F496034

General Info

Members Datasets Scaffolds Average Seq Length
1908 672 1869 99

Family's Representative Sequence

Representative Sequence 3300049533|Ga0501317_020993|Ga0501317_020993_407_763
Length 118
Sequence MDNSTDQQTAEKPVGRLARVVDPRDVIIKPVVSEKSYGLIDENNKYTFLVKKTANKTEVKIAVEKIFGVKVTSVNTINRQGKRKRTRTGYGKRADTKRAIVTLSAESKPIEIFGGPAA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
5 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
6 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
7 2643221692 Nocardia sp. Root136 Isolate Unclassified
8 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
9 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
10 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
11 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
12 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
13 2738541305 Nocardioides sp. CF167 Isolate Unclassified
14 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
15 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
16 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
17 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
18 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
19 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
20 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
21 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
22 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
23 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
24 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
25 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
26 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
27 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
28 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
29 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
30 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
31 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
32 2922554459 Rhodococcus sp. 66b Isolate Unclassified
33 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
34 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
35 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
36 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
37 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
38 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
41 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
42 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
49 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
52 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
53 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
54 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
55 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
56 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
57 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
59 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
61 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
94 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
101 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
102 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
103 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
104 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
105 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
106 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
111 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
112 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
113 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
116 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
120 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
121 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
122 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
123 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
124 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
125 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
126 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
130 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
135 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
136 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
137 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
143 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
144 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
149 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
150 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
151 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
152 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
153 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
154 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
156 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
157 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
158 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
159 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
162 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
177 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
178 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
179 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
180 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
181 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
182 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
183 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
184 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
185 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
186 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
187 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
188 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
189 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
190 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
191 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
192 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
193 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
194 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
195 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
196 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
197 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
198 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
199 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
200 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
201 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
202 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
203 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
204 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
205 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
206 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
211 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
212 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
216 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
218 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
219 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
220 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
221 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
289 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
293 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
294 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
295 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
296 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
297 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
298 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
308 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
309 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
310 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
311 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
312 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
313 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
314 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
315 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
316 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
317 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
318 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
319 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
320 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
321 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
322 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
323 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
324 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
325 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
326 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
327 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
328 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
329 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
330 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
331 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
332 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
333 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
334 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
335 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
336 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
337 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
339 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
342 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
343 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
344 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
345 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
346 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
347 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
348 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
349 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
350 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
351 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
352 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
353 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
354 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
355 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
356 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
357 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
358 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
359 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
360 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
361 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
362 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
363 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
364 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
365 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
366 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
367 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
368 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
369 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
370 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
371 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
372 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
373 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
374 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
375 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
376 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
377 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
378 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
379 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
380 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
382 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
383 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
384 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
385 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
386 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
387 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
388 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
389 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
390 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
391 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
392 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
393 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
394 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
395 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
396 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
397 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
398 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
399 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
400 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
401 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
402 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
403 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
404 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
405 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
406 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
407 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
408 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
409 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
410 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
411 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
412 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
413 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
414 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
415 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
416 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
417 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
418 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
419 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
420 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
421 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
422 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
423 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
424 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
425 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
426 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
427 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
428 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
429 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
430 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
431 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
432 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
433 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
434 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
435 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
436 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
437 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
438 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
439 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
440 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
441 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
442 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
443 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
444 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
445 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
446 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
447 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
448 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
449 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
450 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
451 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
452 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
453 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
454 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
455 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
456 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
457 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
458 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
459 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
460 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
461 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
462 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
463 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
464 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
465 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
466 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
467 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
468 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
469 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
470 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
471 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
472 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
473 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
474 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
475 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
476 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
477 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
478 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
479 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
480 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
481 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
482 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
483 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
484 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
485 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
486 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
487 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
488 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
489 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
490 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
491 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
492 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
493 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
494 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
495 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
496 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
497 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
498 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
499 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
500 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
501 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
502 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
503 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
504 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
505 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
506 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
507 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
508 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
509 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
510 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
511 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
512 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
513 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
514 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
515 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
516 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
517 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
518 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
519 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
520 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
521 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
522 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
523 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
524 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
525 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
526 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
527 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
528 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
529 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
530 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
531 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
532 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
533 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
534 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
535 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
546 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
574 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
575 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
576 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
577 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
580 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
581 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
582 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
585 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
586 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
587 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
588 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
589 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
590 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
591 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
592 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
593 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
594 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
595 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
596 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
597 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
600 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
601 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
602 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
603 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
604 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
605 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
606 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
607 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
608 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
609 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
610 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
611 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
612 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
613 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
614 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
615 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
616 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
617 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
618 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
619 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
620 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
621 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
622 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
623 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
624 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
625 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
626 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
627 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
628 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
629 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
630 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
631 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
632 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
643 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
667 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
668 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
669 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
670 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
671 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
672 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.76
Metatranscriptomes 15.2
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 3.3
Nodule 0.05
Rhizoplane 6.76
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 6.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1041427 3300001915 Bacteria 679
2 JGI24752J21851_1048383 3300001976 Bacteria 575
3 JGI24746J21847_1002880 3300001977 Bacteria 2705
4 JGI24746J21847_1009919 3300001977 Bacteria 1414
5 JGI24746J21847_1041178 3300001977 Bacteria 643
6 JGI24747J21853_1045559 3300001978 Bacteria 527
7 JGI24740J21852_10117882 3300001979 Bacteria 666
8 JGI24739J22299_10012134 3300001989 Bacteria 3164
9 JGI24739J22299_10163606 3300001989 Bacteria 656
10 JGI24739J22299_10248070 3300001989 Bacteria 521
11 JGI24737J22298_10236133 3300001990 Bacteria 540
12 JGI24743J22301_10000788 3300001991 Bacteria 3983
13 JGI24743J22301_10003561 3300001991 Bacteria 2475
14 JGI24743J22301_10137210 3300001991 Bacteria 543
15 JGI24735J21928_10007788 3300002067 Bacteria 3482
16 JGI24735J21928_10082229 3300002067 Bacteria 923
17 JGI24735J21928_10099913 3300002067 Bacteria 833
18 JGI24750J21931_1003131 3300002070 Bacteria 1986
19 JGI24745J21846_1000611 3300002073 Bacteria 3214
20 JGI24738J21930_10001633 3300002075 Bacteria 6156
21 JGI24749J21850_1002100 3300002076 Bacteria 2810
22 JGI24744J21845_10001898 3300002077 Bacteria 4211
23 JGI24744J21845_10003031 3300002077 Bacteria 3445
24 JGI24033J26618_1005426 3300002155 Bacteria 1404
25 JGI24034J26672_10089570 3300002239 Bacteria 570
26 JGI24742J22300_10004109 3300002244 Bacteria 2371
27 JGI24742J22300_10028879 3300002244 Bacteria 964
28 JGI24751J29686_10112356 3300002459 Bacteria 571
29 Ga0006778J45830_1040387 3300003162 Bacteria 609
30 Ga0006778J45830_1066604 3300003162 Bacteria 514
31 Ga0006781J51513_1018983 3300003568 Bacteria 528
32 JGI25404J52841_10006168 3300003659 Bacteria 2498
33 Ga0058858_1006047 3300004785 Bacteria 1244
34 Ga0058858_1439419 3300004785 Bacteria 602
35 Ga0058859_10151791 3300004798 Bacteria 1338
36 Ga0058859_11439842 3300004798 Bacteria 666
37 Ga0058859_11825311 3300004798 Bacteria 860
38 Ga0058863_10019893 3300004799 Bacteria 1860
39 Ga0058863_11747712 3300004799 Bacteria 686
40 Ga0058863_11874661 3300004799 Bacteria 1398
41 Ga0058863_11921357 3300004799 Bacteria 2098
42 Ga0058863_11928268 3300004799 Bacteria 687
43 Ga0058861_11782082 3300004800 Bacteria 754
44 Ga0058861_11824709 3300004800 Bacteria 587
45 Ga0058861_11966061 3300004800 Bacteria 823
46 Ga0058861_11989029 3300004800 Bacteria 673
47 Ga0058861_11996887 3300004800 Bacteria 1161
48 Ga0058861_12014623 3300004800 Bacteria 980
49 Ga0058860_10048539 3300004801 Bacteria 753
50 Ga0058860_10054779 3300004801 Bacteria 1578
51 Ga0058860_10101490 3300004801 Bacteria 1938
52 Ga0058860_11752377 3300004801 Bacteria 537
53 Ga0058860_12054507 3300004801 Bacteria 784
54 Ga0058860_12196300 3300004801 Bacteria 582
55 Ga0058862_10207258 3300004803 Bacteria 601
56 Ga0058862_11833495 3300004803 Bacteria 533
57 Ga0058862_12339345 3300004803 Bacteria 508
58 Ga0058862_12600277 3300004803 Bacteria 509
59 Ga0058862_12635954 3300004803 Bacteria 959
60 Ga0058862_12845447 3300004803 Bacteria 513
61 Ga0065714_10151442 3300005288 Bacteria 1104
62 Ga0070658_10001764 3300005327 Bacteria 18213
63 Ga0070658_10022118 3300005327 Bacteria 5100
64 Ga0070658_10042114 3300005327 Bacteria 3686
65 Ga0070658_10048072 3300005327 Bacteria 3453
66 Ga0070658_10220315 3300005327 Bacteria 1604
67 Ga0070658_10514568 3300005327 Bacteria 1034
68 Ga0070658_10670380 3300005327 Bacteria 900
69 Ga0070658_10938244 3300005327 Bacteria 752
70 Ga0070676_11060840 3300005328 Bacteria 611
71 Ga0070683_100045429 3300005329 Bacteria 4053
72 Ga0070683_100080739 3300005329 Bacteria 3044
73 Ga0070683_100221234 3300005329 Bacteria 1799
74 Ga0070683_100327462 3300005329 Bacteria 1458
75 Ga0070683_100470219 3300005329 Bacteria 1200
76 Ga0070683_100659439 3300005329 Bacteria 1002
77 Ga0070683_100688812 3300005329 Bacteria 979
78 Ga0070683_101167355 3300005329 Bacteria 740
79 Ga0070690_100028148 3300005330 Bacteria 3479
80 Ga0070690_100810243 3300005330 Bacteria 727
81 Ga0070670_100546979 3300005331 Bacteria 1033
82 Ga0070670_101067838 3300005331 Bacteria 736
83 Ga0070677_10026178 3300005333 Bacteria 2184
84 Ga0070677_10688200 3300005333 Bacteria 575
85 Ga0068869_100046622 3300005334 Bacteria 3125
86 Ga0068869_100287171 3300005334 Bacteria 1324
87 Ga0068869_100864641 3300005334 Bacteria 781
88 Ga0068869_101189683 3300005334 Bacteria 670
89 Ga0070666_10108142 3300005335 Bacteria 1922
90 Ga0070666_10360117 3300005335 Bacteria 1042
91 Ga0070666_11241050 3300005335 Bacteria 555
92 Ga0070680_100003083 3300005336 Bacteria 12368
93 Ga0070680_100004398 3300005336 Bacteria 10606
