_0164561
3612	Ga0501047_0283653
3613	Ga0501047_0327459
3614	Ga0501047_0419925
3615	Ga0501047_0527572
3616	Ga0501047_0545349
3617	Ga0501048_0078492
3618	Ga0501048_0357007
3619	Ga0501048_0507189
3620	Ga0501048_0995353
3621	Ga0501067_0054856
3622	Ga0501067_0158465
3623	Ga0501068_0169317
3624	Ga0501068_0230531
3625	Ga0501068_0342801
3626	Ga0501068_0389513
3627	Ga0501068_0391383
3628	Ga0501069_0056676
3629	Ga0501069_0729300
3630	Ga0501070_0048130
3631	Ga0501070_0057104
3632	Ga0501070_0113722
3633	Ga0501070_0698012
3634	Ga0501070_0714016
3635	Ga0501070_1366893
3636	Ga0501071_0024683
3637	Ga0501071_0976006
3638	Ga0501072_0174349
3639	Ga0501072_0519189
3640	Ga0501073_0039915
3641	Ga0501073_0070655
3642	Ga0501073_0084024
3643	Ga0501073_0183402
3644	Ga0501073_0290830
3645	Ga0501073_0400309
3646	Ga0501073_0512194
3647	Ga0501073_0702536
3648	Ga0501073_0932468
3649	Ga0501074_0146097
3650	Ga0501074_0296998
3651	Ga0501074_0373567
3652	Ga0501074_0380455
3653	Ga0501074_0879130
3654	Ga0501075_0465583
3655	Ga0501075_1165259
3656	Ga0501076_0258840
3657	Ga0501076_0571639
3658	Ga0501076_0609350
3659	Ga0501077_0153818
3660	Ga0501077_0267363
3661	Ga0501235_109637
3662	Ga0501238_079361
3663	Ga0501243_034938
3664	Ga0501225_0097801
3665	Ga0501245_136737
3666	Ga0501079_0096662
3667	Ga0501079_0424115
3668	Ga0501079_0455725
3669	Ga0501079_0804993
3670	Ga0501079_0883183
3671	Ga0501079_0894853
3672	Ga0501079_1434692
3673	Ga0501080_0043942
3674	Ga0501080_0051685
3675	Ga0501080_0052843
3676	Ga0501080_0220713
3677	Ga0501080_0239808
3678	Ga0501080_0267426
3679	Ga0501080_0295048
3680	Ga0501080_0414584
3681	Ga0501080_0593730
3682	Ga0501081_0490394
3683	Ga0501083_0076712
3684	Ga0501083_0099152
3685	Ga0501083_0172135
3686	Ga0501083_0390713
3687	Ga0501083_0875508
3688	Ga0501035_0004418
3689	Ga0501035_0004457
3690	Ga0501035_0030043
3691	Ga0501035_0049398
3692	Ga0501035_0050843
3693	Ga0501035_0060536
3694	Ga0501035_0089711
3695	Ga0501035_0106313
3696	Ga0501035_0387075
3697	Ga0501035_0486314
3698	Ga0501035_0769742
3699	Ga0501035_0784251
3700	Ga0501044_0013081
3701	Ga0501044_0029076
3702	Ga0501044_0030360
3703	Ga0501044_0047122
3704	Ga0501044_0067734
3705	Ga0501044_0126631
3706	Ga0501044_0133845
3707	Ga0501044_0189617
3708	Ga0501044_0275721
3709	Ga0501044_0280666
3710	Ga0501044_0291099
3711	Ga0501044_0405905
3712	Ga0501044_0435805
3713	Ga0501044_0462733
3714	Ga0501044_1058572
3715	Ga0501045_0089628
3716	Ga0501045_0227912
3717	nmdc:mga03683_33662_c1
3718	nmdc:mga03n38_27914_c1
3719	nmdc:mga00v17_126638_c1
3720	nmdc:mga00v17_59684_c1
3721	nmdc:mga0yw44_959046_c1
3722	nmdc:mga0k408_118591_c1
3723	nmdc:mga0k408_24799_c1
3724	nmdc:mga06z11_15472_c1
3725	nmdc:mga06z11_591317_c1
3726	nmdc:mga04h51_188112_c1
3727	nmdc:mga07m45_570077_c1
3728	nmdc:mga07m45_734887_c1
3729	nmdc:mga07m45_87006_c1
3730	nmdc:mga05p37_17150_c1
3731	nmdc:mga05p37_2405_c1
3732	nmdc:mga05p37_299549_c1
3733	nmdc:mga05p37_56603_c1
3734	nmdc:mga0qj67_1102782_c1
3735	nmdc:mga0qj67_589911_c1
3736	nmdc:mga06r32_198964_c1
3737	nmdc:mga06r32_638577_c1
3738	nmdc:mga08y16_2707_c1
3739	nmdc:mga08y16_478687_c1
3740	nmdc:mga0n895_1621823_c1
3741	nmdc:mga0n895_21442_c1
3742	nmdc:mga0n895_364106_c1
