F496034
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1908 | 672 | 1869 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300049533|Ga0501317_020993|Ga0501317_020993_407_763 |
| Length | 118 |
| Sequence | MDNSTDQQTAEKPVGRLARVVDPRDVIIKPVVSEKSYGLIDENNKYTFLVKKTANKTEVKIAVEKIFGVKVTSVNTINRQGKRKRTRTGYGKRADTKRAIVTLSAESKPIEIFGGPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 3 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 4 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 5 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 6 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 7 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 8 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 9 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 10 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 11 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 12 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 13 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 14 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 15 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 16 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 17 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 18 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 19 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 20 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 21 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 22 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 23 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 24 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 25 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 26 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 27 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 28 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 29 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 30 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 31 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 32 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 33 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 34 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 35 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 36 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 37 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 38 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 39 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 40 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 41 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 42 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 47 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 48 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 49 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 50 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 51 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 52 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 53 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 54 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 55 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 56 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 57 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 58 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 59 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 61 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 62 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 78 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 109 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 126 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 128 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 129 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 130 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 132 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 133 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 134 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 135 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 136 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 137 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 143 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 144 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 146 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 147 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 148 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 149 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 152 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 153 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 154 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 156 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 157 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 158 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 159 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 162 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 163 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 177 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 178 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 179 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 180 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 181 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 182 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 183 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 184 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 185 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 186 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 187 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 188 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 189 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 201 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 205 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 208 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 211 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 212 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 213 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 214 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 215 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 216 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 218 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 219 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 220 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 221 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 289 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 293 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 294 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 295 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 296 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 297 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 298 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 308 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 309 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 310 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 311 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 312 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 313 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 314 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 315 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 316 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 317 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 318 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 319 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 320 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 321 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 322 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 323 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 324 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 325 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 326 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 327 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 328 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 329 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 330 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 331 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 332 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 333 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 334 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 335 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 336 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 337 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 339 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 342 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 343 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 344 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 345 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 346 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 347 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 348 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 349 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 350 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 351 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 352 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 353 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 354 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 355 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 356 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 357 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 358 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 359 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 360 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 361 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 362 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 363 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 364 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 365 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 366 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 368 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 369 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 370 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 371 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 372 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 373 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 374 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 375 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 376 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 377 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 378 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 379 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 380 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 382 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 383 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 384 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 385 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 386 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 387 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 388 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 389 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 390 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 391 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 392 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 393 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 394 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 395 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 396 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 397 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 398 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 399 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 400 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 401 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 402 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 403 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 404 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 405 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 406 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 407 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 408 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 409 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 410 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 411 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 412 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 413 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 414 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 415 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 416 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 417 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 418 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 419 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 420 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 421 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 422 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 423 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 424 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 425 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 426 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 427 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 428 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 429 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 430 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 431 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 432 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 433 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 434 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 435 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 436 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 437 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 438 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 439 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 440 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 441 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 442 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 443 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 510 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 511 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 512 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 513 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 514 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 515 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 516 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 517 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 518 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 519 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 520 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 521 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 522 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 523 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 524 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 525 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 526 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 527 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 528 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 529 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 530 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 531 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 532 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 533 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 534 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 535 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 575 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 576 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 577 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 585 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 586 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 590 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 594 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 595 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 600 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 601 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 602 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 603 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 604 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 605 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 609 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 612 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 616 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 617 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 618 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 619 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 620 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 621 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 622 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 623 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 625 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 626 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 627 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 628 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 629 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 630 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 631 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 633 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 634 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 635 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 636 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 637 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 638 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 642 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 643 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 644 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 645 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 646 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 647 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 648 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 649 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 650 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 651 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 652 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 653 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 654 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 655 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 656 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 657 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 658 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 659 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 667 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 668 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 669 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 671 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 672 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.76 |
| Metatranscriptomes | 15.2 |
| Isolates | 2.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.05 |
| Bulb | 0 |
| Endosphere | 3.3 |
| Nodule | 0.05 |
| Rhizoplane | 6.76 |
| Rhizosphere | 83.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1041427 | 3300001915 | Bacteria | 679 |
| 2 | JGI24752J21851_1048383 | 3300001976 | Bacteria | 575 |
| 3 | JGI24746J21847_1002880 | 3300001977 | Bacteria | 2705 |
| 4 | JGI24746J21847_1009919 | 3300001977 | Bacteria | 1414 |
| 5 | JGI24746J21847_1041178 | 3300001977 | Bacteria | 643 |
| 6 | JGI24747J21853_1045559 | 3300001978 | Bacteria | 527 |
| 7 | JGI24740J21852_10117882 | 3300001979 | Bacteria | 666 |
| 8 | JGI24739J22299_10012134 | 3300001989 | Bacteria | 3164 |
| 9 | JGI24739J22299_10163606 | 3300001989 | Bacteria | 656 |
| 10 | JGI24739J22299_10248070 | 3300001989 | Bacteria | 521 |
| 11 | JGI24737J22298_10236133 | 3300001990 | Bacteria | 540 |
| 12 | JGI24743J22301_10000788 | 3300001991 | Bacteria | 3983 |
| 13 | JGI24743J22301_10003561 | 3300001991 | Bacteria | 2475 |
| 14 | JGI24743J22301_10137210 | 3300001991 | Bacteria | 543 |
| 15 | JGI24735J21928_10007788 | 3300002067 | Bacteria | 3482 |
| 16 | JGI24735J21928_10082229 | 3300002067 | Bacteria | 923 |
| 17 | JGI24735J21928_10099913 | 3300002067 | Bacteria | 833 |
| 18 | JGI24750J21931_1003131 | 3300002070 | Bacteria | 1986 |
| 19 | JGI24745J21846_1000611 | 3300002073 | Bacteria | 3214 |
| 20 | JGI24738J21930_10001633 | 3300002075 | Bacteria | 6156 |
| 21 | JGI24749J21850_1002100 | 3300002076 | Bacteria | 2810 |
| 22 | JGI24744J21845_10001898 | 3300002077 | Bacteria | 4211 |
| 23 | JGI24744J21845_10003031 | 3300002077 | Bacteria | 3445 |
| 24 | JGI24033J26618_1005426 | 3300002155 | Bacteria | 1404 |
| 25 | JGI24034J26672_10089570 | 3300002239 | Bacteria | 570 |
| 26 | JGI24742J22300_10004109 | 3300002244 | Bacteria | 2371 |
| 27 | JGI24742J22300_10028879 | 3300002244 | Bacteria | 964 |
| 28 | JGI24751J29686_10112356 | 3300002459 | Bacteria | 571 |
| 29 | Ga0006778J45830_1040387 | 3300003162 | Bacteria | 609 |
| 30 | Ga0006778J45830_1066604 | 3300003162 | Bacteria | 514 |
| 31 | Ga0006781J51513_1018983 | 3300003568 | Bacteria | 528 |
| 32 | JGI25404J52841_10006168 | 3300003659 | Bacteria | 2498 |
| 33 | Ga0058858_1006047 | 3300004785 | Bacteria | 1244 |
| 34 | Ga0058858_1439419 | 3300004785 | Bacteria | 602 |
| 35 | Ga0058859_10151791 | 3300004798 | Bacteria | 1338 |
| 36 | Ga0058859_11439842 | 3300004798 | Bacteria | 666 |
| 37 | Ga0058859_11825311 | 3300004798 | Bacteria | 860 |
| 38 | Ga0058863_10019893 | 3300004799 | Bacteria | 1860 |
| 39 | Ga0058863_11747712 | 3300004799 | Bacteria | 686 |
| 40 | Ga0058863_11874661 | 3300004799 | Bacteria | 1398 |
| 41 | Ga0058863_11921357 | 3300004799 | Bacteria | 2098 |
| 42 | Ga0058863_11928268 | 3300004799 | Bacteria | 687 |
| 43 | Ga0058861_11782082 | 3300004800 | Bacteria | 754 |
| 44 | Ga0058861_11824709 | 3300004800 | Bacteria | 587 |
| 45 | Ga0058861_11966061 | 3300004800 | Bacteria | 823 |
| 46 | Ga0058861_11989029 | 3300004800 | Bacteria | 673 |
| 47 | Ga0058861_11996887 | 3300004800 | Bacteria | 1161 |
| 48 | Ga0058861_12014623 | 3300004800 | Bacteria | 980 |
| 49 | Ga0058860_10048539 | 3300004801 | Bacteria | 753 |
| 50 | Ga0058860_10054779 | 3300004801 | Bacteria | 1578 |
| 51 | Ga0058860_10101490 | 3300004801 | Bacteria | 1938 |
| 52 | Ga0058860_11752377 | 3300004801 | Bacteria | 537 |
| 53 | Ga0058860_12054507 | 3300004801 | Bacteria | 784 |
| 54 | Ga0058860_12196300 | 3300004801 | Bacteria | 582 |
| 55 | Ga0058862_10207258 | 3300004803 | Bacteria | 601 |
| 56 | Ga0058862_11833495 | 3300004803 | Bacteria | 533 |
| 57 | Ga0058862_12339345 | 3300004803 | Bacteria | 508 |
| 58 | Ga0058862_12600277 | 3300004803 | Bacteria | 509 |
| 59 | Ga0058862_12635954 | 3300004803 | Bacteria | 959 |
| 60 | Ga0058862_12845447 | 3300004803 | Bacteria | 513 |
| 61 | Ga0065714_10151442 | 3300005288 | Bacteria | 1104 |
| 62 | Ga0070658_10001764 | 3300005327 | Bacteria | 18213 |
| 63 | Ga0070658_10022118 | 3300005327 | Bacteria | 5100 |
| 64 | Ga0070658_10042114 | 3300005327 | Bacteria | 3686 |
| 65 | Ga0070658_10048072 | 3300005327 | Bacteria | 3453 |
| 66 | Ga0070658_10220315 | 3300005327 | Bacteria | 1604 |
| 67 | Ga0070658_10514568 | 3300005327 | Bacteria | 1034 |
| 68 | Ga0070658_10670380 | 3300005327 | Bacteria | 900 |
| 69 | Ga0070658_10938244 | 3300005327 | Bacteria | 752 |
| 70 | Ga0070676_11060840 | 3300005328 | Bacteria | 611 |
| 71 | Ga0070683_100045429 | 3300005329 | Bacteria | 4053 |
| 72 | Ga0070683_100080739 | 3300005329 | Bacteria | 3044 |
| 73 | Ga0070683_100221234 | 3300005329 | Bacteria | 1799 |
| 74 | Ga0070683_100327462 | 3300005329 | Bacteria | 1458 |
| 75 | Ga0070683_100470219 | 3300005329 | Bacteria | 1200 |
| 76 | Ga0070683_100659439 | 3300005329 | Bacteria | 1002 |
| 77 | Ga0070683_100688812 | 3300005329 | Bacteria | 979 |
| 78 | Ga0070683_101167355 | 3300005329 | Bacteria | 740 |
| 79 | Ga0070690_100028148 | 3300005330 | Bacteria | 3479 |
| 80 | Ga0070690_100810243 | 3300005330 | Bacteria | 727 |
| 81 | Ga0070670_100546979 | 3300005331 | Bacteria | 1033 |
| 82 | Ga0070670_101067838 | 3300005331 | Bacteria | 736 |
| 83 | Ga0070677_10026178 | 3300005333 | Bacteria | 2184 |
| 84 | Ga0070677_10688200 | 3300005333 | Bacteria | 575 |
| 85 | Ga0068869_100046622 | 3300005334 | Bacteria | 3125 |
| 86 | Ga0068869_100287171 | 3300005334 | Bacteria | 1324 |
| 87 | Ga0068869_100864641 | 3300005334 | Bacteria | 781 |
| 88 | Ga0068869_101189683 | 3300005334 | Bacteria | 670 |
| 89 | Ga0070666_10108142 | 3300005335 | Bacteria | 1922 |
| 90 | Ga0070666_10360117 | 3300005335 | Bacteria | 1042 |
| 91 | Ga0070666_11241050 | 3300005335 | Bacteria | 555 |
| 92 | Ga0070680_100003083 | 3300005336 | Bacteria | 12368 |
| 93 | Ga0070680_100004398 | 3300005336 | Bacteria | 10606 |
| 94 | Ga0070680_100031712 | 3300005336 | Bacteria | 4249 |
| 95 | Ga0070680_100157136 | 3300005336 | Bacteria | 1910 |
| 96 | Ga0070680_100407949 | 3300005336 | Bacteria | 1159 |
| 97 | Ga0070682_100022692 | 3300005337 | Bacteria | 3719 |
| 98 | Ga0070682_100024938 | 3300005337 | Bacteria | 3565 |
| 99 | Ga0070682_100027729 | 3300005337 | Bacteria | 3400 |
| 100 | Ga0070682_100059983 | 3300005337 | Bacteria | 2405 |
| 101 | Ga0070682_100097993 | 3300005337 | Bacteria | 1930 |
| 102 | Ga0070682_100580110 | 3300005337 | Bacteria | 882 |
| 103 | Ga0070682_100948077 | 3300005337 | Bacteria | 711 |
| 104 | Ga0068868_100096107 | 3300005338 | Bacteria | 2392 |
| 105 | Ga0068868_100121089 | 3300005338 | Bacteria | 2134 |
| 106 | Ga0068868_100195353 | 3300005338 | Bacteria | 1684 |
| 107 | Ga0068868_100282852 | 3300005338 | Bacteria | 1404 |
| 108 | Ga0068868_100925326 | 3300005338 | Bacteria | 794 |
| 109 | Ga0070660_100026612 | 3300005339 | Bacteria | 4309 |
| 110 | Ga0070660_100300302 | 3300005339 | Bacteria | 1316 |
| 111 | Ga0070660_100345603 | 3300005339 | Bacteria | 1224 |
| 112 | Ga0070660_100753900 | 3300005339 | Bacteria | 817 |
| 113 | Ga0070660_100914988 | 3300005339 | Bacteria | 740 |
| 114 | Ga0070660_100915340 | 3300005339 | Bacteria | 740 |
| 115 | Ga0070689_100137123 | 3300005340 | Bacteria | 1965 |
| 116 | Ga0070689_100188908 | 3300005340 | Bacteria | 1677 |
| 117 | Ga0070689_100210630 | 3300005340 | Bacteria | 1590 |
| 118 | Ga0070689_100499648 | 3300005340 | Bacteria | 1042 |
| 119 | Ga0070691_10012309 | 3300005341 | Bacteria | 3917 |