94 Ga0070680_100031712 3300005336 Bacteria 4249
95 Ga0070680_100157136 3300005336 Bacteria 1910
96 Ga0070680_100407949 3300005336 Bacteria 1159
97 Ga0070682_100022692 3300005337 Bacteria 3719
98 Ga0070682_100024938 3300005337 Bacteria 3565
99 Ga0070682_100027729 3300005337 Bacteria 3400
100 Ga0070682_100059983 3300005337 Bacteria 2405
101 Ga0070682_100097993 3300005337 Bacteria 1930
102 Ga0070682_100580110 3300005337 Bacteria 882
103 Ga0070682_100948077 3300005337 Bacteria 711
104 Ga0068868_100096107 3300005338 Bacteria 2392
105 Ga0068868_100121089 3300005338 Bacteria 2134
106 Ga0068868_100195353 3300005338 Bacteria 1684
107 Ga0068868_100282852 3300005338 Bacteria 1404
108 Ga0068868_100925326 3300005338 Bacteria 794
109 Ga0070660_100026612 3300005339 Bacteria 4309
110 Ga0070660_100300302 3300005339 Bacteria 1316
111 Ga0070660_100345603 3300005339 Bacteria 1224
112 Ga0070660_100753900 3300005339 Bacteria 817
113 Ga0070660_100914988 3300005339 Bacteria 740
114 Ga0070660_100915340 3300005339 Bacteria 740
115 Ga0070689_100137123 3300005340 Bacteria 1965
116 Ga0070689_100188908 3300005340 Bacteria 1677
117 Ga0070689_100210630 3300005340 Bacteria 1590
118 Ga0070689_100499648 3300005340 Bacteria 1042
119 Ga0070691_10012309 3300005341 Bacteria 3917
120 Ga0070691_10022947 3300005341 Bacteria 2896
121 Ga0070691_10433091 3300005341 Bacteria 747
122 Ga0070691_10813303 3300005341 Bacteria 570
123 Ga0070691_11018754 3300005341 Bacteria 518
124 Ga0070687_100066257 3300005343 Bacteria 1923
125 Ga0070687_100823329 3300005343 Bacteria 659
126 Ga0070687_101381756 3300005343 Bacteria 526
127 Ga0070661_100079586 3300005344 Bacteria 2419
128 Ga0070661_100538813 3300005344 Bacteria 938
129 Ga0070661_100922893 3300005344 Bacteria 721
130 Ga0070661_101259793 3300005344 Bacteria 620
131 Ga0070692_10049505 3300005345 Bacteria 2179
132 Ga0070692_10051941 3300005345 Bacteria 2133
133 Ga0070692_10140201 3300005345 Bacteria 1368
134 Ga0070692_10397584 3300005345 Bacteria 869
135 Ga0070668_100003483 3300005347 Bacteria 11605
136 Ga0070668_100045485 3300005347 Bacteria 3367
137 Ga0070668_100065951 3300005347 Bacteria 2808
138 Ga0070668_100262585 3300005347 Bacteria 1436
139 Ga0070668_100286859 3300005347 Bacteria 1376
140 Ga0070668_100857714 3300005347 Bacteria 810
141 Ga0070669_100224629 3300005353 Bacteria 1486
142 Ga0070669_100327330 3300005353 Bacteria 1239
143 Ga0070669_101928000 3300005353 Bacteria 516
144 Ga0070675_100065082 3300005354 Bacteria 3014
145 Ga0070675_100122668 3300005354 Bacteria 2208
146 Ga0070675_100153185 3300005354 Bacteria 1977
147 Ga0070675_101375582 3300005354 Bacteria 651
148 Ga0070671_100023520 3300005355 Bacteria 5043
149 Ga0070671_100146598 3300005355 Bacteria 1992
150 Ga0070671_101310872 3300005355 Bacteria 639
151 Ga0070674_100053618 3300005356 Bacteria 2785
152 Ga0070674_100081087 3300005356 Bacteria 2318
153 Ga0070674_101301867 3300005356 Bacteria 648
154 Ga0070673_100221043 3300005364 Bacteria 1639
155 Ga0070673_100273384 3300005364 Bacteria 1480
156 Ga0070673_100285095 3300005364 Bacteria 1450
157 Ga0070673_101708814 3300005364 Bacteria 596
158 Ga0070688_100117492 3300005365 Bacteria 1777
159 Ga0070688_100393198 3300005365 Bacteria 1024
160 Ga0070688_100537183 3300005365 Bacteria 887
161 Ga0070688_100737842 3300005365 Bacteria 766
162 Ga0070659_100010814 3300005366 Bacteria 6730
163 Ga0070659_100143201 3300005366 Bacteria 1946
164 Ga0070659_100942734 3300005366 Bacteria 756
165 Ga0070659_101741183 3300005366 Bacteria 558
166 Ga0070659_101830784 3300005366 Bacteria 544
167 Ga0070667_100004217 3300005367 Bacteria 12135
168 Ga0070667_100016592 3300005367 Bacteria 6094
169 Ga0070667_100416970 3300005367 Bacteria 1223
170 Ga0070667_102324235 3300005367 Bacteria 505
171 Ga0070703_10009587 3300005406 Bacteria 2731
172 Ga0070703_10223580 3300005406 Bacteria 751
173 Ga0070703_10500187 3300005406 Bacteria 547
174 Ga0070709_10086222 3300005434 Bacteria 2061
175 Ga0070709_10089315 3300005434 Bacteria 2029
176 Ga0070714_100000013 3300005435 Bacteria 211756
177 Ga0070714_100051110 3300005435 Bacteria 3523
178 Ga0070714_100124276 3300005435 Bacteria 2298
179 Ga0070714_100255466 3300005435 Bacteria 1622
180 Ga0070714_100622362 3300005435 Bacteria 1038
181 Ga0070714_101267338 3300005435 Bacteria 719
182 Ga0070714_101457326 3300005435 Bacteria 669
183 Ga0070714_101848515 3300005435 Bacteria 590
184 Ga0070713_100008336 3300005436 Bacteria 7350
185 Ga0070713_101290112 3300005436 Bacteria 707
186 Ga0070710_10026928 3300005437 Bacteria 3061
187 Ga0070710_10053151 3300005437 Bacteria 2281
188 Ga0070710_10085821 3300005437 Bacteria 1847
189 Ga0070710_10090187 3300005437 Bacteria 1807
190 Ga0070701_10001181 3300005438 Bacteria 9570
191 Ga0070701_10018401 3300005438 Bacteria 3282
192 Ga0070701_10370624 3300005438 Bacteria 900
193 Ga0070701_11178807 3300005438 Bacteria 543
194 Ga0070711_100144299 3300005439 Bacteria 1788
195 Ga0070711_100588687 3300005439 Bacteria 927
196 Ga0070711_101071082 3300005439 Bacteria 694
197 Ga0070711_101164608 3300005439 Bacteria 666
198 Ga0070711_101718225 3300005439 Bacteria 550
199 Ga0070705_100052016 3300005440 Bacteria 2391
200 Ga0070700_100000035 3300005441 Bacteria 112177
201 Ga0070700_100003597 3300005441 Bacteria 8014
202 Ga0070700_100028068 3300005441 Bacteria 3344
203 Ga0070700_100251879 3300005441 Bacteria 1267
204 Ga0070700_100457360 3300005441 Bacteria 973
205 Ga0070700_100647746 3300005441 Bacteria 834
206 Ga0070700_101725410 3300005441 Bacteria 538
207 Ga0070694_100371787 3300005444 Bacteria 1113
208 Ga0070694_100582079 3300005444 Bacteria 899
209 Ga0070708_100138579 3300005445 Bacteria 2255
210 Ga0070708_100141379 3300005445 Bacteria 2232
211 Ga0070708_100964864 3300005445 Bacteria 800
212 Ga0070663_100003713 3300005455 Bacteria 8850
213 Ga0070663_100008045 3300005455 Bacteria 6465
214 Ga0070663_100042970 3300005455 Bacteria 3178
215 Ga0070663_100055306 3300005455 Bacteria 2840
216 Ga0070663_100059928 3300005455 Bacteria 2736
217 Ga0070663_100117821 3300005455 Bacteria 2002
218 Ga0070663_100152220 3300005455 Bacteria 1774
219 Ga0070663_100540144 3300005455 Bacteria 973
220 Ga0070663_100556367 3300005455 Bacteria 959
221 Ga0070678_100123889 3300005456 Bacteria 2042
222 Ga0070678_100139403 3300005456 Bacteria 1938
223 Ga0070678_100149172 3300005456 Bacteria 1881
224 Ga0070678_100495008 3300005456 Bacteria 1078
225 Ga0070678_100697245 3300005456 Bacteria 914
226 Ga0070678_101925076 3300005456 Bacteria 559
227 Ga0070678_102351050 3300005456 Bacteria 506
228 Ga0070662_100041413 3300005457 Bacteria 3286
229 Ga0070662_100092660 3300005457 Bacteria 2271
230 Ga0070662_100702675 3300005457 Bacteria 855
231 Ga0070681_10004293 3300005458 Bacteria 13527
232 Ga0070681_10022551 3300005458 Bacteria 6323
233 Ga0070681_10034186 3300005458 Bacteria 5105
234 Ga0070681_10043340 3300005458 Bacteria 4508
235 Ga0070681_10248490 3300005458 Bacteria 1692
236 Ga0070681_11274041 3300005458 Bacteria 658
237 Ga0070681_12003764 3300005458 Bacteria 507
238 Ga0070681_12033717 3300005458 Bacteria 503
239 Ga0068867_100007380 3300005459 Bacteria 7777
240 Ga0068867_100116417 3300005459 Bacteria 2060
241 Ga0068867_101090292 3300005459 Bacteria 728
242 Ga0068867_101116175 3300005459 Bacteria 721
243 Ga0070685_10026200 3300005466 Bacteria 3212
244 Ga0070685_10031017 3300005466 Bacteria 2983
245 Ga0070685_10202330 3300005466 Bacteria 1292
246 Ga0070685_10465914 3300005466 Bacteria 888
247 Ga0070706_100083112 3300005467 Bacteria 2966
248 Ga0070706_100114177 3300005467 Bacteria 2515
249 Ga0070707_100017376 3300005468 Bacteria 6762
250 Ga0070698_100006774 3300005471 Bacteria 12422
251 Ga0070698_100090705 3300005471 Bacteria 3039
252 Ga0070698_100142295 3300005471 Bacteria 2349
253 Ga0070698_101663035 3300005471 Bacteria 591
254 Ga0070699_100097370 3300005518 Bacteria 2577
255 Ga0070679_100003833 3300005530 Bacteria 13804
256 Ga0070679_100006878 3300005530 Bacteria 10606
257 Ga0070679_100174430 3300005530 Bacteria 2122
258 Ga0070679_100240378 3300005530 Bacteria 1768
259 Ga0070679_100571901 3300005530 Bacteria 1074
260 Ga0070679_100983619 3300005530 Bacteria 788
261 Ga0070679_101169937 3300005530 Bacteria 714
262 Ga0070684_100020206 3300005535 Bacteria 5525
263 Ga0070684_100057591 3300005535 Bacteria 3393
264 Ga0070684_100351512 3300005535 Bacteria 1356
265 Ga0070684_100371632 3300005535 Bacteria 1316
266 Ga0070684_100410385 3300005535 Bacteria 1249
267 Ga0070684_100429706 3300005535 Bacteria 1219
268 Ga0070684_100837851 3300005535 Bacteria 860
269 Ga0070684_101014798 3300005535 Bacteria 779
270 Ga0070684_101995532 3300005535 Bacteria 548
271 Ga0070697_100016947 3300005536 Bacteria 5728
272 Ga0068853_100307169 3300005539 Bacteria 1467
273 Ga0068853_100336667 3300005539 Bacteria 1401
274 Ga0068853_101196776 3300005539 Bacteria 734
275 Ga0070672_100002167 3300005543 Bacteria 12376
276 Ga0070672_100111347 3300005543 Bacteria 2231
277 Ga0070672_100702452 3300005543 Bacteria 886
278 Ga0070686_100071082 3300005544 Bacteria 2277
279 Ga0070686_100819300 3300005544 Bacteria 752
280 Ga0070695_100077745 3300005545 Bacteria 2187
281 Ga0070695_101017329 3300005545 Bacteria 674
282 Ga0070696_100104744 3300005546 Bacteria 2031
283 Ga0070693_100031013 3300005547 Bacteria 2927
284 Ga0070693_100070840 3300005547 Bacteria 2052
285 Ga0070693_100121492 3300005547 Bacteria 1620
286 Ga0070665_100001905 3300005548 Bacteria 23586
287 Ga0070665_100002601 3300005548 Bacteria 19707
288 Ga0070665_100220087 3300005548 Bacteria 1899
289 Ga0070665_100230283 3300005548 Bacteria 1853
290 Ga0070665_100236226 3300005548 Bacteria 1828
291 Ga0070665_100360166 3300005548 Bacteria 1460
292 Ga0070665_100988870 3300005548 Bacteria 854
293 Ga0070665_101956487 3300005548 Bacteria 592
294 Ga0070665_102071605 3300005548 Bacteria 574
295 Ga0070704_100019131 3300005549 Bacteria 4396
296 Ga0070704_100178966 3300005549 Bacteria 1694
297 Ga0068855_100046634 3300005563 Bacteria 5122
298 Ga0068855_100284096 3300005563 Bacteria 1836
299 Ga0068855_100559322 3300005563 Bacteria 1237
300 Ga0070664_100029753 3300005564 Bacteria 4554
301 Ga0070664_100238332 3300005564 Bacteria 1632
302 Ga0070664_100506842 3300005564 Bacteria 1113
303 Ga0068857_100023375 3300005577 Bacteria 5441
304 Ga0068857_100573578 3300005577 Bacteria 1064
305 Ga0068857_101300636 3300005577 Bacteria 706
306 Ga0068854_100024677 3300005578 Bacteria 4119
307 Ga0068854_100056171 3300005578 Bacteria 2837
308 Ga0068854_100178489 3300005578 Bacteria 1657
309 Ga0068854_100905312 3300005578 Bacteria 776
310 Ga0068856_100305559 3300005614 Bacteria 1608
311 Ga0068856_100754456 3300005614 Bacteria 993
312 Ga0068856_100883884 3300005614 Bacteria 912
313 Ga0068856_101904600 3300005614 Bacteria 605
314 Ga0068856_102289352 3300005614 Bacteria 548
315 Ga0068856_102384077 3300005614 Bacteria 537
316 Ga0070702_100010220 3300005615 Bacteria 4615
317 Ga0070702_100094575 3300005615 Bacteria 1820
318 Ga0070702_100116385 3300005615 Bacteria 1666
319 Ga0070702_100365775 3300005615 Bacteria 1021
320 Ga0070702_100480967 3300005615 Bacteria 908
321 Ga0068852_100002721 3300005616 Bacteria 12219
322 Ga0068852_100104920 3300005616 Bacteria 2559
323 Ga0068852_100459632 3300005616 Bacteria 1262
324 Ga0068852_101086978 3300005616 Bacteria 820
325 Ga0068852_101964835 3300005616 Bacteria 607
326 Ga0068859_100962717 3300005617 Bacteria 936
327 Ga0068859_101607613 3300005617 Bacteria 718
328 Ga0068859_101719729 3300005617 Bacteria 693
329 Ga0068859_102396822 3300005617 Bacteria 581
330 Ga0068864_100093687 3300005618 Bacteria 2653
331 Ga0068864_100263876 3300005618 Bacteria 1603
332 Ga0068864_101349881 3300005618 Bacteria 714
333 Ga0068864_101774768 3300005618 Bacteria 622
334 Ga0068866_10006852 3300005718 Bacteria 4757
335 Ga0068866_10029184 3300005718 Bacteria 2636
336 Ga0068866_10064529 3300005718 Bacteria 1912
337 Ga0068861_100035902 3300005719 Bacteria 3675
338 Ga0068861_100802200 3300005719 Bacteria 884
339 Ga0068861_101538927 3300005719 Bacteria 654
340 Ga0068851_10035205 3300005834 Bacteria 2502
341 Ga0068851_10146074 3300005834 Bacteria 1290
342 Ga0068851_10241831 3300005834 Bacteria 1021
343 Ga0068851_10964187 3300005834 Bacteria 537
344 Ga0068870_10000658 3300005840 Bacteria 13168
345 Ga0068870_10006791 3300005840 Bacteria 5071
346 Ga0068870_10336804 3300005840 Bacteria 964
347 Ga0068870_10422386 3300005840 Bacteria 873
348 Ga0068870_11264107 3300005840 Bacteria 537
349 Ga0068870_11333673 3300005840 Bacteria 524
350 Ga0068863_100000497 3300005841 Bacteria 39901
351 Ga0068863_100130459 3300005841 Bacteria 2400
352 Ga0068863_100335344 3300005841 Bacteria 1470
353 Ga0068863_100427239 3300005841 Bacteria 1298
354 Ga0068858_100019674 3300005842 Bacteria 6312
355 Ga0068858_100365377 3300005842 Bacteria 1383
356 Ga0068858_100365427 3300005842 Bacteria 1383
357 Ga0068858_101474206 3300005842 Bacteria 671
358 Ga0068858_101691493 3300005842 Bacteria 625
359 Ga0068858_101987275 3300005842 Bacteria 575
360 Ga0068860_100000054 3300005843 Bacteria 206114
361 Ga0068860_100138668 3300005843 Bacteria 2336
362 Ga0068860_100193897 3300005843 Bacteria 1966
363 Ga0068860_100616459 3300005843 Bacteria 1091
364 Ga0068860_102779239 3300005843 Bacteria 507
365 Ga0068862_100437710 3300005844 Bacteria 1230
366 Ga0068862_100760369 3300005844 Bacteria 943
367 Ga0068862_100858963 3300005844 Bacteria 890
368 Ga0068862_101531011 3300005844 Bacteria 673
369 Ga0081455_10730822 3300005937 Bacteria 628
370 Ga0081540_1000341 3300005983 Bacteria 47794
371 Ga0070717_10250533 3300006028 Bacteria 1564
372 Ga0070717_10311589 3300006028 Bacteria 1401
373 Ga0075365_10047376 3300006038 Bacteria 2825
374 Ga0075365_10753603 3300006038 Bacteria 687
375 Ga0075363_100000106 3300006048 Bacteria 18994
376 Ga0075363_100016799 3300006048 Bacteria 3618
377 Ga0075363_100049887 3300006048 Bacteria 2229
378 Ga0075363_100135479 3300006048 Bacteria 1384
379 Ga0075363_100442769 3300006048 Bacteria 767
380 Ga0075364_10000119 3300006051 Bacteria 32513
381 Ga0075364_10002085 3300006051 Bacteria 11167
382 Ga0075364_10031775 3300006051 Bacteria 3391
383 Ga0075364_10538181 3300006051 Bacteria 798
384 Ga0075432_10177871 3300006058 Bacteria 831
385 Ga0070715_10017201 3300006163 Bacteria 2733
386 Ga0070715_10084272 3300006163 Bacteria 1449
387 Ga0070712_100060728 3300006175 Bacteria 2667
388 Ga0070712_100411945 3300006175 Bacteria 1118
389 Ga0070712_100609953 3300006175 Bacteria 924
390 Ga0070712_101662177 3300006175 Bacteria 559
391 Ga0075362_10467932 3300006177 Bacteria 642
392 Ga0075367_10604860 3300006178 Bacteria 697
393 Ga0075369_10000768 3300006186 Bacteria 10476
394 Ga0075369_10006299 3300006186 Bacteria 4480
395 Ga0075369_10499827 3300006186 Bacteria 578
396 Ga0097621_100099184 3300006237 Bacteria 2448
397 Ga0097621_100388372 3300006237 Bacteria 1248
398 Ga0097621_100996674 3300006237 Bacteria 783
399 Ga0097621_101044536 3300006237 Bacteria 765
400 Ga0075370_10001554 3300006353 Bacteria 10055
401 Ga0075370_10014981 3300006353 Bacteria 4143
402 Ga0075370_10137124 3300006353 Bacteria 1430
403 Ga0075370_10274662 3300006353 Bacteria 1001
404 Ga0075370_10407942 3300006353 Bacteria 815
405 Ga0075370_10629295 3300006353 Bacteria 651
406 Ga0068871_100065721 3300006358 Bacteria 2971
407 Ga0068871_100918334 3300006358 Bacteria 812
408 Ga0068871_101138532 3300006358 Bacteria 730
409 Ga0068871_101296728 3300006358 Bacteria 685
410 Ga0075433_10233530 3300006852 Bacteria 1633
411 Ga0075434_100205355 3300006871 Bacteria 1990
412 Ga0075434_101355643 3300006871 Bacteria 722
413 Ga0068865_100006802 3300006881 Bacteria 7000
414 Ga0068865_100742020 3300006881 Bacteria 842
415 Ga0068865_101238618 3300006881 Bacteria 661
416 Ga0068865_101561476 3300006881 Bacteria 593
417 Ga0097620_100962672 3300006931 Bacteria 936
418 Ga0097620_101607525 3300006931 Bacteria 718
419 Ga0097620_101719729 3300006931 Bacteria 693
420 Ga0097620_102396822 3300006931 Bacteria 581
421 Ga0075435_101013557 3300007076 Bacteria 725
422 Ga0099795_10439968 3300007788 Bacteria 599
423 Ga0105240_10046258 3300009093 Bacteria 5515
424 Ga0105240_10129775 3300009093 Bacteria 3025
425 Ga0105240_10279796 3300009093 Bacteria 1917
426 Ga0105240_10573941 3300009093 Bacteria 1245
427 Ga0111539_10996282 3300009094 Bacteria 974
428 Ga0111539_12239040 3300009094 Bacteria 634
429 Ga0111539_13334324 3300009094 Bacteria 517
430 Ga0105245_10090859 3300009098 Bacteria 2809
431 Ga0105245_10176435 3300009098 Bacteria 2038
432 Ga0105245_10240303 3300009098 Bacteria 1755
433 Ga0105245_10331477 3300009098 Bacteria 1502
434 Ga0105245_10336107 3300009098 Bacteria 1492
435 Ga0105245_10406179 3300009098 Bacteria 1362
436 Ga0105245_10561875 3300009098 Bacteria 1164
437 Ga0105245_10563991 3300009098 Bacteria 1162
438 Ga0105245_10796479 3300009098 Bacteria 983
439 Ga0105247_10107294 3300009101 Bacteria 1793
440 Ga0105247_10112575 3300009101 Bacteria 1754
441 Ga0105247_10279709 3300009101 Bacteria 1151
442 Ga0105247_10308750 3300009101 Bacteria 1100
443 Ga0105243_10000567 3300009148 Bacteria 37383
444 Ga0105243_10002648 3300009148 Bacteria 14867
445 Ga0105243_10092563 3300009148 Bacteria 2493
446 Ga0105243_10745168 3300009148 Bacteria 960
447 Ga0105243_12503314 3300009148 Bacteria 555
448 Ga0105241_10193643 3300009174 Bacteria 1693
449 Ga0105241_10535843 3300009174 Bacteria 1049
450 Ga0105241_10673073 3300009174 Bacteria 942
451 Ga0105241_10810459 3300009174 Bacteria 863
452 Ga0105242_10105857 3300009176 Bacteria 2390
453 Ga0105242_10153537 3300009176 Bacteria 2009
454 Ga0105242_10751570 3300009176 Bacteria 960
455 Ga0105242_10844031 3300009176 Bacteria 911
456 Ga0105242_11180075 3300009176 Bacteria 784
457 Ga0105242_12394979 3300009176 Bacteria 575
458 Ga0105242_12754481 3300009176 Bacteria 542
459 Ga0105242_13141267 3300009176 Bacteria 512
460 Ga0105248_10129268 3300009177 Bacteria 2850
461 Ga0105248_10360972 3300009177 Bacteria 1635
462 Ga0105248_10416519 3300009177 Bacteria 1513
463 Ga0105248_10750513 3300009177 Bacteria 1101
464 Ga0105248_13310277 3300009177 Bacteria 512
465 Ga0105237_10229716 3300009545 Bacteria 1856
466 Ga0105237_10323663 3300009545 Bacteria 1545
467 Ga0105237_10740180 3300009545 Bacteria 990
468 Ga0105237_11292109 3300009545 Bacteria 736
469 Ga0105237_11898099 3300009545 Bacteria 604
470 Ga0105237_11995228 3300009545 Bacteria 589
471 Ga0105237_12235722 3300009545 Bacteria 556
472 Ga0105238_10117861 3300009551 Bacteria 2635
473 Ga0105238_10301065 3300009551 Bacteria 1587
474 Ga0105238_10305375 3300009551 Bacteria 1575
475 Ga0105238_10389443 3300009551 Bacteria 1386
476 Ga0105238_10812133 3300009551 Bacteria 951
477 Ga0105238_10820965 3300009551 Bacteria 946
478 Ga0105238_11122481 3300009551 Bacteria 809
479 Ga0105238_11709485 3300009551 Bacteria 660
480 Ga0105249_10140872 3300009553 Bacteria 2312
481 Ga0105249_10348738 3300009553 Bacteria 1499
482 Ga0105249_10380345 3300009553 Bacteria 1438
483 Ga0105249_10538049 3300009553 Bacteria 1217
484 Ga0105239_10020346 3300010375 Bacteria 7321
485 Ga0105239_10141441 3300010375 Bacteria 2682
486 Ga0105239_10354484 3300010375 Bacteria 1657
487 Ga0105239_11465419 3300010375 Bacteria 788
488 Ga0105239_11492605 3300010375 Bacteria 781
489 Ga0105239_11671994 3300010375 Bacteria 737
490 Ga0105246_10025484 3300011119 Bacteria 3855
491 Ga0105246_11210957 3300011119 Bacteria 695
492 Ga0105246_11450084 3300011119 Bacteria 642
493 Ga0157317_1002146 3300012475 Bacteria 1143
494 Ga0157343_1003579 3300012488 Bacteria 919
495 Ga0157322_1013516 3300012490 Bacteria 703
496 Ga0157335_1000629 3300012492 Bacteria 1677
497 Ga0157335_1016038 3300012492 Bacteria 665
498 Ga0157341_1001661 3300012494 Bacteria 1381
499 Ga0157319_1008542 3300012497 Bacteria 786
500 Ga0157345_1006509 3300012498 Bacteria 932
501 Ga0157347_1030950 3300012502 Bacteria 670
502 Ga0157313_1026815 3300012503 Bacteria 628
503 Ga0157339_1010932 3300012505 Bacteria 828
504 Ga0157324_1012408 3300012506 Bacteria 754
505 Ga0157324_1018276 3300012506 Bacteria 687
506 Ga0157342_1000500 3300012507 Bacteria 2423
507 Ga0157338_1040527 3300012515 Bacteria 633
508 Ga0157373_10042038 3300013100 Bacteria 3268
509 Ga0157373_10285423 3300013100 Bacteria 1170
510 Ga0157373_10411165 3300013100 Bacteria 970
511 Ga0157371_10024599 3300013102 Bacteria 4395
512 Ga0157371_10216006 3300013102 Bacteria 1377
513 Ga0157371_10590652 3300013102 Bacteria 825
514 Ga0157371_10597225 3300013102 Bacteria 821
515 Ga0157371_10635361 3300013102 Bacteria 796
516 Ga0157370_10108707 3300013104 Bacteria 2593
517 Ga0157370_10149009 3300013104 Bacteria 2178
518 Ga0157370_10172213 3300013104 Bacteria 2012
519 Ga0157370_10255677 3300013104 Bacteria 1620
520 Ga0157370_10443282 3300013104 Bacteria 1194
521 Ga0157370_10800213 3300013104 Bacteria 858
522 Ga0157370_10919194 3300013104 Bacteria 794
523 Ga0157370_11737994 3300013104 Bacteria 560
524 Ga0157369_10129817 3300013105 Bacteria 2671
525 Ga0157369_10141244 3300013105 Bacteria 2548
526 Ga0157369_10329543 3300013105 Bacteria 1586
527 Ga0157369_10403566 3300013105 Bacteria 1418
528 Ga0157369_11055175 3300013105 Bacteria 831
529 Ga0157369_11074293 3300013105 Bacteria 823
530 Ga0157369_11599565 3300013105 Bacteria 663
531 Ga0157374_10131921 3300013296 Bacteria 2418
532 Ga0157374_11126343 3300013296 Bacteria 805
533 Ga0157374_11470717 3300013296 Bacteria 704
534 Ga0157374_11477182 3300013296 Bacteria 703
535 Ga0157374_11632815 3300013296 Bacteria 669
536 Ga0157374_11695415 3300013296 Bacteria 657
537 Ga0157374_11714662 3300013296 Bacteria 653
538 Ga0157374_11796706 3300013296 Bacteria 638
539 Ga0157374_11846234 3300013296 Bacteria 630
540 Ga0157374_12542787 3300013296 Bacteria 539
541 Ga0157378_10040112 3300013297 Bacteria 4152
542 Ga0157378_10204057 3300013297 Bacteria 1871
543 Ga0157378_11348118 3300013297 Bacteria 755
544 Ga0157378_11824487 3300013297 Bacteria 656
545 Ga0163162_10091937 3300013306 Bacteria 3117
546 Ga0163162_10484708 3300013306 Bacteria 1368
547 Ga0163162_10777606 3300013306 Bacteria 1076
548 Ga0163162_11566472 3300013306 Bacteria 751
549 Ga0163162_12258468 3300013306 Bacteria 625
550 Ga0157372_10000069 3300013307 Bacteria 110621
551 Ga0157372_10247858 3300013307 Bacteria 2067
552 Ga0157372_10303539 3300013307 Bacteria 1857
553 Ga0157372_10718867 3300013307 Bacteria 1162
554 Ga0157372_10977450 3300013307 Bacteria 981
555 Ga0157372_11442381 3300013307 Bacteria 793
556 Ga0157372_11757235 3300013307 Bacteria 713
557 Ga0157375_10091509 3300013308 Bacteria 3103
558 Ga0157375_10823793 3300013308 Bacteria 1076
559 Ga0157375_11008643 3300013308 Bacteria 972
560 Ga0157375_11055873 3300013308 Bacteria 950
561 Ga0157375_11675270 3300013308 Bacteria 753
562 Ga0157375_12003571 3300013308 Bacteria 688
563 Ga0157375_12908163 3300013308 Bacteria 572
564 Ga0157375_13751007 3300013308 Bacteria 505
565 Ga0163163_10034337 3300014325 Bacteria 4910
566 Ga0163163_10390101 3300014325 Bacteria 1450
567 Ga0163163_11227374 3300014325 Bacteria 812
568 Ga0163163_12309125 3300014325 Bacteria 597
569 Ga0157380_10037515 3300014326 Bacteria 3755
570 Ga0157380_10204736 3300014326 Bacteria 1754
571 Ga0157380_10521228 3300014326 Bacteria 1159
572 Ga0157380_10789920 3300014326 Bacteria 965
573 Ga0157380_12036197 3300014326 Bacteria 636
574 Ga0157380_12223396 3300014326 Bacteria 612
575 Ga0182008_10023005 3300014497 Bacteria 3188
576 Ga0157377_10023097 3300014745 Bacteria 3293
577 Ga0157377_10133410 3300014745 Bacteria 1519
578 Ga0157377_10218860 3300014745 Bacteria 1218
579 Ga0157379_10008421 3300014968 Bacteria 8965
580 Ga0157379_10485086 3300014968 Bacteria 1144
581 Ga0157379_10899456 3300014968 Bacteria 840
582 Ga0157379_11086010 3300014968 Bacteria 766
583 Ga0157376_10044967 3300014969 Bacteria 3632
584 Ga0157376_10257542 3300014969 Bacteria 1633
585 Ga0157376_10755971 3300014969 Bacteria 982
586 Ga0157376_12092919 3300014969 Bacteria 604
587 Ga0182005_1186331 3300015265 Bacteria 618
588 Ga0163161_10249662 3300017792 Bacteria 1383
589 Ga0163161_10943655 3300017792 Bacteria 733
590 Ga0184593_109258 3300019179 Bacteria 518
591 Ga0197907_10353354 3300020069 Bacteria 855
592 Ga0197907_10377945 3300020069 Bacteria 8513
593 Ga0197907_10781799 3300020069 Bacteria 628
594 Ga0197907_10968004 3300020069 Bacteria 682
595 Ga0197907_11047833 3300020069 Bacteria 1811
596 Ga0197907_11065209 3300020069 Bacteria 3009
597 Ga0197907_11203916 3300020069 Bacteria 712
598 Ga0197907_11348210 3300020069 Bacteria 501
599 Ga0206356_10482235 3300020070 Bacteria 732
600 Ga0206356_10562542 3300020070 Bacteria 736
601 Ga0206356_10734286 3300020070 Bacteria 2963
602 Ga0206356_10806586 3300020070 Bacteria 669
603 Ga0206356_10809245 3300020070 Bacteria 2767
604 Ga0206356_11160282 3300020070 Bacteria 2615
605 Ga0206356_11250559 3300020070 Bacteria 1088
606 Ga0206356_11355722 3300020070 Bacteria 1133
607 Ga0206356_11891214 3300020070 Bacteria 634
608 Ga0206349_1037049 3300020075 Bacteria 2585
609 Ga0206349_1223679 3300020075 Bacteria 586
610 Ga0206349_1265100 3300020075 Bacteria 559
611 Ga0206349_1421489 3300020075 Bacteria 782
612 Ga0206349_1464288 3300020075 Bacteria 1104
613 Ga0206349_1519183 3300020075 Bacteria 797
614 Ga0206349_1522805 3300020075 Bacteria 669
615 Ga0206349_1728033 3300020075 Bacteria 1172
616 Ga0206349_1737707 3300020075 Bacteria 501
617 Ga0206355_1015855 3300020076 Bacteria 656
618 Ga0206355_1205564 3300020076 Bacteria 808
619 Ga0206355_1261997 3300020076 Bacteria 1896
620 Ga0206355_1415001 3300020076 Bacteria 662
621 Ga0206355_1472830 3300020076 Bacteria 561
622 Ga0206355_1654077 3300020076 Bacteria 988
623 Ga0206355_1690241 3300020076 Bacteria 934
624 Ga0206351_10046376 3300020077 Bacteria 698
625 Ga0206351_10076119 3300020077 Bacteria 585
626 Ga0206351_10219957 3300020077 Bacteria 552
627 Ga0206351_10309003 3300020077 Bacteria 859
628 Ga0206351_10377689 3300020077 Bacteria 928
629 Ga0206351_10414096 3300020077 Bacteria 2659
630 Ga0206351_10514268 3300020077 Bacteria 1752
631 Ga0206351_10517565 3300020077 Bacteria 712
632 Ga0206351_10522676 3300020077 Bacteria 957
633 Ga0206352_10139106 3300020078 Bacteria 1344
634 Ga0206352_10258938 3300020078 Bacteria 1023
635 Ga0206352_10333989 3300020078 Bacteria 1154
636 Ga0206352_10725403 3300020078 Bacteria 818
637 Ga0206352_10725571 3300020078 Bacteria 1589
638 Ga0206352_11019656 3300020078 Bacteria 1567
639 Ga0206352_11045450 3300020078 Bacteria 1127
640 Ga0206350_10382414 3300020080 Bacteria 789
641 Ga0206350_10667397 3300020080 Bacteria 4645
642 Ga0206350_11285491 3300020080 Bacteria 1378
643 Ga0206350_11483097 3300020080 Bacteria 2256
644 Ga0206350_11655750 3300020080 Bacteria 890
645 Ga0206354_10317063 3300020081 Bacteria 2737
646 Ga0206354_10357282 3300020081 Bacteria 500
647 Ga0206354_10378201 3300020081 Bacteria 749
648 Ga0206354_10394252 3300020081 Bacteria 654
649 Ga0206354_10491146 3300020081 Bacteria 4082
650 Ga0206354_10670181 3300020081 Bacteria 2821
651 Ga0206354_10676331 3300020081 Bacteria 650
652 Ga0206354_10764178 3300020081 Bacteria 612
653 Ga0206354_11140572 3300020081 Bacteria 566
654 Ga0206354_11153566 3300020081 Bacteria 925
655 Ga0206354_11319487 3300020081 Bacteria 3065
656 Ga0206353_10229932 3300020082 Bacteria 703
657 Ga0206353_10865326 3300020082 Bacteria 1110
658 Ga0206353_10924004 3300020082 Bacteria 4025
659 Ga0206353_11139857 3300020082 Bacteria 559
660 Ga0206353_11303022 3300020082 Bacteria 691
661 Ga0206353_11654695 3300020082 Bacteria 607
662 Ga0154015_1344825 3300020610 Bacteria 547
663 Ga0154015_1350603 3300020610 Bacteria 934
664 Ga0154015_1581024 3300020610 Bacteria 623
665 Ga0213873_10166278 3300021358 Bacteria 671
666 Ga0213876_10022127 3300021384 Bacteria 3363
667 Ga0213876_10131711 3300021384 Bacteria 1329
668 Ga0213876_10496274 3300021384 Bacteria 650
669 Ga0213875_10000107 3300021388 Bacteria 95120
670 Ga0213875_10000362 3300021388 Bacteria 42266
671 Ga0213875_10010348 3300021388 Bacteria 4672
672 Ga0213875_10052334 3300021388 Bacteria 1912
673 Ga0213875_10130105 3300021388 Bacteria 1177
674 Ga0213875_10153206 3300021388 Bacteria 1080
675 Ga0224712_10000575 3300022467 Bacteria 7470
676 Ga0224712_10000978 3300022467 Bacteria 6216
677 Ga0224712_10004671 3300022467 Bacteria 3720
678 Ga0224712_10048915 3300022467 Bacteria 1634
679 Ga0224712_10049036 3300022467 Bacteria 1633
680 Ga0224712_10078968 3300022467 Bacteria 1354
681 Ga0224712_10093646 3300022467 Bacteria 1263
682 Ga0224712_10252712 3300022467 Bacteria 815
683 Ga0224712_10272665 3300022467 Bacteria 786
684 Ga0224712_10513828 3300022467 Bacteria 580
685 Ga0207656_10097780 3300025321 Bacteria 1342
686 Ga0207656_10181829 3300025321 Bacteria 1009
687 Ga0207656_10191995 3300025321 Bacteria 984
688 Ga0207653_10082305 3300025885 Bacteria 1116
689 Ga0207653_10129988 3300025885 Bacteria 913
690 Ga0207682_10298166 3300025893 Bacteria 755
691 Ga0207692_10005017 3300025898 Bacteria 5270
692 Ga0207692_10026725 3300025898 Bacteria 2710