3743	nmdc:mga0n895_376417_c1
3744	nmdc:mga0n895_401754_c1
3745	nmdc:mga0n895_51468_c1
3746	nmdc:mga0n895_829859_c1
3747	nmdc:mga0rr50_1572718_c1
3748	nmdc:mga0rr50_1883_c1
3749	nmdc:mga0rr50_21352_c1
3750	nmdc:mga08x19_117656_c1
3751	nmdc:mga08x19_553281_c1
3752	nmdc:mga0a205_111045_c1
3753	nmdc:mga0a205_1243756_c1
3754	nmdc:mga0a205_27065_c1
3755	nmdc:mga0a205_3344_c1
3756	nmdc:mga0a205_41113_c2
3757	nmdc:mga0a205_511527_c1
3758	Ga0495601_0095032
3759	Ga0495601_0126279
3760	Ga0495601_0473228
3761	Ga0495601_0737399
3762	Ga0495612_0122438
3763	Ga0495595_0030502
3764	Ga0495595_0187910
3765	Ga0495595_0218359
3766	Ga0495619_0004075
3767	Ga0495619_0029701
3768	Ga0495619_0062284
3769	Ga0495619_0729861
3770	Ga0495619_0749776
3771	Ga0500643_020150
3772	Ga0500644_0143428
3773	Ga0500646_0046194
3774	Ga0500651_0000049
3775	Ga0500650_0163284
3776	Ga0500554_093860
3777	Ga0500595_000014
3778	Ga0500595_022261
3779	Ga0500595_035050
3780	Ga0500595_124019
3781	Ga0500655_052835
3782	Ga0500559_0045933
3783	Ga0500559_0240782
3784	Ga0500559_0406507
3785	Ga0500573_0000452
3786	Ga0500588_0023149
3787	Ga0500604_0000294
3788	Ga0500616_0036565
3789	Ga0500639_120431
3790	Ga0500637_0006121
3791	Ga0500637_0554652
3792	Ga0500645_033336
3793	Ga0500645_045350
3794	Ga0500587_042756
3795	Ga0501084_0145424
3796	Ga0501084_0184188
3797	Ga0501084_0186192
3798	Ga0501084_0228536
3799	Ga0501084_0237084
3800	Ga0501084_0412365
3801	Ga0500661_005486
3802	Ga0587084_046118
3803	Ga0587093_098151
3804	Ga0587070_054256
3805	Ga0587073_0274223
3806	Ga0587077_001444
3807	Ga0587077_001858
3808	Ga0587077_002494
3809	Ga0587077_110698
3810	Ga0587077_135272
3811	Ga0587082_001421
3812	Ga0587082_055052
3813	Ga0587082_063732
3814	Ga0587083_0067796
3815	Ga0587085_049557
3816	Ga0587085_084450
3817	Ga0587086_009659
3818	Ga0587086_015268
3819	Ga0587088_011507
3820	Ga0587089_069881
3821	Ga0587090_030089
3822	Ga0587090_030965
3823	Ga0587090_062357
3824	Ga0587090_073016
3825	Ga0587091_046963
3826	Ga0587091_092469
3827	Ga0587091_134224
3828	Ga0587091_153624
3829	Ga0587092_077817
3830	Ga0587094_050947
3831	Ga0587098_013517
3832	Ga0587098_061363
3833	Ga0587125_004288
3834	Ga0587101_000419
3835	Ga0587115_020192
3836	Ga0587128_042262
3837	Ga0587128_081736
3838	Ga0587128_087195
3839	Ga0587128_103403
3840	Ga0587130_028005
3841	Ga0587062_000396
3842	Ga0587068_032060
3843	Ga0587069_026285
3844	Ga0587069_097738
3845	Ga0587072_001969
3846	Ga0587072_075510
3847	Ga0587072_124589
3848	Ga0587075_143785
3849	Ga0587076_001599
3850	Ga0587076_028546
3851	Ga0587076_038267
3852	Ga0587076_087727
3853	Ga0587078_009790
3854	Ga0587078_051425
3855	Ga0587079_065518
3856	Ga0587105_004150
3857	Ga0587107_001723
3858	Ga0587124_004270
3859	Ga0587071_069473
3860	Ga0587111_0000931
3861	Ga0587111_0032299
3862	Ga0501082_0181477
3863	Ga0501082_0329684
3864	Ga0501082_0650201
3865	Ga0501082_1298774
3866	Ga0501082_1328419
3867	Ga0501082_1446147
3868	Ga0466962_0189993
3869	Ga0530510_0154761
3870	Ga0530510_0690050
3871	2643911602
3872	2643963598
3873	2644165880
3874	2644347110
3875	2644410394
3876	2739347282
3877	2842694300
3878	2932403084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