| 120 | Ga0070691_10022947 | 3300005341 | Bacteria | 2896 |
| 121 | Ga0070691_10433091 | 3300005341 | Bacteria | 747 |
| 122 | Ga0070691_10813303 | 3300005341 | Bacteria | 570 |
| 123 | Ga0070691_11018754 | 3300005341 | Bacteria | 518 |
| 124 | Ga0070687_100066257 | 3300005343 | Bacteria | 1923 |
| 125 | Ga0070687_100823329 | 3300005343 | Bacteria | 659 |
| 126 | Ga0070687_101381756 | 3300005343 | Bacteria | 526 |
| 127 | Ga0070661_100079586 | 3300005344 | Bacteria | 2419 |
| 128 | Ga0070661_100538813 | 3300005344 | Bacteria | 938 |
| 129 | Ga0070661_100922893 | 3300005344 | Bacteria | 721 |
| 130 | Ga0070661_101259793 | 3300005344 | Bacteria | 620 |
| 131 | Ga0070692_10049505 | 3300005345 | Bacteria | 2179 |
| 132 | Ga0070692_10051941 | 3300005345 | Bacteria | 2133 |
| 133 | Ga0070692_10140201 | 3300005345 | Bacteria | 1368 |
| 134 | Ga0070692_10397584 | 3300005345 | Bacteria | 869 |
| 135 | Ga0070668_100003483 | 3300005347 | Bacteria | 11605 |
| 136 | Ga0070668_100045485 | 3300005347 | Bacteria | 3367 |
| 137 | Ga0070668_100065951 | 3300005347 | Bacteria | 2808 |
| 138 | Ga0070668_100262585 | 3300005347 | Bacteria | 1436 |
| 139 | Ga0070668_100286859 | 3300005347 | Bacteria | 1376 |
| 140 | Ga0070668_100857714 | 3300005347 | Bacteria | 810 |
| 141 | Ga0070669_100224629 | 3300005353 | Bacteria | 1486 |
| 142 | Ga0070669_100327330 | 3300005353 | Bacteria | 1239 |
| 143 | Ga0070669_101928000 | 3300005353 | Bacteria | 516 |
| 144 | Ga0070675_100065082 | 3300005354 | Bacteria | 3014 |
| 145 | Ga0070675_100122668 | 3300005354 | Bacteria | 2208 |
| 146 | Ga0070675_100153185 | 3300005354 | Bacteria | 1977 |
| 147 | Ga0070675_101375582 | 3300005354 | Bacteria | 651 |
| 148 | Ga0070671_100023520 | 3300005355 | Bacteria | 5043 |
| 149 | Ga0070671_100146598 | 3300005355 | Bacteria | 1992 |
| 150 | Ga0070671_101310872 | 3300005355 | Bacteria | 639 |
| 151 | Ga0070674_100053618 | 3300005356 | Bacteria | 2785 |
| 152 | Ga0070674_100081087 | 3300005356 | Bacteria | 2318 |
| 153 | Ga0070674_101301867 | 3300005356 | Bacteria | 648 |
| 154 | Ga0070673_100221043 | 3300005364 | Bacteria | 1639 |
| 155 | Ga0070673_100273384 | 3300005364 | Bacteria | 1480 |
| 156 | Ga0070673_100285095 | 3300005364 | Bacteria | 1450 |
| 157 | Ga0070673_101708814 | 3300005364 | Bacteria | 596 |
| 158 | Ga0070688_100117492 | 3300005365 | Bacteria | 1777 |
| 159 | Ga0070688_100393198 | 3300005365 | Bacteria | 1024 |
| 160 | Ga0070688_100537183 | 3300005365 | Bacteria | 887 |
| 161 | Ga0070688_100737842 | 3300005365 | Bacteria | 766 |
| 162 | Ga0070659_100010814 | 3300005366 | Bacteria | 6730 |
| 163 | Ga0070659_100143201 | 3300005366 | Bacteria | 1946 |
| 164 | Ga0070659_100942734 | 3300005366 | Bacteria | 756 |
| 165 | Ga0070659_101741183 | 3300005366 | Bacteria | 558 |
| 166 | Ga0070659_101830784 | 3300005366 | Bacteria | 544 |
| 167 | Ga0070667_100004217 | 3300005367 | Bacteria | 12135 |
| 168 | Ga0070667_100016592 | 3300005367 | Bacteria | 6094 |
| 169 | Ga0070667_100416970 | 3300005367 | Bacteria | 1223 |
| 170 | Ga0070667_102324235 | 3300005367 | Bacteria | 505 |
| 171 | Ga0070703_10009587 | 3300005406 | Bacteria | 2731 |
| 172 | Ga0070703_10223580 | 3300005406 | Bacteria | 751 |
| 173 | Ga0070703_10500187 | 3300005406 | Bacteria | 547 |
| 174 | Ga0070709_10086222 | 3300005434 | Bacteria | 2061 |
| 175 | Ga0070709_10089315 | 3300005434 | Bacteria | 2029 |
| 176 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 177 | Ga0070714_100051110 | 3300005435 | Bacteria | 3523 |
| 178 | Ga0070714_100124276 | 3300005435 | Bacteria | 2298 |
| 179 | Ga0070714_100255466 | 3300005435 | Bacteria | 1622 |
| 180 | Ga0070714_100622362 | 3300005435 | Bacteria | 1038 |
| 181 | Ga0070714_101267338 | 3300005435 | Bacteria | 719 |
| 182 | Ga0070714_101457326 | 3300005435 | Bacteria | 669 |
| 183 | Ga0070714_101848515 | 3300005435 | Bacteria | 590 |
| 184 | Ga0070713_100008336 | 3300005436 | Bacteria | 7350 |
| 185 | Ga0070713_101290112 | 3300005436 | Bacteria | 707 |
| 186 | Ga0070710_10026928 | 3300005437 | Bacteria | 3061 |
| 187 | Ga0070710_10053151 | 3300005437 | Bacteria | 2281 |
| 188 | Ga0070710_10085821 | 3300005437 | Bacteria | 1847 |
| 189 | Ga0070710_10090187 | 3300005437 | Bacteria | 1807 |
| 190 | Ga0070701_10001181 | 3300005438 | Bacteria | 9570 |
| 191 | Ga0070701_10018401 | 3300005438 | Bacteria | 3282 |
| 192 | Ga0070701_10370624 | 3300005438 | Bacteria | 900 |
| 193 | Ga0070701_11178807 | 3300005438 | Bacteria | 543 |
| 194 | Ga0070711_100144299 | 3300005439 | Bacteria | 1788 |
| 195 | Ga0070711_100588687 | 3300005439 | Bacteria | 927 |
| 196 | Ga0070711_101071082 | 3300005439 | Bacteria | 694 |
| 197 | Ga0070711_101164608 | 3300005439 | Bacteria | 666 |
| 198 | Ga0070711_101718225 | 3300005439 | Bacteria | 550 |
| 199 | Ga0070705_100052016 | 3300005440 | Bacteria | 2391 |
| 200 | Ga0070700_100000035 | 3300005441 | Bacteria | 112177 |
| 201 | Ga0070700_100003597 | 3300005441 | Bacteria | 8014 |
| 202 | Ga0070700_100028068 | 3300005441 | Bacteria | 3344 |
| 203 | Ga0070700_100251879 | 3300005441 | Bacteria | 1267 |
| 204 | Ga0070700_100457360 | 3300005441 | Bacteria | 973 |
| 205 | Ga0070700_100647746 | 3300005441 | Bacteria | 834 |
| 206 | Ga0070700_101725410 | 3300005441 | Bacteria | 538 |
| 207 | Ga0070694_100371787 | 3300005444 | Bacteria | 1113 |
| 208 | Ga0070694_100582079 | 3300005444 | Bacteria | 899 |
| 209 | Ga0070708_100138579 | 3300005445 | Bacteria | 2255 |
| 210 | Ga0070708_100141379 | 3300005445 | Bacteria | 2232 |
| 211 | Ga0070708_100964864 | 3300005445 | Bacteria | 800 |
| 212 | Ga0070663_100003713 | 3300005455 | Bacteria | 8850 |
| 213 | Ga0070663_100008045 | 3300005455 | Bacteria | 6465 |
| 214 | Ga0070663_100042970 | 3300005455 | Bacteria | 3178 |
| 215 | Ga0070663_100055306 | 3300005455 | Bacteria | 2840 |
| 216 | Ga0070663_100059928 | 3300005455 | Bacteria | 2736 |
| 217 | Ga0070663_100117821 | 3300005455 | Bacteria | 2002 |
| 218 | Ga0070663_100152220 | 3300005455 | Bacteria | 1774 |
| 219 | Ga0070663_100540144 | 3300005455 | Bacteria | 973 |
| 220 | Ga0070663_100556367 | 3300005455 | Bacteria | 959 |
| 221 | Ga0070678_100123889 | 3300005456 | Bacteria | 2042 |
| 222 | Ga0070678_100139403 | 3300005456 | Bacteria | 1938 |
| 223 | Ga0070678_100149172 | 3300005456 | Bacteria | 1881 |
| 224 | Ga0070678_100495008 | 3300005456 | Bacteria | 1078 |
| 225 | Ga0070678_100697245 | 3300005456 | Bacteria | 914 |
| 226 | Ga0070678_101925076 | 3300005456 | Bacteria | 559 |
| 227 | Ga0070678_102351050 | 3300005456 | Bacteria | 506 |
| 228 | Ga0070662_100041413 | 3300005457 | Bacteria | 3286 |
| 229 | Ga0070662_100092660 | 3300005457 | Bacteria | 2271 |
| 230 | Ga0070662_100702675 | 3300005457 | Bacteria | 855 |
| 231 | Ga0070681_10004293 | 3300005458 | Bacteria | 13527 |
| 232 | Ga0070681_10022551 | 3300005458 | Bacteria | 6323 |
| 233 | Ga0070681_10034186 | 3300005458 | Bacteria | 5105 |
| 234 | Ga0070681_10043340 | 3300005458 | Bacteria | 4508 |
| 235 | Ga0070681_10248490 | 3300005458 | Bacteria | 1692 |
| 236 | Ga0070681_11274041 | 3300005458 | Bacteria | 658 |
| 237 | Ga0070681_12003764 | 3300005458 | Bacteria | 507 |
| 238 | Ga0070681_12033717 | 3300005458 | Bacteria | 503 |
| 239 | Ga0068867_100007380 | 3300005459 | Bacteria | 7777 |
| 240 | Ga0068867_100116417 | 3300005459 | Bacteria | 2060 |
| 241 | Ga0068867_101090292 | 3300005459 | Bacteria | 728 |
| 242 | Ga0068867_101116175 | 3300005459 | Bacteria | 721 |
| 243 | Ga0070685_10026200 | 3300005466 | Bacteria | 3212 |
| 244 | Ga0070685_10031017 | 3300005466 | Bacteria | 2983 |
| 245 | Ga0070685_10202330 | 3300005466 | Bacteria | 1292 |
| 246 | Ga0070685_10465914 | 3300005466 | Bacteria | 888 |
| 247 | Ga0070706_100083112 | 3300005467 | Bacteria | 2966 |
| 248 | Ga0070706_100114177 | 3300005467 | Bacteria | 2515 |
| 249 | Ga0070707_100017376 | 3300005468 | Bacteria | 6762 |
| 250 | Ga0070698_100006774 | 3300005471 | Bacteria | 12422 |
| 251 | Ga0070698_100090705 | 3300005471 | Bacteria | 3039 |
| 252 | Ga0070698_100142295 | 3300005471 | Bacteria | 2349 |
| 253 | Ga0070698_101663035 | 3300005471 | Bacteria | 591 |
| 254 | Ga0070699_100097370 | 3300005518 | Bacteria | 2577 |
| 255 | Ga0070679_100003833 | 3300005530 | Bacteria | 13804 |
| 256 | Ga0070679_100006878 | 3300005530 | Bacteria | 10606 |
| 257 | Ga0070679_100174430 | 3300005530 | Bacteria | 2122 |
| 258 | Ga0070679_100240378 | 3300005530 | Bacteria | 1768 |
| 259 | Ga0070679_100571901 | 3300005530 | Bacteria | 1074 |
| 260 | Ga0070679_100983619 | 3300005530 | Bacteria | 788 |
| 261 | Ga0070679_101169937 | 3300005530 | Bacteria | 714 |
| 262 | Ga0070684_100020206 | 3300005535 | Bacteria | 5525 |
| 263 | Ga0070684_100057591 | 3300005535 | Bacteria | 3393 |
| 264 | Ga0070684_100351512 | 3300005535 | Bacteria | 1356 |
| 265 | Ga0070684_100371632 | 3300005535 | Bacteria | 1316 |
| 266 | Ga0070684_100410385 | 3300005535 | Bacteria | 1249 |
| 267 | Ga0070684_100429706 | 3300005535 | Bacteria | 1219 |
| 268 | Ga0070684_100837851 | 3300005535 | Bacteria | 860 |
| 269 | Ga0070684_101014798 | 3300005535 | Bacteria | 779 |
| 270 | Ga0070684_101995532 | 3300005535 | Bacteria | 548 |
| 271 | Ga0070697_100016947 | 3300005536 | Bacteria | 5728 |
| 272 | Ga0068853_100307169 | 3300005539 | Bacteria | 1467 |
| 273 | Ga0068853_100336667 | 3300005539 | Bacteria | 1401 |
| 274 | Ga0068853_101196776 | 3300005539 | Bacteria | 734 |
| 275 | Ga0070672_100002167 | 3300005543 | Bacteria | 12376 |
| 276 | Ga0070672_100111347 | 3300005543 | Bacteria | 2231 |
| 277 | Ga0070672_100702452 | 3300005543 | Bacteria | 886 |
| 278 | Ga0070686_100071082 | 3300005544 | Bacteria | 2277 |
| 279 | Ga0070686_100819300 | 3300005544 | Bacteria | 752 |
| 280 | Ga0070695_100077745 | 3300005545 | Bacteria | 2187 |
| 281 | Ga0070695_101017329 | 3300005545 | Bacteria | 674 |
| 282 | Ga0070696_100104744 | 3300005546 | Bacteria | 2031 |
| 283 | Ga0070693_100031013 | 3300005547 | Bacteria | 2927 |
| 284 | Ga0070693_100070840 | 3300005547 | Bacteria | 2052 |
| 285 | Ga0070693_100121492 | 3300005547 | Bacteria | 1620 |
| 286 | Ga0070665_100001905 | 3300005548 | Bacteria | 23586 |
| 287 | Ga0070665_100002601 | 3300005548 | Bacteria | 19707 |
| 288 | Ga0070665_100220087 | 3300005548 | Bacteria | 1899 |
| 289 | Ga0070665_100230283 | 3300005548 | Bacteria | 1853 |
| 290 | Ga0070665_100236226 | 3300005548 | Bacteria | 1828 |
| 291 | Ga0070665_100360166 | 3300005548 | Bacteria | 1460 |
| 292 | Ga0070665_100988870 | 3300005548 | Bacteria | 854 |
| 293 | Ga0070665_101956487 | 3300005548 | Bacteria | 592 |
| 294 | Ga0070665_102071605 | 3300005548 | Bacteria | 574 |
| 295 | Ga0070704_100019131 | 3300005549 | Bacteria | 4396 |
| 296 | Ga0070704_100178966 | 3300005549 | Bacteria | 1694 |
| 297 | Ga0068855_100046634 | 3300005563 | Bacteria | 5122 |
| 298 | Ga0068855_100284096 | 3300005563 | Bacteria | 1836 |
| 299 | Ga0068855_100559322 | 3300005563 | Bacteria | 1237 |
| 300 | Ga0070664_100029753 | 3300005564 | Bacteria | 4554 |
| 301 | Ga0070664_100238332 | 3300005564 | Bacteria | 1632 |
| 302 | Ga0070664_100506842 | 3300005564 | Bacteria | 1113 |
| 303 | Ga0068857_100023375 | 3300005577 | Bacteria | 5441 |
| 304 | Ga0068857_100573578 | 3300005577 | Bacteria | 1064 |
| 305 | Ga0068857_101300636 | 3300005577 | Bacteria | 706 |
| 306 | Ga0068854_100024677 | 3300005578 | Bacteria | 4119 |
| 307 | Ga0068854_100056171 | 3300005578 | Bacteria | 2837 |
| 308 | Ga0068854_100178489 | 3300005578 | Bacteria | 1657 |
| 309 | Ga0068854_100905312 | 3300005578 | Bacteria | 776 |
| 310 | Ga0068856_100305559 | 3300005614 | Bacteria | 1608 |
| 311 | Ga0068856_100754456 | 3300005614 | Bacteria | 993 |
| 312 | Ga0068856_100883884 | 3300005614 | Bacteria | 912 |
| 313 | Ga0068856_101904600 | 3300005614 | Bacteria | 605 |
| 314 | Ga0068856_102289352 | 3300005614 | Bacteria | 548 |
| 315 | Ga0068856_102384077 | 3300005614 | Bacteria | 537 |
| 316 | Ga0070702_100010220 | 3300005615 | Bacteria | 4615 |
| 317 | Ga0070702_100094575 | 3300005615 | Bacteria | 1820 |
| 318 | Ga0070702_100116385 | 3300005615 | Bacteria | 1666 |
| 319 | Ga0070702_100365775 | 3300005615 | Bacteria | 1021 |
| 320 | Ga0070702_100480967 | 3300005615 | Bacteria | 908 |
| 321 | Ga0068852_100002721 | 3300005616 | Bacteria | 12219 |
| 322 | Ga0068852_100104920 | 3300005616 | Bacteria | 2559 |
| 323 | Ga0068852_100459632 | 3300005616 | Bacteria | 1262 |
| 324 | Ga0068852_101086978 | 3300005616 | Bacteria | 820 |
| 325 | Ga0068852_101964835 | 3300005616 | Bacteria | 607 |
| 326 | Ga0068859_100962717 | 3300005617 | Bacteria | 936 |
| 327 | Ga0068859_101607613 | 3300005617 | Bacteria | 718 |
| 328 | Ga0068859_101719729 | 3300005617 | Bacteria | 693 |
| 329 | Ga0068859_102396822 | 3300005617 | Bacteria | 581 |
| 330 | Ga0068864_100093687 | 3300005618 | Bacteria | 2653 |
| 331 | Ga0068864_100263876 | 3300005618 | Bacteria | 1603 |
| 332 | Ga0068864_101349881 | 3300005618 | Bacteria | 714 |
| 333 | Ga0068864_101774768 | 3300005618 | Bacteria | 622 |
| 334 | Ga0068866_10006852 | 3300005718 | Bacteria | 4757 |
| 335 | Ga0068866_10029184 | 3300005718 | Bacteria | 2636 |
| 336 | Ga0068866_10064529 | 3300005718 | Bacteria | 1912 |
| 337 | Ga0068861_100035902 | 3300005719 | Bacteria | 3675 |
| 338 | Ga0068861_100802200 | 3300005719 | Bacteria | 884 |
| 339 | Ga0068861_101538927 | 3300005719 | Bacteria | 654 |
| 340 | Ga0068851_10035205 | 3300005834 | Bacteria | 2502 |
| 341 | Ga0068851_10146074 | 3300005834 | Bacteria | 1290 |
| 342 | Ga0068851_10241831 | 3300005834 | Bacteria | 1021 |
| 343 | Ga0068851_10964187 | 3300005834 | Bacteria | 537 |
| 344 | Ga0068870_10000658 | 3300005840 | Bacteria | 13168 |
| 345 | Ga0068870_10006791 | 3300005840 | Bacteria | 5071 |
| 346 | Ga0068870_10336804 | 3300005840 | Bacteria | 964 |
| 347 | Ga0068870_10422386 | 3300005840 | Bacteria | 873 |
| 348 | Ga0068870_11264107 | 3300005840 | Bacteria | 537 |
| 349 | Ga0068870_11333673 | 3300005840 | Bacteria | 524 |
| 350 | Ga0068863_100000497 | 3300005841 | Bacteria | 39901 |
| 351 | Ga0068863_100130459 | 3300005841 | Bacteria | 2400 |
| 352 | Ga0068863_100335344 | 3300005841 | Bacteria | 1470 |
| 353 | Ga0068863_100427239 | 3300005841 | Bacteria | 1298 |
| 354 | Ga0068858_100019674 | 3300005842 | Bacteria | 6312 |
| 355 | Ga0068858_100365377 | 3300005842 | Bacteria | 1383 |
| 356 | Ga0068858_100365427 | 3300005842 | Bacteria | 1383 |
| 357 | Ga0068858_101474206 | 3300005842 | Bacteria | 671 |
| 358 | Ga0068858_101691493 | 3300005842 | Bacteria | 625 |
| 359 | Ga0068858_101987275 | 3300005842 | Bacteria | 575 |
| 360 | Ga0068860_100000054 | 3300005843 | Bacteria | 206114 |
| 361 | Ga0068860_100138668 | 3300005843 | Bacteria | 2336 |
| 362 | Ga0068860_100193897 | 3300005843 | Bacteria | 1966 |
| 363 | Ga0068860_100616459 | 3300005843 | Bacteria | 1091 |
| 364 | Ga0068860_102779239 | 3300005843 | Bacteria | 507 |
| 365 | Ga0068862_100437710 | 3300005844 | Bacteria | 1230 |
| 366 | Ga0068862_100760369 | 3300005844 | Bacteria | 943 |
| 367 | Ga0068862_100858963 | 3300005844 | Bacteria | 890 |
| 368 | Ga0068862_101531011 | 3300005844 | Bacteria | 673 |
| 369 | Ga0081455_10730822 | 3300005937 | Bacteria | 628 |
| 370 | Ga0081540_1000341 | 3300005983 | Bacteria | 47794 |
| 371 | Ga0070717_10250533 | 3300006028 | Bacteria | 1564 |
| 372 | Ga0070717_10311589 | 3300006028 | Bacteria | 1401 |
| 373 | Ga0075365_10047376 | 3300006038 | Bacteria | 2825 |
| 374 | Ga0075365_10753603 | 3300006038 | Bacteria | 687 |
| 375 | Ga0075363_100000106 | 3300006048 | Bacteria | 18994 |
| 376 | Ga0075363_100016799 | 3300006048 | Bacteria | 3618 |
| 377 | Ga0075363_100049887 | 3300006048 | Bacteria | 2229 |
| 378 | Ga0075363_100135479 | 3300006048 | Bacteria | 1384 |
| 379 | Ga0075363_100442769 | 3300006048 | Bacteria | 767 |
| 380 | Ga0075364_10000119 | 3300006051 | Bacteria | 32513 |
| 381 | Ga0075364_10002085 | 3300006051 | Bacteria | 11167 |
| 382 | Ga0075364_10031775 | 3300006051 | Bacteria | 3391 |
| 383 | Ga0075364_10538181 | 3300006051 | Bacteria | 798 |
| 384 | Ga0075432_10177871 | 3300006058 | Bacteria | 831 |
| 385 | Ga0070715_10017201 | 3300006163 | Bacteria | 2733 |
| 386 | Ga0070715_10084272 | 3300006163 | Bacteria | 1449 |
| 387 | Ga0070712_100060728 | 3300006175 | Bacteria | 2667 |
| 388 | Ga0070712_100411945 | 3300006175 | Bacteria | 1118 |
| 389 | Ga0070712_100609953 | 3300006175 | Bacteria | 924 |
| 390 | Ga0070712_101662177 | 3300006175 | Bacteria | 559 |
| 391 | Ga0075362_10467932 | 3300006177 | Bacteria | 642 |
| 392 | Ga0075367_10604860 | 3300006178 | Bacteria | 697 |
| 393 | Ga0075369_10000768 | 3300006186 | Bacteria | 10476 |
| 394 | Ga0075369_10006299 | 3300006186 | Bacteria | 4480 |
| 395 | Ga0075369_10499827 | 3300006186 | Bacteria | 578 |
| 396 | Ga0097621_100099184 | 3300006237 | Bacteria | 2448 |
| 397 | Ga0097621_100388372 | 3300006237 | Bacteria | 1248 |
| 398 | Ga0097621_100996674 | 3300006237 | Bacteria | 783 |
| 399 | Ga0097621_101044536 | 3300006237 | Bacteria | 765 |
| 400 | Ga0075370_10001554 | 3300006353 | Bacteria | 10055 |
| 401 | Ga0075370_10014981 | 3300006353 | Bacteria | 4143 |
| 402 | Ga0075370_10137124 | 3300006353 | Bacteria | 1430 |
| 403 | Ga0075370_10274662 | 3300006353 | Bacteria | 1001 |
| 404 | Ga0075370_10407942 | 3300006353 | Bacteria | 815 |
| 405 | Ga0075370_10629295 | 3300006353 | Bacteria | 651 |
| 406 | Ga0068871_100065721 | 3300006358 | Bacteria | 2971 |
| 407 | Ga0068871_100918334 | 3300006358 | Bacteria | 812 |
| 408 | Ga0068871_101138532 | 3300006358 | Bacteria | 730 |
| 409 | Ga0068871_101296728 | 3300006358 | Bacteria | 685 |
| 410 | Ga0075433_10233530 | 3300006852 | Bacteria | 1633 |
| 411 | Ga0075434_100205355 | 3300006871 | Bacteria | 1990 |
| 412 | Ga0075434_101355643 | 3300006871 | Bacteria | 722 |
| 413 | Ga0068865_100006802 | 3300006881 | Bacteria | 7000 |
| 414 | Ga0068865_100742020 | 3300006881 | Bacteria | 842 |
| 415 | Ga0068865_101238618 | 3300006881 | Bacteria | 661 |
| 416 | Ga0068865_101561476 | 3300006881 | Bacteria | 593 |
| 417 | Ga0097620_100962672 | 3300006931 | Bacteria | 936 |
| 418 | Ga0097620_101607525 | 3300006931 | Bacteria | 718 |
| 419 | Ga0097620_101719729 | 3300006931 | Bacteria | 693 |
| 420 | Ga0097620_102396822 | 3300006931 | Bacteria | 581 |
| 421 | Ga0075435_101013557 | 3300007076 | Bacteria | 725 |
| 422 | Ga0099795_10439968 | 3300007788 | Bacteria | 599 |
| 423 | Ga0105240_10046258 | 3300009093 | Bacteria | 5515 |
| 424 | Ga0105240_10129775 | 3300009093 | Bacteria | 3025 |
| 425 | Ga0105240_10279796 | 3300009093 | Bacteria | 1917 |
| 426 | Ga0105240_10573941 | 3300009093 | Bacteria | 1245 |
| 427 | Ga0111539_10996282 | 3300009094 | Bacteria | 974 |
| 428 | Ga0111539_12239040 | 3300009094 | Bacteria | 634 |
| 429 | Ga0111539_13334324 | 3300009094 | Bacteria | 517 |
| 430 | Ga0105245_10090859 | 3300009098 | Bacteria | 2809 |
| 431 | Ga0105245_10176435 | 3300009098 | Bacteria | 2038 |
| 432 | Ga0105245_10240303 | 3300009098 | Bacteria | 1755 |
| 433 | Ga0105245_10331477 | 3300009098 | Bacteria | 1502 |
| 434 | Ga0105245_10336107 | 3300009098 | Bacteria | 1492 |
| 435 | Ga0105245_10406179 | 3300009098 | Bacteria | 1362 |
| 436 | Ga0105245_10561875 | 3300009098 | Bacteria | 1164 |
| 437 | Ga0105245_10563991 | 3300009098 | Bacteria | 1162 |
| 438 | Ga0105245_10796479 | 3300009098 | Bacteria | 983 |
| 439 | Ga0105247_10107294 | 3300009101 | Bacteria | 1793 |
| 440 | Ga0105247_10112575 | 3300009101 | Bacteria | 1754 |
| 441 | Ga0105247_10279709 | 3300009101 | Bacteria | 1151 |
| 442 | Ga0105247_10308750 | 3300009101 | Bacteria | 1100 |
| 443 | Ga0105243_10000567 | 3300009148 | Bacteria | 37383 |
| 444 | Ga0105243_10002648 | 3300009148 | Bacteria | 14867 |
| 445 | Ga0105243_10092563 | 3300009148 | Bacteria | 2493 |
| 446 | Ga0105243_10745168 | 3300009148 | Bacteria | 960 |
| 447 | Ga0105243_12503314 | 3300009148 | Bacteria | 555 |
| 448 | Ga0105241_10193643 | 3300009174 | Bacteria | 1693 |
| 449 | Ga0105241_10535843 | 3300009174 | Bacteria | 1049 |
| 450 | Ga0105241_10673073 | 3300009174 | Bacteria | 942 |
| 451 | Ga0105241_10810459 | 3300009174 | Bacteria | 863 |
| 452 | Ga0105242_10105857 | 3300009176 | Bacteria | 2390 |
| 453 | Ga0105242_10153537 | 3300009176 | Bacteria | 2009 |
| 454 | Ga0105242_10751570 | 3300009176 | Bacteria | 960 |
| 455 | Ga0105242_10844031 | 3300009176 | Bacteria | 911 |
| 456 | Ga0105242_11180075 | 3300009176 | Bacteria | 784 |
| 457 | Ga0105242_12394979 | 3300009176 | Bacteria | 575 |
| 458 | Ga0105242_12754481 | 3300009176 | Bacteria | 542 |
| 459 | Ga0105242_13141267 | 3300009176 | Bacteria | 512 |
| 460 | Ga0105248_10129268 | 3300009177 | Bacteria | 2850 |
| 461 | Ga0105248_10360972 | 3300009177 | Bacteria | 1635 |
| 462 | Ga0105248_10416519 | 3300009177 | Bacteria | 1513 |
| 463 | Ga0105248_10750513 | 3300009177 | Bacteria | 1101 |
| 464 | Ga0105248_13310277 | 3300009177 | Bacteria | 512 |
| 465 | Ga0105237_10229716 | 3300009545 | Bacteria | 1856 |
| 466 | Ga0105237_10323663 | 3300009545 | Bacteria | 1545 |
| 467 | Ga0105237_10740180 | 3300009545 | Bacteria | 990 |
| 468 | Ga0105237_11292109 | 3300009545 | Bacteria | 736 |
| 469 | Ga0105237_11898099 | 3300009545 | Bacteria | 604 |
| 470 | Ga0105237_11995228 | 3300009545 | Bacteria | 589 |
| 471 | Ga0105237_12235722 | 3300009545 | Bacteria | 556 |
| 472 | Ga0105238_10117861 | 3300009551 | Bacteria | 2635 |
| 473 | Ga0105238_10301065 | 3300009551 | Bacteria | 1587 |
| 474 | Ga0105238_10305375 | 3300009551 | Bacteria | 1575 |
| 475 | Ga0105238_10389443 | 3300009551 | Bacteria | 1386 |
| 476 | Ga0105238_10812133 | 3300009551 | Bacteria | 951 |
| 477 | Ga0105238_10820965 | 3300009551 | Bacteria | 946 |
| 478 | Ga0105238_11122481 | 3300009551 | Bacteria | 809 |
| 479 | Ga0105238_11709485 | 3300009551 | Bacteria | 660 |
| 480 | Ga0105249_10140872 | 3300009553 | Bacteria | 2312 |
| 481 | Ga0105249_10348738 | 3300009553 | Bacteria | 1499 |
| 482 | Ga0105249_10380345 | 3300009553 | Bacteria | 1438 |
| 483 | Ga0105249_10538049 | 3300009553 | Bacteria | 1217 |
| 484 | Ga0105239_10020346 | 3300010375 | Bacteria | 7321 |
| 485 | Ga0105239_10141441 | 3300010375 | Bacteria | 2682 |
| 486 | Ga0105239_10354484 | 3300010375 | Bacteria | 1657 |
| 487 | Ga0105239_11465419 | 3300010375 | Bacteria | 788 |
| 488 | Ga0105239_11492605 | 3300010375 | Bacteria | 781 |
| 489 | Ga0105239_11671994 | 3300010375 | Bacteria | 737 |
| 490 | Ga0105246_10025484 | 3300011119 | Bacteria | 3855 |
| 491 | Ga0105246_11210957 | 3300011119 | Bacteria | 695 |
| 492 | Ga0105246_11450084 | 3300011119 | Bacteria | 642 |
| 493 | Ga0157317_1002146 | 3300012475 | Bacteria | 1143 |
| 494 | Ga0157343_1003579 | 3300012488 | Bacteria | 919 |
| 495 | Ga0157322_1013516 | 3300012490 | Bacteria | 703 |
| 496 | Ga0157335_1000629 | 3300012492 | Bacteria | 1677 |
| 497 | Ga0157335_1016038 | 3300012492 | Bacteria | 665 |
| 498 | Ga0157341_1001661 | 3300012494 | Bacteria | 1381 |
| 499 | Ga0157319_1008542 | 3300012497 | Bacteria | 786 |
| 500 | Ga0157345_1006509 | 3300012498 | Bacteria | 932 |
| 501 | Ga0157347_1030950 | 3300012502 | Bacteria | 670 |
| 502 | Ga0157313_1026815 | 3300012503 | Bacteria | 628 |
| 503 | Ga0157339_1010932 | 3300012505 | Bacteria | 828 |
| 504 | Ga0157324_1012408 | 3300012506 | Bacteria | 754 |
| 505 | Ga0157324_1018276 | 3300012506 | Bacteria | 687 |
| 506 | Ga0157342_1000500 | 3300012507 | Bacteria | 2423 |
| 507 | Ga0157338_1040527 | 3300012515 | Bacteria | 633 |
| 508 | Ga0157373_10042038 | 3300013100 | Bacteria | 3268 |
| 509 | Ga0157373_10285423 | 3300013100 | Bacteria | 1170 |
| 510 | Ga0157373_10411165 | 3300013100 | Bacteria | 970 |
| 511 | Ga0157371_10024599 | 3300013102 | Bacteria | 4395 |
| 512 | Ga0157371_10216006 | 3300013102 | Bacteria | 1377 |
| 513 | Ga0157371_10590652 | 3300013102 | Bacteria | 825 |
| 514 | Ga0157371_10597225 | 3300013102 | Bacteria | 821 |
| 515 | Ga0157371_10635361 | 3300013102 | Bacteria | 796 |
| 516 | Ga0157370_10108707 | 3300013104 | Bacteria | 2593 |
| 517 | Ga0157370_10149009 | 3300013104 | Bacteria | 2178 |
| 518 | Ga0157370_10172213 | 3300013104 | Bacteria | 2012 |
| 519 | Ga0157370_10255677 | 3300013104 | Bacteria | 1620 |
| 520 | Ga0157370_10443282 | 3300013104 | Bacteria | 1194 |
| 521 | Ga0157370_10800213 | 3300013104 | Bacteria | 858 |
| 522 | Ga0157370_10919194 | 3300013104 | Bacteria | 794 |
| 523 | Ga0157370_11737994 | 3300013104 | Bacteria | 560 |
| 524 | Ga0157369_10129817 | 3300013105 | Bacteria | 2671 |
| 525 | Ga0157369_10141244 | 3300013105 | Bacteria | 2548 |
| 526 | Ga0157369_10329543 | 3300013105 | Bacteria | 1586 |
| 527 | Ga0157369_10403566 | 3300013105 | Bacteria | 1418 |
| 528 | Ga0157369_11055175 | 3300013105 | Bacteria | 831 |
| 529 | Ga0157369_11074293 | 3300013105 | Bacteria | 823 |
| 530 | Ga0157369_11599565 | 3300013105 | Bacteria | 663 |
| 531 | Ga0157374_10131921 | 3300013296 | Bacteria | 2418 |
| 532 | Ga0157374_11126343 | 3300013296 | Bacteria | 805 |
| 533 | Ga0157374_11470717 | 3300013296 | Bacteria | 704 |
| 534 | Ga0157374_11477182 | 3300013296 | Bacteria | 703 |
| 535 | Ga0157374_11632815 | 3300013296 | Bacteria | 669 |
| 536 | Ga0157374_11695415 | 3300013296 | Bacteria | 657 |
| 537 | Ga0157374_11714662 | 3300013296 | Bacteria | 653 |
| 538 | Ga0157374_11796706 | 3300013296 | Bacteria | 638 |
| 539 | Ga0157374_11846234 | 3300013296 | Bacteria | 630 |
| 540 | Ga0157374_12542787 | 3300013296 | Bacteria | 539 |
| 541 | Ga0157378_10040112 | 3300013297 | Bacteria | 4152 |
| 542 | Ga0157378_10204057 | 3300013297 | Bacteria | 1871 |
| 543 | Ga0157378_11348118 | 3300013297 | Bacteria | 755 |
| 544 | Ga0157378_11824487 | 3300013297 | Bacteria | 656 |
| 545 | Ga0163162_10091937 | 3300013306 | Bacteria | 3117 |
| 546 | Ga0163162_10484708 | 3300013306 | Bacteria | 1368 |
| 547 | Ga0163162_10777606 | 3300013306 | Bacteria | 1076 |
| 548 | Ga0163162_11566472 | 3300013306 | Bacteria | 751 |
| 549 | Ga0163162_12258468 | 3300013306 | Bacteria | 625 |
| 550 | Ga0157372_10000069 | 3300013307 | Bacteria | 110621 |
| 551 | Ga0157372_10247858 | 3300013307 | Bacteria | 2067 |
| 552 | Ga0157372_10303539 | 3300013307 | Bacteria | 1857 |
| 553 | Ga0157372_10718867 | 3300013307 | Bacteria | 1162 |
| 554 | Ga0157372_10977450 | 3300013307 | Bacteria | 981 |
| 555 | Ga0157372_11442381 | 3300013307 | Bacteria | 793 |
| 556 | Ga0157372_11757235 | 3300013307 | Bacteria | 713 |
| 557 | Ga0157375_10091509 | 3300013308 | Bacteria | 3103 |
| 558 | Ga0157375_10823793 | 3300013308 | Bacteria | 1076 |
| 559 | Ga0157375_11008643 | 3300013308 | Bacteria | 972 |
| 560 | Ga0157375_11055873 | 3300013308 | Bacteria | 950 |
| 561 | Ga0157375_11675270 | 3300013308 | Bacteria | 753 |
| 562 | Ga0157375_12003571 | 3300013308 | Bacteria | 688 |
| 563 | Ga0157375_12908163 | 3300013308 | Bacteria | 572 |
| 564 | Ga0157375_13751007 | 3300013308 | Bacteria | 505 |
| 565 | Ga0163163_10034337 | 3300014325 | Bacteria | 4910 |
| 566 | Ga0163163_10390101 | 3300014325 | Bacteria | 1450 |
| 567 | Ga0163163_11227374 | 3300014325 | Bacteria | 812 |
| 568 | Ga0163163_12309125 | 3300014325 | Bacteria | 597 |