693 Ga0207692_10039662 3300025898 Bacteria 2319
694 Ga0207692_10162735 3300025898 Bacteria 1287
695 Ga0207642_10064228 3300025899 Bacteria 1720
696 Ga0207642_10154536 3300025899 Bacteria 1225
697 Ga0207642_10263796 3300025899 Bacteria 983
698 Ga0207710_10004294 3300025900 Bacteria 6241
699 Ga0207710_10069288 3300025900 Bacteria 1615
700 Ga0207710_10400064 3300025900 Bacteria 705
701 Ga0207688_10001159 3300025901 Bacteria 13577
702 Ga0207688_10003298 3300025901 Bacteria 8817
703 Ga0207688_10042994 3300025901 Bacteria 2515
704 Ga0207688_10127394 3300025901 Bacteria 1490
705 Ga0207688_10537841 3300025901 Bacteria 734
706 Ga0207680_10047203 3300025903 Bacteria 2551
707 Ga0207680_10522776 3300025903 Bacteria 846
708 Ga0207647_10107907 3300025904 Bacteria 1647
709 Ga0207647_10132804 3300025904 Bacteria 1462
710 Ga0207647_10177455 3300025904 Bacteria 1239
711 Ga0207647_10291056 3300025904 Bacteria 931
712 Ga0207647_10350024 3300025904 Bacteria 836
713 Ga0207647_10401794 3300025904 Bacteria 772
714 Ga0207647_10502044 3300025904 Bacteria 676
715 Ga0207685_10020620 3300025905 Bacteria 2195
716 Ga0207685_10131484 3300025905 Bacteria 1111
717 Ga0207699_10001668 3300025906 Bacteria 10536
718 Ga0207699_10021552 3300025906 Bacteria 3475
719 Ga0207699_10095716 3300025906 Bacteria 1873
720 Ga0207699_10129509 3300025906 Bacteria 1644
721 Ga0207699_10370112 3300025906 Bacteria 1015
722 Ga0207645_10039213 3300025907 Bacteria 3035
723 Ga0207643_10001355 3300025908 Bacteria 14144
724 Ga0207643_10014701 3300025908 Bacteria 4256
725 Ga0207643_10175640 3300025908 Bacteria 1294
726 Ga0207643_10523333 3300025908 Bacteria 760
727 Ga0207643_10545745 3300025908 Bacteria 743
728 Ga0207705_10000671 3300025909 Bacteria 28465
729 Ga0207705_10027743 3300025909 Bacteria 4038
730 Ga0207705_10216281 3300025909 Bacteria 1454
731 Ga0207705_10226135 3300025909 Bacteria 1422
732 Ga0207705_10354451 3300025909 Bacteria 1131
733 Ga0207705_10464917 3300025909 Bacteria 981
734 Ga0207684_10177547 3300025910 Bacteria 1836
735 Ga0207684_11152632 3300025910 Bacteria 643
736 Ga0207654_10220234 3300025911 Bacteria 1259
737 Ga0207654_10452981 3300025911 Bacteria 900
738 Ga0207707_10001257 3300025912 Bacteria 23769
739 Ga0207707_10006511 3300025912 Bacteria 10199
740 Ga0207707_10008073 3300025912 Bacteria 9140
741 Ga0207707_10121849 3300025912 Bacteria 2280
742 Ga0207707_10717986 3300025912 Bacteria 838
743 Ga0207707_10942357 3300025912 Bacteria 711
744 Ga0207707_11268091 3300025912 Bacteria 593
745 Ga0207695_10115359 3300025913 Bacteria 2660
746 Ga0207695_10697384 3300025913 Bacteria 896
747 Ga0207695_10814538 3300025913 Bacteria 814
748 Ga0207671_10071765 3300025914 Bacteria 2583
749 Ga0207671_10130693 3300025914 Bacteria 1927
750 Ga0207671_10153860 3300025914 Bacteria 1778
751 Ga0207671_10767961 3300025914 Bacteria 765
752 Ga0207671_11468956 3300025914 Bacteria 527
753 Ga0207693_10011155 3300025915 Bacteria 7277
754 Ga0207693_10725458 3300025915 Bacteria 769
755 Ga0207663_10060919 3300025916 Bacteria 2393
756 Ga0207663_10110103 3300025916 Bacteria 1867
757 Ga0207663_10111171 3300025916 Bacteria 1859
758 Ga0207663_10204599 3300025916 Bacteria 1426
759 Ga0207663_10806349 3300025916 Bacteria 748
760 Ga0207663_11657398 3300025916 Bacteria 515
761 Ga0207663_11677928 3300025916 Bacteria 511
762 Ga0207663_11752084 3300025916 Bacteria 500
763 Ga0207660_10000562 3300025917 Bacteria 24961
764 Ga0207660_10004961 3300025917 Bacteria 8672
765 Ga0207660_10053168 3300025917 Bacteria 2885
766 Ga0207660_10155588 3300025917 Bacteria 1759
767 Ga0207660_10848599 3300025917 Bacteria 745
768 Ga0207662_10002882 3300025918 Bacteria 8712
769 Ga0207657_10001387 3300025919 Bacteria 25846
770 Ga0207657_10177471 3300025919 Bacteria 1723
771 Ga0207657_10290547 3300025919 Bacteria 1296
772 Ga0207657_10369061 3300025919 Bacteria 1131
773 Ga0207657_10547404 3300025919 Bacteria 905
774 Ga0207649_10155879 3300025920 Bacteria 1578
775 Ga0207649_10330176 3300025920 Bacteria 1123
776 Ga0207649_10478211 3300025920 Bacteria 944
777 Ga0207652_10000632 3300025921 Bacteria 34827
778 Ga0207652_10005398 3300025921 Bacteria 10371
779 Ga0207652_10061156 3300025921 Bacteria 3251
780 Ga0207652_10531151 3300025921 Bacteria 1058
781 Ga0207652_10837371 3300025921 Bacteria 815
782 Ga0207646_10082391 3300025922 Bacteria 2877
783 Ga0207646_10089945 3300025922 Bacteria 2748
784 Ga0207681_10889624 3300025923 Bacteria 745
785 Ga0207681_11803394 3300025923 Bacteria 510
786 Ga0207694_10278016 3300025924 Bacteria 1375
787 Ga0207694_10282726 3300025924 Bacteria 1363
788 Ga0207694_10405590 3300025924 Bacteria 1134
789 Ga0207694_10493274 3300025924 Bacteria 1025
790 Ga0207694_10772435 3300025924 Bacteria 811
791 Ga0207650_10979736 3300025925 Bacteria 719
792 Ga0207659_10117802 3300025926 Bacteria 2030
793 Ga0207659_10118329 3300025926 Bacteria 2026
794 Ga0207659_10141498 3300025926 Bacteria 1868
795 Ga0207687_10005166 3300025927 Bacteria 8656
796 Ga0207687_10104213 3300025927 Bacteria 2093
797 Ga0207687_10176039 3300025927 Bacteria 1654
798 Ga0207687_10346630 3300025927 Bacteria 1209
799 Ga0207687_10953729 3300025927 Bacteria 735
800 Ga0207700_10007511 3300025928 Bacteria 6668
801 Ga0207700_10010456 3300025928 Bacteria 5857
802 Ga0207700_10047227 3300025928 Bacteria 3190
803 Ga0207664_10000001 3300025929 Bacteria 724213
804 Ga0207664_10003003 3300025929 Bacteria 11208
805 Ga0207664_10040828 3300025929 Bacteria 3611
806 Ga0207664_10081228 3300025929 Bacteria 2637
807 Ga0207664_10283965 3300025929 Bacteria 1453
808 Ga0207664_10480679 3300025929 Bacteria 1111
809 Ga0207644_10022904 3300025931 Bacteria 4271
810 Ga0207644_10190213 3300025931 Bacteria 1613
811 Ga0207644_10622978 3300025931 Bacteria 897
812 Ga0207690_10087503 3300025932 Bacteria 2192
813 Ga0207690_10129601 3300025932 Bacteria 1844
814 Ga0207690_10287156 3300025932 Bacteria 1283
815 Ga0207690_10689245 3300025932 Bacteria 839
816 Ga0207706_10046783 3300025933 Bacteria 3830
817 Ga0207706_10149626 3300025933 Bacteria 2053
818 Ga0207706_10509293 3300025933 Bacteria 1038
819 Ga0207686_10102386 3300025934 Bacteria 1914
820 Ga0207686_10407312 3300025934 Bacteria 1037
821 Ga0207686_10515868 3300025934 Bacteria 929
822 Ga0207686_10849427 3300025934 Bacteria 734
823 Ga0207709_10000305 3300025935 Bacteria 53275
824 Ga0207709_10005029 3300025935 Bacteria 7555
825 Ga0207709_10104660 3300025935 Bacteria 1879
826 Ga0207709_10127337 3300025935 Bacteria 1730
827 Ga0207709_10919582 3300025935 Bacteria 712
828 Ga0207670_10022974 3300025936 Bacteria 3874
829 Ga0207670_10043292 3300025936 Bacteria 2972
830 Ga0207670_10491524 3300025936 Bacteria 995
831 Ga0207670_10954177 3300025936 Bacteria 720
832 Ga0207670_11503418 3300025936 Bacteria 572
833 Ga0207669_10006873 3300025937 Bacteria 5232
834 Ga0207669_10063775 3300025937 Bacteria 2276
835 Ga0207669_10118183 3300025937 Bacteria 1793
836 Ga0207669_10734396 3300025937 Bacteria 814
837 Ga0207669_10756249 3300025937 Bacteria 803
838 Ga0207669_11304185 3300025937 Bacteria 617
839 Ga0207669_11889428 3300025937 Bacteria 510
840 Ga0207704_10439993 3300025938 Bacteria 1038
841 Ga0207704_10626228 3300025938 Bacteria 884
842 Ga0207704_11489114 3300025938 Bacteria 581
843 Ga0207704_11619242 3300025938 Bacteria 556
844 Ga0207665_10402902 3300025939 Bacteria 1042
845 Ga0207665_10692753 3300025939 Bacteria 801
846 Ga0207665_10995262 3300025939 Bacteria 667
847 Ga0207691_10003431 3300025940 Bacteria 15416
848 Ga0207691_10489215 3300025940 Bacteria 1045
849 Ga0207691_10734719 3300025940 Bacteria 831
850 Ga0207711_10224387 3300025941 Bacteria 1719
851 Ga0207711_10542923 3300025941 Bacteria 1084
852 Ga0207689_10002936 3300025942 Bacteria 15743
853 Ga0207689_10173846 3300025942 Bacteria 1776
854 Ga0207689_10281438 3300025942 Bacteria 1377
855 Ga0207661_10050176 3300025944 Bacteria 3323
856 Ga0207661_10104106 3300025944 Bacteria 2389
857 Ga0207661_10109515 3300025944 Bacteria 2333
858 Ga0207661_10187724 3300025944 Bacteria 1810
859 Ga0207661_10402489 3300025944 Bacteria 1241
860 Ga0207661_10542623 3300025944 Bacteria 1065
861 Ga0207661_11488934 3300025944 Bacteria 620
862 Ga0207679_10087528 3300025945 Bacteria 2399
863 Ga0207679_10635713 3300025945 Bacteria 964
864 Ga0207667_10053296 3300025949 Bacteria 4257
865 Ga0207667_10748206 3300025949 Bacteria 977
866 Ga0207667_11781227 3300025949 Bacteria 580
867 Ga0207667_11869828 3300025949 Bacteria 563
868 Ga0207651_10259888 3300025960 Bacteria 1425
869 Ga0207651_10276475 3300025960 Bacteria 1386
870 Ga0207651_10608015 3300025960 Bacteria 956
871 Ga0207651_10700077 3300025960 Bacteria 892
872 Ga0207651_10775105 3300025960 Bacteria 849
873 Ga0207712_10093206 3300025961 Bacteria 2222
874 Ga0207712_10213239 3300025961 Bacteria 1539
875 Ga0207668_10001244 3300025972 Bacteria 15180
876 Ga0207668_10029372 3300025972 Bacteria 3603
877 Ga0207668_10104040 3300025972 Bacteria 2115
878 Ga0207668_10507411 3300025972 Bacteria 1038
879 Ga0207668_10760224 3300025972 Bacteria 855
880 Ga0207640_10110526 3300025981 Bacteria 1947
881 Ga0207640_10129601 3300025981 Bacteria 1821
882 Ga0207640_10336272 3300025981 Bacteria 1208
883 Ga0207640_11804026 3300025981 Bacteria 553
884 Ga0207658_10017892 3300025986 Bacteria 4885
885 Ga0207658_10088255 3300025986 Bacteria 2397
886 Ga0207658_10417015 3300025986 Bacteria 1183
887 Ga0207658_10960136 3300025986 Bacteria 779
888 Ga0207658_11075147 3300025986 Bacteria 735
889 Ga0207677_10296380 3300026023 Bacteria 1334
890 Ga0207677_10510942 3300026023 Bacteria 1041
891 Ga0207677_10594683 3300026023 Bacteria 970
892 Ga0207677_10724953 3300026023 Bacteria 884
893 Ga0207677_11839907 3300026023 Bacteria 562
894 Ga0207703_10094586 3300026035 Bacteria 2520
895 Ga0207639_10140158 3300026041 Bacteria 2013
896 Ga0207639_10307407 3300026041 Bacteria 1403
897 Ga0207639_10508431 3300026041 Bacteria 1102
898 Ga0207639_11572563 3300026041 Bacteria 617
899 Ga0207639_12112016 3300026041 Bacteria 524
900 Ga0207678_10000929 3300026067 Bacteria 26706
901 Ga0207678_10002587 3300026067 Bacteria 16500
902 Ga0207678_10012875 3300026067 Bacteria 7342
903 Ga0207678_10134885 3300026067 Bacteria 2106
904 Ga0207678_10163083 3300026067 Bacteria 1903
905 Ga0207678_10329902 3300026067 Bacteria 1313
906 Ga0207678_10591157 3300026067 Bacteria 973
907 Ga0207678_10608458 3300026067 Bacteria 958
908 Ga0207708_10000030 3300026075 Bacteria 157064
909 Ga0207708_10002425 3300026075 Bacteria 13693
910 Ga0207708_10474917 3300026075 Bacteria 1045
911 Ga0207708_10612653 3300026075 Bacteria 923
912 Ga0207708_12051222 3300026075 Bacteria 501
913 Ga0207702_10003344 3300026078 Bacteria 14708
914 Ga0207702_10593991 3300026078 Bacteria 1086
915 Ga0207702_10628748 3300026078 Bacteria 1055
916 Ga0207702_10914466 3300026078 Bacteria 869
917 Ga0207702_10937072 3300026078 Bacteria 858
918 Ga0207702_12126807 3300026078 Bacteria 551
919 Ga0207641_10000478 3300026088 Bacteria 45330
920 Ga0207641_10012413 3300026088 Bacteria 6984
921 Ga0207641_10100925 3300026088 Bacteria 2542
922 Ga0207641_10587032 3300026088 Bacteria 1090
923 Ga0207648_10007281 3300026089 Bacteria 10910
924 Ga0207648_10133353 3300026089 Bacteria 2187
925 Ga0207648_10334848 3300026089 Bacteria 1362
926 Ga0207648_10843133 3300026089 Bacteria 855
927 Ga0207676_10074155 3300026095 Bacteria 2740
928 Ga0207676_10080647 3300026095 Bacteria 2642
929 Ga0207676_10434265 3300026095 Bacteria 1234
930 Ga0207676_11252210 3300026095 Bacteria 736
931 Ga0207674_10006508 3300026116 Bacteria 13736
932 Ga0207674_10070710 3300026116 Bacteria 3509
933 Ga0207675_100003879 3300026118 Bacteria 14536
934 Ga0207675_100010883 3300026118 Bacteria 8521
935 Ga0207675_100396136 3300026118 Bacteria 1360
936 Ga0207675_100498663 3300026118 Bacteria 1212
937 Ga0207675_101338561 3300026118 Bacteria 737
938 Ga0207683_10002849 3300026121 Bacteria 15092
939 Ga0207683_10074864 3300026121 Bacteria 2996
940 Ga0207683_10111118 3300026121 Bacteria 2454
941 Ga0207683_10126952 3300026121 Bacteria 2292
942 Ga0207683_10176704 3300026121 Bacteria 1935
943 Ga0207683_10683415 3300026121 Bacteria 951
944 Ga0207683_10693507 3300026121 Bacteria 944
945 Ga0207683_10995746 3300026121 Bacteria 778
946 Ga0207683_11764047 3300026121 Bacteria 568
947 Ga0207698_10005035 3300026142 Bacteria 8104
948 Ga0207698_10072778 3300026142 Bacteria 2733
949 Ga0207698_11140528 3300026142 Bacteria 793
950 Ga0265355_1007915 3300028036 Bacteria 846
951 Ga0268266_10006407 3300028379 Bacteria 10787
952 Ga0268266_10021808 3300028379 Bacteria 5456
953 Ga0268266_10073860 3300028379 Bacteria 2960
954 Ga0268266_10232699 3300028379 Bacteria 1697
955 Ga0268266_10508208 3300028379 Bacteria 1151
956 Ga0268266_10571329 3300028379 Bacteria 1085
957 Ga0268266_11662362 3300028379 Bacteria 614
958 Ga0268266_12384300 3300028379 Bacteria 500
959 Ga0268265_10217831 3300028380 Bacteria 1668
960 Ga0268265_10597590 3300028380 Bacteria 1054
961 Ga0268265_11399771 3300028380 Bacteria 701
962 Ga0268265_11520162 3300028380 Bacteria 673
963 Ga0268265_12487598 3300028380 Bacteria 524
964 Ga0268264_10000097 3300028381 Bacteria 229722
965 Ga0268264_10013159 3300028381 Bacteria 6805
966 Ga0268264_10102783 3300028381 Bacteria 2487
967 Ga0268264_10471038 3300028381 Bacteria 1220
968 Ga0307515_10193296 3300028794 Bacteria 1937
969 Ga0265338_10089548 3300028800 Bacteria 2549
970 Ga0265338_10304734 3300028800 Bacteria 1157
971 Ga0265338_10986840 3300028800 Bacteria 571
972 Ga0310981_1087667 3300029285 Bacteria 906
973 Ga0307511_10115089 3300030521 Bacteria 1691
974 Ga0307512_10086539 3300030522 Bacteria 2214
975 Ga0316182_1005526 3300030745 Bacteria 728
976 Ga0265775_102055 3300030762 Bacteria 1017
977 Ga0265775_104385 3300030762 Bacteria 792
978 Ga0265763_1000738 3300030763 Bacteria 2129
979 Ga0265763_1040469 3300030763 Bacteria 560
980 Ga0265766_1011257 3300030863 Bacteria 648
981 Ga0265764_105138 3300030882 Bacteria 728
982 Ga0265769_101293 3300030888 Bacteria 1175
983 Ga0265761_103183 3300030889 Bacteria 797
984 Ga0265773_1012166 3300031018 Bacteria 750
985 Ga0265779_103758 3300031043 Bacteria 785
986 Ga0265760_10181673 3300031090 Bacteria 703
987 Ga0265328_10034011 3300031239 Bacteria 1888
988 Ga0265325_10136111 3300031241 Bacteria 1172
989 Ga0265325_10301924 3300031241 Bacteria 714
990 Ga0265340_10020369 3300031247 Bacteria 3409
991 Ga0265340_10022026 3300031247 Bacteria 3261
992 Ga0265339_10126373 3300031249 Bacteria 1310
993 Ga0265339_10321347 3300031249 Bacteria 734
994 Ga0265331_10047396 3300031250 Bacteria 2068
995 Ga0265327_10000004 3300031251 Bacteria 803973
996 Ga0265327_10000532 3300031251 Bacteria 65543
997 Ga0265316_10222988 3300031344 Bacteria 1390
998 Ga0307513_10863617 3300031456 Bacteria 611
999 Ga0307509_10118846 3300031507 Bacteria 2625
1000 Ga0310117_117420 3300031592 Bacteria 732
1001 Ga0265313_10062846 3300031595 Bacteria 1733
1002 Ga0310107_126959 3300031615 Bacteria 654
1003 Ga0265314_10041461 3300031711 Bacteria 3295
1004 Ga0265342_10086654 3300031712 Bacteria 1800
1005 Ga0316576_10006920 3300031727 Bacteria 7091
1006 Ga0316576_10071235 3300031727 Bacteria 2564
1007 Ga0316576_10123294 3300031727 Bacteria 1947
1008 Ga0316576_10290360 3300031727 Bacteria 1223
1009 Ga0316578_10222609 3300031728 Bacteria 1134
1010 Ga0307405_10006223 3300031731 Bacteria 5849
1011 Ga0307405_10696521 3300031731 Bacteria 841
1012 Ga0307405_11059571 3300031731 Bacteria 695
1013 Ga0307405_11115298 3300031731 Bacteria 679
1014 Ga0307405_11403736 3300031731 Bacteria 611
1015 Ga0307405_11949736 3300031731 Bacteria 525
1016 Ga0307413_10169880 3300031824 Bacteria 1542
1017 Ga0307413_11585277 3300031824 Bacteria 581
1018 Ga0307518_10016411 3300031838 Bacteria 5307
1019 Ga0307410_10565557 3300031852 Bacteria 944
1020 Ga0307410_10604991 3300031852 Bacteria 915
1021 Ga0307410_11914898 3300031852 Bacteria 528
1022 Ga0307406_10144961 3300031901 Bacteria 1686
1023 Ga0307407_10238165 3300031903 Bacteria 1240
1024 Ga0307407_10259715 3300031903 Bacteria 1194
1025 Ga0307407_10792027 3300031903 Bacteria 720
1026 Ga0307407_10941070 3300031903 Bacteria 665
1027 Ga0307407_11635889 3300031903 Bacteria 512
1028 Ga0307412_10064406 3300031911 Bacteria 2477
1029 Ga0307412_10336182 3300031911 Bacteria 1207
1030 Ga0307409_100902359 3300031995 Bacteria 897
1031 Ga0307409_102330774 3300031995 Bacteria 565
1032 Ga0307416_100079924 3300032002 Bacteria 2758
1033 Ga0307416_100725009 3300032002 Bacteria 1085
1034 Ga0307416_100759765 3300032002 Bacteria 1063
1035 Ga0307414_12254754 3300032004 Bacteria 508
1036 Ga0307411_10529935 3300032005 Bacteria 1001
1037 Ga0307411_10592318 3300032005 Bacteria 952
1038 Ga0307415_100099997 3300032126 Bacteria 2124
1039 Ga0307415_100158134 3300032126 Bacteria 1753
1040 Ga0316583_10130276 3300032133 Bacteria 877
1041 Ga0316580_10219549 3300032139 Bacteria 586
1042 Ga0316593_10009690 3300032168 Bacteria 2731
1043 Ga0316593_10108458 3300032168 Bacteria 990
1044 Ga0307510_10019413 3300033180 Bacteria 7973
1045 Ga0316592_1007426 3300033524 Bacteria 2142
1046 Ga0316592_1043955 3300033524 Bacteria 992
1047 Ga0316592_1056390 3300033524 Bacteria 879
1048 Ga0316596_1000140 3300033541 Bacteria 9866
1049 Ga0316596_1006375 3300033541 Bacteria 2742
1050 Ga0373930_0011251 3300034816 Bacteria 1613
1051 Ga0373948_0028084 3300034817 Bacteria 1118
1052 Ga0373950_0020903 3300034818 Bacteria 1154
1053 Ga0373950_0093089 3300034818 Bacteria 642
1054 Ga0373938_0092642 3300034957 Bacteria 750
1055 Ga0373926_0017223 3300035083 Bacteria 2478
1056 Ga0373928_0069499 3300035084 Bacteria 867
1057 Ga0373929_0175187 3300035085 Bacteria 588
1058 Ga0373934_0007912 3300035086 Bacteria 3955
1059 Ga0373934_0033978 3300035086 Bacteria 2003
1060 Ga0373940_0051015 3300035088 Bacteria 1162
1061 Ga0373944_0106580 3300035089 Bacteria 952
1062 Ga0373949_0014280 3300035090 Bacteria 1767
1063 Ga0373952_0011022 3300035092 Bacteria 1757
1064 Ga0373923_0013637 3300035111 Bacteria 3033
1065 Ga0373923_0187403 3300035111 Bacteria 952
1066 Ga0373932_0009133 3300035112 Bacteria 2378
1067 Ga0373936_0018900 3300035113 Bacteria 2666
1068 Ga0373936_0037173 3300035113 Bacteria 1943
1069 Ga0373939_0040331 3300035114 Bacteria 1402
1070 Ga0373939_0045832 3300035114 Bacteria 1336
1071 Ga0373941_0174177 3300035115 Bacteria 803
1072 Ga0373945_0016245 3300035116 Bacteria 2507
1073 Ga0373953_0004941 3300035117 Bacteria 4291
1074 Ga0373953_0083777 3300035117 Bacteria 1328
1075 Ga0373953_0509671 3300035117 Bacteria 533
1076 Ga0373954_0048565 3300035118 Bacteria 1988
1077 Ga0373956_0003612 3300035119 Bacteria 6243
1078 Ga0373956_0008114 3300035119 Bacteria 4249
1079 Ga0373956_0013875 3300035119 Bacteria 3356
1080 Ga0373957_0001036 3300035120 Bacteria 7312
1081 Ga0373957_0005448 3300035120 Bacteria 3943
1082 Ga0373957_0113916 3300035120 Bacteria 1091
1083 Ga0373943_0021734 3300035170 Bacteria 2965
1084 Ga0373943_0262098 3300035170 Bacteria 973
1085 Ga0373946_0009470 3300035171 Bacteria 3589
1086 Ga0373946_0500664 3300035171 Bacteria 623
1087 Ga0373955_0138702 3300035172 Bacteria 1424
1088 Ga0373955_0322328 3300035172 Bacteria 933
1089 Ga0373942_0032481 3300035207 Bacteria 1386
1090 Ga0373942_0060545 3300035207 Bacteria 1084
1091 Ga0373961_0061853 3300035241 Bacteria 1138
1092 Ga0316574_0178719 3300035398 Bacteria 1365
1093 Ga0316574_0431488 3300035398 Bacteria 827
1094 Ga0373924_0013498 3300035410 Bacteria 3070
1095 Ga0373924_0051899 3300035410 Bacteria 1701
1096 Ga0373924_0154129 3300035410 Bacteria 1006
1097 Ga0373931_0101770 3300035691 Bacteria 1617
1098 Ga0373931_0319446 3300035691 Bacteria 964
1099 Ga0373935_0046761 3300035692 Bacteria 2734
1100 Ga0373935_0060354 3300035692 Bacteria 2425
1101 Ga0373927_0013458 3300035695 Bacteria 5436
1102 Ga0373927_0337418 3300035695 Bacteria 993
1103 Ga0373933_0068897 3300035724 Bacteria 2149
1104 Ga0373933_0090081 3300035724 Bacteria 1891
1105 Ga0373947_0034342 3300035725 Bacteria 2998
1106 Ga0310104_10746 3300036242 Bacteria 740
1107 Ga0373937_0091252 3300036401 Bacteria 2822
1108 Ga0373937_0342156 3300036401 Bacteria 1416
1109 Ga0373937_1470515 3300036401 Bacteria 629
1110 Ga0372808_032497 3300036459 Bacteria 748
1111 Ga0372808_054548 3300036459 Bacteria 573
1112 Ga0316582_0520082 3300036647 Bacteria 820
1113 Ga0316584_0009403 3300036712 Bacteria 6785
1114 Ga0316584_0112590 3300036712 Bacteria 2036
1115 Ga0316584_0127940 3300036712 Bacteria 1897
1116 Ga0373925_0000004 3300037068 Bacteria 361597
1117 Ga0373925_0065617 3300037068 Bacteria 2734
1118 Ga0373925_0085471 3300037068 Bacteria 2405
1119 Ga0373925_0991680 3300037068 Bacteria 692
1120 Ga0373925_1773439 3300037068 Bacteria 504
1121 Ga0395899_0004964 3300037312 Bacteria 10353
1122 Ga0395899_0331641 3300037312 Bacteria 1022
1123 Ga0395899_0587271 3300037312 Bacteria 711
1124 Ga0395900_0013704 3300037418 Bacteria 8276
1125 Ga0395900_0215391 3300037418 Bacteria 1938
1126 Ga0395900_0437593 3300037418 Bacteria 1266
1127 Ga0395900_1499602 3300037418 Bacteria 586
1128 Ga0395898_0036774 3300037466 Bacteria 4860
1129 Ga0395898_0965927 3300037466 Bacteria 789
1130 Ga0395905_0065150 3300037471 Bacteria 3411
1131 Ga0316581_0286595 3300037588 Bacteria 506
1132 Ga0436364_0401206 3300037853 Bacteria 5037
1133 Ga0436364_0487881 3300037853 Bacteria 567
1134 Ga0436364_0508850 3300037853 Bacteria 1732
1135 Ga0436364_0520200 3300037853 Bacteria 1890
1136 Ga0436364_0609479 3300037853 Bacteria 47114
1137 Ga0436364_0754979 3300037853 Bacteria 633
1138 Ga0436364_0804097 3300037853 Bacteria 39998
1139 Ga0436364_0844017 3300037853 Bacteria 1446
1140 Ga0436364_0856491 3300037853 Bacteria 1364
1141 Ga0436364_1292141 3300037853 Bacteria 3544
1142 Ga0395901_0156631 3300038443 Bacteria 2392
1143 Ga0436365_0295075 3300039437 Bacteria 2549
1144 Ga0436365_0604975 3300039437 Bacteria 3469
1145 Ga0436365_1560914 3300039437 Bacteria 1503
1146 Ga0436365_1866547 3300039437 Bacteria 1948
1147 Ga0436360_0146467 3300039438 Bacteria 844
1148 Ga0436360_1002306 3300039438 Bacteria 2030
1149 Ga0436363_0531592 3300039450 Bacteria 568
1150 Ga0436363_0713271 3300039450 Bacteria 1567
1151 Ga0436363_1061940 3300039450 Bacteria 575
1152 Ga0436363_1188024 3300039450 Bacteria 510
1153 Ga0436363_1290117 3300039450 Bacteria 684
1154 Ga0436362_0051453 3300039453 Bacteria 602
1155 Ga0436362_1034091 3300039453 Bacteria 1456
1156 Ga0436362_1253162 3300039453 Bacteria 927
1157 Ga0439465_0001503 3300041413 Bacteria 7562
1158 Ga0439465_0224732 3300041413 Bacteria 689
1159 Ga0451787_232286 3300041441 Bacteria 933
1160 Ga0451787_617256 3300041441 Bacteria 935
1161 Ga0451787_783834 3300041441 Bacteria 1338
1162 Ga0451789_0356172 3300041443 Bacteria 1772
1163 Ga0451789_1064070 3300041443 Bacteria 2207
1164 Ga0451790_30083 3300041444 Bacteria 617
1165 Ga0451792_10772 3300041445 Bacteria 578
1166 Ga0451792_14883 3300041445 Bacteria 587
1167 Ga0451794_37396 3300041446 Bacteria 775
1168 Ga0451794_48115 3300041446 Bacteria 830
1169 Ga0451794_50020 3300041446 Bacteria 797
1170 Ga0451794_52070 3300041446 Bacteria 609
1171 Ga0451791_0540367 3300041451 Bacteria 638
1172 Ga0451791_0950749 3300041451 Bacteria 937
1173 Ga0451793_0893875 3300041452 Bacteria 2492
1174 Ga0451793_1809633 3300041452 Bacteria 569
1175 Ga0451797_0934014 3300041453 Bacteria 610
1176 Ga0451797_1097187 3300041453 Bacteria 629
1177 Ga0451797_1162958 3300041453 Bacteria 831
1178 Ga0451795_1158970 3300041456 Bacteria 716
1179 Ga0451795_1175078 3300041456 Bacteria 907
1180 Ga0451795_1286801 3300041456 Bacteria 618
1181 Ga0451798_0310622 3300041458 Bacteria 1019
1182 Ga0451798_0608895 3300041458 Bacteria 522
1183 Ga0451800_0483294 3300041459 Bacteria 1635
1184 Ga0451800_1157504 3300041459 Bacteria 829
1185 Ga0451802_2051750 3300041460 Bacteria 646
1186 Ga0451805_109072 3300041461 Bacteria 642
1187 Ga0451804_0160498 3300041463 Bacteria 652
1188 Ga0451804_0271602 3300041463 Bacteria 1152
1189 Ga0451804_0321468 3300041463 Bacteria 606
1190 Ga0451807_1163869 3300041486 Bacteria 889
1191 Ga0451807_1581569 3300041486 Bacteria 531
1192 Ga0451833_0644812 3300041491 Bacteria 653
1193 Ga0451835_0504333 3300041492 Bacteria 558
1194 Ga0451837_0770417 3300041494 Bacteria 808
1195 Ga0451837_0907669 3300041494 Bacteria 827
1196 Ga0451837_1596043 3300041494 Bacteria 560
1197 Ga0451839_0025401 3300041496 Bacteria 810
1198 Ga0451839_0255728 3300041496 Bacteria 637
1199 Ga0451839_0788412 3300041496 Bacteria 569
1200 Ga0451841_0204057 3300041498 Bacteria 1376
1201 Ga0451841_0559173 3300041498 Bacteria 2003
1202 Ga0451847_0197256 3300041503 Bacteria 766
1203 Ga0451847_0897189 3300041503 Bacteria 571
1204 Ga0451851_0336391 3300041507 Bacteria 572
1205 Ga0451843_0078182 3300041509 Bacteria 1085
1206 Ga0451843_0673582 3300041509 Bacteria 501
1207 Ga0451843_1227703 3300041509 Bacteria 1139
1208 Ga0451855_1437951 3300041511 Bacteria 560
1209 Ga0451853_1178819 3300041512 Bacteria 2324
1210 Ga0451853_1676925 3300041512 Bacteria 714
1211 Ga0451853_2803505 3300041512 Bacteria 805
1212 Ga0439431_0036551 3300041997 Bacteria 1237
1213 Ga0439441_056669 3300042001 Bacteria 818
1214 Ga0439445_0160488 3300042004 Bacteria 657
1215 Ga0439448_0053568 3300042005 Bacteria 1324
1216 Ga0439463_097662 3300042016 Bacteria 757
1217 Ga0450920_130800 3300042122 Bacteria 529
1218 Ga0439435_0047473 3300042436 Bacteria 1220
1219 Ga0439459_0244558 3300042438 Bacteria 505
1220 Ga0450918_024976 3300042531 Bacteria 1046
1221 Ga0466969_0370129 3300044656 Bacteria 649
1222 Ga0466972_0000467 3300044658 Bacteria 20502
1223 Ga0466972_0006214 3300044658 Bacteria 6000
1224 Ga0466972_0490422 3300044658 Bacteria 578
1225 Ga0466965_0025770 3300044683 Bacteria 2848
1226 Ga0466965_0076067 3300044683 Bacteria 1694
1227 Ga0466965_0085411 3300044683 Bacteria 1600
1228 Ga0466965_0186238 3300044683 Bacteria 1096
1229 Ga0466965_0336110 3300044683 Bacteria 825
1230 Ga0466966_0000383 3300044684 Bacteria 28757
1231 Ga0466966_0138637 3300044684 Bacteria 1487
1232 Ga0466966_0213131 3300044684 Bacteria 1167
1233 Ga0466966_0359716 3300044684 Bacteria 874
1234 Ga0466961_0204769 3300044693 Bacteria 1219
1235 Ga0466961_0486598 3300044693 Bacteria 746
1236 Ga0466961_0750258 3300044693 Bacteria 583
1237 Ga0466963_0010998 3300044694 Bacteria 5502
1238 Ga0466963_0043465 3300044694 Bacteria 2954
1239 Ga0466963_0049392 3300044694 Bacteria 2782
1240 Ga0466963_0056459 3300044694 Bacteria 2613
1241 Ga0466963_0072087 3300044694 Bacteria 2326
1242 Ga0466963_0153201 3300044694 Bacteria 1601
1243 Ga0466963_0195228 3300044694 Bacteria 1415
1244 Ga0466963_0235627 3300044694 Bacteria 1283
1245 Ga0466963_0392175 3300044694 Bacteria 979
1246 Ga0466963_0413597 3300044694 Bacteria 951
1247 Ga0466963_0445545 3300044694 Bacteria 914
1248 Ga0466964_0133918 3300044706 Bacteria 1132
1249 Ga0466964_0329825 3300044706 Bacteria 778
1250 Ga0466964_0362360 3300044706 Bacteria 748
1251 Ga0466964_0411812 3300044706 Bacteria 709
1252 Ga0466964_0813611 3300044706 Bacteria 529
1253 Ga0453684_1459255 3300044712 Bacteria 707
1254 Ga0466971_0007279 3300044719 Bacteria 4818
1255 Ga0466971_0020494 3300044719 Bacteria 2939
1256 Ga0466971_0204032 3300044719 Bacteria 934
1257 Ga0466971_0215860 3300044719 Bacteria 908
1258 Ga0466971_0235788 3300044719 Bacteria 869
1259 Ga0466968_0004861 3300044735 Bacteria 5030
1260 Ga0466968_0054416 3300044735 Bacteria 1716
1261 Ga0466968_0073253 3300044735 Bacteria 1494
1262 Ga0466970_0071776 3300044765 Bacteria 1862
1263 Ga0466970_0164699 3300044765 Bacteria 1227
1264 Ga0466970_0207195 3300044765 Bacteria 1092
1265 Ga0466970_0800002 3300044765 Bacteria 552
1266 Ga0466957_0014920 3300044842 Bacteria 4532
1267 Ga0466957_0015313 3300044842 Bacteria 4480
1268 Ga0466957_0144176 3300044842 Bacteria 1536
1269 Ga0466957_0152249 3300044842 Bacteria 1496
1270 Ga0466957_0179224 3300044842 Bacteria 1383
1271 Ga0466957_0456231 3300044842 Bacteria 881
1272 Ga0466957_0940242 3300044842 Bacteria 619
1273 Ga0466960_0000533 3300044901 Bacteria 13018
1274 Ga0466960_0000908 3300044901 Bacteria 10485
1275 Ga0466960_0008863 3300044901 Bacteria 4132
1276 Ga0466960_0036156 3300044901 Bacteria 2312
1277 Ga0466960_0159790 3300044901 Bacteria 1209
1278 Ga0466960_0638681 3300044901 Bacteria 634
1279 Ga0466959_0020923 3300045049 Bacteria 4822
1280 Ga0466959_0256793 3300045049 Bacteria 1204
1281 Ga0466959_0290843 3300045049 Bacteria 1120
1282 Ga0466959_0321966 3300045049 Bacteria 1057
1283 Ga0466959_0392129 3300045049 Bacteria 944
1284 Ga0466959_0395751 3300045049 Bacteria 939
1285 Ga0466959_0515044 3300045049 Bacteria 808
1286 Ga0466959_0977525 3300045049 Bacteria 564
1287 Ga0466958_0019647 3300045836 Bacteria 3932
1288 Ga0466958_0035221 3300045836 Bacteria 2990
1289 Ga0466958_0037294 3300045836 Bacteria 2913
1290 Ga0466958_0357621 3300045836 Bacteria 940
1291 Ga0466958_0545140 3300045836 Bacteria 753
1292 Ga0466958_0891301 3300045836 Bacteria 580
1293 Ga0466958_1043655 3300045836 Bacteria 533
1294 Ga0466967_0007938 3300045976 Bacteria 7719
1295 Ga0466967_0008336 3300045976 Bacteria 7584