31

137

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7mqa-assembly1.cif.gz_L3	cryo-em structure of the human ssu processome, state post-a1	0.9562	3	63
6zqf-assembly1.cif.gz_DS	cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala)	0.9482	3	63
6rbd-assembly1.cif.gz_S	state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles	0.9231	3	64
6rxy-assembly1.cif.gz_Cl	cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state a	0.9207	13	61
6rxz-assembly1.cif.gz_Cl	cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state b	0.9168	13	64

ID	Description	Score	Start	End	Superfamily
af_P54019_1_77_1.10.8.50	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9733	3	63	1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9625	3	63	1.10.8.50
1i94M01	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9613	14	61	1.10.8.50
4ujkT01	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9441	3	63	1.10.8.50
5xyiS01	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9322	1	63	1.10.8.50

ID	Description	Score	Start	End	GO Terms
AF-A0A7C1JM66-F1-model_v4	30S ribosomal protein S13	0.9962	1	60	GO:0003723 GO:0003735 GO:0005840 GO:0006412 GO:1990904
AF-A0A3C1LP09-F1-model_v4	30S ribosomal protein S13	0.9893	1	63	GO:0000731 GO:0003677 GO:0003723 GO:0003735 GO:0005524 GO:0005840 GO:0006261 GO:0006412 GO:0008047 GO:0016887 GO:0017116 GO:1990904
AF-A0A2E2VGD8-F1-model_v4	30S ribosomal protein S13	0.9848	3	63	GO:0003723 GO:0003735 GO:0005840 GO:0006412 GO:1990904
AF-A0A7L4TJ17-F1-model_v4	30S ribosomal protein S13	0.9837	1	59	GO:0003723 GO:0003735 GO:0005829 GO:0006412 GO:0015935
AF-A0A6B0CFM2-F1-model_v4	30S ribosomal protein S13	0.9803	1	60	GO:0000049 GO:0003735 GO:0005840 GO:0006412 GO:1990904

F496105

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

31

137

0.98

Structural Annotation

Top 5 Hits

Map