| 569 | Ga0157380_10037515 | 3300014326 | Bacteria | 3755 |
| 570 | Ga0157380_10204736 | 3300014326 | Bacteria | 1754 |
| 571 | Ga0157380_10521228 | 3300014326 | Bacteria | 1159 |
| 572 | Ga0157380_10789920 | 3300014326 | Bacteria | 965 |
| 573 | Ga0157380_12036197 | 3300014326 | Bacteria | 636 |
| 574 | Ga0157380_12223396 | 3300014326 | Bacteria | 612 |
| 575 | Ga0182008_10023005 | 3300014497 | Bacteria | 3188 |
| 576 | Ga0157377_10023097 | 3300014745 | Bacteria | 3293 |
| 577 | Ga0157377_10133410 | 3300014745 | Bacteria | 1519 |
| 578 | Ga0157377_10218860 | 3300014745 | Bacteria | 1218 |
| 579 | Ga0157379_10008421 | 3300014968 | Bacteria | 8965 |
| 580 | Ga0157379_10485086 | 3300014968 | Bacteria | 1144 |
| 581 | Ga0157379_10899456 | 3300014968 | Bacteria | 840 |
| 582 | Ga0157379_11086010 | 3300014968 | Bacteria | 766 |
| 583 | Ga0157376_10044967 | 3300014969 | Bacteria | 3632 |
| 584 | Ga0157376_10257542 | 3300014969 | Bacteria | 1633 |
| 585 | Ga0157376_10755971 | 3300014969 | Bacteria | 982 |
| 586 | Ga0157376_12092919 | 3300014969 | Bacteria | 604 |
| 587 | Ga0182005_1186331 | 3300015265 | Bacteria | 618 |
| 588 | Ga0163161_10249662 | 3300017792 | Bacteria | 1383 |
| 589 | Ga0163161_10943655 | 3300017792 | Bacteria | 733 |
| 590 | Ga0184593_109258 | 3300019179 | Bacteria | 518 |
| 591 | Ga0197907_10353354 | 3300020069 | Bacteria | 855 |
| 592 | Ga0197907_10377945 | 3300020069 | Bacteria | 8513 |
| 593 | Ga0197907_10781799 | 3300020069 | Bacteria | 628 |
| 594 | Ga0197907_10968004 | 3300020069 | Bacteria | 682 |
| 595 | Ga0197907_11047833 | 3300020069 | Bacteria | 1811 |
| 596 | Ga0197907_11065209 | 3300020069 | Bacteria | 3009 |
| 597 | Ga0197907_11203916 | 3300020069 | Bacteria | 712 |
| 598 | Ga0197907_11348210 | 3300020069 | Bacteria | 501 |
| 599 | Ga0206356_10482235 | 3300020070 | Bacteria | 732 |
| 600 | Ga0206356_10562542 | 3300020070 | Bacteria | 736 |
| 601 | Ga0206356_10734286 | 3300020070 | Bacteria | 2963 |
| 602 | Ga0206356_10806586 | 3300020070 | Bacteria | 669 |
| 603 | Ga0206356_10809245 | 3300020070 | Bacteria | 2767 |
| 604 | Ga0206356_11160282 | 3300020070 | Bacteria | 2615 |
| 605 | Ga0206356_11250559 | 3300020070 | Bacteria | 1088 |
| 606 | Ga0206356_11355722 | 3300020070 | Bacteria | 1133 |
| 607 | Ga0206356_11891214 | 3300020070 | Bacteria | 634 |
| 608 | Ga0206349_1037049 | 3300020075 | Bacteria | 2585 |
| 609 | Ga0206349_1223679 | 3300020075 | Bacteria | 586 |
| 610 | Ga0206349_1265100 | 3300020075 | Bacteria | 559 |
| 611 | Ga0206349_1421489 | 3300020075 | Bacteria | 782 |
| 612 | Ga0206349_1464288 | 3300020075 | Bacteria | 1104 |
| 613 | Ga0206349_1519183 | 3300020075 | Bacteria | 797 |
| 614 | Ga0206349_1522805 | 3300020075 | Bacteria | 669 |
| 615 | Ga0206349_1728033 | 3300020075 | Bacteria | 1172 |
| 616 | Ga0206349_1737707 | 3300020075 | Bacteria | 501 |
| 617 | Ga0206355_1015855 | 3300020076 | Bacteria | 656 |
| 618 | Ga0206355_1205564 | 3300020076 | Bacteria | 808 |
| 619 | Ga0206355_1261997 | 3300020076 | Bacteria | 1896 |
| 620 | Ga0206355_1415001 | 3300020076 | Bacteria | 662 |
| 621 | Ga0206355_1472830 | 3300020076 | Bacteria | 561 |
| 622 | Ga0206355_1654077 | 3300020076 | Bacteria | 988 |
| 623 | Ga0206355_1690241 | 3300020076 | Bacteria | 934 |
| 624 | Ga0206351_10046376 | 3300020077 | Bacteria | 698 |
| 625 | Ga0206351_10076119 | 3300020077 | Bacteria | 585 |
| 626 | Ga0206351_10219957 | 3300020077 | Bacteria | 552 |
| 627 | Ga0206351_10309003 | 3300020077 | Bacteria | 859 |
| 628 | Ga0206351_10377689 | 3300020077 | Bacteria | 928 |
| 629 | Ga0206351_10414096 | 3300020077 | Bacteria | 2659 |
| 630 | Ga0206351_10514268 | 3300020077 | Bacteria | 1752 |
| 631 | Ga0206351_10517565 | 3300020077 | Bacteria | 712 |
| 632 | Ga0206351_10522676 | 3300020077 | Bacteria | 957 |
| 633 | Ga0206352_10139106 | 3300020078 | Bacteria | 1344 |
| 634 | Ga0206352_10258938 | 3300020078 | Bacteria | 1023 |
| 635 | Ga0206352_10333989 | 3300020078 | Bacteria | 1154 |
| 636 | Ga0206352_10725403 | 3300020078 | Bacteria | 818 |
| 637 | Ga0206352_10725571 | 3300020078 | Bacteria | 1589 |
| 638 | Ga0206352_11019656 | 3300020078 | Bacteria | 1567 |
| 639 | Ga0206352_11045450 | 3300020078 | Bacteria | 1127 |
| 640 | Ga0206350_10382414 | 3300020080 | Bacteria | 789 |
| 641 | Ga0206350_10667397 | 3300020080 | Bacteria | 4645 |
| 642 | Ga0206350_11285491 | 3300020080 | Bacteria | 1378 |
| 643 | Ga0206350_11483097 | 3300020080 | Bacteria | 2256 |
| 644 | Ga0206350_11655750 | 3300020080 | Bacteria | 890 |
| 645 | Ga0206354_10317063 | 3300020081 | Bacteria | 2737 |
| 646 | Ga0206354_10357282 | 3300020081 | Bacteria | 500 |
| 647 | Ga0206354_10378201 | 3300020081 | Bacteria | 749 |
| 648 | Ga0206354_10394252 | 3300020081 | Bacteria | 654 |
| 649 | Ga0206354_10491146 | 3300020081 | Bacteria | 4082 |
| 650 | Ga0206354_10670181 | 3300020081 | Bacteria | 2821 |
| 651 | Ga0206354_10676331 | 3300020081 | Bacteria | 650 |
| 652 | Ga0206354_10764178 | 3300020081 | Bacteria | 612 |
| 653 | Ga0206354_11140572 | 3300020081 | Bacteria | 566 |
| 654 | Ga0206354_11153566 | 3300020081 | Bacteria | 925 |
| 655 | Ga0206354_11319487 | 3300020081 | Bacteria | 3065 |
| 656 | Ga0206353_10229932 | 3300020082 | Bacteria | 703 |
| 657 | Ga0206353_10865326 | 3300020082 | Bacteria | 1110 |
| 658 | Ga0206353_10924004 | 3300020082 | Bacteria | 4025 |
| 659 | Ga0206353_11139857 | 3300020082 | Bacteria | 559 |
| 660 | Ga0206353_11303022 | 3300020082 | Bacteria | 691 |
| 661 | Ga0206353_11654695 | 3300020082 | Bacteria | 607 |
| 662 | Ga0154015_1344825 | 3300020610 | Bacteria | 547 |
| 663 | Ga0154015_1350603 | 3300020610 | Bacteria | 934 |
| 664 | Ga0154015_1581024 | 3300020610 | Bacteria | 623 |
| 665 | Ga0213873_10166278 | 3300021358 | Bacteria | 671 |
| 666 | Ga0213876_10022127 | 3300021384 | Bacteria | 3363 |
| 667 | Ga0213876_10131711 | 3300021384 | Bacteria | 1329 |
| 668 | Ga0213876_10496274 | 3300021384 | Bacteria | 650 |
| 669 | Ga0213875_10000107 | 3300021388 | Bacteria | 95120 |
| 670 | Ga0213875_10000362 | 3300021388 | Bacteria | 42266 |
| 671 | Ga0213875_10010348 | 3300021388 | Bacteria | 4672 |
| 672 | Ga0213875_10052334 | 3300021388 | Bacteria | 1912 |
| 673 | Ga0213875_10130105 | 3300021388 | Bacteria | 1177 |
| 674 | Ga0213875_10153206 | 3300021388 | Bacteria | 1080 |
| 675 | Ga0224712_10000575 | 3300022467 | Bacteria | 7470 |
| 676 | Ga0224712_10000978 | 3300022467 | Bacteria | 6216 |
| 677 | Ga0224712_10004671 | 3300022467 | Bacteria | 3720 |
| 678 | Ga0224712_10048915 | 3300022467 | Bacteria | 1634 |
| 679 | Ga0224712_10049036 | 3300022467 | Bacteria | 1633 |
| 680 | Ga0224712_10078968 | 3300022467 | Bacteria | 1354 |
| 681 | Ga0224712_10093646 | 3300022467 | Bacteria | 1263 |
| 682 | Ga0224712_10252712 | 3300022467 | Bacteria | 815 |
| 683 | Ga0224712_10272665 | 3300022467 | Bacteria | 786 |
| 684 | Ga0224712_10513828 | 3300022467 | Bacteria | 580 |
| 685 | Ga0207656_10097780 | 3300025321 | Bacteria | 1342 |
| 686 | Ga0207656_10181829 | 3300025321 | Bacteria | 1009 |
| 687 | Ga0207656_10191995 | 3300025321 | Bacteria | 984 |
| 688 | Ga0207653_10082305 | 3300025885 | Bacteria | 1116 |
| 689 | Ga0207653_10129988 | 3300025885 | Bacteria | 913 |
| 690 | Ga0207682_10298166 | 3300025893 | Bacteria | 755 |
| 691 | Ga0207692_10005017 | 3300025898 | Bacteria | 5270 |
| 692 | Ga0207692_10026725 | 3300025898 | Bacteria | 2710 |
| 693 | Ga0207692_10039662 | 3300025898 | Bacteria | 2319 |
| 694 | Ga0207692_10162735 | 3300025898 | Bacteria | 1287 |
| 695 | Ga0207642_10064228 | 3300025899 | Bacteria | 1720 |
| 696 | Ga0207642_10154536 | 3300025899 | Bacteria | 1225 |
| 697 | Ga0207642_10263796 | 3300025899 | Bacteria | 983 |
| 698 | Ga0207710_10004294 | 3300025900 | Bacteria | 6241 |
| 699 | Ga0207710_10069288 | 3300025900 | Bacteria | 1615 |
| 700 | Ga0207710_10400064 | 3300025900 | Bacteria | 705 |
| 701 | Ga0207688_10001159 | 3300025901 | Bacteria | 13577 |
| 702 | Ga0207688_10003298 | 3300025901 | Bacteria | 8817 |
| 703 | Ga0207688_10042994 | 3300025901 | Bacteria | 2515 |
| 704 | Ga0207688_10127394 | 3300025901 | Bacteria | 1490 |
| 705 | Ga0207688_10537841 | 3300025901 | Bacteria | 734 |
| 706 | Ga0207680_10047203 | 3300025903 | Bacteria | 2551 |
| 707 | Ga0207680_10522776 | 3300025903 | Bacteria | 846 |
| 708 | Ga0207647_10107907 | 3300025904 | Bacteria | 1647 |
| 709 | Ga0207647_10132804 | 3300025904 | Bacteria | 1462 |
| 710 | Ga0207647_10177455 | 3300025904 | Bacteria | 1239 |
| 711 | Ga0207647_10291056 | 3300025904 | Bacteria | 931 |
| 712 | Ga0207647_10350024 | 3300025904 | Bacteria | 836 |
| 713 | Ga0207647_10401794 | 3300025904 | Bacteria | 772 |
| 714 | Ga0207647_10502044 | 3300025904 | Bacteria | 676 |
| 715 | Ga0207685_10020620 | 3300025905 | Bacteria | 2195 |
| 716 | Ga0207685_10131484 | 3300025905 | Bacteria | 1111 |
| 717 | Ga0207699_10001668 | 3300025906 | Bacteria | 10536 |
| 718 | Ga0207699_10021552 | 3300025906 | Bacteria | 3475 |
| 719 | Ga0207699_10095716 | 3300025906 | Bacteria | 1873 |
| 720 | Ga0207699_10129509 | 3300025906 | Bacteria | 1644 |
| 721 | Ga0207699_10370112 | 3300025906 | Bacteria | 1015 |
| 722 | Ga0207645_10039213 | 3300025907 | Bacteria | 3035 |
| 723 | Ga0207643_10001355 | 3300025908 | Bacteria | 14144 |
| 724 | Ga0207643_10014701 | 3300025908 | Bacteria | 4256 |
| 725 | Ga0207643_10175640 | 3300025908 | Bacteria | 1294 |
| 726 | Ga0207643_10523333 | 3300025908 | Bacteria | 760 |
| 727 | Ga0207643_10545745 | 3300025908 | Bacteria | 743 |
| 728 | Ga0207705_10000671 | 3300025909 | Bacteria | 28465 |
| 729 | Ga0207705_10027743 | 3300025909 | Bacteria | 4038 |
| 730 | Ga0207705_10216281 | 3300025909 | Bacteria | 1454 |
| 731 | Ga0207705_10226135 | 3300025909 | Bacteria | 1422 |
| 732 | Ga0207705_10354451 | 3300025909 | Bacteria | 1131 |
| 733 | Ga0207705_10464917 | 3300025909 | Bacteria | 981 |
| 734 | Ga0207684_10177547 | 3300025910 | Bacteria | 1836 |
| 735 | Ga0207684_11152632 | 3300025910 | Bacteria | 643 |
| 736 | Ga0207654_10220234 | 3300025911 | Bacteria | 1259 |
| 737 | Ga0207654_10452981 | 3300025911 | Bacteria | 900 |
| 738 | Ga0207707_10001257 | 3300025912 | Bacteria | 23769 |
| 739 | Ga0207707_10006511 | 3300025912 | Bacteria | 10199 |
| 740 | Ga0207707_10008073 | 3300025912 | Bacteria | 9140 |
| 741 | Ga0207707_10121849 | 3300025912 | Bacteria | 2280 |
| 742 | Ga0207707_10717986 | 3300025912 | Bacteria | 838 |
| 743 | Ga0207707_10942357 | 3300025912 | Bacteria | 711 |
| 744 | Ga0207707_11268091 | 3300025912 | Bacteria | 593 |
| 745 | Ga0207695_10115359 | 3300025913 | Bacteria | 2660 |
| 746 | Ga0207695_10697384 | 3300025913 | Bacteria | 896 |
| 747 | Ga0207695_10814538 | 3300025913 | Bacteria | 814 |
| 748 | Ga0207671_10071765 | 3300025914 | Bacteria | 2583 |
| 749 | Ga0207671_10130693 | 3300025914 | Bacteria | 1927 |
| 750 | Ga0207671_10153860 | 3300025914 | Bacteria | 1778 |
| 751 | Ga0207671_10767961 | 3300025914 | Bacteria | 765 |
| 752 | Ga0207671_11468956 | 3300025914 | Bacteria | 527 |
| 753 | Ga0207693_10011155 | 3300025915 | Bacteria | 7277 |
| 754 | Ga0207693_10725458 | 3300025915 | Bacteria | 769 |
| 755 | Ga0207663_10060919 | 3300025916 | Bacteria | 2393 |
| 756 | Ga0207663_10110103 | 3300025916 | Bacteria | 1867 |
| 757 | Ga0207663_10111171 | 3300025916 | Bacteria | 1859 |
| 758 | Ga0207663_10204599 | 3300025916 | Bacteria | 1426 |
| 759 | Ga0207663_10806349 | 3300025916 | Bacteria | 748 |
| 760 | Ga0207663_11657398 | 3300025916 | Bacteria | 515 |
| 761 | Ga0207663_11677928 | 3300025916 | Bacteria | 511 |
| 762 | Ga0207663_11752084 | 3300025916 | Bacteria | 500 |
| 763 | Ga0207660_10000562 | 3300025917 | Bacteria | 24961 |
| 764 | Ga0207660_10004961 | 3300025917 | Bacteria | 8672 |
| 765 | Ga0207660_10053168 | 3300025917 | Bacteria | 2885 |
| 766 | Ga0207660_10155588 | 3300025917 | Bacteria | 1759 |
| 767 | Ga0207660_10848599 | 3300025917 | Bacteria | 745 |
| 768 | Ga0207662_10002882 | 3300025918 | Bacteria | 8712 |
| 769 | Ga0207657_10001387 | 3300025919 | Bacteria | 25846 |
| 770 | Ga0207657_10177471 | 3300025919 | Bacteria | 1723 |
| 771 | Ga0207657_10290547 | 3300025919 | Bacteria | 1296 |
| 772 | Ga0207657_10369061 | 3300025919 | Bacteria | 1131 |
| 773 | Ga0207657_10547404 | 3300025919 | Bacteria | 905 |
| 774 | Ga0207649_10155879 | 3300025920 | Bacteria | 1578 |
| 775 | Ga0207649_10330176 | 3300025920 | Bacteria | 1123 |
| 776 | Ga0207649_10478211 | 3300025920 | Bacteria | 944 |
| 777 | Ga0207652_10000632 | 3300025921 | Bacteria | 34827 |
| 778 | Ga0207652_10005398 | 3300025921 | Bacteria | 10371 |
| 779 | Ga0207652_10061156 | 3300025921 | Bacteria | 3251 |
| 780 | Ga0207652_10531151 | 3300025921 | Bacteria | 1058 |
| 781 | Ga0207652_10837371 | 3300025921 | Bacteria | 815 |
| 782 | Ga0207646_10082391 | 3300025922 | Bacteria | 2877 |
| 783 | Ga0207646_10089945 | 3300025922 | Bacteria | 2748 |
| 784 | Ga0207681_10889624 | 3300025923 | Bacteria | 745 |
| 785 | Ga0207681_11803394 | 3300025923 | Bacteria | 510 |
| 786 | Ga0207694_10278016 | 3300025924 | Bacteria | 1375 |
| 787 | Ga0207694_10282726 | 3300025924 | Bacteria | 1363 |
| 788 | Ga0207694_10405590 | 3300025924 | Bacteria | 1134 |
| 789 | Ga0207694_10493274 | 3300025924 | Bacteria | 1025 |
| 790 | Ga0207694_10772435 | 3300025924 | Bacteria | 811 |
| 791 | Ga0207650_10979736 | 3300025925 | Bacteria | 719 |
| 792 | Ga0207659_10117802 | 3300025926 | Bacteria | 2030 |
| 793 | Ga0207659_10118329 | 3300025926 | Bacteria | 2026 |
| 794 | Ga0207659_10141498 | 3300025926 | Bacteria | 1868 |
| 795 | Ga0207687_10005166 | 3300025927 | Bacteria | 8656 |
| 796 | Ga0207687_10104213 | 3300025927 | Bacteria | 2093 |
| 797 | Ga0207687_10176039 | 3300025927 | Bacteria | 1654 |
| 798 | Ga0207687_10346630 | 3300025927 | Bacteria | 1209 |
| 799 | Ga0207687_10953729 | 3300025927 | Bacteria | 735 |
| 800 | Ga0207700_10007511 | 3300025928 | Bacteria | 6668 |
| 801 | Ga0207700_10010456 | 3300025928 | Bacteria | 5857 |
| 802 | Ga0207700_10047227 | 3300025928 | Bacteria | 3190 |
| 803 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 804 | Ga0207664_10003003 | 3300025929 | Bacteria | 11208 |
| 805 | Ga0207664_10040828 | 3300025929 | Bacteria | 3611 |
| 806 | Ga0207664_10081228 | 3300025929 | Bacteria | 2637 |
| 807 | Ga0207664_10283965 | 3300025929 | Bacteria | 1453 |
| 808 | Ga0207664_10480679 | 3300025929 | Bacteria | 1111 |
| 809 | Ga0207644_10022904 | 3300025931 | Bacteria | 4271 |
| 810 | Ga0207644_10190213 | 3300025931 | Bacteria | 1613 |
| 811 | Ga0207644_10622978 | 3300025931 | Bacteria | 897 |
| 812 | Ga0207690_10087503 | 3300025932 | Bacteria | 2192 |
| 813 | Ga0207690_10129601 | 3300025932 | Bacteria | 1844 |
| 814 | Ga0207690_10287156 | 3300025932 | Bacteria | 1283 |
| 815 | Ga0207690_10689245 | 3300025932 | Bacteria | 839 |
| 816 | Ga0207706_10046783 | 3300025933 | Bacteria | 3830 |
| 817 | Ga0207706_10149626 | 3300025933 | Bacteria | 2053 |
| 818 | Ga0207706_10509293 | 3300025933 | Bacteria | 1038 |
| 819 | Ga0207686_10102386 | 3300025934 | Bacteria | 1914 |
| 820 | Ga0207686_10407312 | 3300025934 | Bacteria | 1037 |
| 821 | Ga0207686_10515868 | 3300025934 | Bacteria | 929 |
| 822 | Ga0207686_10849427 | 3300025934 | Bacteria | 734 |
| 823 | Ga0207709_10000305 | 3300025935 | Bacteria | 53275 |
| 824 | Ga0207709_10005029 | 3300025935 | Bacteria | 7555 |
| 825 | Ga0207709_10104660 | 3300025935 | Bacteria | 1879 |
| 826 | Ga0207709_10127337 | 3300025935 | Bacteria | 1730 |
| 827 | Ga0207709_10919582 | 3300025935 | Bacteria | 712 |
| 828 | Ga0207670_10022974 | 3300025936 | Bacteria | 3874 |
| 829 | Ga0207670_10043292 | 3300025936 | Bacteria | 2972 |
| 830 | Ga0207670_10491524 | 3300025936 | Bacteria | 995 |
| 831 | Ga0207670_10954177 | 3300025936 | Bacteria | 720 |
| 832 | Ga0207670_11503418 | 3300025936 | Bacteria | 572 |
| 833 | Ga0207669_10006873 | 3300025937 | Bacteria | 5232 |
| 834 | Ga0207669_10063775 | 3300025937 | Bacteria | 2276 |
| 835 | Ga0207669_10118183 | 3300025937 | Bacteria | 1793 |
| 836 | Ga0207669_10734396 | 3300025937 | Bacteria | 814 |
| 837 | Ga0207669_10756249 | 3300025937 | Bacteria | 803 |
| 838 | Ga0207669_11304185 | 3300025937 | Bacteria | 617 |
| 839 | Ga0207669_11889428 | 3300025937 | Bacteria | 510 |
| 840 | Ga0207704_10439993 | 3300025938 | Bacteria | 1038 |
| 841 | Ga0207704_10626228 | 3300025938 | Bacteria | 884 |
| 842 | Ga0207704_11489114 | 3300025938 | Bacteria | 581 |
| 843 | Ga0207704_11619242 | 3300025938 | Bacteria | 556 |
| 844 | Ga0207665_10402902 | 3300025939 | Bacteria | 1042 |
| 845 | Ga0207665_10692753 | 3300025939 | Bacteria | 801 |
| 846 | Ga0207665_10995262 | 3300025939 | Bacteria | 667 |
| 847 | Ga0207691_10003431 | 3300025940 | Bacteria | 15416 |
| 848 | Ga0207691_10489215 | 3300025940 | Bacteria | 1045 |
| 849 | Ga0207691_10734719 | 3300025940 | Bacteria | 831 |
| 850 | Ga0207711_10224387 | 3300025941 | Bacteria | 1719 |
| 851 | Ga0207711_10542923 | 3300025941 | Bacteria | 1084 |
| 852 | Ga0207689_10002936 | 3300025942 | Bacteria | 15743 |
| 853 | Ga0207689_10173846 | 3300025942 | Bacteria | 1776 |
| 854 | Ga0207689_10281438 | 3300025942 | Bacteria | 1377 |
| 855 | Ga0207661_10050176 | 3300025944 | Bacteria | 3323 |
| 856 | Ga0207661_10104106 | 3300025944 | Bacteria | 2389 |
| 857 | Ga0207661_10109515 | 3300025944 | Bacteria | 2333 |
| 858 | Ga0207661_10187724 | 3300025944 | Bacteria | 1810 |
| 859 | Ga0207661_10402489 | 3300025944 | Bacteria | 1241 |
| 860 | Ga0207661_10542623 | 3300025944 | Bacteria | 1065 |
| 861 | Ga0207661_11488934 | 3300025944 | Bacteria | 620 |
| 862 | Ga0207679_10087528 | 3300025945 | Bacteria | 2399 |
| 863 | Ga0207679_10635713 | 3300025945 | Bacteria | 964 |
| 864 | Ga0207667_10053296 | 3300025949 | Bacteria | 4257 |
| 865 | Ga0207667_10748206 | 3300025949 | Bacteria | 977 |
| 866 | Ga0207667_11781227 | 3300025949 | Bacteria | 580 |
| 867 | Ga0207667_11869828 | 3300025949 | Bacteria | 563 |
| 868 | Ga0207651_10259888 | 3300025960 | Bacteria | 1425 |
| 869 | Ga0207651_10276475 | 3300025960 | Bacteria | 1386 |
| 870 | Ga0207651_10608015 | 3300025960 | Bacteria | 956 |
| 871 | Ga0207651_10700077 | 3300025960 | Bacteria | 892 |
| 872 | Ga0207651_10775105 | 3300025960 | Bacteria | 849 |
| 873 | Ga0207712_10093206 | 3300025961 | Bacteria | 2222 |
| 874 | Ga0207712_10213239 | 3300025961 | Bacteria | 1539 |
| 875 | Ga0207668_10001244 | 3300025972 | Bacteria | 15180 |
| 876 | Ga0207668_10029372 | 3300025972 | Bacteria | 3603 |
| 877 | Ga0207668_10104040 | 3300025972 | Bacteria | 2115 |
| 878 | Ga0207668_10507411 | 3300025972 | Bacteria | 1038 |
| 879 | Ga0207668_10760224 | 3300025972 | Bacteria | 855 |
| 880 | Ga0207640_10110526 | 3300025981 | Bacteria | 1947 |
| 881 | Ga0207640_10129601 | 3300025981 | Bacteria | 1821 |
| 882 | Ga0207640_10336272 | 3300025981 | Bacteria | 1208 |
| 883 | Ga0207640_11804026 | 3300025981 | Bacteria | 553 |
| 884 | Ga0207658_10017892 | 3300025986 | Bacteria | 4885 |
| 885 | Ga0207658_10088255 | 3300025986 | Bacteria | 2397 |
| 886 | Ga0207658_10417015 | 3300025986 | Bacteria | 1183 |
| 887 | Ga0207658_10960136 | 3300025986 | Bacteria | 779 |
| 888 | Ga0207658_11075147 | 3300025986 | Bacteria | 735 |
| 889 | Ga0207677_10296380 | 3300026023 | Bacteria | 1334 |
| 890 | Ga0207677_10510942 | 3300026023 | Bacteria | 1041 |
| 891 | Ga0207677_10594683 | 3300026023 | Bacteria | 970 |
| 892 | Ga0207677_10724953 | 3300026023 | Bacteria | 884 |
| 893 | Ga0207677_11839907 | 3300026023 | Bacteria | 562 |
| 894 | Ga0207703_10094586 | 3300026035 | Bacteria | 2520 |
| 895 | Ga0207639_10140158 | 3300026041 | Bacteria | 2013 |
| 896 | Ga0207639_10307407 | 3300026041 | Bacteria | 1403 |
| 897 | Ga0207639_10508431 | 3300026041 | Bacteria | 1102 |
| 898 | Ga0207639_11572563 | 3300026041 | Bacteria | 617 |
| 899 | Ga0207639_12112016 | 3300026041 | Bacteria | 524 |
| 900 | Ga0207678_10000929 | 3300026067 | Bacteria | 26706 |
| 901 | Ga0207678_10002587 | 3300026067 | Bacteria | 16500 |
| 902 | Ga0207678_10012875 | 3300026067 | Bacteria | 7342 |
| 903 | Ga0207678_10134885 | 3300026067 | Bacteria | 2106 |
| 904 | Ga0207678_10163083 | 3300026067 | Bacteria | 1903 |
| 905 | Ga0207678_10329902 | 3300026067 | Bacteria | 1313 |
| 906 | Ga0207678_10591157 | 3300026067 | Bacteria | 973 |
| 907 | Ga0207678_10608458 | 3300026067 | Bacteria | 958 |
| 908 | Ga0207708_10000030 | 3300026075 | Bacteria | 157064 |
| 909 | Ga0207708_10002425 | 3300026075 | Bacteria | 13693 |
| 910 | Ga0207708_10474917 | 3300026075 | Bacteria | 1045 |
| 911 | Ga0207708_10612653 | 3300026075 | Bacteria | 923 |
| 912 | Ga0207708_12051222 | 3300026075 | Bacteria | 501 |
| 913 | Ga0207702_10003344 | 3300026078 | Bacteria | 14708 |
| 914 | Ga0207702_10593991 | 3300026078 | Bacteria | 1086 |
| 915 | Ga0207702_10628748 | 3300026078 | Bacteria | 1055 |
| 916 | Ga0207702_10914466 | 3300026078 | Bacteria | 869 |
| 917 | Ga0207702_10937072 | 3300026078 | Bacteria | 858 |
| 918 | Ga0207702_12126807 | 3300026078 | Bacteria | 551 |
| 919 | Ga0207641_10000478 | 3300026088 | Bacteria | 45330 |
| 920 | Ga0207641_10012413 | 3300026088 | Bacteria | 6984 |
| 921 | Ga0207641_10100925 | 3300026088 | Bacteria | 2542 |
| 922 | Ga0207641_10587032 | 3300026088 | Bacteria | 1090 |
| 923 | Ga0207648_10007281 | 3300026089 | Bacteria | 10910 |
| 924 | Ga0207648_10133353 | 3300026089 | Bacteria | 2187 |
| 925 | Ga0207648_10334848 | 3300026089 | Bacteria | 1362 |
| 926 | Ga0207648_10843133 | 3300026089 | Bacteria | 855 |
| 927 | Ga0207676_10074155 | 3300026095 | Bacteria | 2740 |
| 928 | Ga0207676_10080647 | 3300026095 | Bacteria | 2642 |
| 929 | Ga0207676_10434265 | 3300026095 | Bacteria | 1234 |
| 930 | Ga0207676_11252210 | 3300026095 | Bacteria | 736 |
| 931 | Ga0207674_10006508 | 3300026116 | Bacteria | 13736 |
| 932 | Ga0207674_10070710 | 3300026116 | Bacteria | 3509 |
| 933 | Ga0207675_100003879 | 3300026118 | Bacteria | 14536 |
| 934 | Ga0207675_100010883 | 3300026118 | Bacteria | 8521 |
| 935 | Ga0207675_100396136 | 3300026118 | Bacteria | 1360 |
| 936 | Ga0207675_100498663 | 3300026118 | Bacteria | 1212 |
| 937 | Ga0207675_101338561 | 3300026118 | Bacteria | 737 |
| 938 | Ga0207683_10002849 | 3300026121 | Bacteria | 15092 |
| 939 | Ga0207683_10074864 | 3300026121 | Bacteria | 2996 |
| 940 | Ga0207683_10111118 | 3300026121 | Bacteria | 2454 |
| 941 | Ga0207683_10126952 | 3300026121 | Bacteria | 2292 |
| 942 | Ga0207683_10176704 | 3300026121 | Bacteria | 1935 |
| 943 | Ga0207683_10683415 | 3300026121 | Bacteria | 951 |
| 944 | Ga0207683_10693507 | 3300026121 | Bacteria | 944 |
| 945 | Ga0207683_10995746 | 3300026121 | Bacteria | 778 |
| 946 | Ga0207683_11764047 | 3300026121 | Bacteria | 568 |
| 947 | Ga0207698_10005035 | 3300026142 | Bacteria | 8104 |
| 948 | Ga0207698_10072778 | 3300026142 | Bacteria | 2733 |
| 949 | Ga0207698_11140528 | 3300026142 | Bacteria | 793 |
| 950 | Ga0265355_1007915 | 3300028036 | Bacteria | 846 |
| 951 | Ga0268266_10006407 | 3300028379 | Bacteria | 10787 |
| 952 | Ga0268266_10021808 | 3300028379 | Bacteria | 5456 |
| 953 | Ga0268266_10073860 | 3300028379 | Bacteria | 2960 |
| 954 | Ga0268266_10232699 | 3300028379 | Bacteria | 1697 |
| 955 | Ga0268266_10508208 | 3300028379 | Bacteria | 1151 |
| 956 | Ga0268266_10571329 | 3300028379 | Bacteria | 1085 |
| 957 | Ga0268266_11662362 | 3300028379 | Bacteria | 614 |
| 958 | Ga0268266_12384300 | 3300028379 | Bacteria | 500 |
| 959 | Ga0268265_10217831 | 3300028380 | Bacteria | 1668 |
| 960 | Ga0268265_10597590 | 3300028380 | Bacteria | 1054 |
| 961 | Ga0268265_11399771 | 3300028380 | Bacteria | 701 |
| 962 | Ga0268265_11520162 | 3300028380 | Bacteria | 673 |
| 963 | Ga0268265_12487598 | 3300028380 | Bacteria | 524 |
| 964 | Ga0268264_10000097 | 3300028381 | Bacteria | 229722 |
| 965 | Ga0268264_10013159 | 3300028381 | Bacteria | 6805 |
| 966 | Ga0268264_10102783 | 3300028381 | Bacteria | 2487 |
| 967 | Ga0268264_10471038 | 3300028381 | Bacteria | 1220 |
| 968 | Ga0307515_10193296 | 3300028794 | Bacteria | 1937 |
| 969 | Ga0265338_10089548 | 3300028800 | Bacteria | 2549 |
| 970 | Ga0265338_10304734 | 3300028800 | Bacteria | 1157 |
| 971 | Ga0265338_10986840 | 3300028800 | Bacteria | 571 |
| 972 | Ga0310981_1087667 | 3300029285 | Bacteria | 906 |
| 973 | Ga0307511_10115089 | 3300030521 | Bacteria | 1691 |
| 974 | Ga0307512_10086539 | 3300030522 | Bacteria | 2214 |
| 975 | Ga0316182_1005526 | 3300030745 | Bacteria | 728 |
| 976 | Ga0265775_102055 | 3300030762 | Bacteria | 1017 |
| 977 | Ga0265775_104385 | 3300030762 | Bacteria | 792 |
| 978 | Ga0265763_1000738 | 3300030763 | Bacteria | 2129 |
| 979 | Ga0265763_1040469 | 3300030763 | Bacteria | 560 |
| 980 | Ga0265766_1011257 | 3300030863 | Bacteria | 648 |
| 981 | Ga0265764_105138 | 3300030882 | Bacteria | 728 |
| 982 | Ga0265769_101293 | 3300030888 | Bacteria | 1175 |
| 983 | Ga0265761_103183 | 3300030889 | Bacteria | 797 |
| 984 | Ga0265773_1012166 | 3300031018 | Bacteria | 750 |
| 985 | Ga0265779_103758 | 3300031043 | Bacteria | 785 |
| 986 | Ga0265760_10181673 | 3300031090 | Bacteria | 703 |
| 987 | Ga0265328_10034011 | 3300031239 | Bacteria | 1888 |
| 988 | Ga0265325_10136111 | 3300031241 | Bacteria | 1172 |
| 989 | Ga0265325_10301924 | 3300031241 | Bacteria | 714 |
| 990 | Ga0265340_10020369 | 3300031247 | Bacteria | 3409 |
| 991 | Ga0265340_10022026 | 3300031247 | Bacteria | 3261 |
| 992 | Ga0265339_10126373 | 3300031249 | Bacteria | 1310 |
| 993 | Ga0265339_10321347 | 3300031249 | Bacteria | 734 |
| 994 | Ga0265331_10047396 | 3300031250 | Bacteria | 2068 |
| 995 | Ga0265327_10000004 | 3300031251 | Bacteria | 803973 |
| 996 | Ga0265327_10000532 | 3300031251 | Bacteria | 65543 |
| 997 | Ga0265316_10222988 | 3300031344 | Bacteria | 1390 |
| 998 | Ga0307513_10863617 | 3300031456 | Bacteria | 611 |
| 999 | Ga0307509_10118846 | 3300031507 | Bacteria | 2625 |
| 1000 | Ga0310117_117420 | 3300031592 | Bacteria | 732 |
| 1001 | Ga0265313_10062846 | 3300031595 | Bacteria | 1733 |
| 1002 | Ga0310107_126959 | 3300031615 | Bacteria | 654 |
| 1003 | Ga0265314_10041461 | 3300031711 | Bacteria | 3295 |
| 1004 | Ga0265342_10086654 | 3300031712 | Bacteria | 1800 |
| 1005 | Ga0316576_10006920 | 3300031727 | Bacteria | 7091 |
| 1006 | Ga0316576_10071235 | 3300031727 | Bacteria | 2564 |
| 1007 | Ga0316576_10123294 | 3300031727 | Bacteria | 1947 |
| 1008 | Ga0316576_10290360 | 3300031727 | Bacteria | 1223 |
| 1009 | Ga0316578_10222609 | 3300031728 | Bacteria | 1134 |
| 1010 | Ga0307405_10006223 | 3300031731 | Bacteria | 5849 |
| 1011 | Ga0307405_10696521 | 3300031731 | Bacteria | 841 |
| 1012 | Ga0307405_11059571 | 3300031731 | Bacteria | 695 |
| 1013 | Ga0307405_11115298 | 3300031731 | Bacteria | 679 |
| 1014 | Ga0307405_11403736 | 3300031731 | Bacteria | 611 |
| 1015 | Ga0307405_11949736 | 3300031731 | Bacteria | 525 |
| 1016 | Ga0307413_10169880 | 3300031824 | Bacteria | 1542 |
| 1017 | Ga0307413_11585277 | 3300031824 | Bacteria | 581 |
| 1018 | Ga0307518_10016411 | 3300031838 | Bacteria | 5307 |
| 1019 | Ga0307410_10565557 | 3300031852 | Bacteria | 944 |
| 1020 | Ga0307410_10604991 | 3300031852 | Bacteria | 915 |
| 1021 | Ga0307410_11914898 | 3300031852 | Bacteria | 528 |