1296 Ga0466967_0065145 3300045976 Bacteria 3242
1297 Ga0466967_0073153 3300045976 Bacteria 3074
1298 Ga0466967_0106322 3300045976 Bacteria 2572
1299 Ga0466967_0115719 3300045976 Bacteria 2470
1300 Ga0466967_0169697 3300045976 Bacteria 2052
1301 Ga0466967_0238263 3300045976 Bacteria 1734
1302 Ga0466967_0243718 3300045976 Bacteria 1715
1303 Ga0466967_0262620 3300045976 Bacteria 1652
1304 Ga0466967_0374581 3300045976 Bacteria 1381
1305 Ga0466967_0486540 3300045976 Bacteria 1209
1306 Ga0466967_0523135 3300045976 Bacteria 1166
1307 Ga0466967_0529878 3300045976 Bacteria 1158
1308 Ga0466967_0593390 3300045976 Bacteria 1093
1309 Ga0466967_0785193 3300045976 Bacteria 945
1310 Ga0466967_1373912 3300045976 Bacteria 703
1311 Ga0466967_1374086 3300045976 Bacteria 703
1312 Ga0495592_0061738 3300046454 Bacteria 2753
1313 Ga0495592_0072146 3300046454 Bacteria 2512
1314 Ga0495592_0367408 3300046454 Bacteria 919
1315 Ga0495603_0365855 3300046455 Bacteria 827
1316 Ga0495590_0136878 3300046457 Bacteria 883
1317 Ga0495629_0004222 3300046459 Bacteria 10778
1318 Ga0495629_0298190 3300046459 Bacteria 1104
1319 Ga0495629_0455882 3300046459 Bacteria 865
1320 Ga0495629_1109646 3300046459 Bacteria 511
1321 Ga0495638_0044083 3300046460 Bacteria 2811
1322 Ga0495641_0009678 3300046461 Bacteria 5697
1323 Ga0495641_0254813 3300046461 Bacteria 789
1324 Ga0495651_0022386 3300046462 Bacteria 4911
1325 Ga0495651_0891235 3300046462 Bacteria 544
1326 Ga0495653_0052007 3300046463 Bacteria 3141
1327 Ga0495653_0247523 3300046463 Bacteria 1184
1328 Ga0495653_0302236 3300046463 Bacteria 1043
1329 Ga0495653_0333030 3300046463 Bacteria 980
1330 Ga0495650_0112962 3300046471 Bacteria 1007
1331 Ga0495650_0236782 3300046471 Bacteria 625
1332 Ga0495580_0032022 3300046472 Bacteria 3796
1333 Ga0495580_0244465 3300046472 Bacteria 1230
1334 Ga0495582_0009125 3300046473 Bacteria 5472
1335 Ga0495582_0057796 3300046473 Bacteria 2139
1336 Ga0495582_0287109 3300046473 Bacteria 945
1337 Ga0495582_0359685 3300046473 Bacteria 838
1338 Ga0495639_0025869 3300046475 Bacteria 2590
1339 Ga0495639_0163193 3300046475 Bacteria 1079
1340 Ga0495662_0008003 3300046476 Bacteria 5206
1341 Ga0495662_0010086 3300046476 Bacteria 4633
1342 Ga0495664_0073258 3300046477 Bacteria 2047
1343 Ga0495664_0166328 3300046477 Bacteria 1338
1344 Ga0495664_0214211 3300046477 Bacteria 1166
1345 Ga0495594_0019876 3300046499 Bacteria 3572
1346 Ga0495596_0289901 3300046500 Bacteria 636
1347 Ga0495596_0413783 3300046500 Bacteria 525
1348 Ga0495607_0188365 3300046501 Bacteria 1029
1349 Ga0495608_0009099 3300046511 Bacteria 6942
1350 Ga0495608_0022737 3300046511 Bacteria 4300
1351 Ga0495608_0045500 3300046511 Bacteria 2924
1352 Ga0495608_0463022 3300046511 Bacteria 770
1353 Ga0495610_0090814 3300046512 Bacteria 1385
1354 Ga0495616_0475045 3300046513 Bacteria 503
1355 Ga0495618_0019818 3300046514 Bacteria 4140
1356 Ga0495618_0041394 3300046514 Bacteria 2901
1357 Ga0495620_0115056 3300046515 Bacteria 1064
1358 Ga0495620_0124163 3300046515 Bacteria 1016
1359 Ga0495628_0006081 3300046516 Bacteria 10554
1360 Ga0495628_0060116 3300046516 Bacteria 2982
1361 Ga0495630_0070040 3300046517 Bacteria 2638
1362 Ga0495630_0123303 3300046517 Bacteria 1966
1363 Ga0495630_1253383 3300046517 Bacteria 560
1364 Ga0495631_0109348 3300046518 Bacteria 1189
1365 Ga0495631_0275711 3300046518 Bacteria 716
1366 Ga0495632_0386319 3300046519 Bacteria 613
1367 Ga0495666_0020565 3300046526 Bacteria 3268
1368 Ga0495652_0028241 3300046529 Bacteria 4938
1369 Ga0495652_0078581 3300046529 Bacteria 2730
1370 Ga0495665_0010115 3300046531 Bacteria 5110
1371 Ga0495665_0021929 3300046531 Bacteria 3434
1372 Ga0495665_0172337 3300046531 Bacteria 1126
1373 Ga0495665_0239947 3300046531 Bacteria 934
1374 Ga0495640_0009511 3300046533 Bacteria 7566
1375 Ga0495640_0140168 3300046533 Bacteria 1559
1376 Ga0495586_0007029 3300046535 Bacteria 6000
1377 Ga0495586_0026425 3300046535 Bacteria 3106
1378 Ga0495587_0025211 3300046536 Bacteria 3634
1379 Ga0495587_0270951 3300046536 Bacteria 952
1380 Ga0495587_0580709 3300046536 Bacteria 618
1381 Ga0495621_0010604 3300046539 Bacteria 2826
1382 Ga0495645_0014290 3300046543 Bacteria 5629
1383 Ga0495645_0161902 3300046543 Bacteria 1546
1384 Ga0495645_0323383 3300046543 Bacteria 1001
1385 Ga0495667_0089320 3300046559 Bacteria 1997
1386 Ga0495667_0099963 3300046559 Bacteria 1877
1387 Ga0495667_0206080 3300046559 Bacteria 1257
1388 Ga0495656_0264666 3300046615 Bacteria 872
1389 Ga0495656_0297732 3300046615 Bacteria 826
1390 Ga0495668_0000509 3300046616 Bacteria 48446
1391 Ga0495668_0059405 3300046616 Bacteria 2110
1392 Ga0495668_0128569 3300046616 Bacteria 1387
1393 Ga0495668_0419445 3300046616 Bacteria 736
1394 Ga0495634_0015911 3300046642 Bacteria 5388
1395 Ga0495634_0132120 3300046642 Bacteria 1590
1396 Ga0495634_0192584 3300046642 Bacteria 1271
1397 Ga0495634_0371297 3300046642 Bacteria 854
1398 Ga0495634_0543920 3300046642 Bacteria 678
1399 Ga0495634_0604811 3300046642 Bacteria 636
1400 Ga0495635_0028891 3300046663 Bacteria 3854
1401 Ga0495635_0062183 3300046663 Bacteria 2563
1402 Ga0495635_0300264 3300046663 Bacteria 1077
1403 Ga0495635_0786685 3300046663 Bacteria 614
1404 Ga0495588_0066400 3300046674 Bacteria 1872
1405 Ga0495588_0185847 3300046674 Bacteria 1098
1406 Ga0495588_0197050 3300046674 Bacteria 1064
1407 Ga0495657_0038575 3300046675 Bacteria 3286
1408 Ga0495657_0453603 3300046675 Bacteria 750
1409 Ga0495599_0027775 3300046678 Bacteria 3545
1410 Ga0495599_0138887 3300046678 Bacteria 1507
1411 Ga0495623_0066615 3300046679 Bacteria 2249
1412 Ga0495623_0394141 3300046679 Bacteria 746
1413 Ga0495646_0013551 3300046680 Bacteria 5183
1414 Ga0495646_0025121 3300046680 Bacteria 3748
1415 Ga0495646_0166063 3300046680 Bacteria 1219
1416 Ga0495647_0007780 3300046681 Bacteria 3599
1417 Ga0495647_0257719 3300046681 Bacteria 778
1418 Ga0495658_0005793 3300046683 Bacteria 6064
1419 Ga0495658_0144979 3300046683 Bacteria 1454
1420 Ga0495658_0152966 3300046683 Bacteria 1418
1421 Ga0495658_0245200 3300046683 Bacteria 1126
1422 Ga0495658_0373522 3300046683 Bacteria 907
1423 Ga0495658_0401524 3300046683 Bacteria 874
1424 Ga0495658_0541312 3300046683 Bacteria 745
1425 Ga0495658_0786005 3300046683 Bacteria 609
1426 Ga0495613_0017693 3300046689 Bacteria 5310
1427 Ga0495613_0155166 3300046689 Bacteria 1631
1428 Ga0495613_0812466 3300046689 Bacteria 610
1429 Ga0495624_0032525 3300046690 Bacteria 3381
1430 Ga0495624_0310924 3300046690 Bacteria 949
1431 Ga0495624_0607462 3300046690 Bacteria 652
1432 Ga0495671_0281147 3300046692 Bacteria 802
1433 Ga0495649_0039261 3300046694 Bacteria 2596
1434 Ga0495600_0039666 3300046809 Bacteria 3066
1435 Ga0495600_0044801 3300046809 Bacteria 2885
1436 Ga0495600_0686248 3300046809 Bacteria 617
1437 Ga0495581_0023771 3300047315 Bacteria 3551
1438 Ga0495604_0092975 3300047317 Bacteria 2232
1439 Ga0495604_0114479 3300047317 Bacteria 1961
1440 Ga0495674_0032123 3300047319 Bacteria 4764
1441 Ga0495674_0082380 3300047319 Bacteria 2758
1442 Ga0495674_0217428 3300047319 Bacteria 1581
1443 Ga0495672_0020537 3300047320 Bacteria 4324
1444 Ga0495672_0166918 3300047320 Bacteria 1126
1445 Ga0495676_0050370 3300047321 Bacteria 3340
1446 Ga0495676_0071974 3300047321 Bacteria 2656
1447 Ga0495680_0027683 3300047322 Bacteria 4652
1448 Ga0495680_0048696 3300047322 Bacteria 3326
1449 Ga0495680_0136374 3300047322 Bacteria 1799
1450 Ga0495680_0734873 3300047322 Bacteria 649
1451 Ga0495683_0002868 3300047323 Bacteria 10200
1452 Ga0495675_0024123 3300047444 Bacteria 3876
1453 Ga0495675_0331673 3300047444 Bacteria 898
1454 Ga0495677_0054019 3300047445 Bacteria 1482
1455 Ga0495684_0004161 3300047471 Bacteria 11297
1456 Ga0495684_0096482 3300047471 Bacteria 2237
1457 Ga0495684_0841053 3300047471 Bacteria 596
1458 Ga0495686_0003291 3300047472 Bacteria 14122
1459 Ga0495686_0111188 3300047472 Bacteria 1643
1460 Ga0495593_0003319 3300047673 Bacteria 9645
1461 Ga0495602_0013833 3300048088 Bacteria 8227
1462 Ga0495602_0083198 3300048088 Bacteria 2682
1463 Ga0495614_0096400 3300048089 Bacteria 1290
1464 Ga0495614_0097658 3300048089 Bacteria 1281
1465 Ga0495614_0112935 3300048089 Bacteria 1194
1466 Ga0495614_0208677 3300048089 Bacteria 885
1467 Ga0495626_0242522 3300048091 Bacteria 725
1468 Ga0496100_0091178 3300048903 Bacteria 2079
1469 Ga0496100_0192299 3300048903 Bacteria 1482
1470 Ga0496100_0710810 3300048903 Bacteria 784
1471 Ga0496100_1434383 3300048903 Bacteria 545
1472 Ga0496101_0085853 3300048904 Bacteria 2333
1473 Ga0496101_0100238 3300048904 Bacteria 2166
1474 Ga0496101_1474280 3300048904 Bacteria 530
1475 Ga0496102_0163736 3300048905 Bacteria 2092
1476 Ga0496102_0346594 3300048905 Bacteria 1398
1477 Ga0496102_0413504 3300048905 Bacteria 1267
1478 Ga0496102_0429657 3300048905 Bacteria 1240
1479 Ga0496102_0702133 3300048905 Bacteria 934
1480 Ga0496102_1415271 3300048905 Bacteria 614
1481 Ga0496103_0085017 3300048906 Bacteria 1994
1482 Ga0496103_0127963 3300048906 Bacteria 1620
1483 Ga0496103_0135378 3300048906 Bacteria 1574
1484 Ga0496103_0434505 3300048906 Bacteria 842
1485 Ga0496104_0014968 3300048907 Bacteria 7016
1486 Ga0496104_0168785 3300048907 Bacteria 2098
1487 Ga0496104_0323715 3300048907 Bacteria 1455
1488 Ga0496104_0412306 3300048907 Bacteria 1263
1489 Ga0496104_0414448 3300048907 Bacteria 1259
1490 Ga0496105_0078709 3300048908 Bacteria 2722
1491 Ga0496105_0104287 3300048908 Bacteria 2341
1492 Ga0496105_0106535 3300048908 Bacteria 2314
1493 Ga0496105_0144654 3300048908 Bacteria 1955
1494 Ga0496105_0265243 3300048908 Bacteria 1388
1495 Ga0496105_0475047 3300048908 Bacteria 984
1496 Ga0496105_0871055 3300048908 Bacteria 680
1497 Ga0496105_1378557 3300048908 Bacteria 511
1498 Ga0496106_0047608 3300048909 Bacteria 3227
1499 Ga0496106_0309435 3300048909 Bacteria 1267
1500 Ga0496106_0679074 3300048909 Bacteria 822
1501 Ga0496107_0010178 3300048910 Bacteria 6523
1502 Ga0496107_0440191 3300048910 Bacteria 969
1503 Ga0496107_1218803 3300048910 Bacteria 540
1504 Ga0496108_0000394 3300048911 Bacteria 36076
1505 Ga0496108_0001515 3300048911 Bacteria 18387
1506 Ga0496108_0016331 3300048911 Bacteria 6055
1507 Ga0496108_0026104 3300048911 Bacteria 4818
1508 Ga0496108_0028389 3300048911 Bacteria 4629
1509 Ga0496108_0067497 3300048911 Bacteria 3016
1510 Ga0496108_0475841 3300048911 Bacteria 1091
1511 Ga0496108_0949450 3300048911 Bacteria 736
1512 Ga0496108_1284128 3300048911 Bacteria 616
1513 Ga0496108_1688181 3300048911 Bacteria 522
1514 Ga0496109_0008622 3300048912 Bacteria 8680
1515 Ga0496109_0015777 3300048912 Bacteria 6594
1516 Ga0496109_0025845 3300048912 Bacteria 5233
1517 Ga0496109_0054075 3300048912 Bacteria 3663
1518 Ga0496109_0059705 3300048912 Bacteria 3484
1519 Ga0496109_0147821 3300048912 Bacteria 2199
1520 Ga0496109_0174571 3300048912 Bacteria 2017
1521 Ga0496109_0824600 3300048912 Bacteria 865
1522 Ga0496109_1680357 3300048912 Bacteria 569
1523 Ga0496110_0004143 3300048913 Bacteria 11207
1524 Ga0496110_0012641 3300048913 Bacteria 6946
1525 Ga0496110_0027034 3300048913 Bacteria 4916
1526 Ga0496110_0193348 3300048913 Bacteria 1847
1527 Ga0496110_0490060 3300048913 Bacteria 1119
1528 Ga0496110_0716254 3300048913 Bacteria 903
1529 Ga0496110_0735326 3300048913 Bacteria 889
1530 Ga0496110_0840412 3300048913 Bacteria 823
1531 Ga0496111_0011467 3300048914 Bacteria 5971
1532 Ga0496111_0011991 3300048914 Bacteria 5858
1533 Ga0496111_0298462 3300048914 Bacteria 1194
1534 Ga0496111_0659842 3300048914 Bacteria 763
1535 Ga0496111_0662985 3300048914 Bacteria 761
1536 Ga0496111_1043470 3300048914 Bacteria 584
1537 Ga0496112_0088274 3300048915 Bacteria 3069
1538 Ga0496112_0249649 3300048915 Bacteria 1726
1539 Ga0496112_0288501 3300048915 Bacteria 1587
1540 Ga0496112_0369186 3300048915 Bacteria 1376
1541 Ga0496112_0566177 3300048915 Bacteria 1069
1542 Ga0496112_0566398 3300048915 Bacteria 1069
1543 Ga0496112_1298014 3300048915 Bacteria 643
1544 Ga0496113_0095125 3300048916 Bacteria 2302
1545 Ga0496113_0113223 3300048916 Bacteria 2114
1546 Ga0496113_0133350 3300048916 Bacteria 1950
1547 Ga0496113_0134486 3300048916 Bacteria 1942
1548 Ga0496113_0145175 3300048916 Bacteria 1869
1549 Ga0496113_0331031 3300048916 Bacteria 1221
1550 Ga0496113_1112264 3300048916 Bacteria 619
1551 Ga0496113_1322160 3300048916 Bacteria 560
1552 Ga0496114_0018213 3300048917 Bacteria 5675
1553 Ga0496114_0037300 3300048917 Bacteria 4019
1554 Ga0496114_0037365 3300048917 Bacteria 4016
1555 Ga0496114_0275587 3300048917 Bacteria 1482
1556 Ga0496114_0296028 3300048917 Bacteria 1428
1557 Ga0496114_1148638 3300048917 Bacteria 662
1558 Ga0496115_0053152 3300048918 Bacteria 3250
1559 Ga0496115_0096285 3300048918 Bacteria 2423
1560 Ga0496115_0316748 3300048918 Bacteria 1276
1561 Ga0496115_0563085 3300048918 Bacteria 910
1562 Ga0496115_0629412 3300048918 Bacteria 850
1563 Ga0496115_1285589 3300048918 Bacteria 546
1564 Ga0496117_0103373 3300048920 Bacteria 1795
1565 Ga0496117_0184944 3300048920 Bacteria 1193
1566 Ga0496118_0001260 3300048921 Bacteria 38829
1567 Ga0496118_0007173 3300048921 Bacteria 11916
1568 Ga0496119_0010999 3300048922 Bacteria 7550
1569 Ga0496119_0032653 3300048922 Bacteria 3466
1570 Ga0496119_0158815 3300048922 Bacteria 1204
1571 Ga0496119_0187404 3300048922 Bacteria 1081
1572 Ga0496120_0030224 3300048923 Bacteria 3297
1573 Ga0496120_0149998 3300048923 Bacteria 1173
1574 Ga0496121_0803842 3300048924 Bacteria 552
1575 Ga0496122_0001412 3300048925 Bacteria 38911
1576 Ga0496122_0172045 3300048925 Bacteria 1304
1577 Ga0496122_0278196 3300048925 Bacteria 917
1578 Ga0496123_0177626 3300048926 Bacteria 1115
1579 Ga0496123_0247408 3300048926 Bacteria 882
1580 Ga0496124_0068795 3300048927 Bacteria 2941
1581 Ga0496124_0187875 3300048927 Bacteria 1584
1582 Ga0496124_0460501 3300048927 Bacteria 864
1583 Ga0496125_0000086 3300048928 Bacteria 216489
1584 Ga0496125_0027838 3300048928 Bacteria 5114
1585 Ga0496125_0096987 3300048928 Bacteria 2186
1586 Ga0496125_0696133 3300048928 Bacteria 540
1587 Ga0496126_0011857 3300048929 Bacteria 8968
1588 Ga0496126_0022728 3300048929 Bacteria 6091
1589 Ga0496126_0098258 3300048929 Bacteria 2565
1590 Ga0496126_0170583 3300048929 Bacteria 1854
1591 Ga0496126_0472159 3300048929 Bacteria 1006
1592 Ga0501306_003491 3300049127 Bacteria 1698
1593 Ga0501306_010084 3300049127 Bacteria 1183
1594 Ga0501306_017435 3300049127 Bacteria 974
1595 Ga0501306_056353 3300049127 Bacteria 640
1596 Ga0501308_004882 3300049128 Bacteria 1312
1597 Ga0501308_011965 3300049128 Bacteria 985
1598 Ga0501308_018367 3300049128 Bacteria 855
1599 Ga0501309_013492 3300049129 Bacteria 1087
1600 Ga0501309_025796 3300049129 Bacteria 846
1601 Ga0501309_026974 3300049129 Bacteria 831
1602 Ga0501310_026534 3300049130 Bacteria 751
1603 Ga0501310_042249 3300049130 Bacteria 638
1604 Ga0501341_02817 3300049131 Bacteria 959
1605 Ga0501343_006371 3300049132 Bacteria 920
1606 Ga0501345_02760 3300049134 Bacteria 739
1607 Ga0501304_005327 3300049160 Bacteria 1005
1608 Ga0501305_035354 3300049161 Bacteria 795
1609 Ga0501307_006265 3300049162 Bacteria 1280
1610 Ga0501307_025664 3300049162 Bacteria 792
1611 Ga0495678_221531 3300049459 Bacteria 574
1612 Ga0501311_004858 3300049527 Bacteria 1448
1613 Ga0501311_007879 3300049527 Bacteria 1236
1614 Ga0501311_099077 3300049527 Bacteria 514
1615 Ga0501312_005556 3300049528 Bacteria 1537
1616 Ga0501312_007002 3300049528 Bacteria 1425
1617 Ga0501313_007646 3300049529 Bacteria 1194
1618 Ga0501315_002746 3300049531 Bacteria 1693
1619 Ga0501315_003476 3300049531 Bacteria 1580
1620 Ga0501315_019581 3300049531 Bacteria 902
1621 Ga0501315_022828 3300049531 Bacteria 855
1622 Ga0501316_002256 3300049532 Bacteria 1765
1623 Ga0501316_007989 3300049532 Bacteria 1160
1624 Ga0501316_009885 3300049532 Bacteria 1078
1625 Ga0501316_015895 3300049532 Bacteria 910
1626 Ga0501317_001119 3300049533 Bacteria 2219
1627 Ga0501317_003573 3300049533 Bacteria 1560
1628 Ga0501317_005389 3300049533 Bacteria 1368
1629 Ga0501317_016320 3300049533 Bacteria 962
1630 Ga0501317_020993 3300049533 Bacteria 884
1631 Ga0501317_037503 3300049533 Bacteria 728
1632 Ga0501318_001483 3300049534 Bacteria 1858
1633 Ga0501318_002761 3300049534 Bacteria 1553
1634 Ga0501318_013014 3300049534 Bacteria 962
1635 Ga0501318_014589 3300049534 Bacteria 929
1636 Ga0501318_015033 3300049534 Bacteria 920
1637 Ga0501318_021760 3300049534 Bacteria 817
1638 Ga0501318_063153 3300049534 Bacteria 572
1639 Ga0501319_002366 3300049535 Bacteria 1189
1640 Ga0501319_006520 3300049535 Bacteria 864
1641 Ga0501320_000888 3300049536 Bacteria 1964
1642 Ga0501320_004374 3300049536 Bacteria 1245
1643 Ga0501320_008060 3300049536 Bacteria 1028
1644 Ga0501320_035149 3300049536 Bacteria 638
1645 Ga0501321_001097 3300049537 Bacteria 2051
1646 Ga0501321_002837 3300049537 Bacteria 1541
1647 Ga0501321_022906 3300049537 Bacteria 789
1648 Ga0501322_009917 3300049538 Bacteria 727
1649 Ga0501322_016830 3300049538 Bacteria 615
1650 Ga0501322_030094 3300049538 Bacteria 510
1651 Ga0501323_000539 3300049539 Bacteria 2855
1652 Ga0501323_023339 3300049539 Bacteria 830
1653 Ga0501323_027726 3300049539 Bacteria 781
1654 Ga0501324_000010 3300049540 Bacteria 6825
1655 Ga0501325_001682 3300049541 Bacteria 1407
1656 Ga0501325_005394 3300049541 Bacteria 1015
1657 Ga0501325_011325 3300049541 Bacteria 822
1658 Ga0501326_02636 3300049542 Bacteria 891
1659 Ga0501329_01750 3300049545 Bacteria 984
1660 Ga0501330_002423 3300049546 Bacteria 1057
1661 Ga0501330_004730 3300049546 Bacteria 849
1662 Ga0501331_01798 3300049547 Bacteria 1079
1663 Ga0501334_02717 3300049550 Bacteria 1062
1664 Ga0501335_006923 3300049551 Bacteria 1039
1665 Ga0501336_003497 3300049552 Bacteria 1066
1666 Ga0501339_00289 3300049555 Bacteria 959
1667 Ga0501340_002383 3300049556 Bacteria 1085
1668 Ga0501031_0080470 3300049568 Bacteria 2123
1669 Ga0501032_0367807 3300049569 Bacteria 925
1670 Ga0501033_0018926 3300049570 Bacteria 5205
1671 Ga0501033_0095500 3300049570 Bacteria 2173
1672 Ga0501033_0385905 3300049570 Bacteria 978
1673 Ga0501034_0016509 3300049571 Bacteria 7574
1674 Ga0501034_0051107 3300049571 Bacteria 4168
1675 Ga0501034_0855009 3300049571 Bacteria 800
1676 Ga0501034_0882546 3300049571 Bacteria 783
1677 Ga0501034_0966066 3300049571 Bacteria 737
1678 Ga0501036_0037401 3300049572 Bacteria 4106
1679 Ga0501036_0554857 3300049572 Bacteria 954
1680 Ga0501036_0853537 3300049572 Bacteria 748
1681 Ga0501037_0063557 3300049573 Bacteria 2690
1682 Ga0501037_0485159 3300049573 Bacteria 840
1683 Ga0501038_0021480 3300049574 Bacteria 5792
1684 Ga0501038_0186884 3300049574 Bacteria 1669
1685 Ga0501039_0777360 3300049575 Bacteria 747
1686 Ga0501040_0613000 3300049576 Bacteria 786
1687 Ga0501041_0022527 3300049577 Bacteria 3772
1688 Ga0501041_0550187 3300049577 Bacteria 735
1689 Ga0501042_0018748 3300049578 Bacteria 4795
1690 Ga0501043_0024981 3300049579 Bacteria 4688
1691 Ga0501043_0300656 3300049579 Bacteria 1226
1692 Ga0501046_0658038 3300049580 Bacteria 740
1693 Ga0501047_0042683 3300049581 Bacteria 4381
1694 Ga0501047_0131139 3300049581 Bacteria 2387
1695 Ga0501047_0146277 3300049581 Bacteria 2240
1696 Ga0501047_0187772 3300049581 Bacteria 1931
1697 Ga0501047_0516081 3300049581 Bacteria 1021
1698 Ga0501047_0681433 3300049581 Bacteria 846
1699 Ga0501048_0052303 3300049582 Bacteria 2906
1700 Ga0501048_0661166 3300049582 Bacteria 750
1701 Ga0501048_1043826 3300049582 Bacteria 588
1702 Ga0501067_0077464 3300049583 Bacteria 1842
1703 Ga0501067_0152539 3300049583 Bacteria 1287
1704 Ga0501068_0430597 3300049584 Bacteria 852
1705 Ga0501068_0516047 3300049584 Bacteria 776
1706 Ga0501068_0544010 3300049584 Bacteria 755
1707 Ga0501069_0076429 3300049585 Bacteria 1883
1708 Ga0501069_0119849 3300049585 Bacteria 1502
1709 Ga0501070_0004983 3300049586 Bacteria 11332
1710 Ga0501070_0508396 3300049586 Bacteria 967
1711 Ga0501071_0075875 3300049587 Bacteria 2454
1712 Ga0501072_0105438 3300049588 Bacteria 2241
1713 Ga0501072_0153562 3300049588 Bacteria 1836
1714 Ga0501073_0014388 3300049589 Bacteria 5750
1715 Ga0501074_0002804 3300049590 Bacteria 12192
1716 Ga0501074_0045693 3300049590 Bacteria 3167
1717 Ga0501075_0134635 3300049591 Bacteria 1882
1718 Ga0501076_0209511 3300049592 Bacteria 1592
1719 Ga0501076_0622239 3300049592 Bacteria 891
1720 Ga0501077_0063375 3300049593 Bacteria 2345
1721 Ga0501079_0099906 3300049741 Bacteria 2249
1722 Ga0501079_0350904 3300049741 Bacteria 1156
1723 Ga0501080_0329022 3300049742 Bacteria 1382
1724 Ga0501035_0038527 3300049822 Bacteria 4327
1725 Ga0501035_0110254 3300049822 Bacteria 2412
1726 Ga0501035_0114379 3300049822 Bacteria 2363
1727 Ga0501035_0147188 3300049822 Bacteria 2045
1728 Ga0501044_0001781 3300049823 Bacteria 25182
1729 Ga0501044_0019028 3300049823 Bacteria 7353
1730 Ga0501044_0066267 3300049823 Bacteria 3683
1731 Ga0501044_0186638 3300049823 Bacteria 2038
1732 Ga0501044_0378589 3300049823 Bacteria 1331
1733 Ga0501044_1016167 3300049823 Bacteria 700
1734 Ga0501045_0198872 3300049824 Bacteria 1493
1735 nmdc:mga03683_384112_c1 3300050489 Bacteria 669
1736 nmdc:mga03n38_22870_c1 3300050490 Bacteria 2536
1737 nmdc:mga03n38_31633_c1 3300050490 Bacteria 2235
1738 nmdc:mga03n38_398006_c1 3300050490 Bacteria 758
1739 nmdc:mga03n38_65358_c1 3300050490 Bacteria 1668
1740 nmdc:mga00v17_2711_c1 3300050491 Bacteria 9089
1741 nmdc:mga00v17_48225_c1 3300050491 Bacteria 2581
1742 nmdc:mga00v17_958_c1 3300050491 Bacteria 15464
1743 nmdc:mga0yw44_558839_c1 3300050492 Bacteria 777
1744 nmdc:mga07m45_11732_c1 3300050496 Bacteria 4611
1745 nmdc:mga07m45_149073_c1 3300050496 Bacteria 1356
1746 nmdc:mga07m45_161812_c1 3300050496 Bacteria 1299
1747 nmdc:mga07m45_292859_c2 3300050496 Bacteria 576
1748 nmdc:mga07m45_349572_c1 3300050496 Bacteria 859
1749 nmdc:mga07m45_5415_c1 3300050496 Bacteria 6350
1750 nmdc:mga09592_61988_c1 3300050508 Bacteria 3163
1751 nmdc:mga0n895_246356_c1 3300050512 Bacteria 1814
1752 nmdc:mga08x19_73253_c1 3300050514 Bacteria 2236
1753 nmdc:mga0sz30_2131_c1 3300050516 Bacteria 3655
1754 nmdc:mga0sz30_326574_c1 3300050516 Bacteria 685
1755 nmdc:mga0sz30_6746_c2 3300050516 Bacteria 1712
1756 nmdc:mga0sz30_89399_c1 3300050516 Bacteria 1339
1757 nmdc:mga0sz30_9944_c1 3300050516 Bacteria 3633
1758 Ga0495601_0008187 3300053077 Bacteria 6166
1759 Ga0495601_0010722 3300053077 Bacteria 5467
1760 Ga0495601_0287144 3300053077 Bacteria 1072
1761 Ga0495612_0025359 3300053078 Bacteria 2380
1762 Ga0495612_0034730 3300053078 Bacteria 2042
1763 Ga0495612_0122477 3300053078 Bacteria 1119
1764 Ga0495612_0350429 3300053078 Bacteria 667
1765 Ga0500635_0320329 3300053080 Bacteria 613
1766 Ga0495655_0251992 3300053083 Bacteria 594
1767 Ga0495595_0016795 3300053084 Bacteria 3137
1768 Ga0495595_0068351 3300053084 Bacteria 1675
1769 Ga0495595_0150874 3300053084 Bacteria 1144
1770 Ga0495619_0050871 3300053085 Bacteria 2736
1771 Ga0495619_0079703 3300053085 Bacteria 2203
1772 Ga0495619_0188604 3300053085 Bacteria 1427
1773 Ga0495619_0352703 3300053085 Bacteria 1018
1774 Ga0500578_0065527 3300053086 Bacteria 2317
1775 Ga0500583_0476014 3300053092 Bacteria 590
1776 Ga0500641_0000363 3300053096 Bacteria 16791
1777 Ga0500641_0285173 3300053096 Bacteria 683
1778 Ga0500556_0046105 3300053104 Bacteria 1558
1779 Ga0500562_006102 3300053108 Bacteria 3034
1780 Ga0500562_094435 3300053108 Bacteria 813
1781 Ga0500562_190885 3300053108 Bacteria 556
1782 Ga0500592_053543 3300053116 Bacteria 657
1783 Ga0500642_0006030 3300053130 Bacteria 3960
1784 Ga0500642_0281344 3300053130 Bacteria 756
1785 Ga0500652_278957 3300053131 Bacteria 653
1786 Ga0500658_0256755 3300053134 Bacteria 803
1787 Ga0500559_0036373 3300053136 Bacteria 2129
1788 Ga0500568_0069854 3300053139 Bacteria 1346
1789 Ga0500588_0412599 3300053146 Bacteria 514
1790 Ga0500616_0051871 3300053153 Bacteria 2159
1791 Ga0500622_0327163 3300053156 Bacteria 644
1792 Ga0500611_254895 3300053727 Bacteria 506
1793 Ga0500645_000323 3300053730 Bacteria 33881
1794 Ga0501084_0042157 3300054114 Bacteria 3817
1795 Ga0501084_1334665 3300054114 Bacteria 601
1796 Ga0587084_005492 3300059477 Bacteria 1503
1797 Ga0587084_108187 3300059477 Bacteria 571
1798 Ga0587093_058207 3300059478 Bacteria 625
1799 Ga0587093_103445 3300059478 Bacteria 517
1800 Ga0587066_039088 3300059490 Bacteria 886
1801 Ga0587066_126145 3300059490 Bacteria 610
1802 Ga0587070_041952 3300059491 Bacteria 879
1803 Ga0587070_228714 3300059491 Bacteria 508
1804 Ga0587073_0021819 3300059492 Bacteria 1236
1805 Ga0587077_116916 3300059493 Bacteria 660
1806 Ga0587080_080029 3300059503 Bacteria 669
1807 Ga0587080_117594 3300059503 Bacteria 586
1808 Ga0587080_127434 3300059503 Bacteria 570
1809 Ga0587080_137077 3300059503 Bacteria 556
1810 Ga0587082_017627 3300059504 Bacteria 1127
1811 Ga0587082_032324 3300059504 Bacteria 919
1812 Ga0587082_152991 3300059504 Bacteria 547
1813 Ga0587083_0003149 3300059505 Bacteria 2154
1814 Ga0587083_0030679 3300059505 Bacteria 1068
1815 Ga0587086_014740 3300059507 Bacteria 1001
1816 Ga0587088_055761 3300059508 Bacteria 787
1817 Ga0587088_095075 3300059508 Bacteria 658
1818 Ga0587088_117981 3300059508 Bacteria 611
1819 Ga0587088_150846 3300059508 Bacteria 562
1820 Ga0587091_009412 3300059511 Bacteria 1471
1821 Ga0587091_033593 3300059511 Bacteria 976
1822 Ga0587092_036111 3300059512 Bacteria 840
1823 Ga0587095_036842 3300059514 Bacteria 523
1824 Ga0587095_038656 3300059514 Bacteria 516
1825 Ga0587098_008252 3300059604 Bacteria 1103
1826 Ga0587106_000824 3300059605 Bacteria 2453
1827 Ga0587106_163639 3300059605 Bacteria 503
1828 Ga0587131_004089 3300059609 Bacteria 868
1829 Ga0587099_048083 3300059622 Bacteria 563
1830 Ga0587101_004376 3300059623 Bacteria 1506
1831 Ga0587115_014968 3300059626 Bacteria 1022
1832 Ga0587115_023589 3300059626 Bacteria 873
1833 Ga0587117_041216 3300059627 Bacteria 736
1834 Ga0587117_075804 3300059627 Bacteria 604
1835 Ga0587122_005204 3300059628 Bacteria 1083
1836 Ga0587122_016964 3300059628 Bacteria 758
1837 Ga0587128_045795 3300059630 Bacteria 782
1838 Ga0587128_090712 3300059630 Bacteria 626
1839 Ga0587128_096288 3300059630 Bacteria 614
1840 Ga0587062_002899 3300059639 Bacteria 1682
1841 Ga0587062_016073 3300059639 Bacteria 1007
1842 Ga0587067_211288 3300059640 Bacteria 521
1843 Ga0587068_001416 3300059641 Bacteria 2684
1844 Ga0587069_005095 3300059642 Bacteria 1513
1845 Ga0587069_165265 3300059642 Bacteria 500
1846 Ga0587072_032981 3300059643 Bacteria 975
1847 Ga0587075_045457 3300059644 Bacteria 750
1848 Ga0587075_046182 3300059644 Bacteria 746
1849 Ga0587075_065116 3300059644 Bacteria 666
1850 Ga0587076_145870 3300059645 Bacteria 570
1851 Ga0587076_172177 3300059645 Bacteria 540
1852 Ga0587079_044421 3300059647 Bacteria 910
1853 Ga0587079_083719 3300059647 Bacteria 734
1854 Ga0587079_136003 3300059647 Bacteria 622
1855 Ga0587107_007847 3300059652 Bacteria 1214
1856 Ga0587110_038457 3300059654 Bacteria 607
1857 Ga0587119_016371 3300059658 Bacteria 907
1858 Ga0587119_035124 3300059658 Bacteria 700
1859 Ga0587124_008953 3300059660 Bacteria 869
1860 Ga0587071_043399 3300060344 Bacteria 909
1861 Ga0587071_100577 3300060344 Bacteria 668
1862 Ga0587111_0018608 3300060346 Bacteria 1309
1863 Ga0501082_0086191 3300060353 Bacteria 2709
1864 Ga0466962_0004292 3300061719 Bacteria 6831
1865 Ga0466962_0056659 3300061719 Bacteria 1871
1866 Ga0466962_0058121 3300061719 Bacteria 1846
1867 Ga0466962_0074020 3300061719 Bacteria 1628
1868 Ga0466962_0421950 3300061719 Bacteria 669
1869 Ga0530510_0090696 3300061734 Bacteria 2229

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032168 Ga0316593_10009690 Ga0316593_100096904 85
2 3300033541 Ga0316596_1000140 Ga0316596_100014018 85
3 3300036712 Ga0316584_0009403 Ga0316584_0009403_1154_1453 85
4 3300031727 Ga0316576_10290360 Ga0316576_102903602 86
5 3300031728 Ga0316578_10222609 Ga0316578_102226092 86
6 3300032133 Ga0316583_10130276 Ga0316583_101302762 86
7 3300032139 Ga0316580_10219549 Ga0316580_102195491 86
8 3300033524 Ga0316592_1007426 Ga0316592_10074262 86
9 3300033541 Ga0316596_1006375 Ga0316596_10063752 86
10 3300035398 Ga0316574_0178719 Ga0316574_0178719_374_673 86
11 3300036647 Ga0316582_0520082 Ga0316582_0520082_165_464 86
12 3300036712 Ga0316584_0127940 Ga0316584_0127940_927_1226 86
13 3300059605 Ga0587106_163639 Ga0587106_163639_110_415 89
14 3300049572 Ga0501036_0554857 Ga0501036_0554857_26_298 90
15 3300013104 Ga0157370_10800213 Ga0157370_108002132 91
16 3300049585 Ga0501069_0119849 Ga0501069_0119849_536_811 91
17 iso_pu_bacteria 2837183177 2837185923 91
18 3300005327 Ga0070658_10670380 Ga0070658_106703802 92
19 3300005337 Ga0070682_100022692 Ga0070682_1000226922 92
20 3300005341 Ga0070691_10813303 Ga0070691_108133032 92
21 3300005344 Ga0070661_100538813 Ga0070661_1005388132 92
22 3300005345 Ga0070692_10397584 Ga0070692_103975842 92
23 3300005347 Ga0070668_100857714 Ga0070668_1008577142 92
24 3300005354 Ga0070675_101375582 Ga0070675_1013755822 92
25 3300005366 Ga0070659_100942734 Ga0070659_1009427341 92
26 3300005455 Ga0070663_100055306 Ga0070663_1000553063 92
27 3300005535 Ga0070684_101014798 Ga0070684_1010147982 92
28 3300005564 Ga0070664_100506842 Ga0070664_1005068422 92
29 3300005615 Ga0070702_100480967 Ga0070702_1004809672 92
30 3300005834 Ga0068851_10241831 Ga0068851_102418311 92
31 3300006048 Ga0075363_100016799 Ga0075363_1000167995 92
32 3300006358 Ga0068871_101296728 Ga0068871_1012967282 92
33 3300009098 Ga0105245_10331477 Ga0105245_103314773 92
34 3300009174 Ga0105241_10535843 Ga0105241_105358432 92
35 3300009177 Ga0105248_13310277 Ga0105248_133102772 92
36 3300009545 Ga0105237_11995228 Ga0105237_119952281 92
37 3300013296 Ga0157374_11695415 Ga0157374_116954151 92
38 3300047320 Ga0495672_0020537 Ga0495672_0020537_3083_3400 92
39 3300006048 Ga0075363_100000106 Ga0075363_10000010624 93
40 3300006051 Ga0075364_10000119 Ga0075364_1000011930 93
41 3300006178 Ga0075367_10604860 Ga0075367_106048601 93
42 3300006186 Ga0075369_10006299 Ga0075369_100062995 93
43 3300006353 Ga0075370_10014981 Ga0075370_100149819 93
44 3300025939 Ga0207665_10692753 Ga0207665_106927532 93
45 3300041413 Ga0439465_0001503 Ga0439465_0001503_212_514 93
46 3300041997 Ga0439431_0036551 Ga0439431_0036551_457_759 93
47 3300042001 Ga0439441_056669 Ga0439441_056669_263_565 93
48 3300042436 Ga0439435_0047473 Ga0439435_0047473_177_479 93
49 3300044683 Ga0466965_0085411 Ga0466965_0085411_455_757 93
50 3300044694 Ga0466963_0195228 Ga0466963_0195228_99_401 93
51 3300044706 Ga0466964_0133918 Ga0466964_0133918_634_936 93
52 3300044706 Ga0466964_0362360 Ga0466964_0362360_238_540 93
53 3300044842 Ga0466957_0456231 Ga0466957_0456231_345_647 93
54 3300045976 Ga0466967_0169697 Ga0466967_0169697_480_782 93
55 3300048916 Ga0496113_0134486 Ga0496113_0134486_1111_1404 93
56 3300048921 Ga0496118_0001260 Ga0496118_0001260_14795_15097 93
57 3300048923 Ga0496120_0030224 Ga0496120_0030224_818_1111 93
58 3300050490 nmdc:mga03n38_65358_c1 nmdc:mga03n38_65358_c1_473_775 93
59 3300050491 nmdc:mga00v17_2711_c1 nmdc:mga00v17_2711_c1_8084_8386 93
60 3300050496 nmdc:mga07m45_5415_c1 nmdc:mga07m45_5415_c1_3332_3634 93
61 3300050516 nmdc:mga0sz30_2131_c1 nmdc:mga0sz30_2131_c1_570_872 93
62 3300050516 nmdc:mga0sz30_6746_c2 nmdc:mga0sz30_6746_c2_1299_1601 93
63 3300013307 Ga0157372_10247858 Ga0157372_102478584 94
64 3300020078 Ga0206352_10258938 Ga0206352_102589382 94
65 3300026121 Ga0207683_10126952 Ga0207683_101269521 94
66 3300041463 Ga0451804_0321468 Ga0451804_0321468_24_329 94
67 3300048908 Ga0496105_0265243 Ga0496105_0265243_687_977 94
68 3300048913 Ga0496110_0716254 Ga0496110_0716254_130_420 94
69 3300049570 Ga0501033_0385905 Ga0501033_0385905_212_502 94
70 3300049581 Ga0501047_0187772 Ga0501047_0187772_826_1116 94
71 3300049822 Ga0501035_0114379 Ga0501035_0114379_378_668 94
72 3300049823 Ga0501044_0066267 Ga0501044_0066267_2669_2959 94
73 3300054114 Ga0501084_1334665 Ga0501084_1334665_276_566 94
74 3300059490 Ga0587066_039088 Ga0587066_039088_152_442 94
75 iso_pu_bacteria 2558860112 2558913556 94
76 iso_pu_bacteria 2675903060 2676494456 94
77 iso_pu_bacteria 2775506925 2776372534 94
78 iso_pu_bacteria 2795385472 2795795484 94
79 iso_pu_bacteria 2863067949 2863070292 94
80 iso_pu_bacteria 2884693830 2884694815 94
81 iso_pu_bacteria 2895427314 2895432706 94
82 iso_pu_bacteria 2895442618 2895446489 94
83 3300005458 Ga0070681_12003764 Ga0070681_120037641 95
84 3300006175 Ga0070712_101662177 Ga0070712_1016621772 95
85 3300037466 Ga0395898_0965927 Ga0395898_0965927_255_548 95
86 3300039450 Ga0436363_0531592 Ga0436363_0531592_153_449 95
87 3300048929 Ga0496126_0098258 Ga0496126_0098258_2078_2365 95
88 iso_pu_bacteria 2643221715 2644635650 95
89 iso_pu_bacteria 2738541274 2738704768 95
90 iso_pu_bacteria 2738543028 2739329937 95
91 iso_pu_bacteria 2811994880 2812364361 95
92 iso_pu_bacteria 2842134933 2842136764 95
93 iso_pu_bacteria 2902810491 2902813733 95
94 iso_pu_bacteria 2929212328 2929213757 95
95 3300004798 Ga0058859_11825311 Ga0058859_118253112 96
96 3300004800 Ga0058861_11824709 Ga0058861_118247091 96
97 3300004801 Ga0058860_10048539 Ga0058860_100485391 96
98 3300005334 Ga0068869_100864641 Ga0068869_1008646412 96
99 3300005337 Ga0070682_100948077 Ga0070682_1009480771 96
100 3300005338 Ga0068868_100925326 Ga0068868_1009253262 96
101 3300005355 Ga0070671_101310872 Ga0070671_1013108722 96
102 3300005356 Ga0070674_101301867 Ga0070674_1013018672 96
103 3300005364 Ga0070673_101708814 Ga0070673_1017088141 96
104 3300005365 Ga0070688_100537183 Ga0070688_1005371832 96
105 3300005365 Ga0070688_100737842 Ga0070688_1007378422 96
106 3300005439 Ga0070711_101071082 Ga0070711_1010710822 96
107 3300005441 Ga0070700_101725410 Ga0070700_1017254101 96
108 3300005456 Ga0070678_100697245 Ga0070678_1006972452 96
109 3300005459 Ga0068867_101116175 Ga0068867_1011161752 96
110 3300005466 Ga0070685_10465914 Ga0070685_104659141 96
111 3300005535 Ga0070684_100837851 Ga0070684_1008378512 96
112 3300005543 Ga0070672_100702452 Ga0070672_1007024522 96
113 3300005615 Ga0070702_100094575 Ga0070702_1000945752 96
114 3300005616 Ga0068852_100459632 Ga0068852_1004596322 96
115 3300005618 Ga0068864_101774768 Ga0068864_1017747682 96
116 3300005840 Ga0068870_10336804 Ga0068870_103368042 96
117 3300005842 Ga0068858_101474206 Ga0068858_1014742062 96
118 3300006237 Ga0097621_101044536 Ga0097621_1010445362 96
119 3300006358 Ga0068871_100918334 Ga0068871_1009183342 96
120 3300006358 Ga0068871_101138532 Ga0068871_1011385322 96
121 3300006881 Ga0068865_101561476 Ga0068865_1015614762 96
122 3300009098 Ga0105245_10176435 Ga0105245_101764351 96
123 3300009101 Ga0105247_10308750 Ga0105247_103087502 96
124 3300009148 Ga0105243_10745168 Ga0105243_107451682 96
125 3300009148 Ga0105243_12503314 Ga0105243_125033142 96
126 3300009176 Ga0105242_10751570 Ga0105242_107515702 96
127 3300009176 Ga0105242_12754481 Ga0105242_127544812 96
128 3300009177 Ga0105248_10750513 Ga0105248_107505132 96
129 3300009553 Ga0105249_10538049 Ga0105249_105380492 96
130 3300010375 Ga0105239_11465419 Ga0105239_114654192 96
131 3300011119 Ga0105246_11450084 Ga0105246_114500842 96
132 3300013104 Ga0157370_11737994 Ga0157370_117379942 96
133 3300013105 Ga0157369_11074293 Ga0157369_110742932 96
134 3300013296 Ga0157374_11477182 Ga0157374_114771822 96
135 3300013296 Ga0157374_11846234 Ga0157374_118462342 96
136 3300013297 Ga0157378_11348118 Ga0157378_113481182 96
137 3300013306 Ga0163162_10777606 Ga0163162_107776061 96
138 3300013307 Ga0157372_10718867 Ga0157372_107188672 96
139 3300013308 Ga0157375_11055873 Ga0157375_110558732 96
140 3300013308 Ga0157375_11675270 Ga0157375_116752702 96
141 3300014325 Ga0163163_10390101 Ga0163163_103901012 96
142 3300014325 Ga0163163_12309125 Ga0163163_123091252 96
143 3300014326 Ga0157380_10521228 Ga0157380_105212282 96
144 3300014326 Ga0157380_10789920 Ga0157380_107899202 96
145 3300014326 Ga0157380_12223396 Ga0157380_122233962 96
146 3300014968 Ga0157379_10485086 Ga0157379_104850862 96
147 3300014969 Ga0157376_10257542 Ga0157376_102575423 96
148 3300017792 Ga0163161_10943655 Ga0163161_109436552 96
149 3300020069 Ga0197907_11203916 Ga0197907_112039162 96
150 3300020070 Ga0206356_11160282 Ga0206356_111602822 96
151 3300020070 Ga0206356_11891214 Ga0206356_118912142 96
152 3300020075 Ga0206349_1037049 Ga0206349_10370494 96
153 3300020075 Ga0206349_1223679 Ga0206349_12236791 96
154 3300020075 Ga0206349_1737707 Ga0206349_17377072 96
155 3300020076 Ga0206355_1690241 Ga0206355_16902412 96
156 3300020078 Ga0206352_11019656 Ga0206352_110196562 96
157 3300020081 Ga0206354_10764178 Ga0206354_107641782 96
158 3300020082 Ga0206353_11303022 Ga0206353_113030222 96
159 3300020082 Ga0206353_11654695 Ga0206353_116546951 96
160 3300022467 Ga0224712_10093646 Ga0224712_100936462 96
161 3300022467 Ga0224712_10513828 Ga0224712_105138282 96
162 3300025321 Ga0207656_10191995 Ga0207656_101919952 96
163 3300025901 Ga0207688_10127394 Ga0207688_101273942 96
164 3300025901 Ga0207688_10537841 Ga0207688_105378412 96
165 3300025908 Ga0207643_10523333 Ga0207643_105233332 96
166 3300025916 Ga0207663_10806349 Ga0207663_108063492 96
167 3300025927 Ga0207687_10346630 Ga0207687_103466302 96
168 3300025934 Ga0207686_10407312 Ga0207686_104073122 96
169 3300025935 Ga0207709_10919582 Ga0207709_109195822 96
170 3300025937 Ga0207669_10734396 Ga0207669_107343962 96
171 3300025937 Ga0207669_11304185 Ga0207669_113041852 96
172 3300025940 Ga0207691_10489215 Ga0207691_104892152 96
173 3300025960 Ga0207651_10775105 Ga0207651_107751052 96
174 3300025981 Ga0207640_11804026 Ga0207640_118040262 96
175 3300025986 Ga0207658_11075147 Ga0207658_110751472 96
176 3300026067 Ga0207678_10608458 Ga0207678_106084582 96
177 3300026088 Ga0207641_10587032 Ga0207641_105870322 96
178 3300026089 Ga0207648_10843133 Ga0207648_108431332 96
179 3300026121 Ga0207683_10693507 Ga0207683_106935072 96
180 3300028379 Ga0268266_11662362 Ga0268266_116623622 96
181 3300035171 Ga0373946_0500664 Ga0373946_0500664_58_354 96
182 3300036401 Ga0373937_1470515 Ga0373937_1470515_68_364 96
183 3300037068 Ga0373925_0991680 Ga0373925_0991680_290_586 96
184 3300041441 Ga0451787_617256 Ga0451787_617256_490_786 96
185 3300041443 Ga0451789_0356172 Ga0451789_0356172_1037_1333 96
186 3300041444 Ga0451790_30083 Ga0451790_30083_147_443 96
187 3300041446 Ga0451794_37396 Ga0451794_37396_270_566 96
188 3300041451 Ga0451791_0950749 Ga0451791_0950749_243_539 96
189 3300041452 Ga0451793_0893875 Ga0451793_0893875_1945_2241 96
190 3300041452 Ga0451793_1809633 Ga0451793_1809633_90_383 96
191 3300041453 Ga0451797_1162958 Ga0451797_1162958_487_783 96
192 3300041456 Ga0451795_1158970 Ga0451795_1158970_100_396 96
193 3300041458 Ga0451798_0608895 Ga0451798_0608895_201_497 96
194 3300041459 Ga0451800_0483294 Ga0451800_0483294_270_566 96
195 3300041463 Ga0451804_0160498 Ga0451804_0160498_64_360 96
196 3300041496 Ga0451839_0255728 Ga0451839_0255728_303_599 96
197 3300041496 Ga0451839_0788412 Ga0451839_0788412_161_457 96
198 3300041498 Ga0451841_0559173 Ga0451841_0559173_507_803 96
199 3300041507 Ga0451851_0336391 Ga0451851_0336391_164_460 96
200 3300041509 Ga0451843_1227703 Ga0451843_1227703_225_521 96
201 3300044712 Ga0453684_1459255 Ga0453684_1459255_161_451 96
202 3300046455 Ga0495603_0365855 Ga0495603_0365855_197_493 96
203 3300046459 Ga0495629_0455882 Ga0495629_0455882_190_486 96
204 3300046463 Ga0495653_0302236 Ga0495653_0302236_598_894 96
205 3300046471 Ga0495650_0112962 Ga0495650_0112962_22_318 96
206 3300046473 Ga0495582_0359685 Ga0495582_0359685_293_589 96
207 3300046477 Ga0495664_0166328 Ga0495664_0166328_608_904 96
208 3300046500 Ga0495596_0413783 Ga0495596_0413783_184_480 96
209 3300046511 Ga0495608_0022737 Ga0495608_0022737_3641_3937 96
210 3300046515 Ga0495620_0124163 Ga0495620_0124163_243_539 96
211 3300046517 Ga0495630_1253383 Ga0495630_1253383_155_451 96
212 3300046531 Ga0495665_0021929 Ga0495665_0021929_2801_3097 96
213 3300046536 Ga0495587_0580709 Ga0495587_0580709_100_396 96
214 3300046543 Ga0495645_0323383 Ga0495645_0323383_445_741 96
215 3300046642 Ga0495634_0192584 Ga0495634_0192584_489_785 96
216 3300046642 Ga0495634_0543920 Ga0495634_0543920_39_335 96
217 3300046674 Ga0495588_0185847 Ga0495588_0185847_583_879 96
218 3300046680 Ga0495646_0166063 Ga0495646_0166063_595_891 96
219 3300046683 Ga0495658_0786005 Ga0495658_0786005_90_386 96
220 3300046689 Ga0495613_0812466 Ga0495613_0812466_292_588 96
221 3300046690 Ga0495624_0607462 Ga0495624_0607462_284_580 96
222 3300047322 Ga0495680_0136374 Ga0495680_0136374_146_442 96
223 3300047322 Ga0495680_0734873 Ga0495680_0734873_211_507 96
224 3300048089 Ga0495614_0096400 Ga0495614_0096400_585_881 96
225 3300048903 Ga0496100_0192299 Ga0496100_0192299_49_345 96
226 3300048905 Ga0496102_0429657 Ga0496102_0429657_423_719 96
227 3300048905 Ga0496102_0702133 Ga0496102_0702133_461_757 96
228 3300048906 Ga0496103_0085017 Ga0496103_0085017_380_676 96
229 3300048907 Ga0496104_0014968 Ga0496104_0014968_1062_1358 96
230 3300048908 Ga0496105_0104287 Ga0496105_0104287_215_511 96
231 3300048908 Ga0496105_1378557 Ga0496105_1378557_146_442 96
232 3300048909 Ga0496106_0679074 Ga0496106_0679074_317_613 96
233 3300048910 Ga0496107_0440191 Ga0496107_0440191_14_310 96
234 3300048911 Ga0496108_0001515 Ga0496108_0001515_16132_16428 96
235 3300048911 Ga0496108_0475841 Ga0496108_0475841_558_854 96
236 3300048911 Ga0496108_0949450 Ga0496108_0949450_245_541 96
237 3300048912 Ga0496109_0008622 Ga0496109_0008622_2820_3116 96
238 3300048912 Ga0496109_0147821 Ga0496109_0147821_1417_1713 96
239 3300048912 Ga0496109_0174571 Ga0496109_0174571_1673_1969 96
240 3300048913 Ga0496110_0004143 Ga0496110_0004143_9807_10103 96
241 3300048914 Ga0496111_0011991 Ga0496111_0011991_368_664 96
242 3300048914 Ga0496111_1043470 Ga0496111_1043470_145_441 96
243 3300048915 Ga0496112_0566398 Ga0496112_0566398_309_605 96
244 3300048915 Ga0496112_1298014 Ga0496112_1298014_193_489 96
245 3300048916 Ga0496113_0095125 Ga0496113_0095125_1032_1328 96
246 3300048917 Ga0496114_0037300 Ga0496114_0037300_1858_2154 96
247 3300048917 Ga0496114_0037365 Ga0496114_0037365_1018_1311 96
248 3300048917 Ga0496114_1148638 Ga0496114_1148638_126_419 96
249 3300048918 Ga0496115_0096285 Ga0496115_0096285_1186_1479 96
250 3300048918 Ga0496115_0316748 Ga0496115_0316748_770_1066 96
251 3300049527 Ga0501311_004858 Ga0501311_004858_1091_1393 96
252 3300053078 Ga0495612_0350429 Ga0495612_0350429_122_418 96
253 3300053084 Ga0495595_0150874 Ga0495595_0150874_46_342 96
254 3300053085 Ga0495619_0352703 Ga0495619_0352703_643_939 96
255 iso_pu_bacteria 2523231044 2523386601 96
256 iso_pu_bacteria 2547132424 2548693107 96
257 iso_pu_bacteria 2551306166 2552105774 96
258 iso_pu_bacteria 2565956761 2566992659 96
259 iso_pu_bacteria 2643221692 2644515409 96
260 iso_pu_bacteria 2738541305 2738870335 96
261 iso_pu_bacteria 2738541308 2738887459 96
262 iso_pu_bacteria 2738543005 2739202792 96
263 iso_pu_bacteria 2738543011 2739236885 96
264 iso_pu_bacteria 2889300758 2889305778 96
265 iso_pu_bacteria 2904535858 2904538390 96
266 iso_pu_bacteria 2919713450 2919718241 96
267 iso_pu_bacteria 2922554459 2922559122 96
268 iso_pu_bacteria 2928142448 2928142991 96
269 iso_pu_bacteria 2939743619 2939743914 96
270 iso_pu_bacteria 2974315732 2974316188 96
271 iso_pu_bacteria 2984523437 2984524351 96
272 3300001976 JGI24752J21851_1048383 JGI24752J21851_10483831 97
273 3300001977 JGI24746J21847_1041178 JGI24746J21847_10411782 97
274 3300001979 JGI24740J21852_10117882 JGI24740J21852_101178822 97
275 3300001989 JGI24739J22299_10163606 JGI24739J22299_101636061 97
276 3300001991 JGI24743J22301_10137210 JGI24743J22301_101372102 97
277 3300002239 JGI24034J26672_10089570 JGI24034J26672_100895701 97
278 3300003659 JGI25404J52841_10006168 JGI25404J52841_100061682 97
279 3300004798 Ga0058859_11439842 Ga0058859_114398421 97
280 3300004799 Ga0058863_11747712 Ga0058863_117477122 97
281 3300004800 Ga0058861_11989029 Ga0058861_119890292 97
282 3300004801 Ga0058860_11752377 Ga0058860_117523772 97
283 3300004803 Ga0058862_12845447 Ga0058862_128454472 97
284 3300005327 Ga0070658_10022118 Ga0070658_100221185 97
285 3300005329 Ga0070683_100045429 Ga0070683_1000454292 97
286 3300005330 Ga0070690_100028148 Ga0070690_1000281485 97
287 3300005331 Ga0070670_100546979 Ga0070670_1005469792 97
288 3300005334 Ga0068869_100046622 Ga0068869_1000466222 97
289 3300005334 Ga0068869_101189683 Ga0068869_1011896831 97
290 3300005335 Ga0070666_10108142 Ga0070666_101081423 97
291 3300005336 Ga0070680_100157136 Ga0070680_1001571363 97
292 3300005337 Ga0070682_100027729 Ga0070682_1000277295 97
293 3300005338 Ga0068868_100282852 Ga0068868_1002828522 97
294 3300005339 Ga0070660_100026612 Ga0070660_1000266124 97
295 3300005339 Ga0070660_100914988 Ga0070660_1009149882 97
296 3300005340 Ga0070689_100137123 Ga0070689_1001371232 97
297 3300005341 Ga0070691_10022947 Ga0070691_100229472 97
298 3300005343 Ga0070687_100066257 Ga0070687_1000662573 97
299 3300005344 Ga0070661_100079586 Ga0070661_1000795863 97
300 3300005345 Ga0070692_10140201 Ga0070692_101402012 97
301 3300005347 Ga0070668_100065951 Ga0070668_1000659515 97
302 3300005353 Ga0070669_100327330 Ga0070669_1003273302 97
303 3300005354 Ga0070675_100153185 Ga0070675_1001531852 97
304 3300005355 Ga0070671_100146598 Ga0070671_1001465983 97
305 3300005364 Ga0070673_100221043 Ga0070673_1002210433 97
306 3300005365 Ga0070688_100117492 Ga0070688_1001174923 97
307 3300005366 Ga0070659_100010814 Ga0070659_1000108144 97
308 3300005366 Ga0070659_101830784 Ga0070659_1018307842 97
309 3300005367 Ga0070667_100016592 Ga0070667_1000165928 97
310 3300005367 Ga0070667_102324235 Ga0070667_1023242351 97
311 3300005406 Ga0070703_10009587 Ga0070703_100095872 97
312 3300005438 Ga0070701_10018401 Ga0070701_100184014 97
313 3300005439 Ga0070711_101718225 Ga0070711_1017182251 97
314 3300005440 Ga0070705_100052016 Ga0070705_1000520162 97
315 3300005441 Ga0070700_100028068 Ga0070700_1000280685 97
316 3300005444 Ga0070694_100371787 Ga0070694_1003717872 97
317 3300005445 Ga0070708_100138579 Ga0070708_1001385792 97
318 3300005445 Ga0070708_100141379 Ga0070708_1001413793 97
319 3300005455 Ga0070663_100003713 Ga0070663_10000371314 97
320 3300005455 Ga0070663_100152220 Ga0070663_1001522203 97
321 3300005457 Ga0070662_100041413 Ga0070662_1000414135 97
322 3300005458 Ga0070681_10043340 Ga0070681_100433405 97
323 3300005458 Ga0070681_11274041 Ga0070681_112740411 97
324 3300005459 Ga0068867_100116417 Ga0068867_1001164172 97
325 3300005466 Ga0070685_10026200 Ga0070685_100262005 97
326 3300005467 Ga0070706_100083112 Ga0070706_1000831123 97
327 3300005467 Ga0070706_100114177 Ga0070706_1001141772 97
328 3300005471 Ga0070698_100090705 Ga0070698_1000907053 97
329 3300005471 Ga0070698_100142295 Ga0070698_1001422953 97
330 3300005518 Ga0070699_100097370 Ga0070699_1000973703 97
331 3300005530 Ga0070679_100174430 Ga0070679_1001744302 97
332 3300005530 Ga0070679_100983619 Ga0070679_1009836192 97
333 3300005535 Ga0070684_100020206 Ga0070684_1000202064 97
334 3300005536 Ga0070697_100016947 Ga0070697_1000169474 97
335 3300005539 Ga0068853_100336667 Ga0068853_1003366672 97
336 3300005543 Ga0070672_100111347 Ga0070672_1001113474 97
337 3300005544 Ga0070686_100071082 Ga0070686_1000710822 97
338 3300005545 Ga0070695_100077745 Ga0070695_1000777452 97
339 3300005546 Ga0070696_100104744 Ga0070696_1001047443 97
340 3300005547 Ga0070693_100031013 Ga0070693_1000310133 97
341 3300005548 Ga0070665_100230283 Ga0070665_1002302832 97
342 3300005548 Ga0070665_100360166 Ga0070665_1003601663 97
343 3300005549 Ga0070704_100019131 Ga0070704_1000191312 97
344 3300005563 Ga0068855_100559322 Ga0068855_1005593222 97
345 3300005564 Ga0070664_100238332 Ga0070664_1002383322 97
346 3300005577 Ga0068857_100023375 Ga0068857_1000233755 97
347 3300005578 Ga0068854_100024677 Ga0068854_1000246773 97
348 3300005614 Ga0068856_100754456 Ga0068856_1007544562 97
349 3300005614 Ga0068856_100883884 Ga0068856_1008838842 97
350 3300005614 Ga0068856_102289352 Ga0068856_1022893522 97
351 3300005615 Ga0070702_100010220 Ga0070702_1000102208 97
352 3300005616 Ga0068852_100104920 Ga0068852_1001049204 97
353 3300005618 Ga0068864_100093687 Ga0068864_1000936873 97
354 3300005718 Ga0068866_10006852 Ga0068866_100068526 97
355 3300005719 Ga0068861_100035902 Ga0068861_1000359024 97
356 3300005834 Ga0068851_10035205 Ga0068851_100352052 97
357 3300005840 Ga0068870_10006791 Ga0068870_100067918 97
358 3300005841 Ga0068863_100427239 Ga0068863_1004272392 97
359 3300005842 Ga0068858_100365427 Ga0068858_1003654272 97
360 3300005843 Ga0068860_100138668 Ga0068860_1001386683 97
361 3300005844 Ga0068862_100760369 Ga0068862_1007603692 97
362 3300005937 Ga0081455_10730822 Ga0081455_107308222 97
363 3300005983 Ga0081540_1000341 Ga0081540_100034138 97
364 3300006163 Ga0070715_10084272 Ga0070715_100842722 97
365 3300006237 Ga0097621_100099184 Ga0097621_1000991843 97
366 3300006358 Ga0068871_100065721 Ga0068871_1000657212 97
367 3300006852 Ga0075433_10233530 Ga0075433_102335302 97
368 3300006871 Ga0075434_100205355 Ga0075434_1002053555 97
369 3300006881 Ga0068865_100742020 Ga0068865_1007420202 97
370 3300009093 Ga0105240_10046258 Ga0105240_100462586 97
371 3300009093 Ga0105240_10573941 Ga0105240_105739412 97
372 3300009098 Ga0105245_10336107 Ga0105245_103361072 97
373 3300009101 Ga0105247_10107294 Ga0105247_101072942 97
374 3300009148 Ga0105243_10092563 Ga0105243_100925635 97
375 3300009174 Ga0105241_10193643 Ga0105241_101936432 97
376 3300009176 Ga0105242_10105857 Ga0105242_101058573 97
377 3300009176 Ga0105242_10153537 Ga0105242_101535372 97
378 3300009177 Ga0105248_10360972 Ga0105248_103609723 97
379 3300009545 Ga0105237_11292109 Ga0105237_112921092 97
380 3300009551 Ga0105238_10305375 Ga0105238_103053753 97
381 3300009551 Ga0105238_11709485 Ga0105238_117094852 97
382 3300009553 Ga0105249_10380345 Ga0105249_103803453 97
383 3300010375 Ga0105239_10141441 Ga0105239_101414415 97
384 3300011119 Ga0105246_10025484 Ga0105246_100254844 97
385 3300011119 Ga0105246_11210957 Ga0105246_112109572 97
386 3300012488 Ga0157343_1003579 Ga0157343_10035792 97
387 3300012492 Ga0157335_1000629 Ga0157335_10006292 97
388 3300012494 Ga0157341_1001661 Ga0157341_10016612 97
389 3300012497 Ga0157319_1008542 Ga0157319_10085422 97
390 3300012506 Ga0157324_1012408 Ga0157324_10124082 97
391 3300012507 Ga0157342_1000500 Ga0157342_10005004 97
392 3300013100 Ga0157373_10042038 Ga0157373_100420385 97
393 3300013100 Ga0157373_10411165 Ga0157373_104111652 97
394 3300013102 Ga0157371_10024599 Ga0157371_100245995 97
395 3300013102 Ga0157371_10597225 Ga0157371_105972252 97
396 3300013104 Ga0157370_10172213 Ga0157370_101722132 97
397 3300013105 Ga0157369_11599565 Ga0157369_115995651 97
398 3300013296 Ga0157374_11470717 Ga0157374_114707171 97
399 3300013296 Ga0157374_11714662 Ga0157374_117146621 97
400 3300013296 Ga0157374_11796706 Ga0157374_117967062 97
401 3300013297 Ga0157378_10040112 Ga0157378_100401129 97
402 3300013306 Ga0163162_10091937 Ga0163162_100919375 97
403 3300013307 Ga0157372_10303539 Ga0157372_103035394 97
404 3300013308 Ga0157375_10091509 Ga0157375_100915092 97
405 3300014325 Ga0163163_10034337 Ga0163163_100343373 97
406 3300014326 Ga0157380_10204736 Ga0157380_102047362 97
407 3300014497 Ga0182008_10023005 Ga0182008_100230054 97
408 3300014745 Ga0157377_10023097 Ga0157377_100230973 97
409 3300014969 Ga0157376_10044967 Ga0157376_100449678 97
410 3300017792 Ga0163161_10249662 Ga0163161_102496622 97
411 3300020069 Ga0197907_11065209 Ga0197907_110652094 97
412 3300020070 Ga0206356_10809245 Ga0206356_108092455 97
413 3300020075 Ga0206349_1519183 Ga0206349_15191832 97
414 3300020075 Ga0206349_1522805 Ga0206349_15228052 97
415 3300020076 Ga0206355_1015855 Ga0206355_10158552 97
416 3300020078 Ga0206352_10139106 Ga0206352_101391061 97
417 3300020080 Ga0206350_10667397 Ga0206350_106673975 97
418 3300020081 Ga0206354_11319487 Ga0206354_113194873 97
419 3300020082 Ga0206353_10229932 Ga0206353_102299322 97
420 3300021384 Ga0213876_10496274 Ga0213876_104962742 97
421 3300021388 Ga0213875_10052334 Ga0213875_100523343 97
422 3300022467 Ga0224712_10000978 Ga0224712_100009782 97
423 3300025321 Ga0207656_10181829 Ga0207656_101818292 97
424 3300025885 Ga0207653_10082305 Ga0207653_100823052 97
425 3300025898 Ga0207692_10026725 Ga0207692_100267254 97
426 3300025899 Ga0207642_10064228 Ga0207642_100642282 97
427 3300025900 Ga0207710_10004294 Ga0207710_100042942 97
428 3300025901 Ga0207688_10001159 Ga0207688_100011594 97
429 3300025903 Ga0207680_10047203 Ga0207680_100472035 97
430 3300025904 Ga0207647_10291056 Ga0207647_102910562 97
431 3300025905 Ga0207685_10020620 Ga0207685_100206202 97
432 3300025906 Ga0207699_10001668 Ga0207699_1000166819 97
433 3300025907 Ga0207645_10039213 Ga0207645_100392135 97
434 3300025908 Ga0207643_10014701 Ga0207643_100147015 97
435 3300025909 Ga0207705_10226135 Ga0207705_102261353 97
436 3300025910 Ga0207684_10177547 Ga0207684_101775472 97
437 3300025911 Ga0207654_10220234 Ga0207654_102202342 97
438 3300025912 Ga0207707_10121849 Ga0207707_101218494 97
439 3300025912 Ga0207707_10717986 Ga0207707_107179862 97
440 3300025913 Ga0207695_10697384 Ga0207695_106973842 97
441 3300025914 Ga0207671_10153860 Ga0207671_101538603 97
442 3300025914 Ga0207671_10767961 Ga0207671_107679612 97
443 3300025916 Ga0207663_10060919 Ga0207663_100609192 97
444 3300025916 Ga0207663_11657398 Ga0207663_116573982 97
445 3300025917 Ga0207660_10155588 Ga0207660_101555883 97
446 3300025918 Ga0207662_10002882 Ga0207662_100028825 97
447 3300025919 Ga0207657_10001387 Ga0207657_1000138739 97
448 3300025920 Ga0207649_10330176 Ga0207649_103301762 97
449 3300025921 Ga0207652_10531151 Ga0207652_105311512 97
450 3300025922 Ga0207646_10089945 Ga0207646_100899453 97
451 3300025923 Ga0207681_10889624 Ga0207681_108896242 97
452 3300025924 Ga0207694_10282726 Ga0207694_102827262 97
453 3300025926 Ga0207659_10141498 Ga0207659_101414982 97
454 3300025927 Ga0207687_10005166 Ga0207687_100051663 97
455 3300025928 Ga0207700_10007511 Ga0207700_100075115 97
456 3300025929 Ga0207664_10003003 Ga0207664_100030035 97
457 3300025931 Ga0207644_10190213 Ga0207644_101902132 97
458 3300025932 Ga0207690_10087503 Ga0207690_100875034 97
459 3300025933 Ga0207706_10046783 Ga0207706_100467835 97
460 3300025934 Ga0207686_10102386 Ga0207686_101023863 97
461 3300025935 Ga0207709_10104660 Ga0207709_101046603 97
462 3300025936 Ga0207670_10043292 Ga0207670_100432923 97
463 3300025938 Ga0207704_11619242 Ga0207704_116192422 97
464 3300025939 Ga0207665_10995262 Ga0207665_109952622 97
465 3300025940 Ga0207691_10734719 Ga0207691_107347192 97
466 3300025941 Ga0207711_10542923 Ga0207711_105429232 97
467 3300025942 Ga0207689_10002936 Ga0207689_1000293627 97
468 3300025944 Ga0207661_10187724 Ga0207661_101877243 97
469 3300025945 Ga0207679_10635713 Ga0207679_106357132 97
470 3300025949 Ga0207667_10053296 Ga0207667_100532969 97
471 3300025949 Ga0207667_11869828 Ga0207667_118698282 97
472 3300025960 Ga0207651_10700077 Ga0207651_107000772 97
473 3300025961 Ga0207712_10093206 Ga0207712_100932064 97
474 3300025981 Ga0207640_10129601 Ga0207640_101296014 97
475 3300025986 Ga0207658_10088255 Ga0207658_100882552 97
476 3300026023 Ga0207677_10594683 Ga0207677_105946832 97
477 3300026023 Ga0207677_11839907 Ga0207677_118399073 97
478 3300026041 Ga0207639_10307407 Ga0207639_103074072 97
479 3300026067 Ga0207678_10002587 Ga0207678_100025879 97
480 3300026075 Ga0207708_10612653 Ga0207708_106126532 97
481 3300026078 Ga0207702_10003344 Ga0207702_100033446 97
482 3300026078 Ga0207702_10628748 Ga0207702_106287482 97
483 3300026088 Ga0207641_10012413 Ga0207641_100124133 97
484 3300026089 Ga0207648_10133353 Ga0207648_101333532 97
485 3300026095 Ga0207676_10074155 Ga0207676_100741552 97
486 3300026116 Ga0207674_10006508 Ga0207674_1000650816 97
487 3300026118 Ga0207675_100010883 Ga0207675_1000108834 97
488 3300026121 Ga0207683_10002849 Ga0207683_1000284926 97
489 3300026142 Ga0207698_10005035 Ga0207698_100050359 97
490 3300028379 Ga0268266_10232699 Ga0268266_102326993 97
491 3300028380 Ga0268265_10217831 Ga0268265_102178312 97
492 3300028381 Ga0268264_10102783 Ga0268264_101027833 97
493 3300031090 Ga0265760_10181673 Ga0265760_101816732 97
494 3300031903 Ga0307407_10941070 Ga0307407_109410702 97
495 3300034816 Ga0373930_0011251 Ga0373930_0011251_819_1112 97
496 3300034818 Ga0373950_0020903 Ga0373950_0020903_323_616 97
497 3300034957 Ga0373938_0092642 Ga0373938_0092642_342_635 97
498 3300035083 Ga0373926_0017223 Ga0373926_0017223_1963_2256 97
499 3300035084 Ga0373928_0069499 Ga0373928_0069499_214_507 97
500 3300035085 Ga0373929_0175187 Ga0373929_0175187_138_431 97
501 3300035086 Ga0373934_0007912 Ga0373934_0007912_1998_2291 97
502 3300035088 Ga0373940_0051015 Ga0373940_0051015_388_681 97
503 3300035089 Ga0373944_0106580 Ga0373944_0106580_443_736 97
504 3300035090 Ga0373949_0014280 Ga0373949_0014280_1170_1463 97
505 3300035111 Ga0373923_0013637 Ga0373923_0013637_90_383 97
506 3300035112 Ga0373932_0009133 Ga0373932_0009133_1641_1934 97
507 3300035113 Ga0373936_0037173 Ga0373936_0037173_443_736 97
508 3300035114 Ga0373939_0045832 Ga0373939_0045832_720_1013 97
509 3300035115 Ga0373941_0174177 Ga0373941_0174177_351_644 97
510 3300035116 Ga0373945_0016245 Ga0373945_0016245_1154_1447 97
511 3300035117 Ga0373953_0083777 Ga0373953_0083777_980_1273 97
512 3300035117 Ga0373953_0509671 Ga0373953_0509671_185_478 97
513 3300035118 Ga0373954_0048565 Ga0373954_0048565_1491_1784 97
514 3300035119 Ga0373956_0013875 Ga0373956_0013875_899_1192 97
515 3300035120 Ga0373957_0005448 Ga0373957_0005448_1997_2290 97
516 3300035170 Ga0373943_0021734 Ga0373943_0021734_571_864 97
517 3300035171 Ga0373946_0009470 Ga0373946_0009470_2657_2950 97
518 3300035172 Ga0373955_0322328 Ga0373955_0322328_443_736 97
519 3300035207 Ga0373942_0032481 Ga0373942_0032481_881_1174 97