| 1022 | Ga0307406_10144961 | 3300031901 | Bacteria | 1686 |
| 1023 | Ga0307407_10238165 | 3300031903 | Bacteria | 1240 |
| 1024 | Ga0307407_10259715 | 3300031903 | Bacteria | 1194 |
| 1025 | Ga0307407_10792027 | 3300031903 | Bacteria | 720 |
| 1026 | Ga0307407_10941070 | 3300031903 | Bacteria | 665 |
| 1027 | Ga0307407_11635889 | 3300031903 | Bacteria | 512 |
| 1028 | Ga0307412_10064406 | 3300031911 | Bacteria | 2477 |
| 1029 | Ga0307412_10336182 | 3300031911 | Bacteria | 1207 |
| 1030 | Ga0307409_100902359 | 3300031995 | Bacteria | 897 |
| 1031 | Ga0307409_102330774 | 3300031995 | Bacteria | 565 |
| 1032 | Ga0307416_100079924 | 3300032002 | Bacteria | 2758 |
| 1033 | Ga0307416_100725009 | 3300032002 | Bacteria | 1085 |
| 1034 | Ga0307416_100759765 | 3300032002 | Bacteria | 1063 |
| 1035 | Ga0307414_12254754 | 3300032004 | Bacteria | 508 |
| 1036 | Ga0307411_10529935 | 3300032005 | Bacteria | 1001 |
| 1037 | Ga0307411_10592318 | 3300032005 | Bacteria | 952 |
| 1038 | Ga0307415_100099997 | 3300032126 | Bacteria | 2124 |
| 1039 | Ga0307415_100158134 | 3300032126 | Bacteria | 1753 |
| 1040 | Ga0316583_10130276 | 3300032133 | Bacteria | 877 |
| 1041 | Ga0316580_10219549 | 3300032139 | Bacteria | 586 |
| 1042 | Ga0316593_10009690 | 3300032168 | Bacteria | 2731 |
| 1043 | Ga0316593_10108458 | 3300032168 | Bacteria | 990 |
| 1044 | Ga0307510_10019413 | 3300033180 | Bacteria | 7973 |
| 1045 | Ga0316592_1007426 | 3300033524 | Bacteria | 2142 |
| 1046 | Ga0316592_1043955 | 3300033524 | Bacteria | 992 |
| 1047 | Ga0316592_1056390 | 3300033524 | Bacteria | 879 |
| 1048 | Ga0316596_1000140 | 3300033541 | Bacteria | 9866 |
| 1049 | Ga0316596_1006375 | 3300033541 | Bacteria | 2742 |
| 1050 | Ga0373930_0011251 | 3300034816 | Bacteria | 1613 |
| 1051 | Ga0373948_0028084 | 3300034817 | Bacteria | 1118 |
| 1052 | Ga0373950_0020903 | 3300034818 | Bacteria | 1154 |
| 1053 | Ga0373950_0093089 | 3300034818 | Bacteria | 642 |
| 1054 | Ga0373938_0092642 | 3300034957 | Bacteria | 750 |
| 1055 | Ga0373926_0017223 | 3300035083 | Bacteria | 2478 |
| 1056 | Ga0373928_0069499 | 3300035084 | Bacteria | 867 |
| 1057 | Ga0373929_0175187 | 3300035085 | Bacteria | 588 |
| 1058 | Ga0373934_0007912 | 3300035086 | Bacteria | 3955 |
| 1059 | Ga0373934_0033978 | 3300035086 | Bacteria | 2003 |
| 1060 | Ga0373940_0051015 | 3300035088 | Bacteria | 1162 |
| 1061 | Ga0373944_0106580 | 3300035089 | Bacteria | 952 |
| 1062 | Ga0373949_0014280 | 3300035090 | Bacteria | 1767 |
| 1063 | Ga0373952_0011022 | 3300035092 | Bacteria | 1757 |
| 1064 | Ga0373923_0013637 | 3300035111 | Bacteria | 3033 |
| 1065 | Ga0373923_0187403 | 3300035111 | Bacteria | 952 |
| 1066 | Ga0373932_0009133 | 3300035112 | Bacteria | 2378 |
| 1067 | Ga0373936_0018900 | 3300035113 | Bacteria | 2666 |
| 1068 | Ga0373936_0037173 | 3300035113 | Bacteria | 1943 |
| 1069 | Ga0373939_0040331 | 3300035114 | Bacteria | 1402 |
| 1070 | Ga0373939_0045832 | 3300035114 | Bacteria | 1336 |
| 1071 | Ga0373941_0174177 | 3300035115 | Bacteria | 803 |
| 1072 | Ga0373945_0016245 | 3300035116 | Bacteria | 2507 |
| 1073 | Ga0373953_0004941 | 3300035117 | Bacteria | 4291 |
| 1074 | Ga0373953_0083777 | 3300035117 | Bacteria | 1328 |
| 1075 | Ga0373953_0509671 | 3300035117 | Bacteria | 533 |
| 1076 | Ga0373954_0048565 | 3300035118 | Bacteria | 1988 |
| 1077 | Ga0373956_0003612 | 3300035119 | Bacteria | 6243 |
| 1078 | Ga0373956_0008114 | 3300035119 | Bacteria | 4249 |
| 1079 | Ga0373956_0013875 | 3300035119 | Bacteria | 3356 |
| 1080 | Ga0373957_0001036 | 3300035120 | Bacteria | 7312 |
| 1081 | Ga0373957_0005448 | 3300035120 | Bacteria | 3943 |
| 1082 | Ga0373957_0113916 | 3300035120 | Bacteria | 1091 |
| 1083 | Ga0373943_0021734 | 3300035170 | Bacteria | 2965 |
| 1084 | Ga0373943_0262098 | 3300035170 | Bacteria | 973 |
| 1085 | Ga0373946_0009470 | 3300035171 | Bacteria | 3589 |
| 1086 | Ga0373946_0500664 | 3300035171 | Bacteria | 623 |
| 1087 | Ga0373955_0138702 | 3300035172 | Bacteria | 1424 |
| 1088 | Ga0373955_0322328 | 3300035172 | Bacteria | 933 |
| 1089 | Ga0373942_0032481 | 3300035207 | Bacteria | 1386 |
| 1090 | Ga0373942_0060545 | 3300035207 | Bacteria | 1084 |
| 1091 | Ga0373961_0061853 | 3300035241 | Bacteria | 1138 |
| 1092 | Ga0316574_0178719 | 3300035398 | Bacteria | 1365 |
| 1093 | Ga0316574_0431488 | 3300035398 | Bacteria | 827 |
| 1094 | Ga0373924_0013498 | 3300035410 | Bacteria | 3070 |
| 1095 | Ga0373924_0051899 | 3300035410 | Bacteria | 1701 |
| 1096 | Ga0373924_0154129 | 3300035410 | Bacteria | 1006 |
| 1097 | Ga0373931_0101770 | 3300035691 | Bacteria | 1617 |
| 1098 | Ga0373931_0319446 | 3300035691 | Bacteria | 964 |
| 1099 | Ga0373935_0046761 | 3300035692 | Bacteria | 2734 |
| 1100 | Ga0373935_0060354 | 3300035692 | Bacteria | 2425 |
| 1101 | Ga0373927_0013458 | 3300035695 | Bacteria | 5436 |
| 1102 | Ga0373927_0337418 | 3300035695 | Bacteria | 993 |
| 1103 | Ga0373933_0068897 | 3300035724 | Bacteria | 2149 |
| 1104 | Ga0373933_0090081 | 3300035724 | Bacteria | 1891 |
| 1105 | Ga0373947_0034342 | 3300035725 | Bacteria | 2998 |
| 1106 | Ga0310104_10746 | 3300036242 | Bacteria | 740 |
| 1107 | Ga0373937_0091252 | 3300036401 | Bacteria | 2822 |
| 1108 | Ga0373937_0342156 | 3300036401 | Bacteria | 1416 |
| 1109 | Ga0373937_1470515 | 3300036401 | Bacteria | 629 |
| 1110 | Ga0372808_032497 | 3300036459 | Bacteria | 748 |
| 1111 | Ga0372808_054548 | 3300036459 | Bacteria | 573 |
| 1112 | Ga0316582_0520082 | 3300036647 | Bacteria | 820 |
| 1113 | Ga0316584_0009403 | 3300036712 | Bacteria | 6785 |
| 1114 | Ga0316584_0112590 | 3300036712 | Bacteria | 2036 |
| 1115 | Ga0316584_0127940 | 3300036712 | Bacteria | 1897 |
| 1116 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 1117 | Ga0373925_0065617 | 3300037068 | Bacteria | 2734 |
| 1118 | Ga0373925_0085471 | 3300037068 | Bacteria | 2405 |
| 1119 | Ga0373925_0991680 | 3300037068 | Bacteria | 692 |
| 1120 | Ga0373925_1773439 | 3300037068 | Bacteria | 504 |
| 1121 | Ga0395899_0004964 | 3300037312 | Bacteria | 10353 |
| 1122 | Ga0395899_0331641 | 3300037312 | Bacteria | 1022 |
| 1123 | Ga0395899_0587271 | 3300037312 | Bacteria | 711 |
| 1124 | Ga0395900_0013704 | 3300037418 | Bacteria | 8276 |
| 1125 | Ga0395900_0215391 | 3300037418 | Bacteria | 1938 |
| 1126 | Ga0395900_0437593 | 3300037418 | Bacteria | 1266 |
| 1127 | Ga0395900_1499602 | 3300037418 | Bacteria | 586 |
| 1128 | Ga0395898_0036774 | 3300037466 | Bacteria | 4860 |
| 1129 | Ga0395898_0965927 | 3300037466 | Bacteria | 789 |
| 1130 | Ga0395905_0065150 | 3300037471 | Bacteria | 3411 |
| 1131 | Ga0316581_0286595 | 3300037588 | Bacteria | 506 |
| 1132 | Ga0436364_0401206 | 3300037853 | Bacteria | 5037 |
| 1133 | Ga0436364_0487881 | 3300037853 | Bacteria | 567 |
| 1134 | Ga0436364_0508850 | 3300037853 | Bacteria | 1732 |
| 1135 | Ga0436364_0520200 | 3300037853 | Bacteria | 1890 |
| 1136 | Ga0436364_0609479 | 3300037853 | Bacteria | 47114 |
| 1137 | Ga0436364_0754979 | 3300037853 | Bacteria | 633 |
| 1138 | Ga0436364_0804097 | 3300037853 | Bacteria | 39998 |
| 1139 | Ga0436364_0844017 | 3300037853 | Bacteria | 1446 |
| 1140 | Ga0436364_0856491 | 3300037853 | Bacteria | 1364 |
| 1141 | Ga0436364_1292141 | 3300037853 | Bacteria | 3544 |
| 1142 | Ga0395901_0156631 | 3300038443 | Bacteria | 2392 |
| 1143 | Ga0436365_0295075 | 3300039437 | Bacteria | 2549 |
| 1144 | Ga0436365_0604975 | 3300039437 | Bacteria | 3469 |
| 1145 | Ga0436365_1560914 | 3300039437 | Bacteria | 1503 |
| 1146 | Ga0436365_1866547 | 3300039437 | Bacteria | 1948 |
| 1147 | Ga0436360_0146467 | 3300039438 | Bacteria | 844 |
| 1148 | Ga0436360_1002306 | 3300039438 | Bacteria | 2030 |
| 1149 | Ga0436363_0531592 | 3300039450 | Bacteria | 568 |
| 1150 | Ga0436363_0713271 | 3300039450 | Bacteria | 1567 |
| 1151 | Ga0436363_1061940 | 3300039450 | Bacteria | 575 |
| 1152 | Ga0436363_1188024 | 3300039450 | Bacteria | 510 |
| 1153 | Ga0436363_1290117 | 3300039450 | Bacteria | 684 |
| 1154 | Ga0436362_0051453 | 3300039453 | Bacteria | 602 |
| 1155 | Ga0436362_1034091 | 3300039453 | Bacteria | 1456 |
| 1156 | Ga0436362_1253162 | 3300039453 | Bacteria | 927 |
| 1157 | Ga0439465_0001503 | 3300041413 | Bacteria | 7562 |
| 1158 | Ga0439465_0224732 | 3300041413 | Bacteria | 689 |
| 1159 | Ga0451787_232286 | 3300041441 | Bacteria | 933 |
| 1160 | Ga0451787_617256 | 3300041441 | Bacteria | 935 |
| 1161 | Ga0451787_783834 | 3300041441 | Bacteria | 1338 |
| 1162 | Ga0451789_0356172 | 3300041443 | Bacteria | 1772 |
| 1163 | Ga0451789_1064070 | 3300041443 | Bacteria | 2207 |
| 1164 | Ga0451790_30083 | 3300041444 | Bacteria | 617 |
| 1165 | Ga0451792_10772 | 3300041445 | Bacteria | 578 |
| 1166 | Ga0451792_14883 | 3300041445 | Bacteria | 587 |
| 1167 | Ga0451794_37396 | 3300041446 | Bacteria | 775 |
| 1168 | Ga0451794_48115 | 3300041446 | Bacteria | 830 |
| 1169 | Ga0451794_50020 | 3300041446 | Bacteria | 797 |
| 1170 | Ga0451794_52070 | 3300041446 | Bacteria | 609 |
| 1171 | Ga0451791_0540367 | 3300041451 | Bacteria | 638 |
| 1172 | Ga0451791_0950749 | 3300041451 | Bacteria | 937 |
| 1173 | Ga0451793_0893875 | 3300041452 | Bacteria | 2492 |
| 1174 | Ga0451793_1809633 | 3300041452 | Bacteria | 569 |
| 1175 | Ga0451797_0934014 | 3300041453 | Bacteria | 610 |
| 1176 | Ga0451797_1097187 | 3300041453 | Bacteria | 629 |
| 1177 | Ga0451797_1162958 | 3300041453 | Bacteria | 831 |
| 1178 | Ga0451795_1158970 | 3300041456 | Bacteria | 716 |
| 1179 | Ga0451795_1175078 | 3300041456 | Bacteria | 907 |
| 1180 | Ga0451795_1286801 | 3300041456 | Bacteria | 618 |
| 1181 | Ga0451798_0310622 | 3300041458 | Bacteria | 1019 |
| 1182 | Ga0451798_0608895 | 3300041458 | Bacteria | 522 |
| 1183 | Ga0451800_0483294 | 3300041459 | Bacteria | 1635 |
| 1184 | Ga0451800_1157504 | 3300041459 | Bacteria | 829 |
| 1185 | Ga0451802_2051750 | 3300041460 | Bacteria | 646 |
| 1186 | Ga0451805_109072 | 3300041461 | Bacteria | 642 |
| 1187 | Ga0451804_0160498 | 3300041463 | Bacteria | 652 |
| 1188 | Ga0451804_0271602 | 3300041463 | Bacteria | 1152 |
| 1189 | Ga0451804_0321468 | 3300041463 | Bacteria | 606 |
| 1190 | Ga0451807_1163869 | 3300041486 | Bacteria | 889 |
| 1191 | Ga0451807_1581569 | 3300041486 | Bacteria | 531 |
| 1192 | Ga0451833_0644812 | 3300041491 | Bacteria | 653 |
| 1193 | Ga0451835_0504333 | 3300041492 | Bacteria | 558 |
| 1194 | Ga0451837_0770417 | 3300041494 | Bacteria | 808 |
| 1195 | Ga0451837_0907669 | 3300041494 | Bacteria | 827 |
| 1196 | Ga0451837_1596043 | 3300041494 | Bacteria | 560 |
| 1197 | Ga0451839_0025401 | 3300041496 | Bacteria | 810 |
| 1198 | Ga0451839_0255728 | 3300041496 | Bacteria | 637 |
| 1199 | Ga0451839_0788412 | 3300041496 | Bacteria | 569 |
| 1200 | Ga0451841_0204057 | 3300041498 | Bacteria | 1376 |
| 1201 | Ga0451841_0559173 | 3300041498 | Bacteria | 2003 |
| 1202 | Ga0451847_0197256 | 3300041503 | Bacteria | 766 |
| 1203 | Ga0451847_0897189 | 3300041503 | Bacteria | 571 |
| 1204 | Ga0451851_0336391 | 3300041507 | Bacteria | 572 |
| 1205 | Ga0451843_0078182 | 3300041509 | Bacteria | 1085 |
| 1206 | Ga0451843_0673582 | 3300041509 | Bacteria | 501 |
| 1207 | Ga0451843_1227703 | 3300041509 | Bacteria | 1139 |
| 1208 | Ga0451855_1437951 | 3300041511 | Bacteria | 560 |
| 1209 | Ga0451853_1178819 | 3300041512 | Bacteria | 2324 |
| 1210 | Ga0451853_1676925 | 3300041512 | Bacteria | 714 |
| 1211 | Ga0451853_2803505 | 3300041512 | Bacteria | 805 |
| 1212 | Ga0439431_0036551 | 3300041997 | Bacteria | 1237 |
| 1213 | Ga0439441_056669 | 3300042001 | Bacteria | 818 |
| 1214 | Ga0439445_0160488 | 3300042004 | Bacteria | 657 |
| 1215 | Ga0439448_0053568 | 3300042005 | Bacteria | 1324 |
| 1216 | Ga0439463_097662 | 3300042016 | Bacteria | 757 |
| 1217 | Ga0450920_130800 | 3300042122 | Bacteria | 529 |
| 1218 | Ga0439435_0047473 | 3300042436 | Bacteria | 1220 |
| 1219 | Ga0439459_0244558 | 3300042438 | Bacteria | 505 |
| 1220 | Ga0450918_024976 | 3300042531 | Bacteria | 1046 |
| 1221 | Ga0466969_0370129 | 3300044656 | Bacteria | 649 |
| 1222 | Ga0466972_0000467 | 3300044658 | Bacteria | 20502 |
| 1223 | Ga0466972_0006214 | 3300044658 | Bacteria | 6000 |
| 1224 | Ga0466972_0490422 | 3300044658 | Bacteria | 578 |
| 1225 | Ga0466965_0025770 | 3300044683 | Bacteria | 2848 |
| 1226 | Ga0466965_0076067 | 3300044683 | Bacteria | 1694 |
| 1227 | Ga0466965_0085411 | 3300044683 | Bacteria | 1600 |
| 1228 | Ga0466965_0186238 | 3300044683 | Bacteria | 1096 |
| 1229 | Ga0466965_0336110 | 3300044683 | Bacteria | 825 |
| 1230 | Ga0466966_0000383 | 3300044684 | Bacteria | 28757 |
| 1231 | Ga0466966_0138637 | 3300044684 | Bacteria | 1487 |
| 1232 | Ga0466966_0213131 | 3300044684 | Bacteria | 1167 |
| 1233 | Ga0466966_0359716 | 3300044684 | Bacteria | 874 |
| 1234 | Ga0466961_0204769 | 3300044693 | Bacteria | 1219 |
| 1235 | Ga0466961_0486598 | 3300044693 | Bacteria | 746 |
| 1236 | Ga0466961_0750258 | 3300044693 | Bacteria | 583 |
| 1237 | Ga0466963_0010998 | 3300044694 | Bacteria | 5502 |
| 1238 | Ga0466963_0043465 | 3300044694 | Bacteria | 2954 |
| 1239 | Ga0466963_0049392 | 3300044694 | Bacteria | 2782 |
| 1240 | Ga0466963_0056459 | 3300044694 | Bacteria | 2613 |
| 1241 | Ga0466963_0072087 | 3300044694 | Bacteria | 2326 |
| 1242 | Ga0466963_0153201 | 3300044694 | Bacteria | 1601 |
| 1243 | Ga0466963_0195228 | 3300044694 | Bacteria | 1415 |
| 1244 | Ga0466963_0235627 | 3300044694 | Bacteria | 1283 |
| 1245 | Ga0466963_0392175 | 3300044694 | Bacteria | 979 |
| 1246 | Ga0466963_0413597 | 3300044694 | Bacteria | 951 |
| 1247 | Ga0466963_0445545 | 3300044694 | Bacteria | 914 |
| 1248 | Ga0466964_0133918 | 3300044706 | Bacteria | 1132 |
| 1249 | Ga0466964_0329825 | 3300044706 | Bacteria | 778 |
| 1250 | Ga0466964_0362360 | 3300044706 | Bacteria | 748 |
| 1251 | Ga0466964_0411812 | 3300044706 | Bacteria | 709 |
| 1252 | Ga0466964_0813611 | 3300044706 | Bacteria | 529 |
| 1253 | Ga0453684_1459255 | 3300044712 | Bacteria | 707 |
| 1254 | Ga0466971_0007279 | 3300044719 | Bacteria | 4818 |
| 1255 | Ga0466971_0020494 | 3300044719 | Bacteria | 2939 |
| 1256 | Ga0466971_0204032 | 3300044719 | Bacteria | 934 |
| 1257 | Ga0466971_0215860 | 3300044719 | Bacteria | 908 |
| 1258 | Ga0466971_0235788 | 3300044719 | Bacteria | 869 |
| 1259 | Ga0466968_0004861 | 3300044735 | Bacteria | 5030 |
| 1260 | Ga0466968_0054416 | 3300044735 | Bacteria | 1716 |
| 1261 | Ga0466968_0073253 | 3300044735 | Bacteria | 1494 |
| 1262 | Ga0466970_0071776 | 3300044765 | Bacteria | 1862 |
| 1263 | Ga0466970_0164699 | 3300044765 | Bacteria | 1227 |
| 1264 | Ga0466970_0207195 | 3300044765 | Bacteria | 1092 |
| 1265 | Ga0466970_0800002 | 3300044765 | Bacteria | 552 |
| 1266 | Ga0466957_0014920 | 3300044842 | Bacteria | 4532 |
| 1267 | Ga0466957_0015313 | 3300044842 | Bacteria | 4480 |
| 1268 | Ga0466957_0144176 | 3300044842 | Bacteria | 1536 |
| 1269 | Ga0466957_0152249 | 3300044842 | Bacteria | 1496 |
| 1270 | Ga0466957_0179224 | 3300044842 | Bacteria | 1383 |
| 1271 | Ga0466957_0456231 | 3300044842 | Bacteria | 881 |
| 1272 | Ga0466957_0940242 | 3300044842 | Bacteria | 619 |
| 1273 | Ga0466960_0000533 | 3300044901 | Bacteria | 13018 |
| 1274 | Ga0466960_0000908 | 3300044901 | Bacteria | 10485 |
| 1275 | Ga0466960_0008863 | 3300044901 | Bacteria | 4132 |
| 1276 | Ga0466960_0036156 | 3300044901 | Bacteria | 2312 |
| 1277 | Ga0466960_0159790 | 3300044901 | Bacteria | 1209 |
| 1278 | Ga0466960_0638681 | 3300044901 | Bacteria | 634 |
| 1279 | Ga0466959_0020923 | 3300045049 | Bacteria | 4822 |
| 1280 | Ga0466959_0256793 | 3300045049 | Bacteria | 1204 |
| 1281 | Ga0466959_0290843 | 3300045049 | Bacteria | 1120 |
| 1282 | Ga0466959_0321966 | 3300045049 | Bacteria | 1057 |
| 1283 | Ga0466959_0392129 | 3300045049 | Bacteria | 944 |
| 1284 | Ga0466959_0395751 | 3300045049 | Bacteria | 939 |
| 1285 | Ga0466959_0515044 | 3300045049 | Bacteria | 808 |
| 1286 | Ga0466959_0977525 | 3300045049 | Bacteria | 564 |
| 1287 | Ga0466958_0019647 | 3300045836 | Bacteria | 3932 |
| 1288 | Ga0466958_0035221 | 3300045836 | Bacteria | 2990 |
| 1289 | Ga0466958_0037294 | 3300045836 | Bacteria | 2913 |
| 1290 | Ga0466958_0357621 | 3300045836 | Bacteria | 940 |
| 1291 | Ga0466958_0545140 | 3300045836 | Bacteria | 753 |
| 1292 | Ga0466958_0891301 | 3300045836 | Bacteria | 580 |
| 1293 | Ga0466958_1043655 | 3300045836 | Bacteria | 533 |
| 1294 | Ga0466967_0007938 | 3300045976 | Bacteria | 7719 |
| 1295 | Ga0466967_0008336 | 3300045976 | Bacteria | 7584 |
| 1296 | Ga0466967_0065145 | 3300045976 | Bacteria | 3242 |
| 1297 | Ga0466967_0073153 | 3300045976 | Bacteria | 3074 |
| 1298 | Ga0466967_0106322 | 3300045976 | Bacteria | 2572 |
| 1299 | Ga0466967_0115719 | 3300045976 | Bacteria | 2470 |
| 1300 | Ga0466967_0169697 | 3300045976 | Bacteria | 2052 |
| 1301 | Ga0466967_0238263 | 3300045976 | Bacteria | 1734 |
| 1302 | Ga0466967_0243718 | 3300045976 | Bacteria | 1715 |
| 1303 | Ga0466967_0262620 | 3300045976 | Bacteria | 1652 |
| 1304 | Ga0466967_0374581 | 3300045976 | Bacteria | 1381 |
| 1305 | Ga0466967_0486540 | 3300045976 | Bacteria | 1209 |
| 1306 | Ga0466967_0523135 | 3300045976 | Bacteria | 1166 |
| 1307 | Ga0466967_0529878 | 3300045976 | Bacteria | 1158 |
| 1308 | Ga0466967_0593390 | 3300045976 | Bacteria | 1093 |
| 1309 | Ga0466967_0785193 | 3300045976 | Bacteria | 945 |
| 1310 | Ga0466967_1373912 | 3300045976 | Bacteria | 703 |
| 1311 | Ga0466967_1374086 | 3300045976 | Bacteria | 703 |
| 1312 | Ga0495592_0061738 | 3300046454 | Bacteria | 2753 |
| 1313 | Ga0495592_0072146 | 3300046454 | Bacteria | 2512 |
| 1314 | Ga0495592_0367408 | 3300046454 | Bacteria | 919 |
| 1315 | Ga0495603_0365855 | 3300046455 | Bacteria | 827 |
| 1316 | Ga0495590_0136878 | 3300046457 | Bacteria | 883 |
| 1317 | Ga0495629_0004222 | 3300046459 | Bacteria | 10778 |
| 1318 | Ga0495629_0298190 | 3300046459 | Bacteria | 1104 |
| 1319 | Ga0495629_0455882 | 3300046459 | Bacteria | 865 |
| 1320 | Ga0495629_1109646 | 3300046459 | Bacteria | 511 |
| 1321 | Ga0495638_0044083 | 3300046460 | Bacteria | 2811 |
| 1322 | Ga0495641_0009678 | 3300046461 | Bacteria | 5697 |
| 1323 | Ga0495641_0254813 | 3300046461 | Bacteria | 789 |
| 1324 | Ga0495651_0022386 | 3300046462 | Bacteria | 4911 |
| 1325 | Ga0495651_0891235 | 3300046462 | Bacteria | 544 |
| 1326 | Ga0495653_0052007 | 3300046463 | Bacteria | 3141 |
| 1327 | Ga0495653_0247523 | 3300046463 | Bacteria | 1184 |
| 1328 | Ga0495653_0302236 | 3300046463 | Bacteria | 1043 |
| 1329 | Ga0495653_0333030 | 3300046463 | Bacteria | 980 |
| 1330 | Ga0495650_0112962 | 3300046471 | Bacteria | 1007 |
| 1331 | Ga0495650_0236782 | 3300046471 | Bacteria | 625 |
| 1332 | Ga0495580_0032022 | 3300046472 | Bacteria | 3796 |
| 1333 | Ga0495580_0244465 | 3300046472 | Bacteria | 1230 |
| 1334 | Ga0495582_0009125 | 3300046473 | Bacteria | 5472 |
| 1335 | Ga0495582_0057796 | 3300046473 | Bacteria | 2139 |
| 1336 | Ga0495582_0287109 | 3300046473 | Bacteria | 945 |
| 1337 | Ga0495582_0359685 | 3300046473 | Bacteria | 838 |
| 1338 | Ga0495639_0025869 | 3300046475 | Bacteria | 2590 |
| 1339 | Ga0495639_0163193 | 3300046475 | Bacteria | 1079 |
| 1340 | Ga0495662_0008003 | 3300046476 | Bacteria | 5206 |
| 1341 | Ga0495662_0010086 | 3300046476 | Bacteria | 4633 |
| 1342 | Ga0495664_0073258 | 3300046477 | Bacteria | 2047 |
| 1343 | Ga0495664_0166328 | 3300046477 | Bacteria | 1338 |
| 1344 | Ga0495664_0214211 | 3300046477 | Bacteria | 1166 |
| 1345 | Ga0495594_0019876 | 3300046499 | Bacteria | 3572 |
| 1346 | Ga0495596_0289901 | 3300046500 | Bacteria | 636 |
| 1347 | Ga0495596_0413783 | 3300046500 | Bacteria | 525 |
| 1348 | Ga0495607_0188365 | 3300046501 | Bacteria | 1029 |
| 1349 | Ga0495608_0009099 | 3300046511 | Bacteria | 6942 |
| 1350 | Ga0495608_0022737 | 3300046511 | Bacteria | 4300 |
| 1351 | Ga0495608_0045500 | 3300046511 | Bacteria | 2924 |
| 1352 | Ga0495608_0463022 | 3300046511 | Bacteria | 770 |
| 1353 | Ga0495610_0090814 | 3300046512 | Bacteria | 1385 |
| 1354 | Ga0495616_0475045 | 3300046513 | Bacteria | 503 |
| 1355 | Ga0495618_0019818 | 3300046514 | Bacteria | 4140 |
| 1356 | Ga0495618_0041394 | 3300046514 | Bacteria | 2901 |
| 1357 | Ga0495620_0115056 | 3300046515 | Bacteria | 1064 |
| 1358 | Ga0495620_0124163 | 3300046515 | Bacteria | 1016 |
| 1359 | Ga0495628_0006081 | 3300046516 | Bacteria | 10554 |
| 1360 | Ga0495628_0060116 | 3300046516 | Bacteria | 2982 |
| 1361 | Ga0495630_0070040 | 3300046517 | Bacteria | 2638 |
| 1362 | Ga0495630_0123303 | 3300046517 | Bacteria | 1966 |
| 1363 | Ga0495630_1253383 | 3300046517 | Bacteria | 560 |
| 1364 | Ga0495631_0109348 | 3300046518 | Bacteria | 1189 |
| 1365 | Ga0495631_0275711 | 3300046518 | Bacteria | 716 |
| 1366 | Ga0495632_0386319 | 3300046519 | Bacteria | 613 |
| 1367 | Ga0495666_0020565 | 3300046526 | Bacteria | 3268 |
| 1368 | Ga0495652_0028241 | 3300046529 | Bacteria | 4938 |
| 1369 | Ga0495652_0078581 | 3300046529 | Bacteria | 2730 |
| 1370 | Ga0495665_0010115 | 3300046531 | Bacteria | 5110 |
| 1371 | Ga0495665_0021929 | 3300046531 | Bacteria | 3434 |
| 1372 | Ga0495665_0172337 | 3300046531 | Bacteria | 1126 |
| 1373 | Ga0495665_0239947 | 3300046531 | Bacteria | 934 |
| 1374 | Ga0495640_0009511 | 3300046533 | Bacteria | 7566 |
| 1375 | Ga0495640_0140168 | 3300046533 | Bacteria | 1559 |
| 1376 | Ga0495586_0007029 | 3300046535 | Bacteria | 6000 |
| 1377 | Ga0495586_0026425 | 3300046535 | Bacteria | 3106 |
| 1378 | Ga0495587_0025211 | 3300046536 | Bacteria | 3634 |
| 1379 | Ga0495587_0270951 | 3300046536 | Bacteria | 952 |
| 1380 | Ga0495587_0580709 | 3300046536 | Bacteria | 618 |
| 1381 | Ga0495621_0010604 | 3300046539 | Bacteria | 2826 |
| 1382 | Ga0495645_0014290 | 3300046543 | Bacteria | 5629 |
| 1383 | Ga0495645_0161902 | 3300046543 | Bacteria | 1546 |
| 1384 | Ga0495645_0323383 | 3300046543 | Bacteria | 1001 |
| 1385 | Ga0495667_0089320 | 3300046559 | Bacteria | 1997 |
| 1386 | Ga0495667_0099963 | 3300046559 | Bacteria | 1877 |
| 1387 | Ga0495667_0206080 | 3300046559 | Bacteria | 1257 |
| 1388 | Ga0495656_0264666 | 3300046615 | Bacteria | 872 |
| 1389 | Ga0495656_0297732 | 3300046615 | Bacteria | 826 |
| 1390 | Ga0495668_0000509 | 3300046616 | Bacteria | 48446 |
| 1391 | Ga0495668_0059405 | 3300046616 | Bacteria | 2110 |
| 1392 | Ga0495668_0128569 | 3300046616 | Bacteria | 1387 |
| 1393 | Ga0495668_0419445 | 3300046616 | Bacteria | 736 |
| 1394 | Ga0495634_0015911 | 3300046642 | Bacteria | 5388 |
| 1395 | Ga0495634_0132120 | 3300046642 | Bacteria | 1590 |
| 1396 | Ga0495634_0192584 | 3300046642 | Bacteria | 1271 |
| 1397 | Ga0495634_0371297 | 3300046642 | Bacteria | 854 |
| 1398 | Ga0495634_0543920 | 3300046642 | Bacteria | 678 |
| 1399 | Ga0495634_0604811 | 3300046642 | Bacteria | 636 |
| 1400 | Ga0495635_0028891 | 3300046663 | Bacteria | 3854 |
| 1401 | Ga0495635_0062183 | 3300046663 | Bacteria | 2563 |
| 1402 | Ga0495635_0300264 | 3300046663 | Bacteria | 1077 |
| 1403 | Ga0495635_0786685 | 3300046663 | Bacteria | 614 |
| 1404 | Ga0495588_0066400 | 3300046674 | Bacteria | 1872 |
| 1405 | Ga0495588_0185847 | 3300046674 | Bacteria | 1098 |
| 1406 | Ga0495588_0197050 | 3300046674 | Bacteria | 1064 |
| 1407 | Ga0495657_0038575 | 3300046675 | Bacteria | 3286 |
| 1408 | Ga0495657_0453603 | 3300046675 | Bacteria | 750 |
| 1409 | Ga0495599_0027775 | 3300046678 | Bacteria | 3545 |
| 1410 | Ga0495599_0138887 | 3300046678 | Bacteria | 1507 |
| 1411 | Ga0495623_0066615 | 3300046679 | Bacteria | 2249 |
| 1412 | Ga0495623_0394141 | 3300046679 | Bacteria | 746 |
| 1413 | Ga0495646_0013551 | 3300046680 | Bacteria | 5183 |
| 1414 | Ga0495646_0025121 | 3300046680 | Bacteria | 3748 |
| 1415 | Ga0495646_0166063 | 3300046680 | Bacteria | 1219 |
| 1416 | Ga0495647_0007780 | 3300046681 | Bacteria | 3599 |
| 1417 | Ga0495647_0257719 | 3300046681 | Bacteria | 778 |
| 1418 | Ga0495658_0005793 | 3300046683 | Bacteria | 6064 |
| 1419 | Ga0495658_0144979 | 3300046683 | Bacteria | 1454 |
| 1420 | Ga0495658_0152966 | 3300046683 | Bacteria | 1418 |
| 1421 | Ga0495658_0245200 | 3300046683 | Bacteria | 1126 |
| 1422 | Ga0495658_0373522 | 3300046683 | Bacteria | 907 |
| 1423 | Ga0495658_0401524 | 3300046683 | Bacteria | 874 |
| 1424 | Ga0495658_0541312 | 3300046683 | Bacteria | 745 |
| 1425 | Ga0495658_0786005 | 3300046683 | Bacteria | 609 |
| 1426 | Ga0495613_0017693 | 3300046689 | Bacteria | 5310 |
| 1427 | Ga0495613_0155166 | 3300046689 | Bacteria | 1631 |
| 1428 | Ga0495613_0812466 | 3300046689 | Bacteria | 610 |
| 1429 | Ga0495624_0032525 | 3300046690 | Bacteria | 3381 |
| 1430 | Ga0495624_0310924 | 3300046690 | Bacteria | 949 |
| 1431 | Ga0495624_0607462 | 3300046690 | Bacteria | 652 |
| 1432 | Ga0495671_0281147 | 3300046692 | Bacteria | 802 |
| 1433 | Ga0495649_0039261 | 3300046694 | Bacteria | 2596 |
| 1434 | Ga0495600_0039666 | 3300046809 | Bacteria | 3066 |
| 1435 | Ga0495600_0044801 | 3300046809 | Bacteria | 2885 |
| 1436 | Ga0495600_0686248 | 3300046809 | Bacteria | 617 |
| 1437 | Ga0495581_0023771 | 3300047315 | Bacteria | 3551 |
| 1438 | Ga0495604_0092975 | 3300047317 | Bacteria | 2232 |
| 1439 | Ga0495604_0114479 | 3300047317 | Bacteria | 1961 |
| 1440 | Ga0495674_0032123 | 3300047319 | Bacteria | 4764 |
| 1441 | Ga0495674_0082380 | 3300047319 | Bacteria | 2758 |
| 1442 | Ga0495674_0217428 | 3300047319 | Bacteria | 1581 |
| 1443 | Ga0495672_0020537 | 3300047320 | Bacteria | 4324 |
| 1444 | Ga0495672_0166918 | 3300047320 | Bacteria | 1126 |
| 1445 | Ga0495676_0050370 | 3300047321 | Bacteria | 3340 |
| 1446 | Ga0495676_0071974 | 3300047321 | Bacteria | 2656 |
| 1447 | Ga0495680_0027683 | 3300047322 | Bacteria | 4652 |
| 1448 | Ga0495680_0048696 | 3300047322 | Bacteria | 3326 |
| 1449 | Ga0495680_0136374 | 3300047322 | Bacteria | 1799 |
| 1450 | Ga0495680_0734873 | 3300047322 | Bacteria | 649 |
| 1451 | Ga0495683_0002868 | 3300047323 | Bacteria | 10200 |
| 1452 | Ga0495675_0024123 | 3300047444 | Bacteria | 3876 |
| 1453 | Ga0495675_0331673 | 3300047444 | Bacteria | 898 |
| 1454 | Ga0495677_0054019 | 3300047445 | Bacteria | 1482 |
| 1455 | Ga0495684_0004161 | 3300047471 | Bacteria | 11297 |
| 1456 | Ga0495684_0096482 | 3300047471 | Bacteria | 2237 |
| 1457 | Ga0495684_0841053 | 3300047471 | Bacteria | 596 |
| 1458 | Ga0495686_0003291 | 3300047472 | Bacteria | 14122 |
| 1459 | Ga0495686_0111188 | 3300047472 | Bacteria | 1643 |
| 1460 | Ga0495593_0003319 | 3300047673 | Bacteria | 9645 |
| 1461 | Ga0495602_0013833 | 3300048088 | Bacteria | 8227 |
| 1462 | Ga0495602_0083198 | 3300048088 | Bacteria | 2682 |
| 1463 | Ga0495614_0096400 | 3300048089 | Bacteria | 1290 |
| 1464 | Ga0495614_0097658 | 3300048089 | Bacteria | 1281 |
| 1465 | Ga0495614_0112935 | 3300048089 | Bacteria | 1194 |
| 1466 | Ga0495614_0208677 | 3300048089 | Bacteria | 885 |
| 1467 | Ga0495626_0242522 | 3300048091 | Bacteria | 725 |
| 1468 | Ga0496100_0091178 | 3300048903 | Bacteria | 2079 |
| 1469 | Ga0496100_0192299 | 3300048903 | Bacteria | 1482 |
| 1470 | Ga0496100_0710810 | 3300048903 | Bacteria | 784 |
| 1471 | Ga0496100_1434383 | 3300048903 | Bacteria | 545 |
| 1472 | Ga0496101_0085853 | 3300048904 | Bacteria | 2333 |
| 1473 | Ga0496101_0100238 | 3300048904 | Bacteria | 2166 |