520 3300035241 Ga0373961_0061853 Ga0373961_0061853_711_1004 97
521 3300035398 Ga0316574_0431488 Ga0316574_0431488_245_538 97
522 3300035410 Ga0373924_0013498 Ga0373924_0013498_571_864 97
523 3300035410 Ga0373924_0154129 Ga0373924_0154129_66_359 97
524 3300035692 Ga0373935_0060354 Ga0373935_0060354_2020_2313 97
525 3300035695 Ga0373927_0013458 Ga0373927_0013458_1665_1958 97
526 3300035724 Ga0373933_0068897 Ga0373933_0068897_1842_2135 97
527 3300035725 Ga0373947_0034342 Ga0373947_0034342_189_482 97
528 3300036401 Ga0373937_0342156 Ga0373937_0342156_338_631 97
529 3300036459 Ga0372808_032497 Ga0372808_032497_206_499 97
530 3300037068 Ga0373925_0065617 Ga0373925_0065617_1871_2164 97
531 3300037312 Ga0395899_0331641 Ga0395899_0331641_391_690 97
532 3300037312 Ga0395899_0587271 Ga0395899_0587271_277_570 97
533 3300037418 Ga0395900_0215391 Ga0395900_0215391_776_1075 97
534 3300037466 Ga0395898_0036774 Ga0395898_0036774_2050_2349 97
535 3300037471 Ga0395905_0065150 Ga0395905_0065150_393_692 97
536 3300037853 Ga0436364_0487881 Ga0436364_0487881_155_448 97
537 3300037853 Ga0436364_0754979 Ga0436364_0754979_181_474 97
538 3300037853 Ga0436364_0844017 Ga0436364_0844017_784_1077 97
539 3300037853 Ga0436364_1292141 Ga0436364_1292141_1689_1982 97
540 3300038443 Ga0395901_0156631 Ga0395901_0156631_665_964 97
541 3300039437 Ga0436365_1866547 Ga0436365_1866547_1465_1758 97
542 3300039450 Ga0436363_1188024 Ga0436363_1188024_166_459 97
543 3300041503 Ga0451847_0197256 Ga0451847_0197256_216_509 97
544 3300044684 Ga0466966_0213131 Ga0466966_0213131_660_953 97
545 3300044693 Ga0466961_0486598 Ga0466961_0486598_99_392 97
546 3300044694 Ga0466963_0392175 Ga0466963_0392175_303_596 97
547 3300044694 Ga0466963_0445545 Ga0466963_0445545_493_786 97
548 3300044765 Ga0466970_0207195 Ga0466970_0207195_282_617 97
549 3300045836 Ga0466958_0545140 Ga0466958_0545140_127_420 97
550 3300045836 Ga0466958_1043655 Ga0466958_1043655_103_396 97
551 3300046454 Ga0495592_0061738 Ga0495592_0061738_1855_2148 97
552 3300046459 Ga0495629_0004222 Ga0495629_0004222_6227_6520 97
553 3300046461 Ga0495641_0009678 Ga0495641_0009678_3299_3592 97
554 3300046461 Ga0495641_0254813 Ga0495641_0254813_280_579 97
555 3300046462 Ga0495651_0022386 Ga0495651_0022386_2128_2421 97
556 3300046463 Ga0495653_0052007 Ga0495653_0052007_1665_1958 97
557 3300046463 Ga0495653_0333030 Ga0495653_0333030_181_480 97
558 3300046472 Ga0495580_0032022 Ga0495580_0032022_2042_2335 97
559 3300046473 Ga0495582_0009125 Ga0495582_0009125_2774_3067 97
560 3300046473 Ga0495582_0287109 Ga0495582_0287109_490_789 97
561 3300046475 Ga0495639_0025869 Ga0495639_0025869_1114_1407 97
562 3300046475 Ga0495639_0163193 Ga0495639_0163193_551_844 97
563 3300046476 Ga0495662_0010086 Ga0495662_0010086_2259_2552 97
564 3300046477 Ga0495664_0073258 Ga0495664_0073258_1312_1605 97
565 3300046499 Ga0495594_0019876 Ga0495594_0019876_639_932 97
566 3300046500 Ga0495596_0289901 Ga0495596_0289901_53_352 97
567 3300046511 Ga0495608_0045500 Ga0495608_0045500_2576_2869 97
568 3300046511 Ga0495608_0463022 Ga0495608_0463022_202_501 97
569 3300046514 Ga0495618_0041394 Ga0495618_0041394_2166_2459 97
570 3300046516 Ga0495628_0006081 Ga0495628_0006081_3506_3799 97
571 3300046517 Ga0495630_0070040 Ga0495630_0070040_2256_2549 97
572 3300046519 Ga0495632_0386319 Ga0495632_0386319_59_358 97
573 3300046526 Ga0495666_0020565 Ga0495666_0020565_1312_1605 97
574 3300046529 Ga0495652_0078581 Ga0495652_0078581_1528_1821 97
575 3300046531 Ga0495665_0010115 Ga0495665_0010115_2798_3091 97
576 3300046533 Ga0495640_0009511 Ga0495640_0009511_571_864 97
577 3300046535 Ga0495586_0026425 Ga0495586_0026425_2597_2890 97
578 3300046536 Ga0495587_0270951 Ga0495587_0270951_217_510 97
579 3300046543 Ga0495645_0014290 Ga0495645_0014290_2038_2331 97
580 3300046559 Ga0495667_0089320 Ga0495667_0089320_521_814 97
581 3300046559 Ga0495667_0099963 Ga0495667_0099963_848_1141 97
582 3300046616 Ga0495668_0128569 Ga0495668_0128569_17_316 97
583 3300046642 Ga0495634_0015911 Ga0495634_0015911_4653_4946 97
584 3300046663 Ga0495635_0028891 Ga0495635_0028891_2378_2671 97
585 3300046674 Ga0495588_0066400 Ga0495588_0066400_941_1234 97
586 3300046675 Ga0495657_0453603 Ga0495657_0453603_443_736 97
587 3300046678 Ga0495599_0027775 Ga0495599_0027775_1941_2234 97
588 3300046679 Ga0495623_0066615 Ga0495623_0066615_1450_1743 97
589 3300046680 Ga0495646_0013551 Ga0495646_0013551_4448_4741 97
590 3300046681 Ga0495647_0007780 Ga0495647_0007780_1643_1936 97
591 3300046683 Ga0495658_0005793 Ga0495658_0005793_3790_4083 97
592 3300046683 Ga0495658_0541312 Ga0495658_0541312_261_560 97
593 3300046689 Ga0495613_0017693 Ga0495613_0017693_347_640 97
594 3300046690 Ga0495624_0032525 Ga0495624_0032525_1443_1736 97
595 3300046809 Ga0495600_0044801 Ga0495600_0044801_1409_1702 97
596 3300047317 Ga0495604_0092975 Ga0495604_0092975_1497_1790 97
597 3300047319 Ga0495674_0082380 Ga0495674_0082380_2376_2669 97
598 3300047319 Ga0495674_0217428 Ga0495674_0217428_123_422 97
599 3300047321 Ga0495676_0050370 Ga0495676_0050370_2082_2375 97
600 3300047322 Ga0495680_0048696 Ga0495680_0048696_1528_1821 97
601 3300047444 Ga0495675_0024123 Ga0495675_0024123_3265_3558 97
602 3300047471 Ga0495684_0096482 Ga0495684_0096482_90_383 97
603 3300047673 Ga0495593_0003319 Ga0495593_0003319_5325_5618 97
604 3300048088 Ga0495602_0083198 Ga0495602_0083198_897_1190 97
605 3300048089 Ga0495614_0097658 Ga0495614_0097658_546_839 97
606 3300048089 Ga0495614_0112935 Ga0495614_0112935_364_663 97
607 3300048903 Ga0496100_0091178 Ga0496100_0091178_1523_1816 97
608 3300048904 Ga0496101_0100238 Ga0496101_0100238_1855_2148 97
609 3300048905 Ga0496102_0346594 Ga0496102_0346594_941_1234 97
610 3300048905 Ga0496102_1415271 Ga0496102_1415271_117_416 97
611 3300048906 Ga0496103_0127963 Ga0496103_0127963_1064_1357 97
612 3300048907 Ga0496104_0168785 Ga0496104_0168785_986_1279 97
613 3300048907 Ga0496104_0414448 Ga0496104_0414448_133_432 97
614 3300048908 Ga0496105_0144654 Ga0496105_0144654_820_1113 97
615 3300048908 Ga0496105_0475047 Ga0496105_0475047_321_614 97
616 3300048909 Ga0496106_0047608 Ga0496106_0047608_2313_2606 97
617 3300048910 Ga0496107_0010178 Ga0496107_0010178_4904_5197 97
618 3300048911 Ga0496108_0016331 Ga0496108_0016331_2185_2478 97
619 3300048911 Ga0496108_0067497 Ga0496108_0067497_2083_2376 97
620 3300048912 Ga0496109_0015777 Ga0496109_0015777_3717_4010 97
621 3300048912 Ga0496109_0824600 Ga0496109_0824600_280_579 97
622 3300048913 Ga0496110_0012641 Ga0496110_0012641_3908_4201 97
623 3300048913 Ga0496110_0490060 Ga0496110_0490060_20_313 97
624 3300048913 Ga0496110_0840412 Ga0496110_0840412_49_348 97
625 3300048914 Ga0496111_0298462 Ga0496111_0298462_556_849 97
626 3300048915 Ga0496112_0369186 Ga0496112_0369186_727_1020 97
627 3300048915 Ga0496112_0566177 Ga0496112_0566177_641_934 97
628 3300048916 Ga0496113_0133350 Ga0496113_0133350_1493_1786 97
629 3300048916 Ga0496113_0331031 Ga0496113_0331031_189_482 97
630 3300048916 Ga0496113_1322160 Ga0496113_1322160_56_355 97
631 3300048917 Ga0496114_0018213 Ga0496114_0018213_4085_4378 97
632 3300048918 Ga0496115_0053152 Ga0496115_0053152_2115_2408 97
633 3300048929 Ga0496126_0170583 Ga0496126_0170583_1146_1439 97
634 3300049538 Ga0501322_030094 Ga0501322_030094_151_456 97
635 3300049583 Ga0501067_0152539 Ga0501067_0152539_135_428 97
636 3300050512 nmdc:mga0n895_246356_c1 nmdc:mga0n895_246356_c1_454_747 97
637 3300050514 nmdc:mga08x19_73253_c1 nmdc:mga08x19_73253_c1_1650_1943 97
638 3300053077 Ga0495601_0010722 Ga0495601_0010722_2651_2944 97
639 3300053078 Ga0495612_0025359 Ga0495612_0025359_217_510 97
640 3300053084 Ga0495595_0068351 Ga0495595_0068351_346_639 97
641 3300053085 Ga0495619_0050871 Ga0495619_0050871_443_736 97
642 3300059490 Ga0587066_126145 Ga0587066_126145_110_403 97
643 3300059503 Ga0587080_080029 Ga0587080_080029_111_404 97
644 3300059505 Ga0587083_0030679 Ga0587083_0030679_320_613 97
645 3300059511 Ga0587091_033593 Ga0587091_033593_457_750 97
646 3300059604 Ga0587098_008252 Ga0587098_008252_435_734 97
647 3300059626 Ga0587115_014968 Ga0587115_014968_303_602 97
648 3300059640 Ga0587067_211288 Ga0587067_211288_198_491 97
649 3300059642 Ga0587069_165265 Ga0587069_165265_107_400 97
650 3300059647 Ga0587079_136003 Ga0587079_136003_198_491 97
651 iso_pu_bacteria 2643221681 2644455933 97
652 iso_pu_bacteria 2643221961 2645720825 97
653 iso_pu_bacteria 2643221962 2645723834 97
654 iso_pu_bacteria 2842888712 2842890127 97
655 3300001977 JGI24746J21847_1002880 JGI24746J21847_10028804 98
656 3300001991 JGI24743J22301_10003561 JGI24743J22301_100035613 98
657 3300002067 JGI24735J21928_10007788 JGI24735J21928_100077883 98
658 3300002073 JGI24745J21846_1000611 JGI24745J21846_10006113 98
659 3300002077 JGI24744J21845_10003031 JGI24744J21845_100030313 98
660 3300002244 JGI24742J22300_10028879 JGI24742J22300_100288792 98
661 3300003162 Ga0006778J45830_1066604 Ga0006778J45830_10666041 98
662 3300004785 Ga0058858_1006047 Ga0058858_10060472 98
663 3300004785 Ga0058858_1439419 Ga0058858_14394192 98
664 3300004798 Ga0058859_10151791 Ga0058859_101517912 98
665 3300004799 Ga0058863_11874661 Ga0058863_118746611 98
666 3300004801 Ga0058860_10101490 Ga0058860_101014904 98
667 3300004803 Ga0058862_11833495 Ga0058862_118334951 98
668 3300004803 Ga0058862_12339345 Ga0058862_123393451 98
669 3300005288 Ga0065714_10151442 Ga0065714_101514421 98
670 3300005327 Ga0070658_10001764 Ga0070658_1000176410 98
671 3300005327 Ga0070658_10220315 Ga0070658_102203152 98
672 3300005327 Ga0070658_10938244 Ga0070658_109382442 98
673 3300005329 Ga0070683_100659439 Ga0070683_1006594391 98
674 3300005330 Ga0070690_100810243 Ga0070690_1008102432 98
675 3300005331 Ga0070670_101067838 Ga0070670_1010678382 98
676 3300005333 Ga0070677_10026178 Ga0070677_100261784 98
677 3300005334 Ga0068869_100287171 Ga0068869_1002871712 98
678 3300005335 Ga0070666_10360117 Ga0070666_103601172 98
679 3300005335 Ga0070666_11241050 Ga0070666_112410501 98
680 3300005336 Ga0070680_100004398 Ga0070680_10000439819 98
681 3300005336 Ga0070680_100407949 Ga0070680_1004079492 98
682 3300005337 Ga0070682_100097993 Ga0070682_1000979933 98
683 3300005337 Ga0070682_100580110 Ga0070682_1005801101 98
684 3300005338 Ga0068868_100195353 Ga0068868_1001953532 98
685 3300005339 Ga0070660_100915340 Ga0070660_1009153401 98
686 3300005340 Ga0070689_100210630 Ga0070689_1002106303 98
687 3300005340 Ga0070689_100499648 Ga0070689_1004996482 98
688 3300005341 Ga0070691_10433091 Ga0070691_104330912 98
689 3300005343 Ga0070687_100823329 Ga0070687_1008233292 98
690 3300005344 Ga0070661_100922893 Ga0070661_1009228932 98
691 3300005345 Ga0070692_10051941 Ga0070692_100519412 98
692 3300005347 Ga0070668_100045485 Ga0070668_1000454855 98
693 3300005347 Ga0070668_100262585 Ga0070668_1002625851 98
694 3300005347 Ga0070668_100286859 Ga0070668_1002868592 98
695 3300005353 Ga0070669_101928000 Ga0070669_1019280001 98
696 3300005354 Ga0070675_100122668 Ga0070675_1001226683 98
697 3300005355 Ga0070671_100023520 Ga0070671_1000235207 98
698 3300005356 Ga0070674_100053618 Ga0070674_1000536183 98
699 3300005356 Ga0070674_100081087 Ga0070674_1000810873 98
700 3300005364 Ga0070673_100285095 Ga0070673_1002850952 98
701 3300005365 Ga0070688_100393198 Ga0070688_1003931982 98
702 3300005367 Ga0070667_100004217 Ga0070667_10000421715 98
703 3300005367 Ga0070667_100416970 Ga0070667_1004169702 98
704 3300005406 Ga0070703_10223580 Ga0070703_102235801 98
705 3300005434 Ga0070709_10086222 Ga0070709_100862222 98
706 3300005435 Ga0070714_100000013 Ga0070714_10000001312 98
707 3300005435 Ga0070714_100051110 Ga0070714_1000511102 98
708 3300005435 Ga0070714_101457326 Ga0070714_1014573262 98
709 3300005435 Ga0070714_101848515 Ga0070714_1018485152 98
710 3300005436 Ga0070713_100008336 Ga0070713_1000083366 98
711 3300005437 Ga0070710_10053151 Ga0070710_100531514 98
712 3300005437 Ga0070710_10085821 Ga0070710_100858212 98
713 3300005437 Ga0070710_10090187 Ga0070710_100901873 98
714 3300005438 Ga0070701_10370624 Ga0070701_103706242 98
715 3300005438 Ga0070701_11178807 Ga0070701_111788072 98
716 3300005439 Ga0070711_100588687 Ga0070711_1005886872 98
717 3300005439 Ga0070711_101164608 Ga0070711_1011646082 98
718 3300005441 Ga0070700_100000035 Ga0070700_1000000355 98
719 3300005441 Ga0070700_100251879 Ga0070700_1002518791 98
720 3300005441 Ga0070700_100457360 Ga0070700_1004573602 98
721 3300005444 Ga0070694_100582079 Ga0070694_1005820792 98
722 3300005455 Ga0070663_100059928 Ga0070663_1000599285 98
723 3300005455 Ga0070663_100540144 Ga0070663_1005401442 98
724 3300005455 Ga0070663_100556367 Ga0070663_1005563672 98
725 3300005456 Ga0070678_100123889 Ga0070678_1001238893 98
726 3300005456 Ga0070678_100139403 Ga0070678_1001394031 98
727 3300005456 Ga0070678_102351050 Ga0070678_1023510501 98
728 3300005457 Ga0070662_100092660 Ga0070662_1000926602 98
729 3300005458 Ga0070681_10004293 Ga0070681_1000429319 98
730 3300005459 Ga0068867_101090292 Ga0068867_1010902921 98
731 3300005466 Ga0070685_10202330 Ga0070685_102023302 98
732 3300005471 Ga0070698_101663035 Ga0070698_1016630351 98
733 3300005530 Ga0070679_100006878 Ga0070679_10000687819 98
734 3300005539 Ga0068853_100307169 Ga0068853_1003071692 98
735 3300005539 Ga0068853_101196776 Ga0068853_1011967761 98
736 3300005544 Ga0070686_100819300 Ga0070686_1008193001 98
737 3300005545 Ga0070695_101017329 Ga0070695_1010173292 98
738 3300005547 Ga0070693_100121492 Ga0070693_1001214921 98
739 3300005548 Ga0070665_100001905 Ga0070665_10000190534 98
740 3300005548 Ga0070665_100002601 Ga0070665_10000260117 98
741 3300005548 Ga0070665_100220087 Ga0070665_1002200871 98
742 3300005548 Ga0070665_100236226 Ga0070665_1002362262 98
743 3300005548 Ga0070665_100988870 Ga0070665_1009888702 98
744 3300005548 Ga0070665_101956487 Ga0070665_1019564872 98
745 3300005549 Ga0070704_100178966 Ga0070704_1001789662 98
746 3300005563 Ga0068855_100046634 Ga0068855_1000466345 98
747 3300005563 Ga0068855_100284096 Ga0068855_1002840963 98
748 3300005578 Ga0068854_100178489 Ga0068854_1001784893 98
749 3300005578 Ga0068854_100905312 Ga0068854_1009053122 98
750 3300005614 Ga0068856_100305559 Ga0068856_1003055593 98
751 3300005615 Ga0070702_100116385 Ga0070702_1001163852 98
752 3300005615 Ga0070702_100365775 Ga0070702_1003657752 98
753 3300005616 Ga0068852_101086978 Ga0068852_1010869782 98
754 3300005616 Ga0068852_101964835 Ga0068852_1019648352 98
755 3300005617 Ga0068859_100962717 Ga0068859_1009627172 98
756 3300005617 Ga0068859_102396822 Ga0068859_1023968222 98
757 3300005618 Ga0068864_101349881 Ga0068864_1013498812 98
758 3300005718 Ga0068866_10064529 Ga0068866_100645293 98
759 3300005719 Ga0068861_101538927 Ga0068861_1015389272 98
760 3300005834 Ga0068851_10146074 Ga0068851_101460742 98
761 3300005840 Ga0068870_10422386 Ga0068870_104223862 98
762 3300005840 Ga0068870_11333673 Ga0068870_113336731 98
763 3300005841 Ga0068863_100000497 Ga0068863_10000049730 98
764 3300005841 Ga0068863_100130459 Ga0068863_1001304592 98
765 3300005841 Ga0068863_100335344 Ga0068863_1003353442 98
766 3300005842 Ga0068858_100019674 Ga0068858_1000196744 98
767 3300005842 Ga0068858_100365377 Ga0068858_1003653773 98
768 3300005842 Ga0068858_101987275 Ga0068858_1019872751 98
769 3300005843 Ga0068860_100000054 Ga0068860_100000054104 98
770 3300005843 Ga0068860_100193897 Ga0068860_1001938974 98
771 3300005843 Ga0068860_102779239 Ga0068860_1027792392 98
772 3300005844 Ga0068862_100437710 Ga0068862_1004377102 98
773 3300005844 Ga0068862_100858963 Ga0068862_1008589632 98
774 3300005844 Ga0068862_101531011 Ga0068862_1015310112 98
775 3300006028 Ga0070717_10311589 Ga0070717_103115892 98
776 3300006048 Ga0075363_100442769 Ga0075363_1004427692 98
777 3300006175 Ga0070712_100060728 Ga0070712_1000607282 98
778 3300006186 Ga0075369_10000768 Ga0075369_1000076811 98
779 3300006237 Ga0097621_100388372 Ga0097621_1003883722 98
780 3300006237 Ga0097621_100996674 Ga0097621_1009966742 98
781 3300006353 Ga0075370_10274662 Ga0075370_102746622 98
782 3300006881 Ga0068865_101238618 Ga0068865_1012386182 98
783 3300006931 Ga0097620_100962672 Ga0097620_1009626722 98
784 3300006931 Ga0097620_102396822 Ga0097620_1023968222 98
785 3300007076 Ga0075435_101013557 Ga0075435_1010135572 98
786 3300007788 Ga0099795_10439968 Ga0099795_104399682 98
787 3300009093 Ga0105240_10129775 Ga0105240_101297753 98
788 3300009093 Ga0105240_10279796 Ga0105240_102797962 98
789 3300009094 Ga0111539_12239040 Ga0111539_122390402 98
790 3300009094 Ga0111539_13334324 Ga0111539_133343241 98
791 3300009098 Ga0105245_10090859 Ga0105245_100908593 98
792 3300009098 Ga0105245_10406179 Ga0105245_104061792 98
793 3300009098 Ga0105245_10563991 Ga0105245_105639912 98
794 3300009101 Ga0105247_10112575 Ga0105247_101125753 98
795 3300009101 Ga0105247_10279709 Ga0105247_102797092 98
796 3300009174 Ga0105241_10673073 Ga0105241_106730732 98
797 3300009176 Ga0105242_10844031 Ga0105242_108440312 98
798 3300009176 Ga0105242_12394979 Ga0105242_123949792 98
799 3300009177 Ga0105248_10416519 Ga0105248_104165193 98
800 3300009545 Ga0105237_10323663 Ga0105237_103236632 98
801 3300009545 Ga0105237_10740180 Ga0105237_107401802 98
802 3300009545 Ga0105237_11898099 Ga0105237_118980991 98
803 3300009545 Ga0105237_12235722 Ga0105237_122357222 98
804 3300009551 Ga0105238_10301065 Ga0105238_103010652 98
805 3300009551 Ga0105238_10389443 Ga0105238_103894433 98
806 3300009551 Ga0105238_10812133 Ga0105238_108121332 98
807 3300009551 Ga0105238_10820965 Ga0105238_108209652 98
808 3300009551 Ga0105238_11122481 Ga0105238_111224812 98
809 3300009553 Ga0105249_10140872 Ga0105249_101408722 98
810 3300009553 Ga0105249_10348738 Ga0105249_103487382 98
811 3300010375 Ga0105239_10354484 Ga0105239_103544843 98
812 3300013100 Ga0157373_10285423 Ga0157373_102854232 98
813 3300013102 Ga0157371_10590652 Ga0157371_105906522 98
814 3300013102 Ga0157371_10635361 Ga0157371_106353612 98
815 3300013104 Ga0157370_10108707 Ga0157370_101087074 98
816 3300013104 Ga0157370_10443282 Ga0157370_104432822 98
817 3300013104 Ga0157370_10919194 Ga0157370_109191942 98
818 3300013105 Ga0157369_10129817 Ga0157369_101298172 98
819 3300013105 Ga0157369_10329543 Ga0157369_103295432 98
820 3300013105 Ga0157369_11055175 Ga0157369_110551752 98
821 3300013296 Ga0157374_11126343 Ga0157374_111263432 98
822 3300013296 Ga0157374_12542787 Ga0157374_125427872 98
823 3300013297 Ga0157378_10204057 Ga0157378_102040574 98
824 3300013306 Ga0163162_10484708 Ga0163162_104847083 98
825 3300013306 Ga0163162_11566472 Ga0163162_115664722 98
826 3300013307 Ga0157372_10000069 Ga0157372_1000006982 98
827 3300013307 Ga0157372_11757235 Ga0157372_117572352 98
828 3300013308 Ga0157375_10823793 Ga0157375_108237932 98
829 3300013308 Ga0157375_12908163 Ga0157375_129081631 98
830 3300014325 Ga0163163_11227374 Ga0163163_112273741 98
831 3300014326 Ga0157380_12036197 Ga0157380_120361972 98
832 3300014745 Ga0157377_10133410 Ga0157377_101334102 98
833 3300014968 Ga0157379_10008421 Ga0157379_100084212 98
834 3300014968 Ga0157379_11086010 Ga0157379_110860102 98
835 3300020069 Ga0197907_10353354 Ga0197907_103533542 98
836 3300020069 Ga0197907_10377945 Ga0197907_103779455 98
837 3300020069 Ga0197907_10968004 Ga0197907_109680041 98
838 3300020070 Ga0206356_10734286 Ga0206356_107342864 98
839 3300020070 Ga0206356_11250559 Ga0206356_112505592 98
840 3300020075 Ga0206349_1421489 Ga0206349_14214892 98
841 3300020075 Ga0206349_1728033 Ga0206349_17280332 98
842 3300020076 Ga0206355_1261997 Ga0206355_12619973 98
843 3300020076 Ga0206355_1415001 Ga0206355_14150012 98
844 3300020076 Ga0206355_1472830 Ga0206355_14728302 98
845 3300020077 Ga0206351_10076119 Ga0206351_100761192 98
846 3300020077 Ga0206351_10309003 Ga0206351_103090032 98
847 3300020077 Ga0206351_10377689 Ga0206351_103776892 98
848 3300020077 Ga0206351_10514268 Ga0206351_105142682 98
849 3300020077 Ga0206351_10522676 Ga0206351_105226762 98
850 3300020078 Ga0206352_11045450 Ga0206352_110454503 98
851 3300020080 Ga0206350_11483097 Ga0206350_114830972 98
852 3300020081 Ga0206354_10317063 Ga0206354_103170632 98
853 3300020081 Ga0206354_10357282 Ga0206354_103572822 98
854 3300020081 Ga0206354_10491146 Ga0206354_104911463 98
855 3300020081 Ga0206354_10676331 Ga0206354_106763312 98
856 3300020081 Ga0206354_11153566 Ga0206354_111535662 98
857 3300020082 Ga0206353_10924004 Ga0206353_109240045 98
858 3300020082 Ga0206353_11139857 Ga0206353_111398572 98
859 3300020610 Ga0154015_1344825 Ga0154015_13448251 98
860 3300021358 Ga0213873_10166278 Ga0213873_101662782 98
861 3300021384 Ga0213876_10022127 Ga0213876_100221274 98
862 3300021384 Ga0213876_10131711 Ga0213876_101317111 98
863 3300021388 Ga0213875_10000107 Ga0213875_1000010757 98
864 3300021388 Ga0213875_10010348 Ga0213875_100103486 98
865 3300021388 Ga0213875_10153206 Ga0213875_101532062 98
866 3300022467 Ga0224712_10000575 Ga0224712_1000057511 98
867 3300022467 Ga0224712_10049036 Ga0224712_100490363 98
868 3300022467 Ga0224712_10272665 Ga0224712_102726652 98
869 3300025321 Ga0207656_10097780 Ga0207656_100977802 98
870 3300025885 Ga0207653_10129988 Ga0207653_101299882 98
871 3300025898 Ga0207692_10039662 Ga0207692_100396624 98
872 3300025898 Ga0207692_10162735 Ga0207692_101627351 98
873 3300025899 Ga0207642_10263796 Ga0207642_102637962 98
874 3300025900 Ga0207710_10069288 Ga0207710_100692882 98
875 3300025900 Ga0207710_10400064 Ga0207710_104000642 98
876 3300025901 Ga0207688_10003298 Ga0207688_1000329811 98
877 3300025903 Ga0207680_10522776 Ga0207680_105227762 98
878 3300025904 Ga0207647_10132804 Ga0207647_101328042 98
879 3300025904 Ga0207647_10502044 Ga0207647_105020442 98
880 3300025905 Ga0207685_10131484 Ga0207685_101314842 98
881 3300025906 Ga0207699_10095716 Ga0207699_100957163 98
882 3300025906 Ga0207699_10129509 Ga0207699_101295093 98
883 3300025908 Ga0207643_10175640 Ga0207643_101756402 98
884 3300025908 Ga0207643_10545745 Ga0207643_105457452 98
885 3300025909 Ga0207705_10000671 Ga0207705_1000067133 98
886 3300025909 Ga0207705_10354451 Ga0207705_103544512 98
887 3300025909 Ga0207705_10464917 Ga0207705_104649172 98
888 3300025910 Ga0207684_11152632 Ga0207684_111526322 98
889 3300025912 Ga0207707_10006511 Ga0207707_100065118 98
890 3300025913 Ga0207695_10115359 Ga0207695_101153595 98
891 3300025913 Ga0207695_10814538 Ga0207695_108145381 98
892 3300025914 Ga0207671_10071765 Ga0207671_100717654 98
893 3300025914 Ga0207671_11468956 Ga0207671_114689561 98
894 3300025915 Ga0207693_10011155 Ga0207693_1001115510 98
895 3300025915 Ga0207693_10725458 Ga0207693_107254582 98
896 3300025916 Ga0207663_10111171 Ga0207663_101111713 98
897 3300025916 Ga0207663_10204599 Ga0207663_102045992 98
898 3300025916 Ga0207663_11752084 Ga0207663_117520842 98
899 3300025917 Ga0207660_10000562 Ga0207660_1000056234 98
900 3300025919 Ga0207657_10177471 Ga0207657_101774712 98
901 3300025921 Ga0207652_10000632 Ga0207652_1000063210 98
902 3300025923 Ga0207681_11803394 Ga0207681_118033942 98
903 3300025924 Ga0207694_10278016 Ga0207694_102780162 98
904 3300025924 Ga0207694_10493274 Ga0207694_104932742 98
905 3300025924 Ga0207694_10772435 Ga0207694_107724352 98
906 3300025925 Ga0207650_10979736 Ga0207650_109797362 98
907 3300025926 Ga0207659_10117802 Ga0207659_101178023 98
908 3300025927 Ga0207687_10104213 Ga0207687_101042134 98
909 3300025927 Ga0207687_10176039 Ga0207687_101760393 98
910 3300025928 Ga0207700_10047227 Ga0207700_100472272 98
911 3300025929 Ga0207664_10000001 Ga0207664_10000001518 98
912 3300025929 Ga0207664_10081228 Ga0207664_100812284 98
913 3300025929 Ga0207664_10480679 Ga0207664_104806792 98
914 3300025931 Ga0207644_10022904 Ga0207644_100229045 98
915 3300025931 Ga0207644_10622978 Ga0207644_106229782 98
916 3300025932 Ga0207690_10287156 Ga0207690_102871562 98
917 3300025933 Ga0207706_10149626 Ga0207706_101496262 98
918 3300025934 Ga0207686_10515868 Ga0207686_105158682 98
919 3300025935 Ga0207709_10127337 Ga0207709_101273371 98
920 3300025936 Ga0207670_10491524 Ga0207670_104915242 98
921 3300025936 Ga0207670_10954177 Ga0207670_109541772 98
922 3300025936 Ga0207670_11503418 Ga0207670_115034182 98
923 3300025937 Ga0207669_10063775 Ga0207669_100637753 98
924 3300025937 Ga0207669_10118183 Ga0207669_101181833 98
925 3300025937 Ga0207669_11889428 Ga0207669_118894282 98
926 3300025938 Ga0207704_10626228 Ga0207704_106262282 98
927 3300025938 Ga0207704_11489114 Ga0207704_114891141 98
928 3300025939 Ga0207665_10402902 Ga0207665_104029021 98
929 3300025942 Ga0207689_10173846 Ga0207689_101738461 98
930 3300025944 Ga0207661_10542623 Ga0207661_105426232 98
931 3300025944 Ga0207661_11488934 Ga0207661_114889342 98
932 3300025960 Ga0207651_10259888 Ga0207651_102598882 98
933 3300025960 Ga0207651_10276475 Ga0207651_102764752 98
934 3300025961 Ga0207712_10213239 Ga0207712_102132392 98
935 3300025972 Ga0207668_10029372 Ga0207668_100293726 98
936 3300025972 Ga0207668_10104040 Ga0207668_101040405 98
937 3300025972 Ga0207668_10507411 Ga0207668_105074112 98
938 3300025972 Ga0207668_10760224 Ga0207668_107602242 98
939 3300025981 Ga0207640_10110526 Ga0207640_101105264 98
940 3300025986 Ga0207658_10017892 Ga0207658_100178926 98
941 3300025986 Ga0207658_10417015 Ga0207658_104170151 98
942 3300025986 Ga0207658_10960136 Ga0207658_109601362 98
943 3300026023 Ga0207677_10296380 Ga0207677_102963803 98
944 3300026035 Ga0207703_10094586 Ga0207703_100945863 98
945 3300026041 Ga0207639_10508431 Ga0207639_105084312 98
946 3300026041 Ga0207639_12112016 Ga0207639_121120162 98
947 3300026067 Ga0207678_10134885 Ga0207678_101348854 98
948 3300026067 Ga0207678_10163083 Ga0207678_101630834 98
949 3300026067 Ga0207678_10591157 Ga0207678_105911571 98
950 3300026075 Ga0207708_10000030 Ga0207708_10000030151 98
951 3300026075 Ga0207708_10474917 Ga0207708_104749172 98
952 3300026075 Ga0207708_12051222 Ga0207708_120512222 98
953 3300026078 Ga0207702_10593991 Ga0207702_105939912 98
954 3300026078 Ga0207702_10937072 Ga0207702_109370722 98
955 3300026088 Ga0207641_10000478 Ga0207641_1000047819 98
956 3300026088 Ga0207641_10100925 Ga0207641_101009254 98
957 3300026089 Ga0207648_10334848 Ga0207648_103348481 98
958 3300026095 Ga0207676_10080647 Ga0207676_100806474 98
959 3300026118 Ga0207675_100396136 Ga0207675_1003961361 98
960 3300026118 Ga0207675_100498663 Ga0207675_1004986632 98
961 3300026121 Ga0207683_10111118 Ga0207683_101111185 98
962 3300026121 Ga0207683_10176704 Ga0207683_101767041 98
963 3300026121 Ga0207683_11764047 Ga0207683_117640472 98
964 3300026142 Ga0207698_11140528 Ga0207698_111405282 98
965 3300028379 Ga0268266_10006407 Ga0268266_1000640710 98
966 3300028379 Ga0268266_10021808 Ga0268266_100218085 98
967 3300028379 Ga0268266_10073860 Ga0268266_100738603 98
968 3300028379 Ga0268266_10508208 Ga0268266_105082082 98
969 3300028379 Ga0268266_10571329 Ga0268266_105713292 98
970 3300028380 Ga0268265_11399771 Ga0268265_113997712 98
971 3300028380 Ga0268265_11520162 Ga0268265_115201621 98
972 3300028380 Ga0268265_12487598 Ga0268265_124875982 98
973 3300028381 Ga0268264_10000097 Ga0268264_10000097122 98
974 3300028381 Ga0268264_10013159 Ga0268264_100131592 98
975 3300028381 Ga0268264_10471038 Ga0268264_104710381 98
976 3300028794 Ga0307515_10193296 Ga0307515_101932963 98
977 3300028800 Ga0265338_10089548 Ga0265338_100895483 98
978 3300028800 Ga0265338_10304734 Ga0265338_103047342 98
979 3300028800 Ga0265338_10986840 Ga0265338_109868402 98
980 3300029285 Ga0310981_1087667 Ga0310981_10876672 98
981 3300031241 Ga0265325_10136111 Ga0265325_101361112 98
982 3300031241 Ga0265325_10301924 Ga0265325_103019242 98
983 3300031247 Ga0265340_10022026 Ga0265340_100220264 98
984 3300031249 Ga0265339_10126373 Ga0265339_101263732 98
985 3300031249 Ga0265339_10321347 Ga0265339_103213472 98
986 3300031250 Ga0265331_10047396 Ga0265331_100473963 98
987 3300031251 Ga0265327_10000532 Ga0265327_1000053261 98
988 3300031344 Ga0265316_10222988 Ga0265316_102229882 98
989 3300031456 Ga0307513_10863617 Ga0307513_108636172 98
990 3300031595 Ga0265313_10062846 Ga0265313_100628463 98
991 3300031711 Ga0265314_10041461 Ga0265314_100414612 98
992 3300031712 Ga0265342_10086654 Ga0265342_100866542 98
993 3300031727 Ga0316576_10123294 Ga0316576_101232942 98
994 3300031824 Ga0307413_11585277 Ga0307413_115852772 98
995 3300031838 Ga0307518_10016411 Ga0307518_1001641110 98
996 3300031901 Ga0307406_10144961 Ga0307406_101449613 98
997 3300031903 Ga0307407_10792027 Ga0307407_107920272 98
998 3300031903 Ga0307407_11635889 Ga0307407_116358892 98
999 3300031911 Ga0307412_10336182 Ga0307412_103361822 98
1000 3300031995 Ga0307409_102330774 Ga0307409_1023307742 98
1001 3300032002 Ga0307416_100759765 Ga0307416_1007597652 98
1002 3300032004 Ga0307414_12254754 Ga0307414_122547542 98
1003 3300032126 Ga0307415_100158134 Ga0307415_1001581342 98
1004 3300034817 Ga0373948_0028084 Ga0373948_0028084_747_1049 98
1005 3300034818 Ga0373950_0093089 Ga0373950_0093089_98_400 98
1006 3300035092 Ga0373952_0011022 Ga0373952_0011022_930_1232 98