| 1474 | Ga0496101_1474280 | 3300048904 | Bacteria | 530 |
| 1475 | Ga0496102_0163736 | 3300048905 | Bacteria | 2092 |
| 1476 | Ga0496102_0346594 | 3300048905 | Bacteria | 1398 |
| 1477 | Ga0496102_0413504 | 3300048905 | Bacteria | 1267 |
| 1478 | Ga0496102_0429657 | 3300048905 | Bacteria | 1240 |
| 1479 | Ga0496102_0702133 | 3300048905 | Bacteria | 934 |
| 1480 | Ga0496102_1415271 | 3300048905 | Bacteria | 614 |
| 1481 | Ga0496103_0085017 | 3300048906 | Bacteria | 1994 |
| 1482 | Ga0496103_0127963 | 3300048906 | Bacteria | 1620 |
| 1483 | Ga0496103_0135378 | 3300048906 | Bacteria | 1574 |
| 1484 | Ga0496103_0434505 | 3300048906 | Bacteria | 842 |
| 1485 | Ga0496104_0014968 | 3300048907 | Bacteria | 7016 |
| 1486 | Ga0496104_0168785 | 3300048907 | Bacteria | 2098 |
| 1487 | Ga0496104_0323715 | 3300048907 | Bacteria | 1455 |
| 1488 | Ga0496104_0412306 | 3300048907 | Bacteria | 1263 |
| 1489 | Ga0496104_0414448 | 3300048907 | Bacteria | 1259 |
| 1490 | Ga0496105_0078709 | 3300048908 | Bacteria | 2722 |
| 1491 | Ga0496105_0104287 | 3300048908 | Bacteria | 2341 |
| 1492 | Ga0496105_0106535 | 3300048908 | Bacteria | 2314 |
| 1493 | Ga0496105_0144654 | 3300048908 | Bacteria | 1955 |
| 1494 | Ga0496105_0265243 | 3300048908 | Bacteria | 1388 |
| 1495 | Ga0496105_0475047 | 3300048908 | Bacteria | 984 |
| 1496 | Ga0496105_0871055 | 3300048908 | Bacteria | 680 |
| 1497 | Ga0496105_1378557 | 3300048908 | Bacteria | 511 |
| 1498 | Ga0496106_0047608 | 3300048909 | Bacteria | 3227 |
| 1499 | Ga0496106_0309435 | 3300048909 | Bacteria | 1267 |
| 1500 | Ga0496106_0679074 | 3300048909 | Bacteria | 822 |
| 1501 | Ga0496107_0010178 | 3300048910 | Bacteria | 6523 |
| 1502 | Ga0496107_0440191 | 3300048910 | Bacteria | 969 |
| 1503 | Ga0496107_1218803 | 3300048910 | Bacteria | 540 |
| 1504 | Ga0496108_0000394 | 3300048911 | Bacteria | 36076 |
| 1505 | Ga0496108_0001515 | 3300048911 | Bacteria | 18387 |
| 1506 | Ga0496108_0016331 | 3300048911 | Bacteria | 6055 |
| 1507 | Ga0496108_0026104 | 3300048911 | Bacteria | 4818 |
| 1508 | Ga0496108_0028389 | 3300048911 | Bacteria | 4629 |
| 1509 | Ga0496108_0067497 | 3300048911 | Bacteria | 3016 |
| 1510 | Ga0496108_0475841 | 3300048911 | Bacteria | 1091 |
| 1511 | Ga0496108_0949450 | 3300048911 | Bacteria | 736 |
| 1512 | Ga0496108_1284128 | 3300048911 | Bacteria | 616 |
| 1513 | Ga0496108_1688181 | 3300048911 | Bacteria | 522 |
| 1514 | Ga0496109_0008622 | 3300048912 | Bacteria | 8680 |
| 1515 | Ga0496109_0015777 | 3300048912 | Bacteria | 6594 |
| 1516 | Ga0496109_0025845 | 3300048912 | Bacteria | 5233 |
| 1517 | Ga0496109_0054075 | 3300048912 | Bacteria | 3663 |
| 1518 | Ga0496109_0059705 | 3300048912 | Bacteria | 3484 |
| 1519 | Ga0496109_0147821 | 3300048912 | Bacteria | 2199 |
| 1520 | Ga0496109_0174571 | 3300048912 | Bacteria | 2017 |
| 1521 | Ga0496109_0824600 | 3300048912 | Bacteria | 865 |
| 1522 | Ga0496109_1680357 | 3300048912 | Bacteria | 569 |
| 1523 | Ga0496110_0004143 | 3300048913 | Bacteria | 11207 |
| 1524 | Ga0496110_0012641 | 3300048913 | Bacteria | 6946 |
| 1525 | Ga0496110_0027034 | 3300048913 | Bacteria | 4916 |
| 1526 | Ga0496110_0193348 | 3300048913 | Bacteria | 1847 |
| 1527 | Ga0496110_0490060 | 3300048913 | Bacteria | 1119 |
| 1528 | Ga0496110_0716254 | 3300048913 | Bacteria | 903 |
| 1529 | Ga0496110_0735326 | 3300048913 | Bacteria | 889 |
| 1530 | Ga0496110_0840412 | 3300048913 | Bacteria | 823 |
| 1531 | Ga0496111_0011467 | 3300048914 | Bacteria | 5971 |
| 1532 | Ga0496111_0011991 | 3300048914 | Bacteria | 5858 |
| 1533 | Ga0496111_0298462 | 3300048914 | Bacteria | 1194 |
| 1534 | Ga0496111_0659842 | 3300048914 | Bacteria | 763 |
| 1535 | Ga0496111_0662985 | 3300048914 | Bacteria | 761 |
| 1536 | Ga0496111_1043470 | 3300048914 | Bacteria | 584 |
| 1537 | Ga0496112_0088274 | 3300048915 | Bacteria | 3069 |
| 1538 | Ga0496112_0249649 | 3300048915 | Bacteria | 1726 |
| 1539 | Ga0496112_0288501 | 3300048915 | Bacteria | 1587 |
| 1540 | Ga0496112_0369186 | 3300048915 | Bacteria | 1376 |
| 1541 | Ga0496112_0566177 | 3300048915 | Bacteria | 1069 |
| 1542 | Ga0496112_0566398 | 3300048915 | Bacteria | 1069 |
| 1543 | Ga0496112_1298014 | 3300048915 | Bacteria | 643 |
| 1544 | Ga0496113_0095125 | 3300048916 | Bacteria | 2302 |
| 1545 | Ga0496113_0113223 | 3300048916 | Bacteria | 2114 |
| 1546 | Ga0496113_0133350 | 3300048916 | Bacteria | 1950 |
| 1547 | Ga0496113_0134486 | 3300048916 | Bacteria | 1942 |
| 1548 | Ga0496113_0145175 | 3300048916 | Bacteria | 1869 |
| 1549 | Ga0496113_0331031 | 3300048916 | Bacteria | 1221 |
| 1550 | Ga0496113_1112264 | 3300048916 | Bacteria | 619 |
| 1551 | Ga0496113_1322160 | 3300048916 | Bacteria | 560 |
| 1552 | Ga0496114_0018213 | 3300048917 | Bacteria | 5675 |
| 1553 | Ga0496114_0037300 | 3300048917 | Bacteria | 4019 |
| 1554 | Ga0496114_0037365 | 3300048917 | Bacteria | 4016 |
| 1555 | Ga0496114_0275587 | 3300048917 | Bacteria | 1482 |
| 1556 | Ga0496114_0296028 | 3300048917 | Bacteria | 1428 |
| 1557 | Ga0496114_1148638 | 3300048917 | Bacteria | 662 |
| 1558 | Ga0496115_0053152 | 3300048918 | Bacteria | 3250 |
| 1559 | Ga0496115_0096285 | 3300048918 | Bacteria | 2423 |
| 1560 | Ga0496115_0316748 | 3300048918 | Bacteria | 1276 |
| 1561 | Ga0496115_0563085 | 3300048918 | Bacteria | 910 |
| 1562 | Ga0496115_0629412 | 3300048918 | Bacteria | 850 |
| 1563 | Ga0496115_1285589 | 3300048918 | Bacteria | 546 |
| 1564 | Ga0496117_0103373 | 3300048920 | Bacteria | 1795 |
| 1565 | Ga0496117_0184944 | 3300048920 | Bacteria | 1193 |
| 1566 | Ga0496118_0001260 | 3300048921 | Bacteria | 38829 |
| 1567 | Ga0496118_0007173 | 3300048921 | Bacteria | 11916 |
| 1568 | Ga0496119_0010999 | 3300048922 | Bacteria | 7550 |
| 1569 | Ga0496119_0032653 | 3300048922 | Bacteria | 3466 |
| 1570 | Ga0496119_0158815 | 3300048922 | Bacteria | 1204 |
| 1571 | Ga0496119_0187404 | 3300048922 | Bacteria | 1081 |
| 1572 | Ga0496120_0030224 | 3300048923 | Bacteria | 3297 |
| 1573 | Ga0496120_0149998 | 3300048923 | Bacteria | 1173 |
| 1574 | Ga0496121_0803842 | 3300048924 | Bacteria | 552 |
| 1575 | Ga0496122_0001412 | 3300048925 | Bacteria | 38911 |
| 1576 | Ga0496122_0172045 | 3300048925 | Bacteria | 1304 |
| 1577 | Ga0496122_0278196 | 3300048925 | Bacteria | 917 |
| 1578 | Ga0496123_0177626 | 3300048926 | Bacteria | 1115 |
| 1579 | Ga0496123_0247408 | 3300048926 | Bacteria | 882 |
| 1580 | Ga0496124_0068795 | 3300048927 | Bacteria | 2941 |
| 1581 | Ga0496124_0187875 | 3300048927 | Bacteria | 1584 |
| 1582 | Ga0496124_0460501 | 3300048927 | Bacteria | 864 |
| 1583 | Ga0496125_0000086 | 3300048928 | Bacteria | 216489 |
| 1584 | Ga0496125_0027838 | 3300048928 | Bacteria | 5114 |
| 1585 | Ga0496125_0096987 | 3300048928 | Bacteria | 2186 |
| 1586 | Ga0496125_0696133 | 3300048928 | Bacteria | 540 |
| 1587 | Ga0496126_0011857 | 3300048929 | Bacteria | 8968 |
| 1588 | Ga0496126_0022728 | 3300048929 | Bacteria | 6091 |
| 1589 | Ga0496126_0098258 | 3300048929 | Bacteria | 2565 |
| 1590 | Ga0496126_0170583 | 3300048929 | Bacteria | 1854 |
| 1591 | Ga0496126_0472159 | 3300048929 | Bacteria | 1006 |
| 1592 | Ga0501306_003491 | 3300049127 | Bacteria | 1698 |
| 1593 | Ga0501306_010084 | 3300049127 | Bacteria | 1183 |
| 1594 | Ga0501306_017435 | 3300049127 | Bacteria | 974 |
| 1595 | Ga0501306_056353 | 3300049127 | Bacteria | 640 |
| 1596 | Ga0501308_004882 | 3300049128 | Bacteria | 1312 |
| 1597 | Ga0501308_011965 | 3300049128 | Bacteria | 985 |
| 1598 | Ga0501308_018367 | 3300049128 | Bacteria | 855 |
| 1599 | Ga0501309_013492 | 3300049129 | Bacteria | 1087 |
| 1600 | Ga0501309_025796 | 3300049129 | Bacteria | 846 |
| 1601 | Ga0501309_026974 | 3300049129 | Bacteria | 831 |
| 1602 | Ga0501310_026534 | 3300049130 | Bacteria | 751 |
| 1603 | Ga0501310_042249 | 3300049130 | Bacteria | 638 |
| 1604 | Ga0501341_02817 | 3300049131 | Bacteria | 959 |
| 1605 | Ga0501343_006371 | 3300049132 | Bacteria | 920 |
| 1606 | Ga0501345_02760 | 3300049134 | Bacteria | 739 |
| 1607 | Ga0501304_005327 | 3300049160 | Bacteria | 1005 |
| 1608 | Ga0501305_035354 | 3300049161 | Bacteria | 795 |
| 1609 | Ga0501307_006265 | 3300049162 | Bacteria | 1280 |
| 1610 | Ga0501307_025664 | 3300049162 | Bacteria | 792 |
| 1611 | Ga0495678_221531 | 3300049459 | Bacteria | 574 |
| 1612 | Ga0501311_004858 | 3300049527 | Bacteria | 1448 |
| 1613 | Ga0501311_007879 | 3300049527 | Bacteria | 1236 |
| 1614 | Ga0501311_099077 | 3300049527 | Bacteria | 514 |
| 1615 | Ga0501312_005556 | 3300049528 | Bacteria | 1537 |
| 1616 | Ga0501312_007002 | 3300049528 | Bacteria | 1425 |
| 1617 | Ga0501313_007646 | 3300049529 | Bacteria | 1194 |
| 1618 | Ga0501315_002746 | 3300049531 | Bacteria | 1693 |
| 1619 | Ga0501315_003476 | 3300049531 | Bacteria | 1580 |
| 1620 | Ga0501315_019581 | 3300049531 | Bacteria | 902 |
| 1621 | Ga0501315_022828 | 3300049531 | Bacteria | 855 |
| 1622 | Ga0501316_002256 | 3300049532 | Bacteria | 1765 |
| 1623 | Ga0501316_007989 | 3300049532 | Bacteria | 1160 |
| 1624 | Ga0501316_009885 | 3300049532 | Bacteria | 1078 |
| 1625 | Ga0501316_015895 | 3300049532 | Bacteria | 910 |
| 1626 | Ga0501317_001119 | 3300049533 | Bacteria | 2219 |
| 1627 | Ga0501317_003573 | 3300049533 | Bacteria | 1560 |
| 1628 | Ga0501317_005389 | 3300049533 | Bacteria | 1368 |
| 1629 | Ga0501317_016320 | 3300049533 | Bacteria | 962 |
| 1630 | Ga0501317_020993 | 3300049533 | Bacteria | 884 |
| 1631 | Ga0501317_037503 | 3300049533 | Bacteria | 728 |
| 1632 | Ga0501318_001483 | 3300049534 | Bacteria | 1858 |
| 1633 | Ga0501318_002761 | 3300049534 | Bacteria | 1553 |
| 1634 | Ga0501318_013014 | 3300049534 | Bacteria | 962 |
| 1635 | Ga0501318_014589 | 3300049534 | Bacteria | 929 |
| 1636 | Ga0501318_015033 | 3300049534 | Bacteria | 920 |
| 1637 | Ga0501318_021760 | 3300049534 | Bacteria | 817 |
| 1638 | Ga0501318_063153 | 3300049534 | Bacteria | 572 |
| 1639 | Ga0501319_002366 | 3300049535 | Bacteria | 1189 |
| 1640 | Ga0501319_006520 | 3300049535 | Bacteria | 864 |
| 1641 | Ga0501320_000888 | 3300049536 | Bacteria | 1964 |
| 1642 | Ga0501320_004374 | 3300049536 | Bacteria | 1245 |
| 1643 | Ga0501320_008060 | 3300049536 | Bacteria | 1028 |
| 1644 | Ga0501320_035149 | 3300049536 | Bacteria | 638 |
| 1645 | Ga0501321_001097 | 3300049537 | Bacteria | 2051 |
| 1646 | Ga0501321_002837 | 3300049537 | Bacteria | 1541 |
| 1647 | Ga0501321_022906 | 3300049537 | Bacteria | 789 |
| 1648 | Ga0501322_009917 | 3300049538 | Bacteria | 727 |
| 1649 | Ga0501322_016830 | 3300049538 | Bacteria | 615 |
| 1650 | Ga0501322_030094 | 3300049538 | Bacteria | 510 |
| 1651 | Ga0501323_000539 | 3300049539 | Bacteria | 2855 |
| 1652 | Ga0501323_023339 | 3300049539 | Bacteria | 830 |
| 1653 | Ga0501323_027726 | 3300049539 | Bacteria | 781 |
| 1654 | Ga0501324_000010 | 3300049540 | Bacteria | 6825 |
| 1655 | Ga0501325_001682 | 3300049541 | Bacteria | 1407 |
| 1656 | Ga0501325_005394 | 3300049541 | Bacteria | 1015 |
| 1657 | Ga0501325_011325 | 3300049541 | Bacteria | 822 |
| 1658 | Ga0501326_02636 | 3300049542 | Bacteria | 891 |
| 1659 | Ga0501329_01750 | 3300049545 | Bacteria | 984 |
| 1660 | Ga0501330_002423 | 3300049546 | Bacteria | 1057 |
| 1661 | Ga0501330_004730 | 3300049546 | Bacteria | 849 |
| 1662 | Ga0501331_01798 | 3300049547 | Bacteria | 1079 |
| 1663 | Ga0501334_02717 | 3300049550 | Bacteria | 1062 |
| 1664 | Ga0501335_006923 | 3300049551 | Bacteria | 1039 |
| 1665 | Ga0501336_003497 | 3300049552 | Bacteria | 1066 |
| 1666 | Ga0501339_00289 | 3300049555 | Bacteria | 959 |
| 1667 | Ga0501340_002383 | 3300049556 | Bacteria | 1085 |
| 1668 | Ga0501031_0080470 | 3300049568 | Bacteria | 2123 |
| 1669 | Ga0501032_0367807 | 3300049569 | Bacteria | 925 |
| 1670 | Ga0501033_0018926 | 3300049570 | Bacteria | 5205 |
| 1671 | Ga0501033_0095500 | 3300049570 | Bacteria | 2173 |
| 1672 | Ga0501033_0385905 | 3300049570 | Bacteria | 978 |
| 1673 | Ga0501034_0016509 | 3300049571 | Bacteria | 7574 |
| 1674 | Ga0501034_0051107 | 3300049571 | Bacteria | 4168 |
| 1675 | Ga0501034_0855009 | 3300049571 | Bacteria | 800 |
| 1676 | Ga0501034_0882546 | 3300049571 | Bacteria | 783 |
| 1677 | Ga0501034_0966066 | 3300049571 | Bacteria | 737 |
| 1678 | Ga0501036_0037401 | 3300049572 | Bacteria | 4106 |
| 1679 | Ga0501036_0554857 | 3300049572 | Bacteria | 954 |
| 1680 | Ga0501036_0853537 | 3300049572 | Bacteria | 748 |
| 1681 | Ga0501037_0063557 | 3300049573 | Bacteria | 2690 |
| 1682 | Ga0501037_0485159 | 3300049573 | Bacteria | 840 |
| 1683 | Ga0501038_0021480 | 3300049574 | Bacteria | 5792 |
| 1684 | Ga0501038_0186884 | 3300049574 | Bacteria | 1669 |
| 1685 | Ga0501039_0777360 | 3300049575 | Bacteria | 747 |
| 1686 | Ga0501040_0613000 | 3300049576 | Bacteria | 786 |
| 1687 | Ga0501041_0022527 | 3300049577 | Bacteria | 3772 |
| 1688 | Ga0501041_0550187 | 3300049577 | Bacteria | 735 |
| 1689 | Ga0501042_0018748 | 3300049578 | Bacteria | 4795 |
| 1690 | Ga0501043_0024981 | 3300049579 | Bacteria | 4688 |
| 1691 | Ga0501043_0300656 | 3300049579 | Bacteria | 1226 |
| 1692 | Ga0501046_0658038 | 3300049580 | Bacteria | 740 |
| 1693 | Ga0501047_0042683 | 3300049581 | Bacteria | 4381 |
| 1694 | Ga0501047_0131139 | 3300049581 | Bacteria | 2387 |
| 1695 | Ga0501047_0146277 | 3300049581 | Bacteria | 2240 |
| 1696 | Ga0501047_0187772 | 3300049581 | Bacteria | 1931 |
| 1697 | Ga0501047_0516081 | 3300049581 | Bacteria | 1021 |
| 1698 | Ga0501047_0681433 | 3300049581 | Bacteria | 846 |
| 1699 | Ga0501048_0052303 | 3300049582 | Bacteria | 2906 |
| 1700 | Ga0501048_0661166 | 3300049582 | Bacteria | 750 |
| 1701 | Ga0501048_1043826 | 3300049582 | Bacteria | 588 |
| 1702 | Ga0501067_0077464 | 3300049583 | Bacteria | 1842 |
| 1703 | Ga0501067_0152539 | 3300049583 | Bacteria | 1287 |
| 1704 | Ga0501068_0430597 | 3300049584 | Bacteria | 852 |
| 1705 | Ga0501068_0516047 | 3300049584 | Bacteria | 776 |
| 1706 | Ga0501068_0544010 | 3300049584 | Bacteria | 755 |
| 1707 | Ga0501069_0076429 | 3300049585 | Bacteria | 1883 |
| 1708 | Ga0501069_0119849 | 3300049585 | Bacteria | 1502 |
| 1709 | Ga0501070_0004983 | 3300049586 | Bacteria | 11332 |
| 1710 | Ga0501070_0508396 | 3300049586 | Bacteria | 967 |
| 1711 | Ga0501071_0075875 | 3300049587 | Bacteria | 2454 |
| 1712 | Ga0501072_0105438 | 3300049588 | Bacteria | 2241 |
| 1713 | Ga0501072_0153562 | 3300049588 | Bacteria | 1836 |
| 1714 | Ga0501073_0014388 | 3300049589 | Bacteria | 5750 |
| 1715 | Ga0501074_0002804 | 3300049590 | Bacteria | 12192 |
| 1716 | Ga0501074_0045693 | 3300049590 | Bacteria | 3167 |
| 1717 | Ga0501075_0134635 | 3300049591 | Bacteria | 1882 |
| 1718 | Ga0501076_0209511 | 3300049592 | Bacteria | 1592 |
| 1719 | Ga0501076_0622239 | 3300049592 | Bacteria | 891 |
| 1720 | Ga0501077_0063375 | 3300049593 | Bacteria | 2345 |
| 1721 | Ga0501079_0099906 | 3300049741 | Bacteria | 2249 |
| 1722 | Ga0501079_0350904 | 3300049741 | Bacteria | 1156 |
| 1723 | Ga0501080_0329022 | 3300049742 | Bacteria | 1382 |
| 1724 | Ga0501035_0038527 | 3300049822 | Bacteria | 4327 |
| 1725 | Ga0501035_0110254 | 3300049822 | Bacteria | 2412 |
| 1726 | Ga0501035_0114379 | 3300049822 | Bacteria | 2363 |
| 1727 | Ga0501035_0147188 | 3300049822 | Bacteria | 2045 |
| 1728 | Ga0501044_0001781 | 3300049823 | Bacteria | 25182 |
| 1729 | Ga0501044_0019028 | 3300049823 | Bacteria | 7353 |
| 1730 | Ga0501044_0066267 | 3300049823 | Bacteria | 3683 |
| 1731 | Ga0501044_0186638 | 3300049823 | Bacteria | 2038 |
| 1732 | Ga0501044_0378589 | 3300049823 | Bacteria | 1331 |
| 1733 | Ga0501044_1016167 | 3300049823 | Bacteria | 700 |
| 1734 | Ga0501045_0198872 | 3300049824 | Bacteria | 1493 |
| 1735 | nmdc:mga03683_384112_c1 | 3300050489 | Bacteria | 669 |
| 1736 | nmdc:mga03n38_22870_c1 | 3300050490 | Bacteria | 2536 |
| 1737 | nmdc:mga03n38_31633_c1 | 3300050490 | Bacteria | 2235 |
| 1738 | nmdc:mga03n38_398006_c1 | 3300050490 | Bacteria | 758 |
| 1739 | nmdc:mga03n38_65358_c1 | 3300050490 | Bacteria | 1668 |
| 1740 | nmdc:mga00v17_2711_c1 | 3300050491 | Bacteria | 9089 |
| 1741 | nmdc:mga00v17_48225_c1 | 3300050491 | Bacteria | 2581 |
| 1742 | nmdc:mga00v17_958_c1 | 3300050491 | Bacteria | 15464 |
| 1743 | nmdc:mga0yw44_558839_c1 | 3300050492 | Bacteria | 777 |
| 1744 | nmdc:mga07m45_11732_c1 | 3300050496 | Bacteria | 4611 |
| 1745 | nmdc:mga07m45_149073_c1 | 3300050496 | Bacteria | 1356 |
| 1746 | nmdc:mga07m45_161812_c1 | 3300050496 | Bacteria | 1299 |
| 1747 | nmdc:mga07m45_292859_c2 | 3300050496 | Bacteria | 576 |
| 1748 | nmdc:mga07m45_349572_c1 | 3300050496 | Bacteria | 859 |
| 1749 | nmdc:mga07m45_5415_c1 | 3300050496 | Bacteria | 6350 |
| 1750 | nmdc:mga09592_61988_c1 | 3300050508 | Bacteria | 3163 |
| 1751 | nmdc:mga0n895_246356_c1 | 3300050512 | Bacteria | 1814 |
| 1752 | nmdc:mga08x19_73253_c1 | 3300050514 | Bacteria | 2236 |
| 1753 | nmdc:mga0sz30_2131_c1 | 3300050516 | Bacteria | 3655 |
| 1754 | nmdc:mga0sz30_326574_c1 | 3300050516 | Bacteria | 685 |
| 1755 | nmdc:mga0sz30_6746_c2 | 3300050516 | Bacteria | 1712 |
| 1756 | nmdc:mga0sz30_89399_c1 | 3300050516 | Bacteria | 1339 |
| 1757 | nmdc:mga0sz30_9944_c1 | 3300050516 | Bacteria | 3633 |
| 1758 | Ga0495601_0008187 | 3300053077 | Bacteria | 6166 |
| 1759 | Ga0495601_0010722 | 3300053077 | Bacteria | 5467 |
| 1760 | Ga0495601_0287144 | 3300053077 | Bacteria | 1072 |
| 1761 | Ga0495612_0025359 | 3300053078 | Bacteria | 2380 |
| 1762 | Ga0495612_0034730 | 3300053078 | Bacteria | 2042 |
| 1763 | Ga0495612_0122477 | 3300053078 | Bacteria | 1119 |
| 1764 | Ga0495612_0350429 | 3300053078 | Bacteria | 667 |
| 1765 | Ga0500635_0320329 | 3300053080 | Bacteria | 613 |
| 1766 | Ga0495655_0251992 | 3300053083 | Bacteria | 594 |
| 1767 | Ga0495595_0016795 | 3300053084 | Bacteria | 3137 |
| 1768 | Ga0495595_0068351 | 3300053084 | Bacteria | 1675 |
| 1769 | Ga0495595_0150874 | 3300053084 | Bacteria | 1144 |
| 1770 | Ga0495619_0050871 | 3300053085 | Bacteria | 2736 |
| 1771 | Ga0495619_0079703 | 3300053085 | Bacteria | 2203 |
| 1772 | Ga0495619_0188604 | 3300053085 | Bacteria | 1427 |
| 1773 | Ga0495619_0352703 | 3300053085 | Bacteria | 1018 |
| 1774 | Ga0500578_0065527 | 3300053086 | Bacteria | 2317 |
| 1775 | Ga0500583_0476014 | 3300053092 | Bacteria | 590 |
| 1776 | Ga0500641_0000363 | 3300053096 | Bacteria | 16791 |
| 1777 | Ga0500641_0285173 | 3300053096 | Bacteria | 683 |
| 1778 | Ga0500556_0046105 | 3300053104 | Bacteria | 1558 |
| 1779 | Ga0500562_006102 | 3300053108 | Bacteria | 3034 |
| 1780 | Ga0500562_094435 | 3300053108 | Bacteria | 813 |
| 1781 | Ga0500562_190885 | 3300053108 | Bacteria | 556 |
| 1782 | Ga0500592_053543 | 3300053116 | Bacteria | 657 |
| 1783 | Ga0500642_0006030 | 3300053130 | Bacteria | 3960 |
| 1784 | Ga0500642_0281344 | 3300053130 | Bacteria | 756 |
| 1785 | Ga0500652_278957 | 3300053131 | Bacteria | 653 |
| 1786 | Ga0500658_0256755 | 3300053134 | Bacteria | 803 |
| 1787 | Ga0500559_0036373 | 3300053136 | Bacteria | 2129 |
| 1788 | Ga0500568_0069854 | 3300053139 | Bacteria | 1346 |
| 1789 | Ga0500588_0412599 | 3300053146 | Bacteria | 514 |
| 1790 | Ga0500616_0051871 | 3300053153 | Bacteria | 2159 |
| 1791 | Ga0500622_0327163 | 3300053156 | Bacteria | 644 |
| 1792 | Ga0500611_254895 | 3300053727 | Bacteria | 506 |
| 1793 | Ga0500645_000323 | 3300053730 | Bacteria | 33881 |
| 1794 | Ga0501084_0042157 | 3300054114 | Bacteria | 3817 |
| 1795 | Ga0501084_1334665 | 3300054114 | Bacteria | 601 |
| 1796 | Ga0587084_005492 | 3300059477 | Bacteria | 1503 |
| 1797 | Ga0587084_108187 | 3300059477 | Bacteria | 571 |
| 1798 | Ga0587093_058207 | 3300059478 | Bacteria | 625 |
| 1799 | Ga0587093_103445 | 3300059478 | Bacteria | 517 |
| 1800 | Ga0587066_039088 | 3300059490 | Bacteria | 886 |
| 1801 | Ga0587066_126145 | 3300059490 | Bacteria | 610 |
| 1802 | Ga0587070_041952 | 3300059491 | Bacteria | 879 |
| 1803 | Ga0587070_228714 | 3300059491 | Bacteria | 508 |
| 1804 | Ga0587073_0021819 | 3300059492 | Bacteria | 1236 |
| 1805 | Ga0587077_116916 | 3300059493 | Bacteria | 660 |
| 1806 | Ga0587080_080029 | 3300059503 | Bacteria | 669 |
| 1807 | Ga0587080_117594 | 3300059503 | Bacteria | 586 |
| 1808 | Ga0587080_127434 | 3300059503 | Bacteria | 570 |
| 1809 | Ga0587080_137077 | 3300059503 | Bacteria | 556 |
| 1810 | Ga0587082_017627 | 3300059504 | Bacteria | 1127 |
| 1811 | Ga0587082_032324 | 3300059504 | Bacteria | 919 |
| 1812 | Ga0587082_152991 | 3300059504 | Bacteria | 547 |
| 1813 | Ga0587083_0003149 | 3300059505 | Bacteria | 2154 |
| 1814 | Ga0587083_0030679 | 3300059505 | Bacteria | 1068 |
| 1815 | Ga0587086_014740 | 3300059507 | Bacteria | 1001 |
| 1816 | Ga0587088_055761 | 3300059508 | Bacteria | 787 |
| 1817 | Ga0587088_095075 | 3300059508 | Bacteria | 658 |
| 1818 | Ga0587088_117981 | 3300059508 | Bacteria | 611 |
| 1819 | Ga0587088_150846 | 3300059508 | Bacteria | 562 |
| 1820 | Ga0587091_009412 | 3300059511 | Bacteria | 1471 |
| 1821 | Ga0587091_033593 | 3300059511 | Bacteria | 976 |
| 1822 | Ga0587092_036111 | 3300059512 | Bacteria | 840 |
| 1823 | Ga0587095_036842 | 3300059514 | Bacteria | 523 |
| 1824 | Ga0587095_038656 | 3300059514 | Bacteria | 516 |
| 1825 | Ga0587098_008252 | 3300059604 | Bacteria | 1103 |
| 1826 | Ga0587106_000824 | 3300059605 | Bacteria | 2453 |
| 1827 | Ga0587106_163639 | 3300059605 | Bacteria | 503 |
| 1828 | Ga0587131_004089 | 3300059609 | Bacteria | 868 |
| 1829 | Ga0587099_048083 | 3300059622 | Bacteria | 563 |
| 1830 | Ga0587101_004376 | 3300059623 | Bacteria | 1506 |
| 1831 | Ga0587115_014968 | 3300059626 | Bacteria | 1022 |
| 1832 | Ga0587115_023589 | 3300059626 | Bacteria | 873 |
| 1833 | Ga0587117_041216 | 3300059627 | Bacteria | 736 |
| 1834 | Ga0587117_075804 | 3300059627 | Bacteria | 604 |
| 1835 | Ga0587122_005204 | 3300059628 | Bacteria | 1083 |
| 1836 | Ga0587122_016964 | 3300059628 | Bacteria | 758 |
| 1837 | Ga0587128_045795 | 3300059630 | Bacteria | 782 |
| 1838 | Ga0587128_090712 | 3300059630 | Bacteria | 626 |
| 1839 | Ga0587128_096288 | 3300059630 | Bacteria | 614 |
| 1840 | Ga0587062_002899 | 3300059639 | Bacteria | 1682 |
| 1841 | Ga0587062_016073 | 3300059639 | Bacteria | 1007 |
| 1842 | Ga0587067_211288 | 3300059640 | Bacteria | 521 |
| 1843 | Ga0587068_001416 | 3300059641 | Bacteria | 2684 |
| 1844 | Ga0587069_005095 | 3300059642 | Bacteria | 1513 |
| 1845 | Ga0587069_165265 | 3300059642 | Bacteria | 500 |
| 1846 | Ga0587072_032981 | 3300059643 | Bacteria | 975 |
| 1847 | Ga0587075_045457 | 3300059644 | Bacteria | 750 |
| 1848 | Ga0587075_046182 | 3300059644 | Bacteria | 746 |
| 1849 | Ga0587075_065116 | 3300059644 | Bacteria | 666 |
| 1850 | Ga0587076_145870 | 3300059645 | Bacteria | 570 |
| 1851 | Ga0587076_172177 | 3300059645 | Bacteria | 540 |
| 1852 | Ga0587079_044421 | 3300059647 | Bacteria | 910 |
| 1853 | Ga0587079_083719 | 3300059647 | Bacteria | 734 |
| 1854 | Ga0587079_136003 | 3300059647 | Bacteria | 622 |
| 1855 | Ga0587107_007847 | 3300059652 | Bacteria | 1214 |
| 1856 | Ga0587110_038457 | 3300059654 | Bacteria | 607 |
| 1857 | Ga0587119_016371 | 3300059658 | Bacteria | 907 |
| 1858 | Ga0587119_035124 | 3300059658 | Bacteria | 700 |
| 1859 | Ga0587124_008953 | 3300059660 | Bacteria | 869 |
| 1860 | Ga0587071_043399 | 3300060344 | Bacteria | 909 |
| 1861 | Ga0587071_100577 | 3300060344 | Bacteria | 668 |
| 1862 | Ga0587111_0018608 | 3300060346 | Bacteria | 1309 |
| 1863 | Ga0501082_0086191 | 3300060353 | Bacteria | 2709 |
| 1864 | Ga0466962_0004292 | 3300061719 | Bacteria | 6831 |
| 1865 | Ga0466962_0056659 | 3300061719 | Bacteria | 1871 |
| 1866 | Ga0466962_0058121 | 3300061719 | Bacteria | 1846 |
| 1867 | Ga0466962_0074020 | 3300061719 | Bacteria | 1628 |
| 1868 | Ga0466962_0421950 | 3300061719 | Bacteria | 669 |
| 1869 | Ga0530510_0090696 | 3300061734 | Bacteria | 2229 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032168 | Ga0316593_10009690 | Ga0316593_100096904 | 85 |
| 2 | 3300033541 | Ga0316596_1000140 | Ga0316596_100014018 | 85 |
| 3 | 3300036712 | Ga0316584_0009403 | Ga0316584_0009403_1154_1453 | 85 |
| 4 | 3300031727 | Ga0316576_10290360 | Ga0316576_102903602 | 86 |
| 5 | 3300031728 | Ga0316578_10222609 | Ga0316578_102226092 | 86 |
| 6 | 3300032133 | Ga0316583_10130276 | Ga0316583_101302762 | 86 |
| 7 | 3300032139 | Ga0316580_10219549 | Ga0316580_102195491 | 86 |
| 8 | 3300033524 | Ga0316592_1007426 | Ga0316592_10074262 | 86 |
| 9 | 3300033541 | Ga0316596_1006375 | Ga0316596_10063752 | 86 |
| 10 | 3300035398 | Ga0316574_0178719 | Ga0316574_0178719_374_673 | 86 |
| 11 | 3300036647 | Ga0316582_0520082 | Ga0316582_0520082_165_464 | 86 |
| 12 | 3300036712 | Ga0316584_0127940 | Ga0316584_0127940_927_1226 | 86 |
| 13 | 3300059605 | Ga0587106_163639 | Ga0587106_163639_110_415 | 89 |
| 14 | 3300049572 | Ga0501036_0554857 | Ga0501036_0554857_26_298 | 90 |
| 15 | 3300013104 | Ga0157370_10800213 | Ga0157370_108002132 | 91 |
| 16 | 3300049585 | Ga0501069_0119849 | Ga0501069_0119849_536_811 | 91 |
| 17 | iso_pu_bacteria | 2837183177 | 2837185923 | 91 |
| 18 | 3300005327 | Ga0070658_10670380 | Ga0070658_106703802 | 92 |
| 19 | 3300005337 | Ga0070682_100022692 | Ga0070682_1000226922 | 92 |
| 20 | 3300005341 | Ga0070691_10813303 | Ga0070691_108133032 | 92 |
| 21 | 3300005344 | Ga0070661_100538813 | Ga0070661_1005388132 | 92 |
| 22 | 3300005345 | Ga0070692_10397584 | Ga0070692_103975842 | 92 |
| 23 | 3300005347 | Ga0070668_100857714 | Ga0070668_1008577142 | 92 |
| 24 | 3300005354 | Ga0070675_101375582 | Ga0070675_1013755822 | 92 |
| 25 | 3300005366 | Ga0070659_100942734 | Ga0070659_1009427341 | 92 |
| 26 | 3300005455 | Ga0070663_100055306 | Ga0070663_1000553063 | 92 |
| 27 | 3300005535 | Ga0070684_101014798 | Ga0070684_1010147982 | 92 |
| 28 | 3300005564 | Ga0070664_100506842 | Ga0070664_1005068422 | 92 |
| 29 | 3300005615 | Ga0070702_100480967 | Ga0070702_1004809672 | 92 |
| 30 | 3300005834 | Ga0068851_10241831 | Ga0068851_102418311 | 92 |
| 31 | 3300006048 | Ga0075363_100016799 | Ga0075363_1000167995 | 92 |
| 32 | 3300006358 | Ga0068871_101296728 | Ga0068871_1012967282 | 92 |
| 33 | 3300009098 | Ga0105245_10331477 | Ga0105245_103314773 | 92 |
| 34 | 3300009174 | Ga0105241_10535843 | Ga0105241_105358432 | 92 |
| 35 | 3300009177 | Ga0105248_13310277 | Ga0105248_133102772 | 92 |
| 36 | 3300009545 | Ga0105237_11995228 | Ga0105237_119952281 | 92 |
| 37 | 3300013296 | Ga0157374_11695415 | Ga0157374_116954151 | 92 |
| 38 | 3300047320 | Ga0495672_0020537 | Ga0495672_0020537_3083_3400 | 92 |
| 39 | 3300006048 | Ga0075363_100000106 | Ga0075363_10000010624 | 93 |
| 40 | 3300006051 | Ga0075364_10000119 | Ga0075364_1000011930 | 93 |
| 41 | 3300006178 | Ga0075367_10604860 | Ga0075367_106048601 | 93 |
| 42 | 3300006186 | Ga0075369_10006299 | Ga0075369_100062995 | 93 |
| 43 | 3300006353 | Ga0075370_10014981 | Ga0075370_100149819 | 93 |
| 44 | 3300025939 | Ga0207665_10692753 | Ga0207665_106927532 | 93 |
| 45 | 3300041413 | Ga0439465_0001503 | Ga0439465_0001503_212_514 | 93 |
| 46 | 3300041997 | Ga0439431_0036551 | Ga0439431_0036551_457_759 | 93 |
| 47 | 3300042001 | Ga0439441_056669 | Ga0439441_056669_263_565 | 93 |
| 48 | 3300042436 | Ga0439435_0047473 | Ga0439435_0047473_177_479 | 93 |
| 49 | 3300044683 | Ga0466965_0085411 | Ga0466965_0085411_455_757 | 93 |