1007 3300035114 Ga0373939_0040331 Ga0373939_0040331_27_329 98
1008 3300035119 Ga0373956_0003612 Ga0373956_0003612_4926_5225 98
1009 3300035207 Ga0373942_0060545 Ga0373942_0060545_88_390 98
1010 3300035691 Ga0373931_0101770 Ga0373931_0101770_195_497 98
1011 3300035695 Ga0373927_0337418 Ga0373927_0337418_197_493 98
1012 3300037418 Ga0395900_0013704 Ga0395900_0013704_7694_7993 98
1013 3300037853 Ga0436364_0401206 Ga0436364_0401206_108_410 98
1014 3300037853 Ga0436364_0520200 Ga0436364_0520200_590_886 98
1015 3300037853 Ga0436364_0609479 Ga0436364_0609479_3307_3606 98
1016 3300039437 Ga0436365_0295075 Ga0436365_0295075_1593_1892 98
1017 3300039437 Ga0436365_0604975 Ga0436365_0604975_780_1082 98
1018 3300039450 Ga0436363_1061940 Ga0436363_1061940_29_331 98
1019 3300039450 Ga0436363_1290117 Ga0436363_1290117_194_496 98
1020 3300039453 Ga0436362_0051453 Ga0436362_0051453_250_549 98
1021 3300039453 Ga0436362_1253162 Ga0436362_1253162_256_558 98
1022 3300041441 Ga0451787_783834 Ga0451787_783834_450_752 98
1023 3300041443 Ga0451789_1064070 Ga0451789_1064070_1160_1462 98
1024 3300041445 Ga0451792_14883 Ga0451792_14883_238_540 98
1025 3300041446 Ga0451794_48115 Ga0451794_48115_138_440 98
1026 3300041456 Ga0451795_1175078 Ga0451795_1175078_558_860 98
1027 3300041458 Ga0451798_0310622 Ga0451798_0310622_241_543 98
1028 3300041460 Ga0451802_2051750 Ga0451802_2051750_89_391 98
1029 3300041461 Ga0451805_109072 Ga0451805_109072_287_589 98
1030 3300041491 Ga0451833_0644812 Ga0451833_0644812_226_528 98
1031 3300041494 Ga0451837_0770417 Ga0451837_0770417_234_536 98
1032 3300041494 Ga0451837_0907669 Ga0451837_0907669_77_379 98
1033 3300041496 Ga0451839_0025401 Ga0451839_0025401_221_523 98
1034 3300041498 Ga0451841_0204057 Ga0451841_0204057_249_551 98
1035 3300041509 Ga0451843_0078182 Ga0451843_0078182_487_789 98
1036 3300041512 Ga0451853_2803505 Ga0451853_2803505_211_528 98
1037 3300042016 Ga0439463_097662 Ga0439463_097662_305_604 98
1038 3300042122 Ga0450920_130800 Ga0450920_130800_109_411 98
1039 3300042438 Ga0439459_0244558 Ga0439459_0244558_59_361 98
1040 3300042531 Ga0450918_024976 Ga0450918_024976_718_1020 98
1041 3300044656 Ga0466969_0370129 Ga0466969_0370129_259_558 98
1042 3300044658 Ga0466972_0006214 Ga0466972_0006214_2169_2468 98
1043 3300044683 Ga0466965_0076067 Ga0466965_0076067_309_608 98
1044 3300044684 Ga0466966_0000383 Ga0466966_0000383_27460_27759 98
1045 3300044694 Ga0466963_0010998 Ga0466963_0010998_3240_3539 98
1046 3300044694 Ga0466963_0072087 Ga0466963_0072087_377_679 98
1047 3300044706 Ga0466964_0411812 Ga0466964_0411812_156_458 98
1048 3300044719 Ga0466971_0020494 Ga0466971_0020494_638_937 98
1049 3300044719 Ga0466971_0215860 Ga0466971_0215860_562_858 98
1050 3300044735 Ga0466968_0004861 Ga0466968_0004861_2259_2558 98
1051 3300044842 Ga0466957_0015313 Ga0466957_0015313_1694_1993 98
1052 3300044842 Ga0466957_0152249 Ga0466957_0152249_1092_1394 98
1053 3300044901 Ga0466960_0000533 Ga0466960_0000533_2169_2468 98
1054 3300044901 Ga0466960_0000908 Ga0466960_0000908_4631_4933 98
1055 3300044901 Ga0466960_0036156 Ga0466960_0036156_756_1055 98
1056 3300045049 Ga0466959_0020923 Ga0466959_0020923_2018_2317 98
1057 3300045049 Ga0466959_0256793 Ga0466959_0256793_350_652 98
1058 3300045049 Ga0466959_0395751 Ga0466959_0395751_157_456 98
1059 3300045836 Ga0466958_0357621 Ga0466958_0357621_185_484 98
1060 3300045836 Ga0466958_0891301 Ga0466958_0891301_239_541 98
1061 3300045976 Ga0466967_0007938 Ga0466967_0007938_216_515 98
1062 3300045976 Ga0466967_0008336 Ga0466967_0008336_1736_2035 98
1063 3300045976 Ga0466967_0065145 Ga0466967_0065145_1551_1853 98
1064 3300045976 Ga0466967_0073153 Ga0466967_0073153_2553_2852 98
1065 3300045976 Ga0466967_0238263 Ga0466967_0238263_431_733 98
1066 3300045976 Ga0466967_0523135 Ga0466967_0523135_313_615 98
1067 3300045976 Ga0466967_0593390 Ga0466967_0593390_596_898 98
1068 3300045976 Ga0466967_1374086 Ga0466967_1374086_112_411 98
1069 3300046457 Ga0495590_0136878 Ga0495590_0136878_374_676 98
1070 3300046460 Ga0495638_0044083 Ga0495638_0044083_506_808 98
1071 3300046471 Ga0495650_0236782 Ga0495650_0236782_84_386 98
1072 3300046512 Ga0495610_0090814 Ga0495610_0090814_55_357 98
1073 3300046513 Ga0495616_0475045 Ga0495616_0475045_36_338 98
1074 3300046515 Ga0495620_0115056 Ga0495620_0115056_738_1040 98
1075 3300046518 Ga0495631_0109348 Ga0495631_0109348_676_978 98
1076 3300046518 Ga0495631_0275711 Ga0495631_0275711_62_364 98
1077 3300046615 Ga0495656_0297732 Ga0495656_0297732_273_575 98
1078 3300046616 Ga0495668_0059405 Ga0495668_0059405_1024_1326 98
1079 3300046616 Ga0495668_0419445 Ga0495668_0419445_196_498 98
1080 3300046642 Ga0495634_0604811 Ga0495634_0604811_188_484 98
1081 3300046663 Ga0495635_0786685 Ga0495635_0786685_210_506 98
1082 3300046683 Ga0495658_0245200 Ga0495658_0245200_373_675 98
1083 3300046694 Ga0495649_0039261 Ga0495649_0039261_2204_2506 98
1084 3300046809 Ga0495600_0686248 Ga0495600_0686248_143_439 98
1085 3300047320 Ga0495672_0166918 Ga0495672_0166918_106_408 98
1086 3300047471 Ga0495684_0841053 Ga0495684_0841053_152_448 98
1087 3300047472 Ga0495686_0003291 Ga0495686_0003291_6053_6355 98
1088 3300047472 Ga0495686_0111188 Ga0495686_0111188_172_474 98
1089 3300048091 Ga0495626_0242522 Ga0495626_0242522_340_642 98
1090 3300048903 Ga0496100_0710810 Ga0496100_0710810_329_631 98
1091 3300048904 Ga0496101_1474280 Ga0496101_1474280_172_474 98
1092 3300048905 Ga0496102_0163736 Ga0496102_0163736_406_708 98
1093 3300048906 Ga0496103_0135378 Ga0496103_0135378_59_361 98
1094 3300048907 Ga0496104_0412306 Ga0496104_0412306_76_378 98
1095 3300048908 Ga0496105_0078709 Ga0496105_0078709_658_960 98
1096 3300048908 Ga0496105_0106535 Ga0496105_0106535_1539_1841 98
1097 3300048909 Ga0496106_0309435 Ga0496106_0309435_89_391 98
1098 3300048911 Ga0496108_0000394 Ga0496108_0000394_30812_31114 98
1099 3300048911 Ga0496108_1284128 Ga0496108_1284128_253_555 98
1100 3300048911 Ga0496108_1688181 Ga0496108_1688181_105_401 98
1101 3300048912 Ga0496109_0054075 Ga0496109_0054075_1937_2239 98
1102 3300048912 Ga0496109_0059705 Ga0496109_0059705_3035_3337 98
1103 3300048912 Ga0496109_1680357 Ga0496109_1680357_179_475 98
1104 3300048913 Ga0496110_0027034 Ga0496110_0027034_3709_4011 98
1105 3300048913 Ga0496110_0735326 Ga0496110_0735326_132_434 98
1106 3300048914 Ga0496111_0011467 Ga0496111_0011467_1972_2274 98
1107 3300048915 Ga0496112_0088274 Ga0496112_0088274_1072_1368 98
1108 3300048915 Ga0496112_0249649 Ga0496112_0249649_864_1160 98
1109 3300048915 Ga0496112_0288501 Ga0496112_0288501_668_970 98
1110 3300048916 Ga0496113_0113223 Ga0496113_0113223_28_324 98
1111 3300048916 Ga0496113_0145175 Ga0496113_0145175_896_1198 98
1112 3300048916 Ga0496113_1112264 Ga0496113_1112264_76_378 98
1113 3300048917 Ga0496114_0275587 Ga0496114_0275587_161_463 98
1114 3300048918 Ga0496115_0563085 Ga0496115_0563085_450_752 98
1115 3300048918 Ga0496115_0629412 Ga0496115_0629412_118_420 98
1116 3300048920 Ga0496117_0103373 Ga0496117_0103373_774_1076 98
1117 3300048921 Ga0496118_0007173 Ga0496118_0007173_3998_4300 98
1118 3300048922 Ga0496119_0010999 Ga0496119_0010999_4162_4464 98
1119 3300048922 Ga0496119_0158815 Ga0496119_0158815_865_1167 98
1120 3300048922 Ga0496119_0187404 Ga0496119_0187404_188_484 98
1121 3300048924 Ga0496121_0803842 Ga0496121_0803842_141_443 98
1122 3300048925 Ga0496122_0001412 Ga0496122_0001412_5541_5843 98
1123 3300048925 Ga0496122_0278196 Ga0496122_0278196_332_634 98
1124 3300048926 Ga0496123_0177626 Ga0496123_0177626_288_590 98
1125 3300048927 Ga0496124_0068795 Ga0496124_0068795_1606_1908 98
1126 3300048927 Ga0496124_0460501 Ga0496124_0460501_505_807 98
1127 3300048928 Ga0496125_0000086 Ga0496125_0000086_106457_106759 98
1128 3300048928 Ga0496125_0096987 Ga0496125_0096987_123_425 98
1129 3300048928 Ga0496125_0696133 Ga0496125_0696133_10_309 98
1130 3300048929 Ga0496126_0011857 Ga0496126_0011857_6150_6446 98
1131 3300048929 Ga0496126_0022728 Ga0496126_0022728_2326_2628 98
1132 3300048929 Ga0496126_0472159 Ga0496126_0472159_414_716 98
1133 3300049128 Ga0501308_018367 Ga0501308_018367_42_341 98
1134 3300049129 Ga0501309_026974 Ga0501309_026974_520_819 98
1135 3300049162 Ga0501307_025664 Ga0501307_025664_43_345 98
1136 3300049531 Ga0501315_002746 Ga0501315_002746_661_960 98
1137 3300049533 Ga0501317_037503 Ga0501317_037503_120_422 98
1138 3300049534 Ga0501318_001483 Ga0501318_001483_675_974 98
1139 3300049534 Ga0501318_063153 Ga0501318_063153_188_487 98
1140 3300049569 Ga0501032_0367807 Ga0501032_0367807_225_527 98
1141 3300049570 Ga0501033_0018926 Ga0501033_0018926_4751_5053 98
1142 3300049571 Ga0501034_0051107 Ga0501034_0051107_2634_2936 98
1143 3300049579 Ga0501043_0300656 Ga0501043_0300656_286_588 98
1144 3300049580 Ga0501046_0658038 Ga0501046_0658038_214_516 98
1145 3300049581 Ga0501047_0131139 Ga0501047_0131139_2064_2366 98
1146 3300049581 Ga0501047_0516081 Ga0501047_0516081_253_555 98
1147 3300049581 Ga0501047_0681433 Ga0501047_0681433_439_741 98
1148 3300049582 Ga0501048_0661166 Ga0501048_0661166_410_712 98
1149 3300049582 Ga0501048_1043826 Ga0501048_1043826_193_495 98
1150 3300049584 Ga0501068_0516047 Ga0501068_0516047_242_544 98
1151 3300049584 Ga0501068_0544010 Ga0501068_0544010_41_340 98
1152 3300049586 Ga0501070_0508396 Ga0501070_0508396_516_815 98
1153 3300049588 Ga0501072_0153562 Ga0501072_0153562_85_384 98
1154 3300049592 Ga0501076_0622239 Ga0501076_0622239_211_510 98
1155 3300049741 Ga0501079_0350904 Ga0501079_0350904_682_981 98
1156 3300049822 Ga0501035_0038527 Ga0501035_0038527_2826_3128 98
1157 3300049822 Ga0501035_0147188 Ga0501035_0147188_1367_1669 98
1158 3300049823 Ga0501044_0001781 Ga0501044_0001781_13770_14072 98
1159 3300049823 Ga0501044_0019028 Ga0501044_0019028_3046_3348 98
1160 3300050490 nmdc:mga03n38_398006_c1 nmdc:mga03n38_398006_c1_311_613 98
1161 3300050508 nmdc:mga09592_61988_c1 nmdc:mga09592_61988_c1_886_1185 98
1162 3300050516 nmdc:mga0sz30_326574_c1 nmdc:mga0sz30_326574_c1_265_567 98
1163 3300050516 nmdc:mga0sz30_89399_c1 nmdc:mga0sz30_89399_c1_119_421 98
1164 3300050516 nmdc:mga0sz30_9944_c1 nmdc:mga0sz30_9944_c1_210_512 98
1165 3300053086 Ga0500578_0065527 Ga0500578_0065527_594_896 98
1166 3300053092 Ga0500583_0476014 Ga0500583_0476014_12_314 98
1167 3300053104 Ga0500556_0046105 Ga0500556_0046105_775_1077 98
1168 3300053108 Ga0500562_006102 Ga0500562_006102_2033_2335 98
1169 3300053108 Ga0500562_094435 Ga0500562_094435_121_423 98
1170 3300053108 Ga0500562_190885 Ga0500562_190885_200_499 98
1171 3300053116 Ga0500592_053543 Ga0500592_053543_34_336 98
1172 3300053130 Ga0500642_0006030 Ga0500642_0006030_1711_2013 98
1173 3300053130 Ga0500642_0281344 Ga0500642_0281344_166_468 98
1174 3300053131 Ga0500652_278957 Ga0500652_278957_291_593 98
1175 3300053134 Ga0500658_0256755 Ga0500658_0256755_180_482 98
1176 3300053136 Ga0500559_0036373 Ga0500559_0036373_1445_1747 98
1177 3300053139 Ga0500568_0069854 Ga0500568_0069854_143_445 98
1178 3300053146 Ga0500588_0412599 Ga0500588_0412599_32_334 98
1179 3300053153 Ga0500616_0051871 Ga0500616_0051871_952_1254 98
1180 3300053727 Ga0500611_254895 Ga0500611_254895_21_323 98
1181 3300053730 Ga0500645_000323 Ga0500645_000323_1232_1534 98
1182 3300059491 Ga0587070_228714 Ga0587070_228714_193_489 98
1183 3300059503 Ga0587080_117594 Ga0587080_117594_143_439 98
1184 3300059503 Ga0587080_137077 Ga0587080_137077_103_405 98
1185 3300059508 Ga0587088_095075 Ga0587088_095075_191_493 98
1186 3300059628 Ga0587122_016964 Ga0587122_016964_320_619 98
1187 3300059630 Ga0587128_096288 Ga0587128_096288_238_549 98
1188 3300059647 Ga0587079_044421 Ga0587079_044421_172_474 98
1189 3300059647 Ga0587079_083719 Ga0587079_083719_285_587 98
1190 3300060344 Ga0587071_043399 Ga0587071_043399_447_749 98
1191 3300061719 Ga0466962_0056659 Ga0466962_0056659_1190_1489 98
1192 3300061719 Ga0466962_0058121 Ga0466962_0058121_1198_1500 98
1193 3300004799 Ga0058863_11921357 Ga0058863_119213574 99
1194 3300004801 Ga0058860_10054779 Ga0058860_100547792 99
1195 3300004803 Ga0058862_12635954 Ga0058862_126359541 99
1196 3300005329 Ga0070683_100688812 Ga0070683_1006888122 99
1197 3300005333 Ga0070677_10688200 Ga0070677_106882002 99
1198 3300005336 Ga0070680_100003083 Ga0070680_1000030837 99
1199 3300005366 Ga0070659_101741183 Ga0070659_1017411832 99
1200 3300005435 Ga0070714_100622362 Ga0070714_1006223622 99
1201 3300005458 Ga0070681_10022551 Ga0070681_100225515 99
1202 3300005458 Ga0070681_12033717 Ga0070681_120337172 99
1203 3300005530 Ga0070679_100003833 Ga0070679_1000038334 99
1204 3300005530 Ga0070679_101169937 Ga0070679_1011699372 99
1205 3300005535 Ga0070684_100351512 Ga0070684_1003515122 99
1206 3300005614 Ga0068856_102384077 Ga0068856_1023840772 99
1207 3300006038 Ga0075365_10047376 Ga0075365_100473765 99
1208 3300006048 Ga0075363_100049887 Ga0075363_1000498875 99
1209 3300006048 Ga0075363_100135479 Ga0075363_1001354793 99
1210 3300006051 Ga0075364_10031775 Ga0075364_100317752 99
1211 3300006051 Ga0075364_10538181 Ga0075364_105381812 99
1212 3300006058 Ga0075432_10177871 Ga0075432_101778711 99
1213 3300006175 Ga0070712_100609953 Ga0070712_1006099532 99
1214 3300006177 Ga0075362_10467932 Ga0075362_104679322 99
1215 3300006353 Ga0075370_10001554 Ga0075370_1000155414 99
1216 3300006353 Ga0075370_10137124 Ga0075370_101371243 99
1217 3300006353 Ga0075370_10629295 Ga0075370_106292951 99
1218 3300009148 Ga0105243_10000567 Ga0105243_1000056711 99
1219 3300009176 Ga0105242_13141267 Ga0105242_131412671 99
1220 3300010375 Ga0105239_11492605 Ga0105239_114926052 99
1221 3300010375 Ga0105239_11671994 Ga0105239_116719942 99
1222 3300012475 Ga0157317_1002146 Ga0157317_10021462 99
1223 3300012492 Ga0157335_1016038 Ga0157335_10160382 99
1224 3300012498 Ga0157345_1006509 Ga0157345_10065092 99
1225 3300012502 Ga0157347_1030950 Ga0157347_10309502 99
1226 3300012503 Ga0157313_1026815 Ga0157313_10268151 99
1227 3300012505 Ga0157339_1010932 Ga0157339_10109322 99
1228 3300012515 Ga0157338_1040527 Ga0157338_10405271 99
1229 3300013104 Ga0157370_10255677 Ga0157370_102556773 99
1230 3300013105 Ga0157369_10403566 Ga0157369_104035663 99
1231 3300013308 Ga0157375_12003571 Ga0157375_120035712 99
1232 3300014969 Ga0157376_10755971 Ga0157376_107559712 99
1233 3300019179 Ga0184593_109258 Ga0184593_1092581 99
1234 3300020070 Ga0206356_10806586 Ga0206356_108065862 99
1235 3300020077 Ga0206351_10046376 Ga0206351_100463762 99
1236 3300020077 Ga0206351_10517565 Ga0206351_105175652 99
1237 3300020080 Ga0206350_11285491 Ga0206350_112854913 99
1238 3300020081 Ga0206354_10394252 Ga0206354_103942522 99
1239 3300020081 Ga0206354_11140572 Ga0206354_111405722 99
1240 3300022467 Ga0224712_10078968 Ga0224712_100789683 99
1241 3300025893 Ga0207682_10298166 Ga0207682_102981661 99
1242 3300025904 Ga0207647_10350024 Ga0207647_103500242 99
1243 3300025912 Ga0207707_10001257 Ga0207707_1000125713 99
1244 3300025912 Ga0207707_11268091 Ga0207707_112680911 99
1245 3300025917 Ga0207660_10004961 Ga0207660_100049617 99
1246 3300025921 Ga0207652_10005398 Ga0207652_100053984 99
1247 3300025929 Ga0207664_10283965 Ga0207664_102839652 99
1248 3300025935 Ga0207709_10000305 Ga0207709_1000030510 99
1249 3300025949 Ga0207667_11781227 Ga0207667_117812272 99
1250 3300026078 Ga0207702_12126807 Ga0207702_121268072 99
1251 3300026095 Ga0207676_11252210 Ga0207676_112522101 99
1252 3300030521 Ga0307511_10115089 Ga0307511_101150892 99
1253 3300030745 Ga0316182_1005526 Ga0316182_10055261 99
1254 3300030762 Ga0265775_104385 Ga0265775_1043851 99
1255 3300031247 Ga0265340_10020369 Ga0265340_100203693 99
1256 3300031251 Ga0265327_10000004 Ga0265327_10000004775 99
1257 3300031727 Ga0316576_10006920 Ga0316576_1000692014 99
1258 3300031727 Ga0316576_10071235 Ga0316576_100712352 99
1259 3300032002 Ga0307416_100725009 Ga0307416_1007250092 99
1260 3300032168 Ga0316593_10108458 Ga0316593_101084582 99
1261 3300033524 Ga0316592_1043955 Ga0316592_10439553 99
1262 3300033524 Ga0316592_1056390 Ga0316592_10563902 99
1263 3300035120 Ga0373957_0113916 Ga0373957_0113916_204_503 99
1264 3300035691 Ga0373931_0319446 Ga0373931_0319446_432_731 99
1265 3300036242 Ga0310104_10746 Ga0310104_10746_135_434 99
1266 3300036712 Ga0316584_0112590 Ga0316584_0112590_398_697 99
1267 3300041441 Ga0451787_232286 Ga0451787_232286_281_580 99
1268 3300041446 Ga0451794_52070 Ga0451794_52070_159_464 99
1269 3300041463 Ga0451804_0271602 Ga0451804_0271602_24_323 99
1270 3300041486 Ga0451807_1163869 Ga0451807_1163869_206_505 99
1271 3300041512 Ga0451853_1676925 Ga0451853_1676925_132_431 99
1272 3300044658 Ga0466972_0490422 Ga0466972_0490422_84_389 99
1273 3300044684 Ga0466966_0359716 Ga0466966_0359716_266_565 99
1274 3300044693 Ga0466961_0750258 Ga0466961_0750258_16_315 99
1275 3300044694 Ga0466963_0056459 Ga0466963_0056459_1532_1831 99
1276 3300044694 Ga0466963_0235627 Ga0466963_0235627_515_814 99
1277 3300044694 Ga0466963_0413597 Ga0466963_0413597_240_539 99
1278 3300044706 Ga0466964_0329825 Ga0466964_0329825_109_408 99
1279 3300044719 Ga0466971_0007279 Ga0466971_0007279_2311_2610 99
1280 3300044719 Ga0466971_0235788 Ga0466971_0235788_364_663 99
1281 3300044842 Ga0466957_0144176 Ga0466957_0144176_22_321 99
1282 3300044842 Ga0466957_0940242 Ga0466957_0940242_44_343 99
1283 3300045049 Ga0466959_0321966 Ga0466959_0321966_369_668 99
1284 3300045049 Ga0466959_0392129 Ga0466959_0392129_52_351 99
1285 3300045049 Ga0466959_0515044 Ga0466959_0515044_236_586 99
1286 3300045836 Ga0466958_0019647 Ga0466958_0019647_1243_1542 99
1287 3300045976 Ga0466967_0106322 Ga0466967_0106322_1552_1851 99
1288 3300045976 Ga0466967_0115719 Ga0466967_0115719_1663_1962 99
1289 3300045976 Ga0466967_0243718 Ga0466967_0243718_687_986 99
1290 3300045976 Ga0466967_0262620 Ga0466967_0262620_1030_1335 99
1291 3300045976 Ga0466967_0529878 Ga0466967_0529878_579_878 99
1292 3300045976 Ga0466967_0785193 Ga0466967_0785193_394_693 99
1293 3300046472 Ga0495580_0244465 Ga0495580_0244465_113_418 99
1294 3300046501 Ga0495607_0188365 Ga0495607_0188365_277_582 99
1295 3300046531 Ga0495665_0172337 Ga0495665_0172337_69_374 99
1296 3300046539 Ga0495621_0010604 Ga0495621_0010604_187_492 99
1297 3300046615 Ga0495656_0264666 Ga0495656_0264666_399_704 99
1298 3300046616 Ga0495668_0000509 Ga0495668_0000509_15306_15611 99
1299 3300046674 Ga0495588_0197050 Ga0495588_0197050_689_994 99
1300 3300047315 Ga0495581_0023771 Ga0495581_0023771_167_472 99
1301 3300047323 Ga0495683_0002868 Ga0495683_0002868_8500_8805 99
1302 3300047445 Ga0495677_0054019 Ga0495677_0054019_809_1114 99
1303 3300048911 Ga0496108_0026104 Ga0496108_0026104_1952_2257 99
1304 3300048914 Ga0496111_0662985 Ga0496111_0662985_235_540 99
1305 3300048920 Ga0496117_0184944 Ga0496117_0184944_782_1087 99
1306 3300048925 Ga0496122_0172045 Ga0496122_0172045_639_944 99
1307 3300048926 Ga0496123_0247408 Ga0496123_0247408_259_564 99
1308 3300048928 Ga0496125_0027838 Ga0496125_0027838_3459_3764 99
1309 3300049127 Ga0501306_010084 Ga0501306_010084_344_649 99
1310 3300049127 Ga0501306_056353 Ga0501306_056353_136_486 99
1311 3300049128 Ga0501308_004882 Ga0501308_004882_555_860 99
1312 3300049128 Ga0501308_011965 Ga0501308_011965_155_457 99
1313 3300049129 Ga0501309_013492 Ga0501309_013492_395_700 99
1314 3300049129 Ga0501309_025796 Ga0501309_025796_154_459 99
1315 3300049130 Ga0501310_042249 Ga0501310_042249_268_573 99
1316 3300049131 Ga0501341_02817 Ga0501341_02817_451_756 99
1317 3300049132 Ga0501343_006371 Ga0501343_006371_317_622 99
1318 3300049134 Ga0501345_02760 Ga0501345_02760_143_448 99
1319 3300049161 Ga0501305_035354 Ga0501305_035354_37_342 99
1320 3300049162 Ga0501307_006265 Ga0501307_006265_467_772 99
1321 3300049527 Ga0501311_007879 Ga0501311_007879_820_1122 99
1322 3300049528 Ga0501312_005556 Ga0501312_005556_412_717 99
1323 3300049528 Ga0501312_007002 Ga0501312_007002_509_814 99
1324 3300049529 Ga0501313_007646 Ga0501313_007646_609_914 99
1325 3300049531 Ga0501315_003476 Ga0501315_003476_810_1115 99
1326 3300049531 Ga0501315_019581 Ga0501315_019581_352_657 99
1327 3300049532 Ga0501316_002256 Ga0501316_002256_766_1071 99
1328 3300049532 Ga0501316_015895 Ga0501316_015895_360_665 99
1329 3300049533 Ga0501317_001119 Ga0501317_001119_1293_1598 99
1330 3300049533 Ga0501317_003573 Ga0501317_003573_788_1093 99
1331 3300049533 Ga0501317_005389 Ga0501317_005389_201_503 99
1332 3300049534 Ga0501318_002761 Ga0501318_002761_782_1087 99
1333 3300049534 Ga0501318_015033 Ga0501318_015033_160_510 99
1334 3300049534 Ga0501318_021760 Ga0501318_021760_297_599 99
1335 3300049535 Ga0501319_002366 Ga0501319_002366_190_495 99
1336 3300049536 Ga0501320_000888 Ga0501320_000888_367_672 99
1337 3300049536 Ga0501320_004374 Ga0501320_004374_246_551 99
1338 3300049537 Ga0501321_001097 Ga0501321_001097_1549_1848 99
1339 3300049537 Ga0501321_002837 Ga0501321_002837_412_717 99
1340 3300049538 Ga0501322_009917 Ga0501322_009917_78_383 99
1341 3300049539 Ga0501323_000539 Ga0501323_000539_2143_2448 99
1342 3300049539 Ga0501323_023339 Ga0501323_023339_343_645 99
1343 3300049540 Ga0501324_000010 Ga0501324_000010_1369_1674 99
1344 3300049541 Ga0501325_001682 Ga0501325_001682_659_964 99
1345 3300049541 Ga0501325_005394 Ga0501325_005394_441_746 99
1346 3300049542 Ga0501326_02636 Ga0501326_02636_436_741 99
1347 3300049545 Ga0501329_01750 Ga0501329_01750_173_478 99
1348 3300049546 Ga0501330_002423 Ga0501330_002423_360_665 99
1349 3300049546 Ga0501330_004730 Ga0501330_004730_256_561 99
1350 3300049547 Ga0501331_01798 Ga0501331_01798_336_641 99
1351 3300049550 Ga0501334_02717 Ga0501334_02717_451_756 99
1352 3300049551 Ga0501335_006923 Ga0501335_006923_266_571 99
1353 3300049552 Ga0501336_003497 Ga0501336_003497_142_447 99
1354 3300049555 Ga0501339_00289 Ga0501339_00289_451_756 99
1355 3300049556 Ga0501340_002383 Ga0501340_002383_528_833 99
1356 3300049581 Ga0501047_0146277 Ga0501047_0146277_615_914 99
1357 3300049585 Ga0501069_0076429 Ga0501069_0076429_53_358 99
1358 3300049823 Ga0501044_0186638 Ga0501044_0186638_1084_1389 99
1359 3300050489 nmdc:mga03683_384112_c1 nmdc:mga03683_384112_c1_318_623 99
1360 3300050490 nmdc:mga03n38_22870_c1 nmdc:mga03n38_22870_c1_1816_2139 99
1361 3300050490 nmdc:mga03n38_31633_c1 nmdc:mga03n38_31633_c1_213_518 99
1362 3300050491 nmdc:mga00v17_48225_c1 nmdc:mga00v17_48225_c1_479_784 99
1363 3300050496 nmdc:mga07m45_11732_c1 nmdc:mga07m45_11732_c1_1479_1784 99
1364 3300050496 nmdc:mga07m45_149073_c1 nmdc:mga07m45_149073_c1_1037_1342 99
1365 3300050496 nmdc:mga07m45_161812_c1 nmdc:mga07m45_161812_c1_690_995 99
1366 3300050496 nmdc:mga07m45_292859_c2 nmdc:mga07m45_292859_c2_169_492 99
1367 3300053083 Ga0495655_0251992 Ga0495655_0251992_76_375 99
1368 3300053156 Ga0500622_0327163 Ga0500622_0327163_314_619 99
1369 3300059478 Ga0587093_103445 Ga0587093_103445_68_376 99
1370 3300059493 Ga0587077_116916 Ga0587077_116916_83_385 99
1371 3300059504 Ga0587082_152991 Ga0587082_152991_99_398 99
1372 3300059654 Ga0587110_038457 Ga0587110_038457_28_333 99
1373 3300059660 Ga0587124_008953 Ga0587124_008953_274_576 99
1374 3300060346 Ga0587111_0018608 Ga0587111_0018608_659_964 99
1375 3300061719 Ga0466962_0004292 Ga0466962_0004292_1930_2229 99
1376 iso_pu_bacteria 3001119090 3001120668 99
1377 3300001915 JGI24741J21665_1041427 JGI24741J21665_10414271 100
1378 3300001977 JGI24746J21847_1009919 JGI24746J21847_10099193 100
1379 3300001978 JGI24747J21853_1045559 JGI24747J21853_10455591 100
1380 3300001989 JGI24739J22299_10012134 JGI24739J22299_100121345 100
1381 3300001989 JGI24739J22299_10248070 JGI24739J22299_102480701 100
1382 3300001990 JGI24737J22298_10236133 JGI24737J22298_102361332 100
1383 3300001991 JGI24743J22301_10000788 JGI24743J22301_100007884 100
1384 3300002067 JGI24735J21928_10082229 JGI24735J21928_100822292 100
1385 3300002067 JGI24735J21928_10099913 JGI24735J21928_100999133 100
1386 3300002070 JGI24750J21931_1003131 JGI24750J21931_10031314 100
1387 3300002075 JGI24738J21930_10001633 JGI24738J21930_100016336 100
1388 3300002076 JGI24749J21850_1002100 JGI24749J21850_10021005 100
1389 3300002077 JGI24744J21845_10001898 JGI24744J21845_100018984 100
1390 3300002155 JGI24033J26618_1005426 JGI24033J26618_10054261 100
1391 3300002244 JGI24742J22300_10004109 JGI24742J22300_100041094 100
1392 3300002459 JGI24751J29686_10112356 JGI24751J29686_101123562 100
1393 3300003162 Ga0006778J45830_1040387 Ga0006778J45830_10403872 100
1394 3300003568 Ga0006781J51513_1018983 Ga0006781J51513_10189832 100
1395 3300004799 Ga0058863_10019893 Ga0058863_100198932 100
1396 3300004799 Ga0058863_11928268 Ga0058863_119282681 100
1397 3300004800 Ga0058861_11782082 Ga0058861_117820821 100
1398 3300004800 Ga0058861_11966061 Ga0058861_119660612 100
1399 3300004800 Ga0058861_11996887 Ga0058861_119968872 100
1400 3300004800 Ga0058861_12014623 Ga0058861_120146232 100
1401 3300004801 Ga0058860_12054507 Ga0058860_120545071 100
1402 3300004801 Ga0058860_12196300 Ga0058860_121963002 100
1403 3300004803 Ga0058862_10207258 Ga0058862_102072581 100
1404 3300004803 Ga0058862_12600277 Ga0058862_126002771 100
1405 3300005327 Ga0070658_10042114 Ga0070658_100421145 100
1406 3300005327 Ga0070658_10048072 Ga0070658_100480726 100
1407 3300005327 Ga0070658_10514568 Ga0070658_105145682 100
1408 3300005328 Ga0070676_11060840 Ga0070676_110608402 100
1409 3300005329 Ga0070683_100080739 Ga0070683_1000807394 100
1410 3300005329 Ga0070683_100221234 Ga0070683_1002212342 100
1411 3300005329 Ga0070683_100327462 Ga0070683_1003274622 100
1412 3300005329 Ga0070683_100470219 Ga0070683_1004702191 100
1413 3300005329 Ga0070683_101167355 Ga0070683_1011673552 100
1414 3300005336 Ga0070680_100031712 Ga0070680_1000317125 100
1415 3300005337 Ga0070682_100024938 Ga0070682_1000249385 100
1416 3300005337 Ga0070682_100059983 Ga0070682_1000599833 100
1417 3300005338 Ga0068868_100096107 Ga0068868_1000961072 100
1418 3300005338 Ga0068868_100121089 Ga0068868_1001210892 100
1419 3300005339 Ga0070660_100300302 Ga0070660_1003003022 100
1420 3300005339 Ga0070660_100345603 Ga0070660_1003456032 100
1421 3300005339 Ga0070660_100753900 Ga0070660_1007539002 100
1422 3300005340 Ga0070689_100188908 Ga0070689_1001889082 100
1423 3300005341 Ga0070691_10012309 Ga0070691_100123092 100
1424 3300005341 Ga0070691_11018754 Ga0070691_110187542 100
1425 3300005343 Ga0070687_101381756 Ga0070687_1013817561 100
1426 3300005344 Ga0070661_101259793 Ga0070661_1012597932 100
1427 3300005345 Ga0070692_10049505 Ga0070692_100495054 100
1428 3300005347 Ga0070668_100003483 Ga0070668_1000034835 100
1429 3300005353 Ga0070669_100224629 Ga0070669_1002246292 100
1430 3300005354 Ga0070675_100065082 Ga0070675_1000650825 100
1431 3300005364 Ga0070673_100273384 Ga0070673_1002733842 100
1432 3300005366 Ga0070659_100143201 Ga0070659_1001432012 100
1433 3300005406 Ga0070703_10500187 Ga0070703_105001871 100
1434 3300005434 Ga0070709_10089315 Ga0070709_100893152 100
1435 3300005435 Ga0070714_100124276 Ga0070714_1001242765 100
1436 3300005435 Ga0070714_100255466 Ga0070714_1002554662 100
1437 3300005435 Ga0070714_101267338 Ga0070714_1012673382 100
1438 3300005436 Ga0070713_101290112 Ga0070713_1012901122 100
1439 3300005437 Ga0070710_10026928 Ga0070710_100269281 100
1440 3300005438 Ga0070701_10001181 Ga0070701_100011819 100
1441 3300005439 Ga0070711_100144299 Ga0070711_1001442993 100
1442 3300005441 Ga0070700_100003597 Ga0070700_1000035972 100
1443 3300005441 Ga0070700_100647746 Ga0070700_1006477462 100
1444 3300005445 Ga0070708_100964864 Ga0070708_1009648641 100
1445 3300005455 Ga0070663_100008045 Ga0070663_1000080457 100
1446 3300005455 Ga0070663_100042970 Ga0070663_1000429706 100
1447 3300005455 Ga0070663_100117821 Ga0070663_1001178212 100
1448 3300005456 Ga0070678_100149172 Ga0070678_1001491723 100
1449 3300005456 Ga0070678_100495008 Ga0070678_1004950082 100
1450 3300005456 Ga0070678_101925076 Ga0070678_1019250761 100
1451 3300005457 Ga0070662_100702675 Ga0070662_1007026752 100
1452 3300005458 Ga0070681_10034186 Ga0070681_100341865 100
1453 3300005458 Ga0070681_10248490 Ga0070681_102484903 100
1454 3300005459 Ga0068867_100007380 Ga0068867_1000073809 100
1455 3300005466 Ga0070685_10031017 Ga0070685_100310172 100
1456 3300005468 Ga0070707_100017376 Ga0070707_1000173765 100
1457 3300005471 Ga0070698_100006774 Ga0070698_10000677421 100
1458 3300005530 Ga0070679_100240378 Ga0070679_1002403783 100
1459 3300005530 Ga0070679_100571901 Ga0070679_1005719012 100
1460 3300005535 Ga0070684_100057591 Ga0070684_1000575912 100
1461 3300005535 Ga0070684_100371632 Ga0070684_1003716321 100
1462 3300005535 Ga0070684_100410385 Ga0070684_1004103851 100
1463 3300005535 Ga0070684_100429706 Ga0070684_1004297062 100
1464 3300005535 Ga0070684_101995532 Ga0070684_1019955322 100
1465 3300005543 Ga0070672_100002167 Ga0070672_10000216711 100
1466 3300005547 Ga0070693_100070840 Ga0070693_1000708403 100
1467 3300005548 Ga0070665_102071605 Ga0070665_1020716052 100
1468 3300005564 Ga0070664_100029753 Ga0070664_1000297533 100