| 50 | 3300044694 | Ga0466963_0195228 | Ga0466963_0195228_99_401 | 93 |
| 51 | 3300044706 | Ga0466964_0133918 | Ga0466964_0133918_634_936 | 93 |
| 52 | 3300044706 | Ga0466964_0362360 | Ga0466964_0362360_238_540 | 93 |
| 53 | 3300044842 | Ga0466957_0456231 | Ga0466957_0456231_345_647 | 93 |
| 54 | 3300045976 | Ga0466967_0169697 | Ga0466967_0169697_480_782 | 93 |
| 55 | 3300048916 | Ga0496113_0134486 | Ga0496113_0134486_1111_1404 | 93 |
| 56 | 3300048921 | Ga0496118_0001260 | Ga0496118_0001260_14795_15097 | 93 |
| 57 | 3300048923 | Ga0496120_0030224 | Ga0496120_0030224_818_1111 | 93 |
| 58 | 3300050490 | nmdc:mga03n38_65358_c1 | nmdc:mga03n38_65358_c1_473_775 | 93 |
| 59 | 3300050491 | nmdc:mga00v17_2711_c1 | nmdc:mga00v17_2711_c1_8084_8386 | 93 |
| 60 | 3300050496 | nmdc:mga07m45_5415_c1 | nmdc:mga07m45_5415_c1_3332_3634 | 93 |
| 61 | 3300050516 | nmdc:mga0sz30_2131_c1 | nmdc:mga0sz30_2131_c1_570_872 | 93 |
| 62 | 3300050516 | nmdc:mga0sz30_6746_c2 | nmdc:mga0sz30_6746_c2_1299_1601 | 93 |
| 63 | 3300013307 | Ga0157372_10247858 | Ga0157372_102478584 | 94 |
| 64 | 3300020078 | Ga0206352_10258938 | Ga0206352_102589382 | 94 |
| 65 | 3300026121 | Ga0207683_10126952 | Ga0207683_101269521 | 94 |
| 66 | 3300041463 | Ga0451804_0321468 | Ga0451804_0321468_24_329 | 94 |
| 67 | 3300048908 | Ga0496105_0265243 | Ga0496105_0265243_687_977 | 94 |
| 68 | 3300048913 | Ga0496110_0716254 | Ga0496110_0716254_130_420 | 94 |
| 69 | 3300049570 | Ga0501033_0385905 | Ga0501033_0385905_212_502 | 94 |
| 70 | 3300049581 | Ga0501047_0187772 | Ga0501047_0187772_826_1116 | 94 |
| 71 | 3300049822 | Ga0501035_0114379 | Ga0501035_0114379_378_668 | 94 |
| 72 | 3300049823 | Ga0501044_0066267 | Ga0501044_0066267_2669_2959 | 94 |
| 73 | 3300054114 | Ga0501084_1334665 | Ga0501084_1334665_276_566 | 94 |
| 74 | 3300059490 | Ga0587066_039088 | Ga0587066_039088_152_442 | 94 |
| 75 | iso_pu_bacteria | 2558860112 | 2558913556 | 94 |
| 76 | iso_pu_bacteria | 2675903060 | 2676494456 | 94 |
| 77 | iso_pu_bacteria | 2775506925 | 2776372534 | 94 |
| 78 | iso_pu_bacteria | 2795385472 | 2795795484 | 94 |
| 79 | iso_pu_bacteria | 2863067949 | 2863070292 | 94 |
| 80 | iso_pu_bacteria | 2884693830 | 2884694815 | 94 |
| 81 | iso_pu_bacteria | 2895427314 | 2895432706 | 94 |
| 82 | iso_pu_bacteria | 2895442618 | 2895446489 | 94 |
| 83 | 3300005458 | Ga0070681_12003764 | Ga0070681_120037641 | 95 |
| 84 | 3300006175 | Ga0070712_101662177 | Ga0070712_1016621772 | 95 |
| 85 | 3300037466 | Ga0395898_0965927 | Ga0395898_0965927_255_548 | 95 |
| 86 | 3300039450 | Ga0436363_0531592 | Ga0436363_0531592_153_449 | 95 |
| 87 | 3300048929 | Ga0496126_0098258 | Ga0496126_0098258_2078_2365 | 95 |
| 88 | iso_pu_bacteria | 2643221715 | 2644635650 | 95 |
| 89 | iso_pu_bacteria | 2738541274 | 2738704768 | 95 |
| 90 | iso_pu_bacteria | 2738543028 | 2739329937 | 95 |
| 91 | iso_pu_bacteria | 2811994880 | 2812364361 | 95 |
| 92 | iso_pu_bacteria | 2842134933 | 2842136764 | 95 |
| 93 | iso_pu_bacteria | 2902810491 | 2902813733 | 95 |
| 94 | iso_pu_bacteria | 2929212328 | 2929213757 | 95 |
| 95 | 3300004798 | Ga0058859_11825311 | Ga0058859_118253112 | 96 |
| 96 | 3300004800 | Ga0058861_11824709 | Ga0058861_118247091 | 96 |
| 97 | 3300004801 | Ga0058860_10048539 | Ga0058860_100485391 | 96 |
| 98 | 3300005334 | Ga0068869_100864641 | Ga0068869_1008646412 | 96 |
| 99 | 3300005337 | Ga0070682_100948077 | Ga0070682_1009480771 | 96 |
| 100 | 3300005338 | Ga0068868_100925326 | Ga0068868_1009253262 | 96 |
| 101 | 3300005355 | Ga0070671_101310872 | Ga0070671_1013108722 | 96 |
| 102 | 3300005356 | Ga0070674_101301867 | Ga0070674_1013018672 | 96 |
| 103 | 3300005364 | Ga0070673_101708814 | Ga0070673_1017088141 | 96 |
| 104 | 3300005365 | Ga0070688_100537183 | Ga0070688_1005371832 | 96 |
| 105 | 3300005365 | Ga0070688_100737842 | Ga0070688_1007378422 | 96 |
| 106 | 3300005439 | Ga0070711_101071082 | Ga0070711_1010710822 | 96 |
| 107 | 3300005441 | Ga0070700_101725410 | Ga0070700_1017254101 | 96 |
| 108 | 3300005456 | Ga0070678_100697245 | Ga0070678_1006972452 | 96 |
| 109 | 3300005459 | Ga0068867_101116175 | Ga0068867_1011161752 | 96 |
| 110 | 3300005466 | Ga0070685_10465914 | Ga0070685_104659141 | 96 |
| 111 | 3300005535 | Ga0070684_100837851 | Ga0070684_1008378512 | 96 |
| 112 | 3300005543 | Ga0070672_100702452 | Ga0070672_1007024522 | 96 |
| 113 | 3300005615 | Ga0070702_100094575 | Ga0070702_1000945752 | 96 |
| 114 | 3300005616 | Ga0068852_100459632 | Ga0068852_1004596322 | 96 |
| 115 | 3300005618 | Ga0068864_101774768 | Ga0068864_1017747682 | 96 |
| 116 | 3300005840 | Ga0068870_10336804 | Ga0068870_103368042 | 96 |
| 117 | 3300005842 | Ga0068858_101474206 | Ga0068858_1014742062 | 96 |
| 118 | 3300006237 | Ga0097621_101044536 | Ga0097621_1010445362 | 96 |
| 119 | 3300006358 | Ga0068871_100918334 | Ga0068871_1009183342 | 96 |
| 120 | 3300006358 | Ga0068871_101138532 | Ga0068871_1011385322 | 96 |
| 121 | 3300006881 | Ga0068865_101561476 | Ga0068865_1015614762 | 96 |
| 122 | 3300009098 | Ga0105245_10176435 | Ga0105245_101764351 | 96 |
| 123 | 3300009101 | Ga0105247_10308750 | Ga0105247_103087502 | 96 |
| 124 | 3300009148 | Ga0105243_10745168 | Ga0105243_107451682 | 96 |
| 125 | 3300009148 | Ga0105243_12503314 | Ga0105243_125033142 | 96 |
| 126 | 3300009176 | Ga0105242_10751570 | Ga0105242_107515702 | 96 |
| 127 | 3300009176 | Ga0105242_12754481 | Ga0105242_127544812 | 96 |
| 128 | 3300009177 | Ga0105248_10750513 | Ga0105248_107505132 | 96 |
| 129 | 3300009553 | Ga0105249_10538049 | Ga0105249_105380492 | 96 |
| 130 | 3300010375 | Ga0105239_11465419 | Ga0105239_114654192 | 96 |
| 131 | 3300011119 | Ga0105246_11450084 | Ga0105246_114500842 | 96 |
| 132 | 3300013104 | Ga0157370_11737994 | Ga0157370_117379942 | 96 |
| 133 | 3300013105 | Ga0157369_11074293 | Ga0157369_110742932 | 96 |
| 134 | 3300013296 | Ga0157374_11477182 | Ga0157374_114771822 | 96 |
| 135 | 3300013296 | Ga0157374_11846234 | Ga0157374_118462342 | 96 |
| 136 | 3300013297 | Ga0157378_11348118 | Ga0157378_113481182 | 96 |
| 137 | 3300013306 | Ga0163162_10777606 | Ga0163162_107776061 | 96 |
| 138 | 3300013307 | Ga0157372_10718867 | Ga0157372_107188672 | 96 |
| 139 | 3300013308 | Ga0157375_11055873 | Ga0157375_110558732 | 96 |
| 140 | 3300013308 | Ga0157375_11675270 | Ga0157375_116752702 | 96 |
| 141 | 3300014325 | Ga0163163_10390101 | Ga0163163_103901012 | 96 |
| 142 | 3300014325 | Ga0163163_12309125 | Ga0163163_123091252 | 96 |
| 143 | 3300014326 | Ga0157380_10521228 | Ga0157380_105212282 | 96 |
| 144 | 3300014326 | Ga0157380_10789920 | Ga0157380_107899202 | 96 |
| 145 | 3300014326 | Ga0157380_12223396 | Ga0157380_122233962 | 96 |
| 146 | 3300014968 | Ga0157379_10485086 | Ga0157379_104850862 | 96 |
| 147 | 3300014969 | Ga0157376_10257542 | Ga0157376_102575423 | 96 |
| 148 | 3300017792 | Ga0163161_10943655 | Ga0163161_109436552 | 96 |
| 149 | 3300020069 | Ga0197907_11203916 | Ga0197907_112039162 | 96 |
| 150 | 3300020070 | Ga0206356_11160282 | Ga0206356_111602822 | 96 |
| 151 | 3300020070 | Ga0206356_11891214 | Ga0206356_118912142 | 96 |
| 152 | 3300020075 | Ga0206349_1037049 | Ga0206349_10370494 | 96 |
| 153 | 3300020075 | Ga0206349_1223679 | Ga0206349_12236791 | 96 |
| 154 | 3300020075 | Ga0206349_1737707 | Ga0206349_17377072 | 96 |
| 155 | 3300020076 | Ga0206355_1690241 | Ga0206355_16902412 | 96 |
| 156 | 3300020078 | Ga0206352_11019656 | Ga0206352_110196562 | 96 |
| 157 | 3300020081 | Ga0206354_10764178 | Ga0206354_107641782 | 96 |
| 158 | 3300020082 | Ga0206353_11303022 | Ga0206353_113030222 | 96 |
| 159 | 3300020082 | Ga0206353_11654695 | Ga0206353_116546951 | 96 |
| 160 | 3300022467 | Ga0224712_10093646 | Ga0224712_100936462 | 96 |
| 161 | 3300022467 | Ga0224712_10513828 | Ga0224712_105138282 | 96 |
| 162 | 3300025321 | Ga0207656_10191995 | Ga0207656_101919952 | 96 |
| 163 | 3300025901 | Ga0207688_10127394 | Ga0207688_101273942 | 96 |
| 164 | 3300025901 | Ga0207688_10537841 | Ga0207688_105378412 | 96 |
| 165 | 3300025908 | Ga0207643_10523333 | Ga0207643_105233332 | 96 |
| 166 | 3300025916 | Ga0207663_10806349 | Ga0207663_108063492 | 96 |
| 167 | 3300025927 | Ga0207687_10346630 | Ga0207687_103466302 | 96 |
| 168 | 3300025934 | Ga0207686_10407312 | Ga0207686_104073122 | 96 |
| 169 | 3300025935 | Ga0207709_10919582 | Ga0207709_109195822 | 96 |
| 170 | 3300025937 | Ga0207669_10734396 | Ga0207669_107343962 | 96 |
| 171 | 3300025937 | Ga0207669_11304185 | Ga0207669_113041852 | 96 |
| 172 | 3300025940 | Ga0207691_10489215 | Ga0207691_104892152 | 96 |
| 173 | 3300025960 | Ga0207651_10775105 | Ga0207651_107751052 | 96 |
| 174 | 3300025981 | Ga0207640_11804026 | Ga0207640_118040262 | 96 |
| 175 | 3300025986 | Ga0207658_11075147 | Ga0207658_110751472 | 96 |
| 176 | 3300026067 | Ga0207678_10608458 | Ga0207678_106084582 | 96 |
| 177 | 3300026088 | Ga0207641_10587032 | Ga0207641_105870322 | 96 |
| 178 | 3300026089 | Ga0207648_10843133 | Ga0207648_108431332 | 96 |
| 179 | 3300026121 | Ga0207683_10693507 | Ga0207683_106935072 | 96 |
| 180 | 3300028379 | Ga0268266_11662362 | Ga0268266_116623622 | 96 |
| 181 | 3300035171 | Ga0373946_0500664 | Ga0373946_0500664_58_354 | 96 |
| 182 | 3300036401 | Ga0373937_1470515 | Ga0373937_1470515_68_364 | 96 |
| 183 | 3300037068 | Ga0373925_0991680 | Ga0373925_0991680_290_586 | 96 |
| 184 | 3300041441 | Ga0451787_617256 | Ga0451787_617256_490_786 | 96 |
| 185 | 3300041443 | Ga0451789_0356172 | Ga0451789_0356172_1037_1333 | 96 |
| 186 | 3300041444 | Ga0451790_30083 | Ga0451790_30083_147_443 | 96 |
| 187 | 3300041446 | Ga0451794_37396 | Ga0451794_37396_270_566 | 96 |
| 188 | 3300041451 | Ga0451791_0950749 | Ga0451791_0950749_243_539 | 96 |
| 189 | 3300041452 | Ga0451793_0893875 | Ga0451793_0893875_1945_2241 | 96 |
| 190 | 3300041452 | Ga0451793_1809633 | Ga0451793_1809633_90_383 | 96 |
| 191 | 3300041453 | Ga0451797_1162958 | Ga0451797_1162958_487_783 | 96 |
| 192 | 3300041456 | Ga0451795_1158970 | Ga0451795_1158970_100_396 | 96 |
| 193 | 3300041458 | Ga0451798_0608895 | Ga0451798_0608895_201_497 | 96 |
| 194 | 3300041459 | Ga0451800_0483294 | Ga0451800_0483294_270_566 | 96 |
| 195 | 3300041463 | Ga0451804_0160498 | Ga0451804_0160498_64_360 | 96 |
| 196 | 3300041496 | Ga0451839_0255728 | Ga0451839_0255728_303_599 | 96 |
| 197 | 3300041496 | Ga0451839_0788412 | Ga0451839_0788412_161_457 | 96 |
| 198 | 3300041498 | Ga0451841_0559173 | Ga0451841_0559173_507_803 | 96 |
| 199 | 3300041507 | Ga0451851_0336391 | Ga0451851_0336391_164_460 | 96 |
| 200 | 3300041509 | Ga0451843_1227703 | Ga0451843_1227703_225_521 | 96 |
| 201 | 3300044712 | Ga0453684_1459255 | Ga0453684_1459255_161_451 | 96 |
| 202 | 3300046455 | Ga0495603_0365855 | Ga0495603_0365855_197_493 | 96 |
| 203 | 3300046459 | Ga0495629_0455882 | Ga0495629_0455882_190_486 | 96 |
| 204 | 3300046463 | Ga0495653_0302236 | Ga0495653_0302236_598_894 | 96 |
| 205 | 3300046471 | Ga0495650_0112962 | Ga0495650_0112962_22_318 | 96 |
| 206 | 3300046473 | Ga0495582_0359685 | Ga0495582_0359685_293_589 | 96 |
| 207 | 3300046477 | Ga0495664_0166328 | Ga0495664_0166328_608_904 | 96 |
| 208 | 3300046500 | Ga0495596_0413783 | Ga0495596_0413783_184_480 | 96 |
| 209 | 3300046511 | Ga0495608_0022737 | Ga0495608_0022737_3641_3937 | 96 |
| 210 | 3300046515 | Ga0495620_0124163 | Ga0495620_0124163_243_539 | 96 |
| 211 | 3300046517 | Ga0495630_1253383 | Ga0495630_1253383_155_451 | 96 |
| 212 | 3300046531 | Ga0495665_0021929 | Ga0495665_0021929_2801_3097 | 96 |
| 213 | 3300046536 | Ga0495587_0580709 | Ga0495587_0580709_100_396 | 96 |
| 214 | 3300046543 | Ga0495645_0323383 | Ga0495645_0323383_445_741 | 96 |
| 215 | 3300046642 | Ga0495634_0192584 | Ga0495634_0192584_489_785 | 96 |
| 216 | 3300046642 | Ga0495634_0543920 | Ga0495634_0543920_39_335 | 96 |
| 217 | 3300046674 | Ga0495588_0185847 | Ga0495588_0185847_583_879 | 96 |
| 218 | 3300046680 | Ga0495646_0166063 | Ga0495646_0166063_595_891 | 96 |
| 219 | 3300046683 | Ga0495658_0786005 | Ga0495658_0786005_90_386 | 96 |
| 220 | 3300046689 | Ga0495613_0812466 | Ga0495613_0812466_292_588 | 96 |
| 221 | 3300046690 | Ga0495624_0607462 | Ga0495624_0607462_284_580 | 96 |
| 222 | 3300047322 | Ga0495680_0136374 | Ga0495680_0136374_146_442 | 96 |
| 223 | 3300047322 | Ga0495680_0734873 | Ga0495680_0734873_211_507 | 96 |
| 224 | 3300048089 | Ga0495614_0096400 | Ga0495614_0096400_585_881 | 96 |
| 225 | 3300048903 | Ga0496100_0192299 | Ga0496100_0192299_49_345 | 96 |
| 226 | 3300048905 | Ga0496102_0429657 | Ga0496102_0429657_423_719 | 96 |
| 227 | 3300048905 | Ga0496102_0702133 | Ga0496102_0702133_461_757 | 96 |
| 228 | 3300048906 | Ga0496103_0085017 | Ga0496103_0085017_380_676 | 96 |
| 229 | 3300048907 | Ga0496104_0014968 | Ga0496104_0014968_1062_1358 | 96 |
| 230 | 3300048908 | Ga0496105_0104287 | Ga0496105_0104287_215_511 | 96 |
| 231 | 3300048908 | Ga0496105_1378557 | Ga0496105_1378557_146_442 | 96 |
| 232 | 3300048909 | Ga0496106_0679074 | Ga0496106_0679074_317_613 | 96 |
| 233 | 3300048910 | Ga0496107_0440191 | Ga0496107_0440191_14_310 | 96 |
| 234 | 3300048911 | Ga0496108_0001515 | Ga0496108_0001515_16132_16428 | 96 |
| 235 | 3300048911 | Ga0496108_0475841 | Ga0496108_0475841_558_854 | 96 |
| 236 | 3300048911 | Ga0496108_0949450 | Ga0496108_0949450_245_541 | 96 |
| 237 | 3300048912 | Ga0496109_0008622 | Ga0496109_0008622_2820_3116 | 96 |
| 238 | 3300048912 | Ga0496109_0147821 | Ga0496109_0147821_1417_1713 | 96 |
| 239 | 3300048912 | Ga0496109_0174571 | Ga0496109_0174571_1673_1969 | 96 |
| 240 | 3300048913 | Ga0496110_0004143 | Ga0496110_0004143_9807_10103 | 96 |
| 241 | 3300048914 | Ga0496111_0011991 | Ga0496111_0011991_368_664 | 96 |
| 242 | 3300048914 | Ga0496111_1043470 | Ga0496111_1043470_145_441 | 96 |
| 243 | 3300048915 | Ga0496112_0566398 | Ga0496112_0566398_309_605 | 96 |
| 244 | 3300048915 | Ga0496112_1298014 | Ga0496112_1298014_193_489 | 96 |
| 245 | 3300048916 | Ga0496113_0095125 | Ga0496113_0095125_1032_1328 | 96 |
| 246 | 3300048917 | Ga0496114_0037300 | Ga0496114_0037300_1858_2154 | 96 |
| 247 | 3300048917 | Ga0496114_0037365 | Ga0496114_0037365_1018_1311 | 96 |
| 248 | 3300048917 | Ga0496114_1148638 | Ga0496114_1148638_126_419 | 96 |
| 249 | 3300048918 | Ga0496115_0096285 | Ga0496115_0096285_1186_1479 | 96 |
| 250 | 3300048918 | Ga0496115_0316748 | Ga0496115_0316748_770_1066 | 96 |
| 251 | 3300049527 | Ga0501311_004858 | Ga0501311_004858_1091_1393 | 96 |
| 252 | 3300053078 | Ga0495612_0350429 | Ga0495612_0350429_122_418 | 96 |
| 253 | 3300053084 | Ga0495595_0150874 | Ga0495595_0150874_46_342 | 96 |
| 254 | 3300053085 | Ga0495619_0352703 | Ga0495619_0352703_643_939 | 96 |
| 255 | iso_pu_bacteria | 2523231044 | 2523386601 | 96 |
| 256 | iso_pu_bacteria | 2547132424 | 2548693107 | 96 |
| 257 | iso_pu_bacteria | 2551306166 | 2552105774 | 96 |
| 258 | iso_pu_bacteria | 2565956761 | 2566992659 | 96 |
| 259 | iso_pu_bacteria | 2643221692 | 2644515409 | 96 |
| 260 | iso_pu_bacteria | 2738541305 | 2738870335 | 96 |
| 261 | iso_pu_bacteria | 2738541308 | 2738887459 | 96 |
| 262 | iso_pu_bacteria | 2738543005 | 2739202792 | 96 |
| 263 | iso_pu_bacteria | 2738543011 | 2739236885 | 96 |
| 264 | iso_pu_bacteria | 2889300758 | 2889305778 | 96 |
| 265 | iso_pu_bacteria | 2904535858 | 2904538390 | 96 |
| 266 | iso_pu_bacteria | 2919713450 | 2919718241 | 96 |
| 267 | iso_pu_bacteria | 2922554459 | 2922559122 | 96 |
| 268 | iso_pu_bacteria | 2928142448 | 2928142991 | 96 |
| 269 | iso_pu_bacteria | 2939743619 | 2939743914 | 96 |
| 270 | iso_pu_bacteria | 2974315732 | 2974316188 | 96 |
| 271 | iso_pu_bacteria | 2984523437 | 2984524351 | 96 |
| 272 | 3300001976 | JGI24752J21851_1048383 | JGI24752J21851_10483831 | 97 |
| 273 | 3300001977 | JGI24746J21847_1041178 | JGI24746J21847_10411782 | 97 |
| 274 | 3300001979 | JGI24740J21852_10117882 | JGI24740J21852_101178822 | 97 |
| 275 | 3300001989 | JGI24739J22299_10163606 | JGI24739J22299_101636061 | 97 |
| 276 | 3300001991 | JGI24743J22301_10137210 | JGI24743J22301_101372102 | 97 |
| 277 | 3300002239 | JGI24034J26672_10089570 | JGI24034J26672_100895701 | 97 |
| 278 | 3300003659 | JGI25404J52841_10006168 | JGI25404J52841_100061682 | 97 |
| 279 | 3300004798 | Ga0058859_11439842 | Ga0058859_114398421 | 97 |
| 280 | 3300004799 | Ga0058863_11747712 | Ga0058863_117477122 | 97 |
| 281 | 3300004800 | Ga0058861_11989029 | Ga0058861_119890292 | 97 |
| 282 | 3300004801 | Ga0058860_11752377 | Ga0058860_117523772 | 97 |
| 283 | 3300004803 | Ga0058862_12845447 | Ga0058862_128454472 | 97 |
| 284 | 3300005327 | Ga0070658_10022118 | Ga0070658_100221185 | 97 |
| 285 | 3300005329 | Ga0070683_100045429 | Ga0070683_1000454292 | 97 |
| 286 | 3300005330 | Ga0070690_100028148 | Ga0070690_1000281485 | 97 |
| 287 | 3300005331 | Ga0070670_100546979 | Ga0070670_1005469792 | 97 |
| 288 | 3300005334 | Ga0068869_100046622 | Ga0068869_1000466222 | 97 |
| 289 | 3300005334 | Ga0068869_101189683 | Ga0068869_1011896831 | 97 |
| 290 | 3300005335 | Ga0070666_10108142 | Ga0070666_101081423 | 97 |
| 291 | 3300005336 | Ga0070680_100157136 | Ga0070680_1001571363 | 97 |
| 292 | 3300005337 | Ga0070682_100027729 | Ga0070682_1000277295 | 97 |
| 293 | 3300005338 | Ga0068868_100282852 | Ga0068868_1002828522 | 97 |
| 294 | 3300005339 | Ga0070660_100026612 | Ga0070660_1000266124 | 97 |
| 295 | 3300005339 | Ga0070660_100914988 | Ga0070660_1009149882 | 97 |
| 296 | 3300005340 | Ga0070689_100137123 | Ga0070689_1001371232 | 97 |
| 297 | 3300005341 | Ga0070691_10022947 | Ga0070691_100229472 | 97 |
| 298 | 3300005343 | Ga0070687_100066257 | Ga0070687_1000662573 | 97 |
| 299 | 3300005344 | Ga0070661_100079586 | Ga0070661_1000795863 | 97 |
| 300 | 3300005345 | Ga0070692_10140201 | Ga0070692_101402012 | 97 |
| 301 | 3300005347 | Ga0070668_100065951 | Ga0070668_1000659515 | 97 |
| 302 | 3300005353 | Ga0070669_100327330 | Ga0070669_1003273302 | 97 |
| 303 | 3300005354 | Ga0070675_100153185 | Ga0070675_1001531852 | 97 |
| 304 | 3300005355 | Ga0070671_100146598 | Ga0070671_1001465983 | 97 |
| 305 | 3300005364 | Ga0070673_100221043 | Ga0070673_1002210433 | 97 |
| 306 | 3300005365 | Ga0070688_100117492 | Ga0070688_1001174923 | 97 |
| 307 | 3300005366 | Ga0070659_100010814 | Ga0070659_1000108144 | 97 |
| 308 | 3300005366 | Ga0070659_101830784 | Ga0070659_1018307842 | 97 |
| 309 | 3300005367 | Ga0070667_100016592 | Ga0070667_1000165928 | 97 |
| 310 | 3300005367 | Ga0070667_102324235 | Ga0070667_1023242351 | 97 |
| 311 | 3300005406 | Ga0070703_10009587 | Ga0070703_100095872 | 97 |
| 312 | 3300005438 | Ga0070701_10018401 | Ga0070701_100184014 | 97 |
| 313 | 3300005439 | Ga0070711_101718225 | Ga0070711_1017182251 | 97 |
| 314 | 3300005440 | Ga0070705_100052016 | Ga0070705_1000520162 | 97 |
| 315 | 3300005441 | Ga0070700_100028068 | Ga0070700_1000280685 | 97 |
| 316 | 3300005444 | Ga0070694_100371787 | Ga0070694_1003717872 | 97 |
| 317 | 3300005445 | Ga0070708_100138579 | Ga0070708_1001385792 | 97 |
| 318 | 3300005445 | Ga0070708_100141379 | Ga0070708_1001413793 | 97 |
| 319 | 3300005455 | Ga0070663_100003713 | Ga0070663_10000371314 | 97 |
| 320 | 3300005455 | Ga0070663_100152220 | Ga0070663_1001522203 | 97 |
| 321 | 3300005457 | Ga0070662_100041413 | Ga0070662_1000414135 | 97 |
| 322 | 3300005458 | Ga0070681_10043340 | Ga0070681_100433405 | 97 |
| 323 | 3300005458 | Ga0070681_11274041 | Ga0070681_112740411 | 97 |
| 324 | 3300005459 | Ga0068867_100116417 | Ga0068867_1001164172 | 97 |
| 325 | 3300005466 | Ga0070685_10026200 | Ga0070685_100262005 | 97 |
| 326 | 3300005467 | Ga0070706_100083112 | Ga0070706_1000831123 | 97 |
| 327 | 3300005467 | Ga0070706_100114177 | Ga0070706_1001141772 | 97 |
| 328 | 3300005471 | Ga0070698_100090705 | Ga0070698_1000907053 | 97 |
| 329 | 3300005471 | Ga0070698_100142295 | Ga0070698_1001422953 | 97 |
| 330 | 3300005518 | Ga0070699_100097370 | Ga0070699_1000973703 | 97 |
| 331 | 3300005530 | Ga0070679_100174430 | Ga0070679_1001744302 | 97 |
| 332 | 3300005530 | Ga0070679_100983619 | Ga0070679_1009836192 | 97 |
| 333 | 3300005535 | Ga0070684_100020206 | Ga0070684_1000202064 | 97 |
| 334 | 3300005536 | Ga0070697_100016947 | Ga0070697_1000169474 | 97 |
| 335 | 3300005539 | Ga0068853_100336667 | Ga0068853_1003366672 | 97 |
| 336 | 3300005543 | Ga0070672_100111347 | Ga0070672_1001113474 | 97 |
| 337 | 3300005544 | Ga0070686_100071082 | Ga0070686_1000710822 | 97 |
| 338 | 3300005545 | Ga0070695_100077745 | Ga0070695_1000777452 | 97 |
| 339 | 3300005546 | Ga0070696_100104744 | Ga0070696_1001047443 | 97 |
| 340 | 3300005547 | Ga0070693_100031013 | Ga0070693_1000310133 | 97 |
| 341 | 3300005548 | Ga0070665_100230283 | Ga0070665_1002302832 | 97 |
| 342 | 3300005548 | Ga0070665_100360166 | Ga0070665_1003601663 | 97 |
| 343 | 3300005549 | Ga0070704_100019131 | Ga0070704_1000191312 | 97 |
| 344 | 3300005563 | Ga0068855_100559322 | Ga0068855_1005593222 | 97 |
| 345 | 3300005564 | Ga0070664_100238332 | Ga0070664_1002383322 | 97 |
| 346 | 3300005577 | Ga0068857_100023375 | Ga0068857_1000233755 | 97 |
| 347 | 3300005578 | Ga0068854_100024677 | Ga0068854_1000246773 | 97 |
| 348 | 3300005614 | Ga0068856_100754456 | Ga0068856_1007544562 | 97 |
| 349 | 3300005614 | Ga0068856_100883884 | Ga0068856_1008838842 | 97 |
| 350 | 3300005614 | Ga0068856_102289352 | Ga0068856_1022893522 | 97 |
| 351 | 3300005615 | Ga0070702_100010220 | Ga0070702_1000102208 | 97 |
| 352 | 3300005616 | Ga0068852_100104920 | Ga0068852_1001049204 | 97 |
| 353 | 3300005618 | Ga0068864_100093687 | Ga0068864_1000936873 | 97 |
| 354 | 3300005718 | Ga0068866_10006852 | Ga0068866_100068526 | 97 |
| 355 | 3300005719 | Ga0068861_100035902 | Ga0068861_1000359024 | 97 |
| 356 | 3300005834 | Ga0068851_10035205 | Ga0068851_100352052 | 97 |
| 357 | 3300005840 | Ga0068870_10006791 | Ga0068870_100067918 | 97 |
| 358 | 3300005841 | Ga0068863_100427239 | Ga0068863_1004272392 | 97 |
| 359 | 3300005842 | Ga0068858_100365427 | Ga0068858_1003654272 | 97 |
| 360 | 3300005843 | Ga0068860_100138668 | Ga0068860_1001386683 | 97 |
| 361 | 3300005844 | Ga0068862_100760369 | Ga0068862_1007603692 | 97 |
| 362 | 3300005937 | Ga0081455_10730822 | Ga0081455_107308222 | 97 |
| 363 | 3300005983 | Ga0081540_1000341 | Ga0081540_100034138 | 97 |
| 364 | 3300006163 | Ga0070715_10084272 | Ga0070715_100842722 | 97 |
| 365 | 3300006237 | Ga0097621_100099184 | Ga0097621_1000991843 | 97 |
| 366 | 3300006358 | Ga0068871_100065721 | Ga0068871_1000657212 | 97 |
| 367 | 3300006852 | Ga0075433_10233530 | Ga0075433_102335302 | 97 |
| 368 | 3300006871 | Ga0075434_100205355 | Ga0075434_1002053555 | 97 |
| 369 | 3300006881 | Ga0068865_100742020 | Ga0068865_1007420202 | 97 |
| 370 | 3300009093 | Ga0105240_10046258 | Ga0105240_100462586 | 97 |
| 371 | 3300009093 | Ga0105240_10573941 | Ga0105240_105739412 | 97 |
| 372 | 3300009098 | Ga0105245_10336107 | Ga0105245_103361072 | 97 |
| 373 | 3300009101 | Ga0105247_10107294 | Ga0105247_101072942 | 97 |
| 374 | 3300009148 | Ga0105243_10092563 | Ga0105243_100925635 | 97 |
| 375 | 3300009174 | Ga0105241_10193643 | Ga0105241_101936432 | 97 |
| 376 | 3300009176 | Ga0105242_10105857 | Ga0105242_101058573 | 97 |
| 377 | 3300009176 | Ga0105242_10153537 | Ga0105242_101535372 | 97 |
| 378 | 3300009177 | Ga0105248_10360972 | Ga0105248_103609723 | 97 |
| 379 | 3300009545 | Ga0105237_11292109 | Ga0105237_112921092 | 97 |
| 380 | 3300009551 | Ga0105238_10305375 | Ga0105238_103053753 | 97 |
| 381 | 3300009551 | Ga0105238_11709485 | Ga0105238_117094852 | 97 |
| 382 | 3300009553 | Ga0105249_10380345 | Ga0105249_103803453 | 97 |
| 383 | 3300010375 | Ga0105239_10141441 | Ga0105239_101414415 | 97 |
| 384 | 3300011119 | Ga0105246_10025484 | Ga0105246_100254844 | 97 |
| 385 | 3300011119 | Ga0105246_11210957 | Ga0105246_112109572 | 97 |
| 386 | 3300012488 | Ga0157343_1003579 | Ga0157343_10035792 | 97 |
| 387 | 3300012492 | Ga0157335_1000629 | Ga0157335_10006292 | 97 |
| 388 | 3300012494 | Ga0157341_1001661 | Ga0157341_10016612 | 97 |
| 389 | 3300012497 | Ga0157319_1008542 | Ga0157319_10085422 | 97 |
| 390 | 3300012506 | Ga0157324_1012408 | Ga0157324_10124082 | 97 |
| 391 | 3300012507 | Ga0157342_1000500 | Ga0157342_10005004 | 97 |
| 392 | 3300013100 | Ga0157373_10042038 | Ga0157373_100420385 | 97 |
| 393 | 3300013100 | Ga0157373_10411165 | Ga0157373_104111652 | 97 |
| 394 | 3300013102 | Ga0157371_10024599 | Ga0157371_100245995 | 97 |
| 395 | 3300013102 | Ga0157371_10597225 | Ga0157371_105972252 | 97 |
| 396 | 3300013104 | Ga0157370_10172213 | Ga0157370_101722132 | 97 |
| 397 | 3300013105 | Ga0157369_11599565 | Ga0157369_115995651 | 97 |
| 398 | 3300013296 | Ga0157374_11470717 | Ga0157374_114707171 | 97 |
| 399 | 3300013296 | Ga0157374_11714662 | Ga0157374_117146621 | 97 |
| 400 | 3300013296 | Ga0157374_11796706 | Ga0157374_117967062 | 97 |
| 401 | 3300013297 | Ga0157378_10040112 | Ga0157378_100401129 | 97 |
| 402 | 3300013306 | Ga0163162_10091937 | Ga0163162_100919375 | 97 |
| 403 | 3300013307 | Ga0157372_10303539 | Ga0157372_103035394 | 97 |
| 404 | 3300013308 | Ga0157375_10091509 | Ga0157375_100915092 | 97 |
| 405 | 3300014325 | Ga0163163_10034337 | Ga0163163_100343373 | 97 |
| 406 | 3300014326 | Ga0157380_10204736 | Ga0157380_102047362 | 97 |
| 407 | 3300014497 | Ga0182008_10023005 | Ga0182008_100230054 | 97 |
| 408 | 3300014745 | Ga0157377_10023097 | Ga0157377_100230973 | 97 |
| 409 | 3300014969 | Ga0157376_10044967 | Ga0157376_100449678 | 97 |
| 410 | 3300017792 | Ga0163161_10249662 | Ga0163161_102496622 | 97 |
| 411 | 3300020069 | Ga0197907_11065209 | Ga0197907_110652094 | 97 |
| 412 | 3300020070 | Ga0206356_10809245 | Ga0206356_108092455 | 97 |
| 413 | 3300020075 | Ga0206349_1519183 | Ga0206349_15191832 | 97 |
| 414 | 3300020075 | Ga0206349_1522805 | Ga0206349_15228052 | 97 |
| 415 | 3300020076 | Ga0206355_1015855 | Ga0206355_10158552 | 97 |
| 416 | 3300020078 | Ga0206352_10139106 | Ga0206352_101391061 | 97 |
| 417 | 3300020080 | Ga0206350_10667397 | Ga0206350_106673975 | 97 |
| 418 | 3300020081 | Ga0206354_11319487 | Ga0206354_113194873 | 97 |
| 419 | 3300020082 | Ga0206353_10229932 | Ga0206353_102299322 | 97 |
| 420 | 3300021384 | Ga0213876_10496274 | Ga0213876_104962742 | 97 |
| 421 | 3300021388 | Ga0213875_10052334 | Ga0213875_100523343 | 97 |
| 422 | 3300022467 | Ga0224712_10000978 | Ga0224712_100009782 | 97 |
| 423 | 3300025321 | Ga0207656_10181829 | Ga0207656_101818292 | 97 |
| 424 | 3300025885 | Ga0207653_10082305 | Ga0207653_100823052 | 97 |
| 425 | 3300025898 | Ga0207692_10026725 | Ga0207692_100267254 | 97 |
| 426 | 3300025899 | Ga0207642_10064228 | Ga0207642_100642282 | 97 |
| 427 | 3300025900 | Ga0207710_10004294 | Ga0207710_100042942 | 97 |
| 428 | 3300025901 | Ga0207688_10001159 | Ga0207688_100011594 | 97 |
| 429 | 3300025903 | Ga0207680_10047203 | Ga0207680_100472035 | 97 |
| 430 | 3300025904 | Ga0207647_10291056 | Ga0207647_102910562 | 97 |
| 431 | 3300025905 | Ga0207685_10020620 | Ga0207685_100206202 | 97 |
| 432 | 3300025906 | Ga0207699_10001668 | Ga0207699_1000166819 | 97 |
| 433 | 3300025907 | Ga0207645_10039213 | Ga0207645_100392135 | 97 |
| 434 | 3300025908 | Ga0207643_10014701 | Ga0207643_100147015 | 97 |
| 435 | 3300025909 | Ga0207705_10226135 | Ga0207705_102261353 | 97 |
| 436 | 3300025910 | Ga0207684_10177547 | Ga0207684_101775472 | 97 |
| 437 | 3300025911 | Ga0207654_10220234 | Ga0207654_102202342 | 97 |
| 438 | 3300025912 | Ga0207707_10121849 | Ga0207707_101218494 | 97 |
| 439 | 3300025912 | Ga0207707_10717986 | Ga0207707_107179862 | 97 |
| 440 | 3300025913 | Ga0207695_10697384 | Ga0207695_106973842 | 97 |
| 441 | 3300025914 | Ga0207671_10153860 | Ga0207671_101538603 | 97 |
| 442 | 3300025914 | Ga0207671_10767961 | Ga0207671_107679612 | 97 |
| 443 | 3300025916 | Ga0207663_10060919 | Ga0207663_100609192 | 97 |
| 444 | 3300025916 | Ga0207663_11657398 | Ga0207663_116573982 | 97 |
| 445 | 3300025917 | Ga0207660_10155588 | Ga0207660_101555883 | 97 |
| 446 | 3300025918 | Ga0207662_10002882 | Ga0207662_100028825 | 97 |
| 447 | 3300025919 | Ga0207657_10001387 | Ga0207657_1000138739 | 97 |
| 448 | 3300025920 | Ga0207649_10330176 | Ga0207649_103301762 | 97 |
| 449 | 3300025921 | Ga0207652_10531151 | Ga0207652_105311512 | 97 |
| 450 | 3300025922 | Ga0207646_10089945 | Ga0207646_100899453 | 97 |
| 451 | 3300025923 | Ga0207681_10889624 | Ga0207681_108896242 | 97 |
| 452 | 3300025924 | Ga0207694_10282726 | Ga0207694_102827262 | 97 |
| 453 | 3300025926 | Ga0207659_10141498 | Ga0207659_101414982 | 97 |
| 454 | 3300025927 | Ga0207687_10005166 | Ga0207687_100051663 | 97 |
| 455 | 3300025928 | Ga0207700_10007511 | Ga0207700_100075115 | 97 |
| 456 | 3300025929 | Ga0207664_10003003 | Ga0207664_100030035 | 97 |
| 457 | 3300025931 | Ga0207644_10190213 | Ga0207644_101902132 | 97 |
| 458 | 3300025932 | Ga0207690_10087503 | Ga0207690_100875034 | 97 |
| 459 | 3300025933 | Ga0207706_10046783 | Ga0207706_100467835 | 97 |
| 460 | 3300025934 | Ga0207686_10102386 | Ga0207686_101023863 | 97 |
| 461 | 3300025935 | Ga0207709_10104660 | Ga0207709_101046603 | 97 |
| 462 | 3300025936 | Ga0207670_10043292 | Ga0207670_100432923 | 97 |
| 463 | 3300025938 | Ga0207704_11619242 | Ga0207704_116192422 | 97 |
| 464 | 3300025939 | Ga0207665_10995262 | Ga0207665_109952622 | 97 |
| 465 | 3300025940 | Ga0207691_10734719 | Ga0207691_107347192 | 97 |
| 466 | 3300025941 | Ga0207711_10542923 | Ga0207711_105429232 | 97 |
| 467 | 3300025942 | Ga0207689_10002936 | Ga0207689_1000293627 | 97 |
| 468 | 3300025944 | Ga0207661_10187724 | Ga0207661_101877243 | 97 |
| 469 | 3300025945 | Ga0207679_10635713 | Ga0207679_106357132 | 97 |
| 470 | 3300025949 | Ga0207667_10053296 | Ga0207667_100532969 | 97 |
| 471 | 3300025949 | Ga0207667_11869828 | Ga0207667_118698282 | 97 |
| 472 | 3300025960 | Ga0207651_10700077 | Ga0207651_107000772 | 97 |
| 473 | 3300025961 | Ga0207712_10093206 | Ga0207712_100932064 | 97 |
| 474 | 3300025981 | Ga0207640_10129601 | Ga0207640_101296014 | 97 |
| 475 | 3300025986 | Ga0207658_10088255 | Ga0207658_100882552 | 97 |
| 476 | 3300026023 | Ga0207677_10594683 | Ga0207677_105946832 | 97 |
| 477 | 3300026023 | Ga0207677_11839907 | Ga0207677_118399073 | 97 |
| 478 | 3300026041 | Ga0207639_10307407 | Ga0207639_103074072 | 97 |
| 479 | 3300026067 | Ga0207678_10002587 | Ga0207678_100025879 | 97 |
| 480 | 3300026075 | Ga0207708_10612653 | Ga0207708_106126532 | 97 |
| 481 | 3300026078 | Ga0207702_10003344 | Ga0207702_100033446 | 97 |
| 482 | 3300026078 | Ga0207702_10628748 | Ga0207702_106287482 | 97 |
| 483 | 3300026088 | Ga0207641_10012413 | Ga0207641_100124133 | 97 |
| 484 | 3300026089 | Ga0207648_10133353 | Ga0207648_101333532 | 97 |
| 485 | 3300026095 | Ga0207676_10074155 | Ga0207676_100741552 | 97 |
| 486 | 3300026116 | Ga0207674_10006508 | Ga0207674_1000650816 | 97 |
| 487 | 3300026118 | Ga0207675_100010883 | Ga0207675_1000108834 | 97 |
| 488 | 3300026121 | Ga0207683_10002849 | Ga0207683_1000284926 | 97 |
| 489 | 3300026142 | Ga0207698_10005035 | Ga0207698_100050359 | 97 |
| 490 | 3300028379 | Ga0268266_10232699 | Ga0268266_102326993 | 97 |
| 491 | 3300028380 | Ga0268265_10217831 | Ga0268265_102178312 | 97 |
| 492 | 3300028381 | Ga0268264_10102783 | Ga0268264_101027833 | 97 |
| 493 | 3300031090 | Ga0265760_10181673 | Ga0265760_101816732 | 97 |
| 494 | 3300031903 | Ga0307407_10941070 | Ga0307407_109410702 | 97 |
| 495 | 3300034816 | Ga0373930_0011251 | Ga0373930_0011251_819_1112 | 97 |
| 496 | 3300034818 | Ga0373950_0020903 | Ga0373950_0020903_323_616 | 97 |
| 497 | 3300034957 | Ga0373938_0092642 | Ga0373938_0092642_342_635 | 97 |
| 498 | 3300035083 | Ga0373926_0017223 | Ga0373926_0017223_1963_2256 | 97 |
| 499 | 3300035084 | Ga0373928_0069499 | Ga0373928_0069499_214_507 | 97 |
| 500 | 3300035085 | Ga0373929_0175187 | Ga0373929_0175187_138_431 | 97 |
| 501 | 3300035086 | Ga0373934_0007912 | Ga0373934_0007912_1998_2291 | 97 |
| 502 | 3300035088 | Ga0373940_0051015 | Ga0373940_0051015_388_681 | 97 |
| 503 | 3300035089 | Ga0373944_0106580 | Ga0373944_0106580_443_736 | 97 |
| 504 | 3300035090 | Ga0373949_0014280 | Ga0373949_0014280_1170_1463 | 97 |
| 505 | 3300035111 | Ga0373923_0013637 | Ga0373923_0013637_90_383 | 97 |
| 506 | 3300035112 | Ga0373932_0009133 | Ga0373932_0009133_1641_1934 | 97 |
| 507 | 3300035113 | Ga0373936_0037173 | Ga0373936_0037173_443_736 | 97 |
| 508 | 3300035114 | Ga0373939_0045832 | Ga0373939_0045832_720_1013 | 97 |
| 509 | 3300035115 | Ga0373941_0174177 | Ga0373941_0174177_351_644 | 97 |
| 510 | 3300035116 | Ga0373945_0016245 | Ga0373945_0016245_1154_1447 | 97 |
| 511 | 3300035117 | Ga0373953_0083777 | Ga0373953_0083777_980_1273 | 97 |
| 512 | 3300035117 | Ga0373953_0509671 | Ga0373953_0509671_185_478 | 97 |
| 513 | 3300035118 | Ga0373954_0048565 | Ga0373954_0048565_1491_1784 | 97 |
| 514 | 3300035119 | Ga0373956_0013875 | Ga0373956_0013875_899_1192 | 97 |
| 515 | 3300035120 | Ga0373957_0005448 | Ga0373957_0005448_1997_2290 | 97 |
| 516 | 3300035170 | Ga0373943_0021734 | Ga0373943_0021734_571_864 | 97 |
| 517 | 3300035171 | Ga0373946_0009470 | Ga0373946_0009470_2657_2950 | 97 |
| 518 | 3300035172 | Ga0373955_0322328 | Ga0373955_0322328_443_736 | 97 |
| 519 | 3300035207 | Ga0373942_0032481 | Ga0373942_0032481_881_1174 | 97 |
| 520 | 3300035241 | Ga0373961_0061853 | Ga0373961_0061853_711_1004 | 97 |
| 521 | 3300035398 | Ga0316574_0431488 | Ga0316574_0431488_245_538 | 97 |
| 522 | 3300035410 | Ga0373924_0013498 | Ga0373924_0013498_571_864 | 97 |
| 523 | 3300035410 | Ga0373924_0154129 | Ga0373924_0154129_66_359 | 97 |
| 524 | 3300035692 | Ga0373935_0060354 | Ga0373935_0060354_2020_2313 | 97 |
| 525 | 3300035695 | Ga0373927_0013458 | Ga0373927_0013458_1665_1958 | 97 |
| 526 | 3300035724 | Ga0373933_0068897 | Ga0373933_0068897_1842_2135 | 97 |
| 527 | 3300035725 | Ga0373947_0034342 | Ga0373947_0034342_189_482 | 97 |
| 528 | 3300036401 | Ga0373937_0342156 | Ga0373937_0342156_338_631 | 97 |
| 529 | 3300036459 | Ga0372808_032497 | Ga0372808_032497_206_499 | 97 |
| 530 | 3300037068 | Ga0373925_0065617 | Ga0373925_0065617_1871_2164 | 97 |
| 531 | 3300037312 | Ga0395899_0331641 | Ga0395899_0331641_391_690 | 97 |
| 532 | 3300037312 | Ga0395899_0587271 | Ga0395899_0587271_277_570 | 97 |
| 533 | 3300037418 | Ga0395900_0215391 | Ga0395900_0215391_776_1075 | 97 |
| 534 | 3300037466 | Ga0395898_0036774 | Ga0395898_0036774_2050_2349 | 97 |
| 535 | 3300037471 | Ga0395905_0065150 | Ga0395905_0065150_393_692 | 97 |
| 536 | 3300037853 | Ga0436364_0487881 | Ga0436364_0487881_155_448 | 97 |
| 537 | 3300037853 | Ga0436364_0754979 | Ga0436364_0754979_181_474 | 97 |
| 538 | 3300037853 | Ga0436364_0844017 | Ga0436364_0844017_784_1077 | 97 |
| 539 | 3300037853 | Ga0436364_1292141 | Ga0436364_1292141_1689_1982 | 97 |
| 540 | 3300038443 | Ga0395901_0156631 | Ga0395901_0156631_665_964 | 97 |
| 541 | 3300039437 | Ga0436365_1866547 | Ga0436365_1866547_1465_1758 | 97 |
| 542 | 3300039450 | Ga0436363_1188024 | Ga0436363_1188024_166_459 | 97 |
| 543 | 3300041503 | Ga0451847_0197256 | Ga0451847_0197256_216_509 | 97 |
| 544 | 3300044684 | Ga0466966_0213131 | Ga0466966_0213131_660_953 | 97 |
| 545 | 3300044693 | Ga0466961_0486598 | Ga0466961_0486598_99_392 | 97 |
| 546 | 3300044694 | Ga0466963_0392175 | Ga0466963_0392175_303_596 | 97 |
| 547 | 3300044694 | Ga0466963_0445545 | Ga0466963_0445545_493_786 | 97 |
| 548 | 3300044765 | Ga0466970_0207195 | Ga0466970_0207195_282_617 | 97 |
| 549 | 3300045836 | Ga0466958_0545140 | Ga0466958_0545140_127_420 | 97 |
| 550 | 3300045836 | Ga0466958_1043655 | Ga0466958_1043655_103_396 | 97 |
| 551 | 3300046454 | Ga0495592_0061738 | Ga0495592_0061738_1855_2148 | 97 |
| 552 | 3300046459 | Ga0495629_0004222 | Ga0495629_0004222_6227_6520 | 97 |
| 553 | 3300046461 | Ga0495641_0009678 | Ga0495641_0009678_3299_3592 | 97 |
| 554 | 3300046461 | Ga0495641_0254813 | Ga0495641_0254813_280_579 | 97 |
| 555 | 3300046462 | Ga0495651_0022386 | Ga0495651_0022386_2128_2421 | 97 |
| 556 | 3300046463 | Ga0495653_0052007 | Ga0495653_0052007_1665_1958 | 97 |
| 557 | 3300046463 | Ga0495653_0333030 | Ga0495653_0333030_181_480 | 97 |
| 558 | 3300046472 | Ga0495580_0032022 | Ga0495580_0032022_2042_2335 | 97 |
| 559 | 3300046473 | Ga0495582_0009125 | Ga0495582_0009125_2774_3067 | 97 |
| 560 | 3300046473 | Ga0495582_0287109 | Ga0495582_0287109_490_789 | 97 |
| 561 | 3300046475 | Ga0495639_0025869 | Ga0495639_0025869_1114_1407 | 97 |
| 562 | 3300046475 | Ga0495639_0163193 | Ga0495639_0163193_551_844 | 97 |
| 563 | 3300046476 | Ga0495662_0010086 | Ga0495662_0010086_2259_2552 | 97 |
| 564 | 3300046477 | Ga0495664_0073258 | Ga0495664_0073258_1312_1605 | 97 |
| 565 | 3300046499 | Ga0495594_0019876 | Ga0495594_0019876_639_932 | 97 |
| 566 | 3300046500 | Ga0495596_0289901 | Ga0495596_0289901_53_352 | 97 |
| 567 | 3300046511 | Ga0495608_0045500 | Ga0495608_0045500_2576_2869 | 97 |
| 568 | 3300046511 | Ga0495608_0463022 | Ga0495608_0463022_202_501 | 97 |
| 569 | 3300046514 | Ga0495618_0041394 | Ga0495618_0041394_2166_2459 | 97 |
| 570 | 3300046516 | Ga0495628_0006081 | Ga0495628_0006081_3506_3799 | 97 |
| 571 | 3300046517 | Ga0495630_0070040 | Ga0495630_0070040_2256_2549 | 97 |
| 572 | 3300046519 | Ga0495632_0386319 | Ga0495632_0386319_59_358 | 97 |
| 573 | 3300046526 | Ga0495666_0020565 | Ga0495666_0020565_1312_1605 | 97 |
| 574 | 3300046529 | Ga0495652_0078581 | Ga0495652_0078581_1528_1821 | 97 |
| 575 | 3300046531 | Ga0495665_0010115 | Ga0495665_0010115_2798_3091 | 97 |
| 576 | 3300046533 | Ga0495640_0009511 | Ga0495640_0009511_571_864 | 97 |
| 577 | 3300046535 | Ga0495586_0026425 | Ga0495586_0026425_2597_2890 | 97 |
| 578 | 3300046536 | Ga0495587_0270951 | Ga0495587_0270951_217_510 | 97 |
| 579 | 3300046543 | Ga0495645_0014290 | Ga0495645_0014290_2038_2331 | 97 |
| 580 | 3300046559 | Ga0495667_0089320 | Ga0495667_0089320_521_814 | 97 |
| 581 | 3300046559 | Ga0495667_0099963 | Ga0495667_0099963_848_1141 | 97 |
| 582 | 3300046616 | Ga0495668_0128569 | Ga0495668_0128569_17_316 | 97 |
| 583 | 3300046642 | Ga0495634_0015911 | Ga0495634_0015911_4653_4946 | 97 |
| 584 | 3300046663 | Ga0495635_0028891 | Ga0495635_0028891_2378_2671 | 97 |
| 585 | 3300046674 | Ga0495588_0066400 | Ga0495588_0066400_941_1234 | 97 |
| 586 | 3300046675 | Ga0495657_0453603 | Ga0495657_0453603_443_736 | 97 |
| 587 | 3300046678 | Ga0495599_0027775 | Ga0495599_0027775_1941_2234 | 97 |
| 588 | 3300046679 | Ga0495623_0066615 | Ga0495623_0066615_1450_1743 | 97 |
| 589 | 3300046680 | Ga0495646_0013551 | Ga0495646_0013551_4448_4741 | 97 |
| 590 | 3300046681 | Ga0495647_0007780 | Ga0495647_0007780_1643_1936 | 97 |
| 591 | 3300046683 | Ga0495658_0005793 | Ga0495658_0005793_3790_4083 | 97 |
| 592 | 3300046683 | Ga0495658_0541312 | Ga0495658_0541312_261_560 | 97 |
| 593 | 3300046689 | Ga0495613_0017693 | Ga0495613_0017693_347_640 | 97 |
| 594 | 3300046690 | Ga0495624_0032525 | Ga0495624_0032525_1443_1736 | 97 |
| 595 | 3300046809 | Ga0495600_0044801 | Ga0495600_0044801_1409_1702 | 97 |
| 596 | 3300047317 | Ga0495604_0092975 | Ga0495604_0092975_1497_1790 | 97 |
| 597 | 3300047319 | Ga0495674_0082380 | Ga0495674_0082380_2376_2669 | 97 |
| 598 | 3300047319 | Ga0495674_0217428 | Ga0495674_0217428_123_422 | 97 |
| 599 | 3300047321 | Ga0495676_0050370 | Ga0495676_0050370_2082_2375 | 97 |
| 600 | 3300047322 | Ga0495680_0048696 | Ga0495680_0048696_1528_1821 | 97 |
| 601 | 3300047444 | Ga0495675_0024123 | Ga0495675_0024123_3265_3558 | 97 |
| 602 | 3300047471 | Ga0495684_0096482 | Ga0495684_0096482_90_383 | 97 |
| 603 | 3300047673 | Ga0495593_0003319 | Ga0495593_0003319_5325_5618 | 97 |
| 604 | 3300048088 | Ga0495602_0083198 | Ga0495602_0083198_897_1190 | 97 |
| 605 | 3300048089 | Ga0495614_0097658 | Ga0495614_0097658_546_839 | 97 |
| 606 | 3300048089 | Ga0495614_0112935 | Ga0495614_0112935_364_663 | 97 |
| 607 | 3300048903 | Ga0496100_0091178 | Ga0496100_0091178_1523_1816 | 97 |
| 608 | 3300048904 | Ga0496101_0100238 | Ga0496101_0100238_1855_2148 | 97 |
| 609 | 3300048905 | Ga0496102_0346594 | Ga0496102_0346594_941_1234 | 97 |
| 610 | 3300048905 | Ga0496102_1415271 | Ga0496102_1415271_117_416 | 97 |
| 611 | 3300048906 | Ga0496103_0127963 | Ga0496103_0127963_1064_1357 | 97 |
| 612 | 3300048907 | Ga0496104_0168785 | Ga0496104_0168785_986_1279 | 97 |
| 613 | 3300048907 | Ga0496104_0414448 | Ga0496104_0414448_133_432 | 97 |
| 614 | 3300048908 | Ga0496105_0144654 | Ga0496105_0144654_820_1113 | 97 |
| 615 | 3300048908 | Ga0496105_0475047 | Ga0496105_0475047_321_614 | 97 |
| 616 | 3300048909 | Ga0496106_0047608 | Ga0496106_0047608_2313_2606 | 97 |
| 617 | 3300048910 | Ga0496107_0010178 | Ga0496107_0010178_4904_5197 | 97 |
| 618 | 3300048911 | Ga0496108_0016331 | Ga0496108_0016331_2185_2478 | 97 |
| 619 | 3300048911 | Ga0496108_0067497 | Ga0496108_0067497_2083_2376 | 97 |
| 620 | 3300048912 | Ga0496109_0015777 | Ga0496109_0015777_3717_4010 | 97 |
| 621 | 3300048912 | Ga0496109_0824600 | Ga0496109_0824600_280_579 | 97 |
| 622 | 3300048913 | Ga0496110_0012641 | Ga0496110_0012641_3908_4201 | 97 |
| 623 | 3300048913 | Ga0496110_0490060 | Ga0496110_0490060_20_313 | 97 |
| 624 | 3300048913 | Ga0496110_0840412 | Ga0496110_0840412_49_348 | 97 |
| 625 | 3300048914 | Ga0496111_0298462 | Ga0496111_0298462_556_849 | 97 |
| 626 | 3300048915 | Ga0496112_0369186 | Ga0496112_0369186_727_1020 | 97 |
| 627 | 3300048915 | Ga0496112_0566177 | Ga0496112_0566177_641_934 | 97 |
| 628 | 3300048916 | Ga0496113_0133350 | Ga0496113_0133350_1493_1786 | 97 |
| 629 | 3300048916 | Ga0496113_0331031 | Ga0496113_0331031_189_482 | 97 |
| 630 | 3300048916 | Ga0496113_1322160 | Ga0496113_1322160_56_355 | 97 |
| 631 | 3300048917 | Ga0496114_0018213 | Ga0496114_0018213_4085_4378 | 97 |
| 632 | 3300048918 | Ga0496115_0053152 | Ga0496115_0053152_2115_2408 | 97 |
| 633 | 3300048929 | Ga0496126_0170583 | Ga0496126_0170583_1146_1439 | 97 |
| 634 | 3300049538 | Ga0501322_030094 | Ga0501322_030094_151_456 | 97 |
| 635 | 3300049583 | Ga0501067_0152539 | Ga0501067_0152539_135_428 | 97 |
| 636 | 3300050512 | nmdc:mga0n895_246356_c1 | nmdc:mga0n895_246356_c1_454_747 | 97 |
| 637 | 3300050514 | nmdc:mga08x19_73253_c1 | nmdc:mga08x19_73253_c1_1650_1943 | 97 |
| 638 | 3300053077 | Ga0495601_0010722 | Ga0495601_0010722_2651_2944 | 97 |
| 639 | 3300053078 | Ga0495612_0025359 | Ga0495612_0025359_217_510 | 97 |
| 640 | 3300053084 | Ga0495595_0068351 | Ga0495595_0068351_346_639 | 97 |
| 641 | 3300053085 | Ga0495619_0050871 | Ga0495619_0050871_443_736 | 97 |
| 642 | 3300059490 | Ga0587066_126145 | Ga0587066_126145_110_403 | 97 |
| 643 | 3300059503 | Ga0587080_080029 | Ga0587080_080029_111_404 | 97 |
| 644 | 3300059505 | Ga0587083_0030679 | Ga0587083_0030679_320_613 | 97 |
| 645 | 3300059511 | Ga0587091_033593 | Ga0587091_033593_457_750 | 97 |
| 646 | 3300059604 | Ga0587098_008252 | Ga0587098_008252_435_734 | 97 |
| 647 | 3300059626 | Ga0587115_014968 | Ga0587115_014968_303_602 | 97 |
| 648 | 3300059640 | Ga0587067_211288 | Ga0587067_211288_198_491 | 97 |
| 649 | 3300059642 | Ga0587069_165265 | Ga0587069_165265_107_400 | 97 |
| 650 | 3300059647 | Ga0587079_136003 | Ga0587079_136003_198_491 | 97 |
| 651 | iso_pu_bacteria | 2643221681 | 2644455933 | 97 |
| 652 | iso_pu_bacteria | 2643221961 | 2645720825 | 97 |
| 653 | iso_pu_bacteria | 2643221962 | 2645723834 | 97 |
| 654 | iso_pu_bacteria | 2842888712 | 2842890127 | 97 |
| 655 | 3300001977 | JGI24746J21847_1002880 | JGI24746J21847_10028804 | 98 |
| 656 | 3300001991 | JGI24743J22301_10003561 | JGI24743J22301_100035613 | 98 |
| 657 | 3300002067 | JGI24735J21928_10007788 | JGI24735J21928_100077883 | 98 |
| 658 | 3300002073 | JGI24745J21846_1000611 | JGI24745J21846_10006113 | 98 |
| 659 | 3300002077 | JGI24744J21845_10003031 | JGI24744J21845_100030313 | 98 |
| 660 | 3300002244 | JGI24742J22300_10028879 | JGI24742J22300_100288792 | 98 |
| 661 | 3300003162 | Ga0006778J45830_1066604 | Ga0006778J45830_10666041 | 98 |
| 662 | 3300004785 | Ga0058858_1006047 | Ga0058858_10060472 | 98 |
| 663 | 3300004785 | Ga0058858_1439419 | Ga0058858_14394192 | 98 |
| 664 | 3300004798 | Ga0058859_10151791 | Ga0058859_101517912 | 98 |
| 665 | 3300004799 | Ga0058863_11874661 | Ga0058863_118746611 | 98 |
| 666 | 3300004801 | Ga0058860_10101490 | Ga0058860_101014904 | 98 |
| 667 | 3300004803 | Ga0058862_11833495 | Ga0058862_118334951 | 98 |
| 668 | 3300004803 | Ga0058862_12339345 | Ga0058862_123393451 | 98 |
| 669 | 3300005288 | Ga0065714_10151442 | Ga0065714_101514421 | 98 |
| 670 | 3300005327 | Ga0070658_10001764 | Ga0070658_1000176410 | 98 |
| 671 | 3300005327 | Ga0070658_10220315 | Ga0070658_102203152 | 98 |
| 672 | 3300005327 | Ga0070658_10938244 | Ga0070658_109382442 | 98 |
| 673 | 3300005329 | Ga0070683_100659439 | Ga0070683_1006594391 | 98 |
| 674 | 3300005330 | Ga0070690_100810243 | Ga0070690_1008102432 | 98 |
| 675 | 3300005331 | Ga0070670_101067838 | Ga0070670_1010678382 | 98 |
| 676 | 3300005333 | Ga0070677_10026178 | Ga0070677_100261784 | 98 |
| 677 | 3300005334 | Ga0068869_100287171 | Ga0068869_1002871712 | 98 |
| 678 | 3300005335 | Ga0070666_10360117 | Ga0070666_103601172 | 98 |
| 679 | 3300005335 | Ga0070666_11241050 | Ga0070666_112410501 | 98 |
| 680 | 3300005336 | Ga0070680_100004398 | Ga0070680_10000439819 | 98 |
| 681 | 3300005336 | Ga0070680_100407949 | Ga0070680_1004079492 | 98 |
| 682 | 3300005337 | Ga0070682_100097993 | Ga0070682_1000979933 | 98 |
| 683 | 3300005337 | Ga0070682_100580110 | Ga0070682_1005801101 | 98 |
| 684 | 3300005338 | Ga0068868_100195353 | Ga0068868_1001953532 | 98 |
| 685 | 3300005339 | Ga0070660_100915340 | Ga0070660_1009153401 | 98 |
| 686 | 3300005340 | Ga0070689_100210630 | Ga0070689_1002106303 | 98 |
| 687 | 3300005340 | Ga0070689_100499648 | Ga0070689_1004996482 | 98 |
| 688 | 3300005341 | Ga0070691_10433091 | Ga0070691_104330912 | 98 |
| 689 | 3300005343 | Ga0070687_100823329 | Ga0070687_1008233292 | 98 |
| 690 | 3300005344 | Ga0070661_100922893 | Ga0070661_1009228932 | 98 |
| 691 | 3300005345 | Ga0070692_10051941 | Ga0070692_100519412 | 98 |
| 692 | 3300005347 | Ga0070668_100045485 | Ga0070668_1000454855 | 98 |
| 693 | 3300005347 | Ga0070668_100262585 | Ga0070668_1002625851 | 98 |
| 694 | 3300005347 | Ga0070668_100286859 | Ga0070668_1002868592 | 98 |
| 695 | 3300005353 | Ga0070669_101928000 | Ga0070669_1019280001 | 98 |
| 696 | 3300005354 | Ga0070675_100122668 | Ga0070675_1001226683 | 98 |
| 697 | 3300005355 | Ga0070671_100023520 | Ga0070671_1000235207 | 98 |
| 698 | 3300005356 | Ga0070674_100053618 | Ga0070674_1000536183 | 98 |
| 699 | 3300005356 | Ga0070674_100081087 | Ga0070674_1000810873 | 98 |
| 700 | 3300005364 | Ga0070673_100285095 | Ga0070673_1002850952 | 98 |
| 701 | 3300005365 | Ga0070688_100393198 | Ga0070688_1003931982 | 98 |
| 702 | 3300005367 | Ga0070667_100004217 | Ga0070667_10000421715 | 98 |
| 703 | 3300005367 | Ga0070667_100416970 | Ga0070667_1004169702 | 98 |
| 704 | 3300005406 | Ga0070703_10223580 | Ga0070703_102235801 | 98 |
| 705 | 3300005434 | Ga0070709_10086222 | Ga0070709_100862222 | 98 |
| 706 | 3300005435 | Ga0070714_100000013 | Ga0070714_10000001312 | 98 |
| 707 | 3300005435 | Ga0070714_100051110 | Ga0070714_1000511102 | 98 |
| 708 | 3300005435 | Ga0070714_101457326 | Ga0070714_1014573262 | 98 |
| 709 | 3300005435 | Ga0070714_101848515 | Ga0070714_1018485152 | 98 |
| 710 | 3300005436 | Ga0070713_100008336 | Ga0070713_1000083366 | 98 |
| 711 | 3300005437 | Ga0070710_10053151 | Ga0070710_100531514 | 98 |
| 712 | 3300005437 | Ga0070710_10085821 | Ga0070710_100858212 | 98 |
| 713 | 3300005437 | Ga0070710_10090187 | Ga0070710_100901873 | 98 |
| 714 | 3300005438 | Ga0070701_10370624 | Ga0070701_103706242 | 98 |
| 715 | 3300005438 | Ga0070701_11178807 | Ga0070701_111788072 | 98 |
| 716 | 3300005439 | Ga0070711_100588687 | Ga0070711_1005886872 | 98 |
| 717 | 3300005439 | Ga0070711_101164608 | Ga0070711_1011646082 | 98 |
| 718 | 3300005441 | Ga0070700_100000035 | Ga0070700_1000000355 | 98 |
| 719 | 3300005441 | Ga0070700_100251879 | Ga0070700_1002518791 | 98 |
| 720 | 3300005441 | Ga0070700_100457360 | Ga0070700_1004573602 | 98 |
| 721 | 3300005444 | Ga0070694_100582079 | Ga0070694_1005820792 | 98 |
| 722 | 3300005455 | Ga0070663_100059928 | Ga0070663_1000599285 | 98 |
| 723 | 3300005455 | Ga0070663_100540144 | Ga0070663_1005401442 | 98 |
| 724 | 3300005455 | Ga0070663_100556367 | Ga0070663_1005563672 | 98 |
| 725 | 3300005456 | Ga0070678_100123889 | Ga0070678_1001238893 | 98 |
| 726 | 3300005456 | Ga0070678_100139403 | Ga0070678_1001394031 | 98 |
| 727 | 3300005456 | Ga0070678_102351050 | Ga0070678_1023510501 | 98 |
| 728 | 3300005457 | Ga0070662_100092660 | Ga0070662_1000926602 | 98 |
| 729 | 3300005458 | Ga0070681_10004293 | Ga0070681_1000429319 | 98 |
| 730 | 3300005459 | Ga0068867_101090292 | Ga0068867_1010902921 | 98 |
| 731 | 3300005466 | Ga0070685_10202330 | Ga0070685_102023302 | 98 |
| 732 | 3300005471 | Ga0070698_101663035 | Ga0070698_1016630351 | 98 |
| 733 | 3300005530 | Ga0070679_100006878 | Ga0070679_10000687819 | 98 |
| 734 | 3300005539 | Ga0068853_100307169 | Ga0068853_1003071692 | 98 |
| 735 | 3300005539 | Ga0068853_101196776 | Ga0068853_1011967761 | 98 |
| 736 | 3300005544 | Ga0070686_100819300 | Ga0070686_1008193001 | 98 |
| 737 | 3300005545 | Ga0070695_101017329 | Ga0070695_1010173292 | 98 |
| 738 | 3300005547 | Ga0070693_100121492 | Ga0070693_1001214921 | 98 |
| 739 | 3300005548 | Ga0070665_100001905 | Ga0070665_10000190534 | 98 |
| 740 | 3300005548 | Ga0070665_100002601 | Ga0070665_10000260117 | 98 |
| 741 | 3300005548 | Ga0070665_100220087 | Ga0070665_1002200871 | 98 |
| 742 | 3300005548 | Ga0070665_100236226 | Ga0070665_1002362262 | 98 |
| 743 | 3300005548 | Ga0070665_100988870 | Ga0070665_1009888702 | 98 |
| 744 | 3300005548 | Ga0070665_101956487 | Ga0070665_1019564872 | 98 |
| 745 | 3300005549 | Ga0070704_100178966 | Ga0070704_1001789662 | 98 |
| 746 | 3300005563 | Ga0068855_100046634 | Ga0068855_1000466345 | 98 |
| 747 | 3300005563 | Ga0068855_100284096 | Ga0068855_1002840963 | 98 |
| 748 | 3300005578 | Ga0068854_100178489 | Ga0068854_1001784893 | 98 |
| 749 | 3300005578 | Ga0068854_100905312 | Ga0068854_1009053122 | 98 |
| 750 | 3300005614 | Ga0068856_100305559 | Ga0068856_1003055593 | 98 |
| 751 | 3300005615 | Ga0070702_100116385 | Ga0070702_1001163852 | 98 |
| 752 | 3300005615 | Ga0070702_100365775 | Ga0070702_1003657752 | 98 |
| 753 | 3300005616 | Ga0068852_101086978 | Ga0068852_1010869782 | 98 |
| 754 | 3300005616 | Ga0068852_101964835 | Ga0068852_1019648352 | 98 |
| 755 | 3300005617 | Ga0068859_100962717 | Ga0068859_1009627172 | 98 |
| 756 | 3300005617 | Ga0068859_102396822 | Ga0068859_1023968222 | 98 |
| 757 | 3300005618 | Ga0068864_101349881 | Ga0068864_1013498812 | 98 |
| 758 | 3300005718 | Ga0068866_10064529 | Ga0068866_100645293 | 98 |
| 759 | 3300005719 | Ga0068861_101538927 | Ga0068861_1015389272 | 98 |
| 760 | 3300005834 | Ga0068851_10146074 | Ga0068851_101460742 | 98 |
| 761 | 3300005840 | Ga0068870_10422386 | Ga0068870_104223862 | 98 |
| 762 | 3300005840 | Ga0068870_11333673 | Ga0068870_113336731 | 98 |
| 763 | 3300005841 | Ga0068863_100000497 | Ga0068863_10000049730 | 98 |
| 764 | 3300005841 | Ga0068863_100130459 | Ga0068863_1001304592 | 98 |
| 765 | 3300005841 | Ga0068863_100335344 | Ga0068863_1003353442 | 98 |
| 766 | 3300005842 | Ga0068858_100019674 | Ga0068858_1000196744 | 98 |
| 767 | 3300005842 | Ga0068858_100365377 | Ga0068858_1003653773 | 98 |
| 768 | 3300005842 | Ga0068858_101987275 | Ga0068858_1019872751 | 98 |
| 769 | 3300005843 | Ga0068860_100000054 | Ga0068860_100000054104 | 98 |
| 770 | 3300005843 | Ga0068860_100193897 | Ga0068860_1001938974 | 98 |
| 771 | 3300005843 | Ga0068860_102779239 | Ga0068860_1027792392 | 98 |
| 772 | 3300005844 | Ga0068862_100437710 | Ga0068862_1004377102 | 98 |
| 773 | 3300005844 | Ga0068862_100858963 | Ga0068862_1008589632 | 98 |
| 774 | 3300005844 | Ga0068862_101531011 | Ga0068862_1015310112 | 98 |
| 775 | 3300006028 | Ga0070717_10311589 | Ga0070717_103115892 | 98 |
| 776 | 3300006048 | Ga0075363_100442769 | Ga0075363_1004427692 | 98 |
| 777 | 3300006175 | Ga0070712_100060728 | Ga0070712_1000607282 | 98 |
| 778 | 3300006186 | Ga0075369_10000768 | Ga0075369_1000076811 | 98 |
| 779 | 3300006237 | Ga0097621_100388372 | Ga0097621_1003883722 | 98 |
| 780 | 3300006237 | Ga0097621_100996674 | Ga0097621_1009966742 | 98 |
| 781 | 3300006353 | Ga0075370_10274662 | Ga0075370_102746622 | 98 |
| 782 | 3300006881 | Ga0068865_101238618 | Ga0068865_1012386182 | 98 |
| 783 | 3300006931 | Ga0097620_100962672 | Ga0097620_1009626722 | 98 |
| 784 | 3300006931 | Ga0097620_102396822 | Ga0097620_1023968222 | 98 |
| 785 | 3300007076 | Ga0075435_101013557 | Ga0075435_1010135572 | 98 |
| 786 | 3300007788 | Ga0099795_10439968 | Ga0099795_104399682 | 98 |
| 787 | 3300009093 | Ga0105240_10129775 | Ga0105240_101297753 | 98 |
| 788 | 3300009093 | Ga0105240_10279796 | Ga0105240_102797962 | 98 |
| 789 | 3300009094 | Ga0111539_12239040 | Ga0111539_122390402 | 98 |
| 790 | 3300009094 | Ga0111539_13334324 | Ga0111539_133343241 | 98 |
| 791 | 3300009098 | Ga0105245_10090859 | Ga0105245_100908593 | 98 |
| 792 | 3300009098 | Ga0105245_10406179 | Ga0105245_104061792 | 98 |
| 793 | 3300009098 | Ga0105245_10563991 | Ga0105245_105639912 | 98 |
| 794 | 3300009101 | Ga0105247_10112575 | Ga0105247_101125753 | 98 |
| 795 | 3300009101 | Ga0105247_10279709 | Ga0105247_102797092 | 98 |
| 796 | 3300009174 | Ga0105241_10673073 | Ga0105241_106730732 | 98 |
| 797 | 3300009176 | Ga0105242_10844031 | Ga0105242_108440312 | 98 |
| 798 | 3300009176 | Ga0105242_12394979 | Ga0105242_123949792 | 98 |
| 799 | 3300009177 | Ga0105248_10416519 | Ga0105248_104165193 | 98 |
| 800 | 3300009545 | Ga0105237_10323663 | Ga0105237_103236632 | 98 |
| 801 | 3300009545 | Ga0105237_10740180 | Ga0105237_107401802 | 98 |
| 802 | 3300009545 | Ga0105237_11898099 | Ga0105237_118980991 | 98 |
| 803 | 3300009545 | Ga0105237_12235722 | Ga0105237_122357222 | 98 |
| 804 | 3300009551 | Ga0105238_10301065 | Ga0105238_103010652 | 98 |
| 805 | 3300009551 | Ga0105238_10389443 | Ga0105238_103894433 | 98 |
| 806 | 3300009551 | Ga0105238_10812133 | Ga0105238_108121332 | 98 |
| 807 | 3300009551 | Ga0105238_10820965 | Ga0105238_108209652 | 98 |
| 808 | 3300009551 | Ga0105238_11122481 | Ga0105238_111224812 | 98 |
| 809 | 3300009553 | Ga0105249_10140872 | Ga0105249_101408722 | 98 |
| 810 | 3300009553 | Ga0105249_10348738 | Ga0105249_103487382 | 98 |