1469 3300005577 Ga0068857_100573578 Ga0068857_1005735782 100
1470 3300005577 Ga0068857_101300636 Ga0068857_1013006362 100
1471 3300005578 Ga0068854_100056171 Ga0068854_1000561713 100
1472 3300005614 Ga0068856_101904600 Ga0068856_1019046002 100
1473 3300005616 Ga0068852_100002721 Ga0068852_1000027215 100
1474 3300005617 Ga0068859_101607613 Ga0068859_1016076131 100
1475 3300005617 Ga0068859_101719729 Ga0068859_1017197292 100
1476 3300005618 Ga0068864_100263876 Ga0068864_1002638762 100
1477 3300005718 Ga0068866_10029184 Ga0068866_100291843 100
1478 3300005719 Ga0068861_100802200 Ga0068861_1008022002 100
1479 3300005834 Ga0068851_10964187 Ga0068851_109641871 100
1480 3300005840 Ga0068870_10000658 Ga0068870_100006585 100
1481 3300005840 Ga0068870_11264107 Ga0068870_112641072 100
1482 3300005842 Ga0068858_101691493 Ga0068858_1016914931 100
1483 3300005843 Ga0068860_100616459 Ga0068860_1006164592 100
1484 3300006028 Ga0070717_10250533 Ga0070717_102505332 100
1485 3300006038 Ga0075365_10753603 Ga0075365_107536032 100
1486 3300006051 Ga0075364_10002085 Ga0075364_1000208521 100
1487 3300006163 Ga0070715_10017201 Ga0070715_100172012 100
1488 3300006175 Ga0070712_100411945 Ga0070712_1004119452 100
1489 3300006186 Ga0075369_10499827 Ga0075369_104998272 100
1490 3300006353 Ga0075370_10407942 Ga0075370_104079422 100
1491 3300006871 Ga0075434_101355643 Ga0075434_1013556432 100
1492 3300006881 Ga0068865_100006802 Ga0068865_1000068025 100
1493 3300006931 Ga0097620_101607525 Ga0097620_1016075252 100
1494 3300006931 Ga0097620_101719729 Ga0097620_1017197292 100
1495 3300009094 Ga0111539_10996282 Ga0111539_109962821 100
1496 3300009098 Ga0105245_10240303 Ga0105245_102403032 100
1497 3300009098 Ga0105245_10561875 Ga0105245_105618752 100
1498 3300009098 Ga0105245_10796479 Ga0105245_107964792 100
1499 3300009148 Ga0105243_10002648 Ga0105243_1000264816 100
1500 3300009174 Ga0105241_10810459 Ga0105241_108104592 100
1501 3300009176 Ga0105242_11180075 Ga0105242_111800752 100
1502 3300009177 Ga0105248_10129268 Ga0105248_101292684 100
1503 3300009545 Ga0105237_10229716 Ga0105237_102297162 100
1504 3300009551 Ga0105238_10117861 Ga0105238_101178614 100
1505 3300010375 Ga0105239_10020346 Ga0105239_100203469 100
1506 3300012490 Ga0157322_1013516 Ga0157322_10135162 100
1507 3300012506 Ga0157324_1018276 Ga0157324_10182762 100
1508 3300013102 Ga0157371_10216006 Ga0157371_102160062 100
1509 3300013104 Ga0157370_10149009 Ga0157370_101490094 100
1510 3300013105 Ga0157369_10141244 Ga0157369_101412445 100
1511 3300013296 Ga0157374_10131921 Ga0157374_101319212 100
1512 3300013296 Ga0157374_11632815 Ga0157374_116328152 100
1513 3300013297 Ga0157378_11824487 Ga0157378_118244872 100
1514 3300013306 Ga0163162_12258468 Ga0163162_122584682 100
1515 3300013307 Ga0157372_10977450 Ga0157372_109774502 100
1516 3300013307 Ga0157372_11442381 Ga0157372_114423812 100
1517 3300013308 Ga0157375_11008643 Ga0157375_110086432 100
1518 3300013308 Ga0157375_13751007 Ga0157375_137510071 100
1519 3300014326 Ga0157380_10037515 Ga0157380_100375152 100
1520 3300014745 Ga0157377_10218860 Ga0157377_102188602 100
1521 3300014968 Ga0157379_10899456 Ga0157379_108994562 100
1522 3300014969 Ga0157376_12092919 Ga0157376_120929192 100
1523 3300015265 Ga0182005_1186331 Ga0182005_11863312 100
1524 3300020069 Ga0197907_10781799 Ga0197907_107817992 100
1525 3300020069 Ga0197907_11047833 Ga0197907_110478333 100
1526 3300020069 Ga0197907_11348210 Ga0197907_113482102 100
1527 3300020070 Ga0206356_10482235 Ga0206356_104822352 100
1528 3300020070 Ga0206356_10562542 Ga0206356_105625422 100
1529 3300020070 Ga0206356_11355722 Ga0206356_113557222 100
1530 3300020075 Ga0206349_1265100 Ga0206349_12651001 100
1531 3300020075 Ga0206349_1464288 Ga0206349_14642882 100
1532 3300020076 Ga0206355_1205564 Ga0206355_12055642 100
1533 3300020076 Ga0206355_1654077 Ga0206355_16540772 100
1534 3300020077 Ga0206351_10219957 Ga0206351_102199572 100
1535 3300020077 Ga0206351_10414096 Ga0206351_104140964 100
1536 3300020078 Ga0206352_10333989 Ga0206352_103339892 100
1537 3300020078 Ga0206352_10725403 Ga0206352_107254032 100
1538 3300020078 Ga0206352_10725571 Ga0206352_107255713 100
1539 3300020080 Ga0206350_10382414 Ga0206350_103824142 100
1540 3300020080 Ga0206350_11655750 Ga0206350_116557502 100
1541 3300020081 Ga0206354_10378201 Ga0206354_103782012 100
1542 3300020081 Ga0206354_10670181 Ga0206354_106701813 100
1543 3300020082 Ga0206353_10865326 Ga0206353_108653263 100
1544 3300020610 Ga0154015_1350603 Ga0154015_13506032 100
1545 3300020610 Ga0154015_1581024 Ga0154015_15810242 100
1546 3300021388 Ga0213875_10000362 Ga0213875_100003625 100
1547 3300021388 Ga0213875_10130105 Ga0213875_101301052 100
1548 3300022467 Ga0224712_10004671 Ga0224712_100046712 100
1549 3300022467 Ga0224712_10048915 Ga0224712_100489152 100
1550 3300022467 Ga0224712_10252712 Ga0224712_102527122 100
1551 3300025898 Ga0207692_10005017 Ga0207692_100050173 100
1552 3300025899 Ga0207642_10154536 Ga0207642_101545362 100
1553 3300025901 Ga0207688_10042994 Ga0207688_100429941 100
1554 3300025904 Ga0207647_10107907 Ga0207647_101079072 100
1555 3300025904 Ga0207647_10177455 Ga0207647_101774552 100
1556 3300025904 Ga0207647_10401794 Ga0207647_104017942 100
1557 3300025906 Ga0207699_10021552 Ga0207699_100215523 100
1558 3300025906 Ga0207699_10370112 Ga0207699_103701122 100
1559 3300025908 Ga0207643_10001355 Ga0207643_1000135515 100
1560 3300025909 Ga0207705_10027743 Ga0207705_100277435 100
1561 3300025909 Ga0207705_10216281 Ga0207705_102162813 100
1562 3300025911 Ga0207654_10452981 Ga0207654_104529812 100
1563 3300025912 Ga0207707_10008073 Ga0207707_1000807314 100
1564 3300025912 Ga0207707_10942357 Ga0207707_109423572 100
1565 3300025914 Ga0207671_10130693 Ga0207671_101306932 100
1566 3300025916 Ga0207663_10110103 Ga0207663_101101032 100
1567 3300025916 Ga0207663_11677928 Ga0207663_116779281 100
1568 3300025917 Ga0207660_10053168 Ga0207660_100531683 100
1569 3300025917 Ga0207660_10848599 Ga0207660_108485992 100
1570 3300025919 Ga0207657_10290547 Ga0207657_102905472 100
1571 3300025919 Ga0207657_10369061 Ga0207657_103690612 100
1572 3300025919 Ga0207657_10547404 Ga0207657_105474042 100
1573 3300025920 Ga0207649_10155879 Ga0207649_101558791 100
1574 3300025920 Ga0207649_10478211 Ga0207649_104782112 100
1575 3300025921 Ga0207652_10061156 Ga0207652_100611565 100
1576 3300025921 Ga0207652_10837371 Ga0207652_108373712 100
1577 3300025922 Ga0207646_10082391 Ga0207646_100823914 100
1578 3300025924 Ga0207694_10405590 Ga0207694_104055902 100
1579 3300025926 Ga0207659_10118329 Ga0207659_101183293 100
1580 3300025927 Ga0207687_10953729 Ga0207687_109537292 100
1581 3300025928 Ga0207700_10010456 Ga0207700_100104565 100
1582 3300025929 Ga0207664_10040828 Ga0207664_100408283 100
1583 3300025932 Ga0207690_10129601 Ga0207690_101296013 100
1584 3300025932 Ga0207690_10689245 Ga0207690_106892452 100
1585 3300025933 Ga0207706_10509293 Ga0207706_105092931 100
1586 3300025934 Ga0207686_10849427 Ga0207686_108494272 100
1587 3300025935 Ga0207709_10005029 Ga0207709_100050295 100
1588 3300025936 Ga0207670_10022974 Ga0207670_100229745 100
1589 3300025937 Ga0207669_10006873 Ga0207669_100068735 100
1590 3300025937 Ga0207669_10756249 Ga0207669_107562492 100
1591 3300025938 Ga0207704_10439993 Ga0207704_104399932 100
1592 3300025940 Ga0207691_10003431 Ga0207691_1000343116 100
1593 3300025941 Ga0207711_10224387 Ga0207711_102243873 100
1594 3300025942 Ga0207689_10281438 Ga0207689_102814382 100
1595 3300025944 Ga0207661_10050176 Ga0207661_100501765 100
1596 3300025944 Ga0207661_10104106 Ga0207661_101041064 100
1597 3300025944 Ga0207661_10109515 Ga0207661_101095152 100
1598 3300025944 Ga0207661_10402489 Ga0207661_104024892 100
1599 3300025945 Ga0207679_10087528 Ga0207679_100875282 100
1600 3300025949 Ga0207667_10748206 Ga0207667_107482062 100
1601 3300025960 Ga0207651_10608015 Ga0207651_106080152 100
1602 3300025972 Ga0207668_10001244 Ga0207668_1000124418 100
1603 3300025981 Ga0207640_10336272 Ga0207640_103362721 100
1604 3300026023 Ga0207677_10510942 Ga0207677_105109422 100
1605 3300026023 Ga0207677_10724953 Ga0207677_107249532 100
1606 3300026041 Ga0207639_10140158 Ga0207639_101401582 100
1607 3300026041 Ga0207639_11572563 Ga0207639_115725632 100
1608 3300026067 Ga0207678_10000929 Ga0207678_1000092919 100
1609 3300026067 Ga0207678_10012875 Ga0207678_100128756 100
1610 3300026067 Ga0207678_10329902 Ga0207678_103299022 100
1611 3300026075 Ga0207708_10002425 Ga0207708_1000242524 100
1612 3300026078 Ga0207702_10914466 Ga0207702_109144662 100
1613 3300026089 Ga0207648_10007281 Ga0207648_1000728110 100
1614 3300026095 Ga0207676_10434265 Ga0207676_104342652 100
1615 3300026116 Ga0207674_10070710 Ga0207674_100707102 100
1616 3300026118 Ga0207675_100003879 Ga0207675_10000387916 100
1617 3300026118 Ga0207675_101338561 Ga0207675_1013385612 100
1618 3300026121 Ga0207683_10074864 Ga0207683_100748643 100
1619 3300026121 Ga0207683_10683415 Ga0207683_106834152 100
1620 3300026121 Ga0207683_10995746 Ga0207683_109957462 100
1621 3300026142 Ga0207698_10072778 Ga0207698_100727784 100
1622 3300028036 Ga0265355_1007915 Ga0265355_10079152 100
1623 3300028379 Ga0268266_12384300 Ga0268266_123843002 100
1624 3300028380 Ga0268265_10597590 Ga0268265_105975902 100
1625 3300030522 Ga0307512_10086539 Ga0307512_100865393 100
1626 3300030762 Ga0265775_102055 Ga0265775_1020552 100
1627 3300030763 Ga0265763_1000738 Ga0265763_10007382 100
1628 3300030763 Ga0265763_1040469 Ga0265763_10404691 100
1629 3300030863 Ga0265766_1011257 Ga0265766_10112572 100
1630 3300030882 Ga0265764_105138 Ga0265764_1051381 100
1631 3300030888 Ga0265769_101293 Ga0265769_1012932 100
1632 3300030889 Ga0265761_103183 Ga0265761_1031832 100
1633 3300031018 Ga0265773_1012166 Ga0265773_10121662 100
1634 3300031043 Ga0265779_103758 Ga0265779_1037582 100
1635 3300031239 Ga0265328_10034011 Ga0265328_100340114 100
1636 3300031507 Ga0307509_10118846 Ga0307509_101188464 100
1637 3300031592 Ga0310117_117420 Ga0310117_1174202 100
1638 3300031615 Ga0310107_126959 Ga0310107_1269592 100
1639 3300031731 Ga0307405_10006223 Ga0307405_100062237 100
1640 3300031731 Ga0307405_10696521 Ga0307405_106965212 100
1641 3300031731 Ga0307405_11059571 Ga0307405_110595711 100
1642 3300031731 Ga0307405_11115298 Ga0307405_111152982 100
1643 3300031731 Ga0307405_11403736 Ga0307405_114037362 100
1644 3300031731 Ga0307405_11949736 Ga0307405_119497362 100
1645 3300031824 Ga0307413_10169880 Ga0307413_101698802 100
1646 3300031852 Ga0307410_10565557 Ga0307410_105655572 100
1647 3300031852 Ga0307410_10604991 Ga0307410_106049911 100
1648 3300031852 Ga0307410_11914898 Ga0307410_119148982 100
1649 3300031903 Ga0307407_10238165 Ga0307407_102381652 100
1650 3300031903 Ga0307407_10259715 Ga0307407_102597152 100
1651 3300031911 Ga0307412_10064406 Ga0307412_100644063 100
1652 3300031995 Ga0307409_100902359 Ga0307409_1009023592 100
1653 3300032002 Ga0307416_100079924 Ga0307416_1000799244 100
1654 3300032005 Ga0307411_10529935 Ga0307411_105299352 100
1655 3300032005 Ga0307411_10592318 Ga0307411_105923182 100
1656 3300032126 Ga0307415_100099997 Ga0307415_1000999972 100
1657 3300033180 Ga0307510_10019413 Ga0307510_100194139 100
1658 3300035086 Ga0373934_0033978 Ga0373934_0033978_179_481 100
1659 3300035111 Ga0373923_0187403 Ga0373923_0187403_152_454 100
1660 3300035113 Ga0373936_0018900 Ga0373936_0018900_2080_2382 100
1661 3300035117 Ga0373953_0004941 Ga0373953_0004941_3631_3933 100
1662 3300035119 Ga0373956_0008114 Ga0373956_0008114_3804_4106 100
1663 3300035120 Ga0373957_0001036 Ga0373957_0001036_6545_6847 100
1664 3300035170 Ga0373943_0262098 Ga0373943_0262098_569_871 100
1665 3300035172 Ga0373955_0138702 Ga0373955_0138702_584_886 100
1666 3300035410 Ga0373924_0051899 Ga0373924_0051899_146_448 100
1667 3300035692 Ga0373935_0046761 Ga0373935_0046761_547_849 100
1668 3300035724 Ga0373933_0090081 Ga0373933_0090081_1346_1648 100
1669 3300036401 Ga0373937_0091252 Ga0373937_0091252_1975_2277 100
1670 3300036459 Ga0372808_054548 Ga0372808_054548_68_370 100
1671 3300037068 Ga0373925_0000004 Ga0373925_0000004_299145_299447 100
1672 3300037068 Ga0373925_0085471 Ga0373925_0085471_673_975 100
1673 3300037068 Ga0373925_1773439 Ga0373925_1773439_114_419 100
1674 3300037312 Ga0395899_0004964 Ga0395899_0004964_2141_2446 100
1675 3300037418 Ga0395900_0437593 Ga0395900_0437593_28_330 100
1676 3300037418 Ga0395900_1499602 Ga0395900_1499602_112_417 100
1677 3300037588 Ga0316581_0286595 Ga0316581_0286595_108_410 100
1678 3300037853 Ga0436364_0508850 Ga0436364_0508850_763_1065 100
1679 3300037853 Ga0436364_0804097 Ga0436364_0804097_2248_2550 100
1680 3300037853 Ga0436364_0856491 Ga0436364_0856491_59_361 100
1681 3300039437 Ga0436365_1560914 Ga0436365_1560914_825_1127 100
1682 3300039438 Ga0436360_0146467 Ga0436360_0146467_21_323 100
1683 3300039438 Ga0436360_1002306 Ga0436360_1002306_1041_1343 100
1684 3300039450 Ga0436363_0713271 Ga0436363_0713271_825_1127 100
1685 3300039453 Ga0436362_1034091 Ga0436362_1034091_651_953 100
1686 3300041413 Ga0439465_0224732 Ga0439465_0224732_275_580 100
1687 3300041445 Ga0451792_10772 Ga0451792_10772_176_481 100
1688 3300041446 Ga0451794_50020 Ga0451794_50020_281_586 100
1689 3300041451 Ga0451791_0540367 Ga0451791_0540367_222_527 100
1690 3300041453 Ga0451797_0934014 Ga0451797_0934014_165_470 100
1691 3300041453 Ga0451797_1097187 Ga0451797_1097187_17_322 100
1692 3300041456 Ga0451795_1286801 Ga0451795_1286801_140_445 100
1693 3300041459 Ga0451800_1157504 Ga0451800_1157504_26_331 100
1694 3300041486 Ga0451807_1581569 Ga0451807_1581569_53_358 100
1695 3300041492 Ga0451835_0504333 Ga0451835_0504333_145_450 100
1696 3300041494 Ga0451837_1596043 Ga0451837_1596043_227_532 100
1697 3300041503 Ga0451847_0897189 Ga0451847_0897189_159_464 100
1698 3300041509 Ga0451843_0673582 Ga0451843_0673582_151_456 100
1699 3300041511 Ga0451855_1437951 Ga0451855_1437951_226_528 100
1700 3300041512 Ga0451853_1178819 Ga0451853_1178819_421_726 100
1701 3300042004 Ga0439445_0160488 Ga0439445_0160488_52_357 100
1702 3300042005 Ga0439448_0053568 Ga0439448_0053568_521_826 100
1703 3300044658 Ga0466972_0000467 Ga0466972_0000467_9510_9821 100
1704 3300044683 Ga0466965_0025770 Ga0466965_0025770_1394_1705 100
1705 3300044683 Ga0466965_0186238 Ga0466965_0186238_460_765 100
1706 3300044683 Ga0466965_0336110 Ga0466965_0336110_321_626 100
1707 3300044684 Ga0466966_0138637 Ga0466966_0138637_184_495 100
1708 3300044693 Ga0466961_0204769 Ga0466961_0204769_492_803 100
1709 3300044694 Ga0466963_0043465 Ga0466963_0043465_1138_1440 100
1710 3300044694 Ga0466963_0049392 Ga0466963_0049392_267_572 100
1711 3300044694 Ga0466963_0153201 Ga0466963_0153201_720_1025 100
1712 3300044706 Ga0466964_0813611 Ga0466964_0813611_139_441 100
1713 3300044719 Ga0466971_0204032 Ga0466971_0204032_143_454 100
1714 3300044735 Ga0466968_0054416 Ga0466968_0054416_36_338 100
1715 3300044735 Ga0466968_0073253 Ga0466968_0073253_622_933 100
1716 3300044765 Ga0466970_0071776 Ga0466970_0071776_1266_1577 100
1717 3300044765 Ga0466970_0164699 Ga0466970_0164699_393_698 100
1718 3300044765 Ga0466970_0800002 Ga0466970_0800002_204_527 100
1719 3300044842 Ga0466957_0014920 Ga0466957_0014920_396_701 100
1720 3300044842 Ga0466957_0179224 Ga0466957_0179224_350_652 100
1721 3300044901 Ga0466960_0008863 Ga0466960_0008863_731_1036 100
1722 3300044901 Ga0466960_0159790 Ga0466960_0159790_535_840 100
1723 3300044901 Ga0466960_0638681 Ga0466960_0638681_53_364 100
1724 3300045049 Ga0466959_0290843 Ga0466959_0290843_240_551 100
1725 3300045049 Ga0466959_0977525 Ga0466959_0977525_231_536 100
1726 3300045836 Ga0466958_0035221 Ga0466958_0035221_122_427 100
1727 3300045836 Ga0466958_0037294 Ga0466958_0037294_1996_2298 100
1728 3300045976 Ga0466967_0374581 Ga0466967_0374581_83_385 100
1729 3300045976 Ga0466967_0486540 Ga0466967_0486540_560_865 100
1730 3300045976 Ga0466967_1373912 Ga0466967_1373912_231_542 100
1731 3300046454 Ga0495592_0072146 Ga0495592_0072146_559_861 100
1732 3300046454 Ga0495592_0367408 Ga0495592_0367408_501_806 100
1733 3300046459 Ga0495629_0298190 Ga0495629_0298190_526_831 100
1734 3300046459 Ga0495629_1109646 Ga0495629_1109646_54_365 100
1735 3300046462 Ga0495651_0891235 Ga0495651_0891235_89_391 100
1736 3300046463 Ga0495653_0247523 Ga0495653_0247523_510_812 100
1737 3300046473 Ga0495582_0057796 Ga0495582_0057796_156_464 100
1738 3300046476 Ga0495662_0008003 Ga0495662_0008003_4552_4854 100
1739 3300046477 Ga0495664_0214211 Ga0495664_0214211_693_995 100
1740 3300046511 Ga0495608_0009099 Ga0495608_0009099_6378_6680 100
1741 3300046514 Ga0495618_0019818 Ga0495618_0019818_152_454 100
1742 3300046516 Ga0495628_0060116 Ga0495628_0060116_1738_2040 100
1743 3300046517 Ga0495630_0123303 Ga0495630_0123303_1163_1465 100
1744 3300046529 Ga0495652_0028241 Ga0495652_0028241_993_1295 100
1745 3300046531 Ga0495665_0239947 Ga0495665_0239947_166_468 100
1746 3300046533 Ga0495640_0140168 Ga0495640_0140168_179_481 100
1747 3300046535 Ga0495586_0007029 Ga0495586_0007029_502_804 100
1748 3300046536 Ga0495587_0025211 Ga0495587_0025211_235_537 100
1749 3300046543 Ga0495645_0161902 Ga0495645_0161902_1203_1505 100
1750 3300046559 Ga0495667_0206080 Ga0495667_0206080_257_559 100
1751 3300046642 Ga0495634_0132120 Ga0495634_0132120_253_555 100
1752 3300046642 Ga0495634_0371297 Ga0495634_0371297_187_492 100
1753 3300046663 Ga0495635_0062183 Ga0495635_0062183_1226_1528 100
1754 3300046663 Ga0495635_0300264 Ga0495635_0300264_49_354 100
1755 3300046675 Ga0495657_0038575 Ga0495657_0038575_1245_1547 100
1756 3300046678 Ga0495599_0138887 Ga0495599_0138887_1164_1466 100
1757 3300046679 Ga0495623_0394141 Ga0495623_0394141_52_354 100
1758 3300046680 Ga0495646_0025121 Ga0495646_0025121_349_651 100
1759 3300046681 Ga0495647_0257719 Ga0495647_0257719_150_452 100
1760 3300046683 Ga0495658_0144979 Ga0495658_0144979_983_1291 100
1761 3300046683 Ga0495658_0152966 Ga0495658_0152966_65_373 100
1762 3300046683 Ga0495658_0373522 Ga0495658_0373522_225_530 100
1763 3300046683 Ga0495658_0401524 Ga0495658_0401524_449_760 100
1764 3300046689 Ga0495613_0155166 Ga0495613_0155166_965_1267 100
1765 3300046690 Ga0495624_0310924 Ga0495624_0310924_511_813 100
1766 3300046692 Ga0495671_0281147 Ga0495671_0281147_31_336 100
1767 3300046809 Ga0495600_0039666 Ga0495600_0039666_2092_2394 100
1768 3300047317 Ga0495604_0114479 Ga0495604_0114479_685_987 100
1769 3300047319 Ga0495674_0032123 Ga0495674_0032123_680_982 100
1770 3300047321 Ga0495676_0071974 Ga0495676_0071974_219_527 100
1771 3300047322 Ga0495680_0027683 Ga0495680_0027683_502_804 100
1772 3300047444 Ga0495675_0331673 Ga0495675_0331673_239_541 100
1773 3300047471 Ga0495684_0004161 Ga0495684_0004161_10130_10432 100
1774 3300048088 Ga0495602_0013833 Ga0495602_0013833_199_501 100
1775 3300048089 Ga0495614_0208677 Ga0495614_0208677_216_524 100
1776 3300048903 Ga0496100_1434383 Ga0496100_1434383_178_483 100
1777 3300048904 Ga0496101_0085853 Ga0496101_0085853_1625_1930 100
1778 3300048905 Ga0496102_0413504 Ga0496102_0413504_536_841 100
1779 3300048906 Ga0496103_0434505 Ga0496103_0434505_168_473 100
1780 3300048907 Ga0496104_0323715 Ga0496104_0323715_467_769 100
1781 3300048908 Ga0496105_0871055 Ga0496105_0871055_333_638 100
1782 3300048910 Ga0496107_1218803 Ga0496107_1218803_147_452 100
1783 3300048911 Ga0496108_0028389 Ga0496108_0028389_3568_3873 100
1784 3300048912 Ga0496109_0025845 Ga0496109_0025845_3241_3546 100
1785 3300048913 Ga0496110_0193348 Ga0496110_0193348_730_1035 100
1786 3300048914 Ga0496111_0659842 Ga0496111_0659842_440_745 100
1787 3300048917 Ga0496114_0296028 Ga0496114_0296028_1003_1308 100
1788 3300048918 Ga0496115_1285589 Ga0496115_1285589_179_481 100
1789 3300048922 Ga0496119_0032653 Ga0496119_0032653_2055_2357 100
1790 3300048923 Ga0496120_0149998 Ga0496120_0149998_330_632 100
1791 3300048927 Ga0496124_0187875 Ga0496124_0187875_693_998 100
1792 3300049127 Ga0501306_003491 Ga0501306_003491_920_1225 100
1793 3300049127 Ga0501306_017435 Ga0501306_017435_644_949 100
1794 3300049130 Ga0501310_026534 Ga0501310_026534_362_667 100
1795 3300049160 Ga0501304_005327 Ga0501304_005327_644_994 100
1796 3300049459 Ga0495678_221531 Ga0495678_221531_119_424 100
1797 3300049527 Ga0501311_099077 Ga0501311_099077_38_343 100
1798 3300049531 Ga0501315_022828 Ga0501315_022828_500_805 100
1799 3300049532 Ga0501316_007989 Ga0501316_007989_407_712 100
1800 3300049532 Ga0501316_009885 Ga0501316_009885_132_455 100
1801 3300049533 Ga0501317_016320 Ga0501317_016320_366_671 100
1802 3300049533 Ga0501317_020993 Ga0501317_020993_407_763 100
1803 3300049534 Ga0501318_013014 Ga0501318_013014_441_746 100
1804 3300049534 Ga0501318_014589 Ga0501318_014589_493_798 100
1805 3300049535 Ga0501319_006520 Ga0501319_006520_436_741 100
1806 3300049536 Ga0501320_008060 Ga0501320_008060_662_967 100
1807 3300049536 Ga0501320_035149 Ga0501320_035149_313_618 100
1808 3300049537 Ga0501321_022906 Ga0501321_022906_436_741 100
1809 3300049538 Ga0501322_016830 Ga0501322_016830_169_474 100
1810 3300049539 Ga0501323_027726 Ga0501323_027726_103_408 100
1811 3300049541 Ga0501325_011325 Ga0501325_011325_103_408 100
1812 3300049568 Ga0501031_0080470 Ga0501031_0080470_778_1083 100
1813 3300049570 Ga0501033_0095500 Ga0501033_0095500_666_971 100
1814 3300049571 Ga0501034_0016509 Ga0501034_0016509_1192_1494 100
1815 3300049571 Ga0501034_0855009 Ga0501034_0855009_141_443 100
1816 3300049571 Ga0501034_0882546 Ga0501034_0882546_15_320 100
1817 3300049571 Ga0501034_0966066 Ga0501034_0966066_416_721 100
1818 3300049572 Ga0501036_0037401 Ga0501036_0037401_2158_2460 100
1819 3300049572 Ga0501036_0853537 Ga0501036_0853537_375_680 100
1820 3300049573 Ga0501037_0063557 Ga0501037_0063557_2039_2341 100
1821 3300049573 Ga0501037_0485159 Ga0501037_0485159_221_526 100
1822 3300049574 Ga0501038_0021480 Ga0501038_0021480_3853_4155 100
1823 3300049574 Ga0501038_0186884 Ga0501038_0186884_247_552 100
1824 3300049575 Ga0501039_0777360 Ga0501039_0777360_163_468 100
1825 3300049576 Ga0501040_0613000 Ga0501040_0613000_292_597 100
1826 3300049577 Ga0501041_0022527 Ga0501041_0022527_1424_1729 100
1827 3300049577 Ga0501041_0550187 Ga0501041_0550187_259_561 100
1828 3300049578 Ga0501042_0018748 Ga0501042_0018748_762_1064 100
1829 3300049579 Ga0501043_0024981 Ga0501043_0024981_2605_2907 100
1830 3300049581 Ga0501047_0042683 Ga0501047_0042683_1794_2096 100
1831 3300049582 Ga0501048_0052303 Ga0501048_0052303_1817_2119 100
1832 3300049583 Ga0501067_0077464 Ga0501067_0077464_681_986 100
1833 3300049584 Ga0501068_0430597 Ga0501068_0430597_369_674 100
1834 3300049586 Ga0501070_0004983 Ga0501070_0004983_1539_1844 100
1835 3300049587 Ga0501071_0075875 Ga0501071_0075875_499_804 100
1836 3300049588 Ga0501072_0105438 Ga0501072_0105438_392_697 100
1837 3300049589 Ga0501073_0014388 Ga0501073_0014388_278_580 100
1838 3300049590 Ga0501074_0002804 Ga0501074_0002804_10060_10362 100
1839 3300049590 Ga0501074_0045693 Ga0501074_0045693_2673_2978 100
1840 3300049591 Ga0501075_0134635 Ga0501075_0134635_624_929 100
1841 3300049592 Ga0501076_0209511 Ga0501076_0209511_887_1192 100
1842 3300049593 Ga0501077_0063375 Ga0501077_0063375_1569_1874 100
1843 3300049741 Ga0501079_0099906 Ga0501079_0099906_1434_1739 100
1844 3300049742 Ga0501080_0329022 Ga0501080_0329022_766_1068 100
1845 3300049822 Ga0501035_0110254 Ga0501035_0110254_1664_1969 100
1846 3300049823 Ga0501044_0378589 Ga0501044_0378589_881_1183 100
1847 3300049823 Ga0501044_1016167 Ga0501044_1016167_11_313 100
1848 3300049824 Ga0501045_0198872 Ga0501045_0198872_492_797 100
1849 3300050491 nmdc:mga00v17_958_c1 nmdc:mga00v17_958_c1_4943_5248 100
1850 3300050492 nmdc:mga0yw44_558839_c1 nmdc:mga0yw44_558839_c1_274_579 100
1851 3300050496 nmdc:mga07m45_349572_c1 nmdc:mga07m45_349572_c1_365_670 100
1852 3300053077 Ga0495601_0008187 Ga0495601_0008187_4905_5210 100
1853 3300053077 Ga0495601_0287144 Ga0495601_0287144_501_803 100
1854 3300053078 Ga0495612_0034730 Ga0495612_0034730_1070_1372 100
1855 3300053078 Ga0495612_0122477 Ga0495612_0122477_663_968 100
1856 3300053080 Ga0500635_0320329 Ga0500635_0320329_152_475 100
1857 3300053084 Ga0495595_0016795 Ga0495595_0016795_1122_1424 100
1858 3300053085 Ga0495619_0079703 Ga0495619_0079703_1009_1311 100
1859 3300053085 Ga0495619_0188604 Ga0495619_0188604_690_995 100
1860 3300053096 Ga0500641_0000363 Ga0500641_0000363_9148_9453 100
1861 3300053096 Ga0500641_0285173 Ga0500641_0285173_163_465 100
1862 3300054114 Ga0501084_0042157 Ga0501084_0042157_1388_1693 100
1863 3300059477 Ga0587084_005492 Ga0587084_005492_738_1043 100
1864 3300059477 Ga0587084_108187 Ga0587084_108187_163_468 100
1865 3300059478 Ga0587093_058207 Ga0587093_058207_65_370 100
1866 3300059491 Ga0587070_041952 Ga0587070_041952_302_607 100
1867 3300059492 Ga0587073_0021819 Ga0587073_0021819_523_828 100
1868 3300059503 Ga0587080_127434 Ga0587080_127434_103_408 100
1869 3300059504 Ga0587082_017627 Ga0587082_017627_191_496 100
1870 3300059504 Ga0587082_032324 Ga0587082_032324_267_569 100
1871 3300059505 Ga0587083_0003149 Ga0587083_0003149_1171_1476 100
1872 3300059507 Ga0587086_014740 Ga0587086_014740_467_772 100
1873 3300059508 Ga0587088_055761 Ga0587088_055761_90_401 100
1874 3300059508 Ga0587088_117981 Ga0587088_117981_282_584 100
1875 3300059508 Ga0587088_150846 Ga0587088_150846_115_420 100
1876 3300059511 Ga0587091_009412 Ga0587091_009412_654_959 100
1877 3300059512 Ga0587092_036111 Ga0587092_036111_467_772 100
1878 3300059514 Ga0587095_036842 Ga0587095_036842_79_384 100
1879 3300059514 Ga0587095_038656 Ga0587095_038656_106_411 100
1880 3300059605 Ga0587106_000824 Ga0587106_000824_27_332 100
1881 3300059609 Ga0587131_004089 Ga0587131_004089_231_536 100
1882 3300059622 Ga0587099_048083 Ga0587099_048083_79_384 100
1883 3300059623 Ga0587101_004376 Ga0587101_004376_249_554 100
1884 3300059626 Ga0587115_023589 Ga0587115_023589_437_742 100
1885 3300059627 Ga0587117_041216 Ga0587117_041216_138_443 100
1886 3300059627 Ga0587117_075804 Ga0587117_075804_227_532 100
1887 3300059628 Ga0587122_005204 Ga0587122_005204_360_665 100
1888 3300059630 Ga0587128_045795 Ga0587128_045795_275_580 100
1889 3300059630 Ga0587128_090712 Ga0587128_090712_23_328 100
1890 3300059639 Ga0587062_002899 Ga0587062_002899_912_1217 100
1891 3300059639 Ga0587062_016073 Ga0587062_016073_271_582 100
1892 3300059641 Ga0587068_001416 Ga0587068_001416_506_811 100
1893 3300059642 Ga0587069_005095 Ga0587069_005095_391_696 100
1894 3300059643 Ga0587072_032981 Ga0587072_032981_229_534 100
1895 3300059644 Ga0587075_045457 Ga0587075_045457_414_725 100
1896 3300059644 Ga0587075_046182 Ga0587075_046182_313_621 100
1897 3300059644 Ga0587075_065116 Ga0587075_065116_52_357 100
1898 3300059645 Ga0587076_145870 Ga0587076_145870_110_415 100
1899 3300059645 Ga0587076_172177 Ga0587076_172177_171_476 100
1900 3300059652 Ga0587107_007847 Ga0587107_007847_631_942 100
1901 3300059658 Ga0587119_016371 Ga0587119_016371_164_466 100
1902 3300059658 Ga0587119_035124 Ga0587119_035124_273_578 100
1903 3300060344 Ga0587071_100577 Ga0587071_100577_331_642 100
1904 3300060353 Ga0501082_0086191 Ga0501082_0086191_55_360 100
1905 3300061719 Ga0466962_0074020 Ga0466962_0074020_913_1218 100
1906 3300061719 Ga0466962_0421950 Ga0466962_0421950_262_573 100
1907 3300061734 Ga0530510_0090696 Ga0530510_0090696_931_1236 100
1908 iso_pu_bacteria 8033684223 8033689349 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

25

112

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9407 7 93
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.9247 7 95
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9201 6 93
2qa4-assembly1.cif.gz_S a more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit 0.9178 9 90
6ddg-assembly1.cif.gz_F structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.916 8 91
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9224 7 95 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9034 9 93 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9032 7 95 3.30.70.330
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9021 1 88 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8951 9 93 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A537VZX2-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL2; Large ribosomal subunit protein uL23] 0.9657 5 92 GO:0002181
GO:0003735
GO:0015934
GO:0016740
GO:0019843
AF-A0A0N1C050-F1-model_v4 Large ribosomal subunit protein uL23 0.9628 7 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A541BXJ8-F1-model_v4 Large ribosomal subunit protein uL23 0.9615 7 97 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A5USI7-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9609 5 97 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A419EVM5-F1-model_v4 Large ribosomal subunit protein uL23 0.9582 5 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
90.23 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map