| 811 | 3300010375 | Ga0105239_10354484 | Ga0105239_103544843 | 98 |
| 812 | 3300013100 | Ga0157373_10285423 | Ga0157373_102854232 | 98 |
| 813 | 3300013102 | Ga0157371_10590652 | Ga0157371_105906522 | 98 |
| 814 | 3300013102 | Ga0157371_10635361 | Ga0157371_106353612 | 98 |
| 815 | 3300013104 | Ga0157370_10108707 | Ga0157370_101087074 | 98 |
| 816 | 3300013104 | Ga0157370_10443282 | Ga0157370_104432822 | 98 |
| 817 | 3300013104 | Ga0157370_10919194 | Ga0157370_109191942 | 98 |
| 818 | 3300013105 | Ga0157369_10129817 | Ga0157369_101298172 | 98 |
| 819 | 3300013105 | Ga0157369_10329543 | Ga0157369_103295432 | 98 |
| 820 | 3300013105 | Ga0157369_11055175 | Ga0157369_110551752 | 98 |
| 821 | 3300013296 | Ga0157374_11126343 | Ga0157374_111263432 | 98 |
| 822 | 3300013296 | Ga0157374_12542787 | Ga0157374_125427872 | 98 |
| 823 | 3300013297 | Ga0157378_10204057 | Ga0157378_102040574 | 98 |
| 824 | 3300013306 | Ga0163162_10484708 | Ga0163162_104847083 | 98 |
| 825 | 3300013306 | Ga0163162_11566472 | Ga0163162_115664722 | 98 |
| 826 | 3300013307 | Ga0157372_10000069 | Ga0157372_1000006982 | 98 |
| 827 | 3300013307 | Ga0157372_11757235 | Ga0157372_117572352 | 98 |
| 828 | 3300013308 | Ga0157375_10823793 | Ga0157375_108237932 | 98 |
| 829 | 3300013308 | Ga0157375_12908163 | Ga0157375_129081631 | 98 |
| 830 | 3300014325 | Ga0163163_11227374 | Ga0163163_112273741 | 98 |
| 831 | 3300014326 | Ga0157380_12036197 | Ga0157380_120361972 | 98 |
| 832 | 3300014745 | Ga0157377_10133410 | Ga0157377_101334102 | 98 |
| 833 | 3300014968 | Ga0157379_10008421 | Ga0157379_100084212 | 98 |
| 834 | 3300014968 | Ga0157379_11086010 | Ga0157379_110860102 | 98 |
| 835 | 3300020069 | Ga0197907_10353354 | Ga0197907_103533542 | 98 |
| 836 | 3300020069 | Ga0197907_10377945 | Ga0197907_103779455 | 98 |
| 837 | 3300020069 | Ga0197907_10968004 | Ga0197907_109680041 | 98 |
| 838 | 3300020070 | Ga0206356_10734286 | Ga0206356_107342864 | 98 |
| 839 | 3300020070 | Ga0206356_11250559 | Ga0206356_112505592 | 98 |
| 840 | 3300020075 | Ga0206349_1421489 | Ga0206349_14214892 | 98 |
| 841 | 3300020075 | Ga0206349_1728033 | Ga0206349_17280332 | 98 |
| 842 | 3300020076 | Ga0206355_1261997 | Ga0206355_12619973 | 98 |
| 843 | 3300020076 | Ga0206355_1415001 | Ga0206355_14150012 | 98 |
| 844 | 3300020076 | Ga0206355_1472830 | Ga0206355_14728302 | 98 |
| 845 | 3300020077 | Ga0206351_10076119 | Ga0206351_100761192 | 98 |
| 846 | 3300020077 | Ga0206351_10309003 | Ga0206351_103090032 | 98 |
| 847 | 3300020077 | Ga0206351_10377689 | Ga0206351_103776892 | 98 |
| 848 | 3300020077 | Ga0206351_10514268 | Ga0206351_105142682 | 98 |
| 849 | 3300020077 | Ga0206351_10522676 | Ga0206351_105226762 | 98 |
| 850 | 3300020078 | Ga0206352_11045450 | Ga0206352_110454503 | 98 |
| 851 | 3300020080 | Ga0206350_11483097 | Ga0206350_114830972 | 98 |
| 852 | 3300020081 | Ga0206354_10317063 | Ga0206354_103170632 | 98 |
| 853 | 3300020081 | Ga0206354_10357282 | Ga0206354_103572822 | 98 |
| 854 | 3300020081 | Ga0206354_10491146 | Ga0206354_104911463 | 98 |
| 855 | 3300020081 | Ga0206354_10676331 | Ga0206354_106763312 | 98 |
| 856 | 3300020081 | Ga0206354_11153566 | Ga0206354_111535662 | 98 |
| 857 | 3300020082 | Ga0206353_10924004 | Ga0206353_109240045 | 98 |
| 858 | 3300020082 | Ga0206353_11139857 | Ga0206353_111398572 | 98 |
| 859 | 3300020610 | Ga0154015_1344825 | Ga0154015_13448251 | 98 |
| 860 | 3300021358 | Ga0213873_10166278 | Ga0213873_101662782 | 98 |
| 861 | 3300021384 | Ga0213876_10022127 | Ga0213876_100221274 | 98 |
| 862 | 3300021384 | Ga0213876_10131711 | Ga0213876_101317111 | 98 |
| 863 | 3300021388 | Ga0213875_10000107 | Ga0213875_1000010757 | 98 |
| 864 | 3300021388 | Ga0213875_10010348 | Ga0213875_100103486 | 98 |
| 865 | 3300021388 | Ga0213875_10153206 | Ga0213875_101532062 | 98 |
| 866 | 3300022467 | Ga0224712_10000575 | Ga0224712_1000057511 | 98 |
| 867 | 3300022467 | Ga0224712_10049036 | Ga0224712_100490363 | 98 |
| 868 | 3300022467 | Ga0224712_10272665 | Ga0224712_102726652 | 98 |
| 869 | 3300025321 | Ga0207656_10097780 | Ga0207656_100977802 | 98 |
| 870 | 3300025885 | Ga0207653_10129988 | Ga0207653_101299882 | 98 |
| 871 | 3300025898 | Ga0207692_10039662 | Ga0207692_100396624 | 98 |
| 872 | 3300025898 | Ga0207692_10162735 | Ga0207692_101627351 | 98 |
| 873 | 3300025899 | Ga0207642_10263796 | Ga0207642_102637962 | 98 |
| 874 | 3300025900 | Ga0207710_10069288 | Ga0207710_100692882 | 98 |
| 875 | 3300025900 | Ga0207710_10400064 | Ga0207710_104000642 | 98 |
| 876 | 3300025901 | Ga0207688_10003298 | Ga0207688_1000329811 | 98 |
| 877 | 3300025903 | Ga0207680_10522776 | Ga0207680_105227762 | 98 |
| 878 | 3300025904 | Ga0207647_10132804 | Ga0207647_101328042 | 98 |
| 879 | 3300025904 | Ga0207647_10502044 | Ga0207647_105020442 | 98 |
| 880 | 3300025905 | Ga0207685_10131484 | Ga0207685_101314842 | 98 |
| 881 | 3300025906 | Ga0207699_10095716 | Ga0207699_100957163 | 98 |
| 882 | 3300025906 | Ga0207699_10129509 | Ga0207699_101295093 | 98 |
| 883 | 3300025908 | Ga0207643_10175640 | Ga0207643_101756402 | 98 |
| 884 | 3300025908 | Ga0207643_10545745 | Ga0207643_105457452 | 98 |
| 885 | 3300025909 | Ga0207705_10000671 | Ga0207705_1000067133 | 98 |
| 886 | 3300025909 | Ga0207705_10354451 | Ga0207705_103544512 | 98 |
| 887 | 3300025909 | Ga0207705_10464917 | Ga0207705_104649172 | 98 |
| 888 | 3300025910 | Ga0207684_11152632 | Ga0207684_111526322 | 98 |
| 889 | 3300025912 | Ga0207707_10006511 | Ga0207707_100065118 | 98 |
| 890 | 3300025913 | Ga0207695_10115359 | Ga0207695_101153595 | 98 |
| 891 | 3300025913 | Ga0207695_10814538 | Ga0207695_108145381 | 98 |
| 892 | 3300025914 | Ga0207671_10071765 | Ga0207671_100717654 | 98 |
| 893 | 3300025914 | Ga0207671_11468956 | Ga0207671_114689561 | 98 |
| 894 | 3300025915 | Ga0207693_10011155 | Ga0207693_1001115510 | 98 |
| 895 | 3300025915 | Ga0207693_10725458 | Ga0207693_107254582 | 98 |
| 896 | 3300025916 | Ga0207663_10111171 | Ga0207663_101111713 | 98 |
| 897 | 3300025916 | Ga0207663_10204599 | Ga0207663_102045992 | 98 |
| 898 | 3300025916 | Ga0207663_11752084 | Ga0207663_117520842 | 98 |
| 899 | 3300025917 | Ga0207660_10000562 | Ga0207660_1000056234 | 98 |
| 900 | 3300025919 | Ga0207657_10177471 | Ga0207657_101774712 | 98 |
| 901 | 3300025921 | Ga0207652_10000632 | Ga0207652_1000063210 | 98 |
| 902 | 3300025923 | Ga0207681_11803394 | Ga0207681_118033942 | 98 |
| 903 | 3300025924 | Ga0207694_10278016 | Ga0207694_102780162 | 98 |
| 904 | 3300025924 | Ga0207694_10493274 | Ga0207694_104932742 | 98 |
| 905 | 3300025924 | Ga0207694_10772435 | Ga0207694_107724352 | 98 |
| 906 | 3300025925 | Ga0207650_10979736 | Ga0207650_109797362 | 98 |
| 907 | 3300025926 | Ga0207659_10117802 | Ga0207659_101178023 | 98 |
| 908 | 3300025927 | Ga0207687_10104213 | Ga0207687_101042134 | 98 |
| 909 | 3300025927 | Ga0207687_10176039 | Ga0207687_101760393 | 98 |
| 910 | 3300025928 | Ga0207700_10047227 | Ga0207700_100472272 | 98 |
| 911 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001518 | 98 |
| 912 | 3300025929 | Ga0207664_10081228 | Ga0207664_100812284 | 98 |
| 913 | 3300025929 | Ga0207664_10480679 | Ga0207664_104806792 | 98 |
| 914 | 3300025931 | Ga0207644_10022904 | Ga0207644_100229045 | 98 |
| 915 | 3300025931 | Ga0207644_10622978 | Ga0207644_106229782 | 98 |
| 916 | 3300025932 | Ga0207690_10287156 | Ga0207690_102871562 | 98 |
| 917 | 3300025933 | Ga0207706_10149626 | Ga0207706_101496262 | 98 |
| 918 | 3300025934 | Ga0207686_10515868 | Ga0207686_105158682 | 98 |
| 919 | 3300025935 | Ga0207709_10127337 | Ga0207709_101273371 | 98 |
| 920 | 3300025936 | Ga0207670_10491524 | Ga0207670_104915242 | 98 |
| 921 | 3300025936 | Ga0207670_10954177 | Ga0207670_109541772 | 98 |
| 922 | 3300025936 | Ga0207670_11503418 | Ga0207670_115034182 | 98 |
| 923 | 3300025937 | Ga0207669_10063775 | Ga0207669_100637753 | 98 |
| 924 | 3300025937 | Ga0207669_10118183 | Ga0207669_101181833 | 98 |
| 925 | 3300025937 | Ga0207669_11889428 | Ga0207669_118894282 | 98 |
| 926 | 3300025938 | Ga0207704_10626228 | Ga0207704_106262282 | 98 |
| 927 | 3300025938 | Ga0207704_11489114 | Ga0207704_114891141 | 98 |
| 928 | 3300025939 | Ga0207665_10402902 | Ga0207665_104029021 | 98 |
| 929 | 3300025942 | Ga0207689_10173846 | Ga0207689_101738461 | 98 |
| 930 | 3300025944 | Ga0207661_10542623 | Ga0207661_105426232 | 98 |
| 931 | 3300025944 | Ga0207661_11488934 | Ga0207661_114889342 | 98 |
| 932 | 3300025960 | Ga0207651_10259888 | Ga0207651_102598882 | 98 |
| 933 | 3300025960 | Ga0207651_10276475 | Ga0207651_102764752 | 98 |
| 934 | 3300025961 | Ga0207712_10213239 | Ga0207712_102132392 | 98 |
| 935 | 3300025972 | Ga0207668_10029372 | Ga0207668_100293726 | 98 |
| 936 | 3300025972 | Ga0207668_10104040 | Ga0207668_101040405 | 98 |
| 937 | 3300025972 | Ga0207668_10507411 | Ga0207668_105074112 | 98 |
| 938 | 3300025972 | Ga0207668_10760224 | Ga0207668_107602242 | 98 |
| 939 | 3300025981 | Ga0207640_10110526 | Ga0207640_101105264 | 98 |
| 940 | 3300025986 | Ga0207658_10017892 | Ga0207658_100178926 | 98 |
| 941 | 3300025986 | Ga0207658_10417015 | Ga0207658_104170151 | 98 |
| 942 | 3300025986 | Ga0207658_10960136 | Ga0207658_109601362 | 98 |
| 943 | 3300026023 | Ga0207677_10296380 | Ga0207677_102963803 | 98 |
| 944 | 3300026035 | Ga0207703_10094586 | Ga0207703_100945863 | 98 |
| 945 | 3300026041 | Ga0207639_10508431 | Ga0207639_105084312 | 98 |
| 946 | 3300026041 | Ga0207639_12112016 | Ga0207639_121120162 | 98 |
| 947 | 3300026067 | Ga0207678_10134885 | Ga0207678_101348854 | 98 |
| 948 | 3300026067 | Ga0207678_10163083 | Ga0207678_101630834 | 98 |
| 949 | 3300026067 | Ga0207678_10591157 | Ga0207678_105911571 | 98 |
| 950 | 3300026075 | Ga0207708_10000030 | Ga0207708_10000030151 | 98 |
| 951 | 3300026075 | Ga0207708_10474917 | Ga0207708_104749172 | 98 |
| 952 | 3300026075 | Ga0207708_12051222 | Ga0207708_120512222 | 98 |
| 953 | 3300026078 | Ga0207702_10593991 | Ga0207702_105939912 | 98 |
| 954 | 3300026078 | Ga0207702_10937072 | Ga0207702_109370722 | 98 |
| 955 | 3300026088 | Ga0207641_10000478 | Ga0207641_1000047819 | 98 |
| 956 | 3300026088 | Ga0207641_10100925 | Ga0207641_101009254 | 98 |
| 957 | 3300026089 | Ga0207648_10334848 | Ga0207648_103348481 | 98 |
| 958 | 3300026095 | Ga0207676_10080647 | Ga0207676_100806474 | 98 |
| 959 | 3300026118 | Ga0207675_100396136 | Ga0207675_1003961361 | 98 |
| 960 | 3300026118 | Ga0207675_100498663 | Ga0207675_1004986632 | 98 |
| 961 | 3300026121 | Ga0207683_10111118 | Ga0207683_101111185 | 98 |
| 962 | 3300026121 | Ga0207683_10176704 | Ga0207683_101767041 | 98 |
| 963 | 3300026121 | Ga0207683_11764047 | Ga0207683_117640472 | 98 |
| 964 | 3300026142 | Ga0207698_11140528 | Ga0207698_111405282 | 98 |
| 965 | 3300028379 | Ga0268266_10006407 | Ga0268266_1000640710 | 98 |
| 966 | 3300028379 | Ga0268266_10021808 | Ga0268266_100218085 | 98 |
| 967 | 3300028379 | Ga0268266_10073860 | Ga0268266_100738603 | 98 |
| 968 | 3300028379 | Ga0268266_10508208 | Ga0268266_105082082 | 98 |
| 969 | 3300028379 | Ga0268266_10571329 | Ga0268266_105713292 | 98 |
| 970 | 3300028380 | Ga0268265_11399771 | Ga0268265_113997712 | 98 |
| 971 | 3300028380 | Ga0268265_11520162 | Ga0268265_115201621 | 98 |
| 972 | 3300028380 | Ga0268265_12487598 | Ga0268265_124875982 | 98 |
| 973 | 3300028381 | Ga0268264_10000097 | Ga0268264_10000097122 | 98 |
| 974 | 3300028381 | Ga0268264_10013159 | Ga0268264_100131592 | 98 |
| 975 | 3300028381 | Ga0268264_10471038 | Ga0268264_104710381 | 98 |
| 976 | 3300028794 | Ga0307515_10193296 | Ga0307515_101932963 | 98 |
| 977 | 3300028800 | Ga0265338_10089548 | Ga0265338_100895483 | 98 |
| 978 | 3300028800 | Ga0265338_10304734 | Ga0265338_103047342 | 98 |
| 979 | 3300028800 | Ga0265338_10986840 | Ga0265338_109868402 | 98 |
| 980 | 3300029285 | Ga0310981_1087667 | Ga0310981_10876672 | 98 |
| 981 | 3300031241 | Ga0265325_10136111 | Ga0265325_101361112 | 98 |
| 982 | 3300031241 | Ga0265325_10301924 | Ga0265325_103019242 | 98 |
| 983 | 3300031247 | Ga0265340_10022026 | Ga0265340_100220264 | 98 |
| 984 | 3300031249 | Ga0265339_10126373 | Ga0265339_101263732 | 98 |
| 985 | 3300031249 | Ga0265339_10321347 | Ga0265339_103213472 | 98 |
| 986 | 3300031250 | Ga0265331_10047396 | Ga0265331_100473963 | 98 |
| 987 | 3300031251 | Ga0265327_10000532 | Ga0265327_1000053261 | 98 |
| 988 | 3300031344 | Ga0265316_10222988 | Ga0265316_102229882 | 98 |
| 989 | 3300031456 | Ga0307513_10863617 | Ga0307513_108636172 | 98 |
| 990 | 3300031595 | Ga0265313_10062846 | Ga0265313_100628463 | 98 |
| 991 | 3300031711 | Ga0265314_10041461 | Ga0265314_100414612 | 98 |
| 992 | 3300031712 | Ga0265342_10086654 | Ga0265342_100866542 | 98 |
| 993 | 3300031727 | Ga0316576_10123294 | Ga0316576_101232942 | 98 |
| 994 | 3300031824 | Ga0307413_11585277 | Ga0307413_115852772 | 98 |
| 995 | 3300031838 | Ga0307518_10016411 | Ga0307518_1001641110 | 98 |
| 996 | 3300031901 | Ga0307406_10144961 | Ga0307406_101449613 | 98 |
| 997 | 3300031903 | Ga0307407_10792027 | Ga0307407_107920272 | 98 |
| 998 | 3300031903 | Ga0307407_11635889 | Ga0307407_116358892 | 98 |
| 999 | 3300031911 | Ga0307412_10336182 | Ga0307412_103361822 | 98 |
| 1000 | 3300031995 | Ga0307409_102330774 | Ga0307409_1023307742 | 98 |
| 1001 | 3300032002 | Ga0307416_100759765 | Ga0307416_1007597652 | 98 |
| 1002 | 3300032004 | Ga0307414_12254754 | Ga0307414_122547542 | 98 |
| 1003 | 3300032126 | Ga0307415_100158134 | Ga0307415_1001581342 | 98 |
| 1004 | 3300034817 | Ga0373948_0028084 | Ga0373948_0028084_747_1049 | 98 |
| 1005 | 3300034818 | Ga0373950_0093089 | Ga0373950_0093089_98_400 | 98 |
| 1006 | 3300035092 | Ga0373952_0011022 | Ga0373952_0011022_930_1232 | 98 |
| 1007 | 3300035114 | Ga0373939_0040331 | Ga0373939_0040331_27_329 | 98 |
| 1008 | 3300035119 | Ga0373956_0003612 | Ga0373956_0003612_4926_5225 | 98 |
| 1009 | 3300035207 | Ga0373942_0060545 | Ga0373942_0060545_88_390 | 98 |
| 1010 | 3300035691 | Ga0373931_0101770 | Ga0373931_0101770_195_497 | 98 |
| 1011 | 3300035695 | Ga0373927_0337418 | Ga0373927_0337418_197_493 | 98 |
| 1012 | 3300037418 | Ga0395900_0013704 | Ga0395900_0013704_7694_7993 | 98 |
| 1013 | 3300037853 | Ga0436364_0401206 | Ga0436364_0401206_108_410 | 98 |
| 1014 | 3300037853 | Ga0436364_0520200 | Ga0436364_0520200_590_886 | 98 |
| 1015 | 3300037853 | Ga0436364_0609479 | Ga0436364_0609479_3307_3606 | 98 |
| 1016 | 3300039437 | Ga0436365_0295075 | Ga0436365_0295075_1593_1892 | 98 |
| 1017 | 3300039437 | Ga0436365_0604975 | Ga0436365_0604975_780_1082 | 98 |
| 1018 | 3300039450 | Ga0436363_1061940 | Ga0436363_1061940_29_331 | 98 |
| 1019 | 3300039450 | Ga0436363_1290117 | Ga0436363_1290117_194_496 | 98 |
| 1020 | 3300039453 | Ga0436362_0051453 | Ga0436362_0051453_250_549 | 98 |
| 1021 | 3300039453 | Ga0436362_1253162 | Ga0436362_1253162_256_558 | 98 |
| 1022 | 3300041441 | Ga0451787_783834 | Ga0451787_783834_450_752 | 98 |
| 1023 | 3300041443 | Ga0451789_1064070 | Ga0451789_1064070_1160_1462 | 98 |
| 1024 | 3300041445 | Ga0451792_14883 | Ga0451792_14883_238_540 | 98 |
| 1025 | 3300041446 | Ga0451794_48115 | Ga0451794_48115_138_440 | 98 |
| 1026 | 3300041456 | Ga0451795_1175078 | Ga0451795_1175078_558_860 | 98 |
| 1027 | 3300041458 | Ga0451798_0310622 | Ga0451798_0310622_241_543 | 98 |
| 1028 | 3300041460 | Ga0451802_2051750 | Ga0451802_2051750_89_391 | 98 |
| 1029 | 3300041461 | Ga0451805_109072 | Ga0451805_109072_287_589 | 98 |
| 1030 | 3300041491 | Ga0451833_0644812 | Ga0451833_0644812_226_528 | 98 |
| 1031 | 3300041494 | Ga0451837_0770417 | Ga0451837_0770417_234_536 | 98 |
| 1032 | 3300041494 | Ga0451837_0907669 | Ga0451837_0907669_77_379 | 98 |
| 1033 | 3300041496 | Ga0451839_0025401 | Ga0451839_0025401_221_523 | 98 |
| 1034 | 3300041498 | Ga0451841_0204057 | Ga0451841_0204057_249_551 | 98 |
| 1035 | 3300041509 | Ga0451843_0078182 | Ga0451843_0078182_487_789 | 98 |
| 1036 | 3300041512 | Ga0451853_2803505 | Ga0451853_2803505_211_528 | 98 |
| 1037 | 3300042016 | Ga0439463_097662 | Ga0439463_097662_305_604 | 98 |
| 1038 | 3300042122 | Ga0450920_130800 | Ga0450920_130800_109_411 | 98 |
| 1039 | 3300042438 | Ga0439459_0244558 | Ga0439459_0244558_59_361 | 98 |
| 1040 | 3300042531 | Ga0450918_024976 | Ga0450918_024976_718_1020 | 98 |
| 1041 | 3300044656 | Ga0466969_0370129 | Ga0466969_0370129_259_558 | 98 |
| 1042 | 3300044658 | Ga0466972_0006214 | Ga0466972_0006214_2169_2468 | 98 |
| 1043 | 3300044683 | Ga0466965_0076067 | Ga0466965_0076067_309_608 | 98 |
| 1044 | 3300044684 | Ga0466966_0000383 | Ga0466966_0000383_27460_27759 | 98 |
| 1045 | 3300044694 | Ga0466963_0010998 | Ga0466963_0010998_3240_3539 | 98 |
| 1046 | 3300044694 | Ga0466963_0072087 | Ga0466963_0072087_377_679 | 98 |
| 1047 | 3300044706 | Ga0466964_0411812 | Ga0466964_0411812_156_458 | 98 |
| 1048 | 3300044719 | Ga0466971_0020494 | Ga0466971_0020494_638_937 | 98 |
| 1049 | 3300044719 | Ga0466971_0215860 | Ga0466971_0215860_562_858 | 98 |
| 1050 | 3300044735 | Ga0466968_0004861 | Ga0466968_0004861_2259_2558 | 98 |
| 1051 | 3300044842 | Ga0466957_0015313 | Ga0466957_0015313_1694_1993 | 98 |
| 1052 | 3300044842 | Ga0466957_0152249 | Ga0466957_0152249_1092_1394 | 98 |
| 1053 | 3300044901 | Ga0466960_0000533 | Ga0466960_0000533_2169_2468 | 98 |
| 1054 | 3300044901 | Ga0466960_0000908 | Ga0466960_0000908_4631_4933 | 98 |
| 1055 | 3300044901 | Ga0466960_0036156 | Ga0466960_0036156_756_1055 | 98 |
| 1056 | 3300045049 | Ga0466959_0020923 | Ga0466959_0020923_2018_2317 | 98 |
| 1057 | 3300045049 | Ga0466959_0256793 | Ga0466959_0256793_350_652 | 98 |
| 1058 | 3300045049 | Ga0466959_0395751 | Ga0466959_0395751_157_456 | 98 |
| 1059 | 3300045836 | Ga0466958_0357621 | Ga0466958_0357621_185_484 | 98 |
| 1060 | 3300045836 | Ga0466958_0891301 | Ga0466958_0891301_239_541 | 98 |
| 1061 | 3300045976 | Ga0466967_0007938 | Ga0466967_0007938_216_515 | 98 |
| 1062 | 3300045976 | Ga0466967_0008336 | Ga0466967_0008336_1736_2035 | 98 |
| 1063 | 3300045976 | Ga0466967_0065145 | Ga0466967_0065145_1551_1853 | 98 |
| 1064 | 3300045976 | Ga0466967_0073153 | Ga0466967_0073153_2553_2852 | 98 |
| 1065 | 3300045976 | Ga0466967_0238263 | Ga0466967_0238263_431_733 | 98 |
| 1066 | 3300045976 | Ga0466967_0523135 | Ga0466967_0523135_313_615 | 98 |
| 1067 | 3300045976 | Ga0466967_0593390 | Ga0466967_0593390_596_898 | 98 |
| 1068 | 3300045976 | Ga0466967_1374086 | Ga0466967_1374086_112_411 | 98 |
| 1069 | 3300046457 | Ga0495590_0136878 | Ga0495590_0136878_374_676 | 98 |
| 1070 | 3300046460 | Ga0495638_0044083 | Ga0495638_0044083_506_808 | 98 |
| 1071 | 3300046471 | Ga0495650_0236782 | Ga0495650_0236782_84_386 | 98 |
| 1072 | 3300046512 | Ga0495610_0090814 | Ga0495610_0090814_55_357 | 98 |
| 1073 | 3300046513 | Ga0495616_0475045 | Ga0495616_0475045_36_338 | 98 |
| 1074 | 3300046515 | Ga0495620_0115056 | Ga0495620_0115056_738_1040 | 98 |
| 1075 | 3300046518 | Ga0495631_0109348 | Ga0495631_0109348_676_978 | 98 |
| 1076 | 3300046518 | Ga0495631_0275711 | Ga0495631_0275711_62_364 | 98 |
| 1077 | 3300046615 | Ga0495656_0297732 | Ga0495656_0297732_273_575 | 98 |
| 1078 | 3300046616 | Ga0495668_0059405 | Ga0495668_0059405_1024_1326 | 98 |
| 1079 | 3300046616 | Ga0495668_0419445 | Ga0495668_0419445_196_498 | 98 |
| 1080 | 3300046642 | Ga0495634_0604811 | Ga0495634_0604811_188_484 | 98 |
| 1081 | 3300046663 | Ga0495635_0786685 | Ga0495635_0786685_210_506 | 98 |
| 1082 | 3300046683 | Ga0495658_0245200 | Ga0495658_0245200_373_675 | 98 |
| 1083 | 3300046694 | Ga0495649_0039261 | Ga0495649_0039261_2204_2506 | 98 |
| 1084 | 3300046809 | Ga0495600_0686248 | Ga0495600_0686248_143_439 | 98 |
| 1085 | 3300047320 | Ga0495672_0166918 | Ga0495672_0166918_106_408 | 98 |
| 1086 | 3300047471 | Ga0495684_0841053 | Ga0495684_0841053_152_448 | 98 |
| 1087 | 3300047472 | Ga0495686_0003291 | Ga0495686_0003291_6053_6355 | 98 |
| 1088 | 3300047472 | Ga0495686_0111188 | Ga0495686_0111188_172_474 | 98 |
| 1089 | 3300048091 | Ga0495626_0242522 | Ga0495626_0242522_340_642 | 98 |
| 1090 | 3300048903 | Ga0496100_0710810 | Ga0496100_0710810_329_631 | 98 |
| 1091 | 3300048904 | Ga0496101_1474280 | Ga0496101_1474280_172_474 | 98 |
| 1092 | 3300048905 | Ga0496102_0163736 | Ga0496102_0163736_406_708 | 98 |
| 1093 | 3300048906 | Ga0496103_0135378 | Ga0496103_0135378_59_361 | 98 |
| 1094 | 3300048907 | Ga0496104_0412306 | Ga0496104_0412306_76_378 | 98 |
| 1095 | 3300048908 | Ga0496105_0078709 | Ga0496105_0078709_658_960 | 98 |
| 1096 | 3300048908 | Ga0496105_0106535 | Ga0496105_0106535_1539_1841 | 98 |
| 1097 | 3300048909 | Ga0496106_0309435 | Ga0496106_0309435_89_391 | 98 |
| 1098 | 3300048911 | Ga0496108_0000394 | Ga0496108_0000394_30812_31114 | 98 |
| 1099 | 3300048911 | Ga0496108_1284128 | Ga0496108_1284128_253_555 | 98 |
| 1100 | 3300048911 | Ga0496108_1688181 | Ga0496108_1688181_105_401 | 98 |
| 1101 | 3300048912 | Ga0496109_0054075 | Ga0496109_0054075_1937_2239 | 98 |
| 1102 | 3300048912 | Ga0496109_0059705 | Ga0496109_0059705_3035_3337 | 98 |
| 1103 | 3300048912 | Ga0496109_1680357 | Ga0496109_1680357_179_475 | 98 |
| 1104 | 3300048913 | Ga0496110_0027034 | Ga0496110_0027034_3709_4011 | 98 |
| 1105 | 3300048913 | Ga0496110_0735326 | Ga0496110_0735326_132_434 | 98 |
| 1106 | 3300048914 | Ga0496111_0011467 | Ga0496111_0011467_1972_2274 | 98 |
| 1107 | 3300048915 | Ga0496112_0088274 | Ga0496112_0088274_1072_1368 | 98 |
| 1108 | 3300048915 | Ga0496112_0249649 | Ga0496112_0249649_864_1160 | 98 |
| 1109 | 3300048915 | Ga0496112_0288501 | Ga0496112_0288501_668_970 | 98 |
| 1110 | 3300048916 | Ga0496113_0113223 | Ga0496113_0113223_28_324 | 98 |
| 1111 | 3300048916 | Ga0496113_0145175 | Ga0496113_0145175_896_1198 | 98 |
| 1112 | 3300048916 | Ga0496113_1112264 | Ga0496113_1112264_76_378 | 98 |
| 1113 | 3300048917 | Ga0496114_0275587 | Ga0496114_0275587_161_463 | 98 |
| 1114 | 3300048918 | Ga0496115_0563085 | Ga0496115_0563085_450_752 | 98 |
| 1115 | 3300048918 | Ga0496115_0629412 | Ga0496115_0629412_118_420 | 98 |
| 1116 | 3300048920 | Ga0496117_0103373 | Ga0496117_0103373_774_1076 | 98 |
| 1117 | 3300048921 | Ga0496118_0007173 | Ga0496118_0007173_3998_4300 | 98 |
| 1118 | 3300048922 | Ga0496119_0010999 | Ga0496119_0010999_4162_4464 | 98 |
| 1119 | 3300048922 | Ga0496119_0158815 | Ga0496119_0158815_865_1167 | 98 |
| 1120 | 3300048922 | Ga0496119_0187404 | Ga0496119_0187404_188_484 | 98 |
| 1121 | 3300048924 | Ga0496121_0803842 | Ga0496121_0803842_141_443 | 98 |
| 1122 | 3300048925 | Ga0496122_0001412 | Ga0496122_0001412_5541_5843 | 98 |
| 1123 | 3300048925 | Ga0496122_0278196 | Ga0496122_0278196_332_634 | 98 |
| 1124 | 3300048926 | Ga0496123_0177626 | Ga0496123_0177626_288_590 | 98 |
| 1125 | 3300048927 | Ga0496124_0068795 | Ga0496124_0068795_1606_1908 | 98 |
| 1126 | 3300048927 | Ga0496124_0460501 | Ga0496124_0460501_505_807 | 98 |
| 1127 | 3300048928 | Ga0496125_0000086 | Ga0496125_0000086_106457_106759 | 98 |
| 1128 | 3300048928 | Ga0496125_0096987 | Ga0496125_0096987_123_425 | 98 |
| 1129 | 3300048928 | Ga0496125_0696133 | Ga0496125_0696133_10_309 | 98 |
| 1130 | 3300048929 | Ga0496126_0011857 | Ga0496126_0011857_6150_6446 | 98 |
| 1131 | 3300048929 | Ga0496126_0022728 | Ga0496126_0022728_2326_2628 | 98 |
| 1132 | 3300048929 | Ga0496126_0472159 | Ga0496126_0472159_414_716 | 98 |
| 1133 | 3300049128 | Ga0501308_018367 | Ga0501308_018367_42_341 | 98 |
| 1134 | 3300049129 | Ga0501309_026974 | Ga0501309_026974_520_819 | 98 |
| 1135 | 3300049162 | Ga0501307_025664 | Ga0501307_025664_43_345 | 98 |
| 1136 | 3300049531 | Ga0501315_002746 | Ga0501315_002746_661_960 | 98 |
| 1137 | 3300049533 | Ga0501317_037503 | Ga0501317_037503_120_422 | 98 |
| 1138 | 3300049534 | Ga0501318_001483 | Ga0501318_001483_675_974 | 98 |
| 1139 | 3300049534 | Ga0501318_063153 | Ga0501318_063153_188_487 | 98 |
| 1140 | 3300049569 | Ga0501032_0367807 | Ga0501032_0367807_225_527 | 98 |
| 1141 | 3300049570 | Ga0501033_0018926 | Ga0501033_0018926_4751_5053 | 98 |
| 1142 | 3300049571 | Ga0501034_0051107 | Ga0501034_0051107_2634_2936 | 98 |
| 1143 | 3300049579 | Ga0501043_0300656 | Ga0501043_0300656_286_588 | 98 |
| 1144 | 3300049580 | Ga0501046_0658038 | Ga0501046_0658038_214_516 | 98 |
| 1145 | 3300049581 | Ga0501047_0131139 | Ga0501047_0131139_2064_2366 | 98 |
| 1146 | 3300049581 | Ga0501047_0516081 | Ga0501047_0516081_253_555 | 98 |
| 1147 | 3300049581 | Ga0501047_0681433 | Ga0501047_0681433_439_741 | 98 |
| 1148 | 3300049582 | Ga0501048_0661166 | Ga0501048_0661166_410_712 | 98 |
| 1149 | 3300049582 | Ga0501048_1043826 | Ga0501048_1043826_193_495 | 98 |
| 1150 | 3300049584 | Ga0501068_0516047 | Ga0501068_0516047_242_544 | 98 |
| 1151 | 3300049584 | Ga0501068_0544010 | Ga0501068_0544010_41_340 | 98 |
| 1152 | 3300049586 | Ga0501070_0508396 | Ga0501070_0508396_516_815 | 98 |
| 1153 | 3300049588 | Ga0501072_0153562 | Ga0501072_0153562_85_384 | 98 |
| 1154 | 3300049592 | Ga0501076_0622239 | Ga0501076_0622239_211_510 | 98 |
| 1155 | 3300049741 | Ga0501079_0350904 | Ga0501079_0350904_682_981 | 98 |
| 1156 | 3300049822 | Ga0501035_0038527 | Ga0501035_0038527_2826_3128 | 98 |
| 1157 | 3300049822 | Ga0501035_0147188 | Ga0501035_0147188_1367_1669 | 98 |
| 1158 | 3300049823 | Ga0501044_0001781 | Ga0501044_0001781_13770_14072 | 98 |
| 1159 | 3300049823 | Ga0501044_0019028 | Ga0501044_0019028_3046_3348 | 98 |
| 1160 | 3300050490 | nmdc:mga03n38_398006_c1 | nmdc:mga03n38_398006_c1_311_613 | 98 |
| 1161 | 3300050508 | nmdc:mga09592_61988_c1 | nmdc:mga09592_61988_c1_886_1185 | 98 |
| 1162 | 3300050516 | nmdc:mga0sz30_326574_c1 | nmdc:mga0sz30_326574_c1_265_567 | 98 |
| 1163 | 3300050516 | nmdc:mga0sz30_89399_c1 | nmdc:mga0sz30_89399_c1_119_421 | 98 |
| 1164 | 3300050516 | nmdc:mga0sz30_9944_c1 | nmdc:mga0sz30_9944_c1_210_512 | 98 |
| 1165 | 3300053086 | Ga0500578_0065527 | Ga0500578_0065527_594_896 | 98 |
| 1166 | 3300053092 | Ga0500583_0476014 | Ga0500583_0476014_12_314 | 98 |
| 1167 | 3300053104 | Ga0500556_0046105 | Ga0500556_0046105_775_1077 | 98 |
| 1168 | 3300053108 | Ga0500562_006102 | Ga0500562_006102_2033_2335 | 98 |
| 1169 | 3300053108 | Ga0500562_094435 | Ga0500562_094435_121_423 | 98 |
| 1170 | 3300053108 | Ga0500562_190885 | Ga0500562_190885_200_499 | 98 |
| 1171 | 3300053116 | Ga0500592_053543 | Ga0500592_053543_34_336 | 98 |
| 1172 | 3300053130 | Ga0500642_0006030 | Ga0500642_0006030_1711_2013 | 98 |
| 1173 | 3300053130 | Ga0500642_0281344 | Ga0500642_0281344_166_468 | 98 |
| 1174 | 3300053131 | Ga0500652_278957 | Ga0500652_278957_291_593 | 98 |
| 1175 | 3300053134 | Ga0500658_0256755 | Ga0500658_0256755_180_482 | 98 |
| 1176 | 3300053136 | Ga0500559_0036373 | Ga0500559_0036373_1445_1747 | 98 |
| 1177 | 3300053139 | Ga0500568_0069854 | Ga0500568_0069854_143_445 | 98 |
| 1178 | 3300053146 | Ga0500588_0412599 | Ga0500588_0412599_32_334 | 98 |
| 1179 | 3300053153 | Ga0500616_0051871 | Ga0500616_0051871_952_1254 | 98 |
| 1180 | 3300053727 | Ga0500611_254895 | Ga0500611_254895_21_323 | 98 |
| 1181 | 3300053730 | Ga0500645_000323 | Ga0500645_000323_1232_1534 | 98 |
| 1182 | 3300059491 | Ga0587070_228714 | Ga0587070_228714_193_489 | 98 |
| 1183 | 3300059503 | Ga0587080_117594 | Ga0587080_117594_143_439 | 98 |
| 1184 | 3300059503 | Ga0587080_137077 | Ga0587080_137077_103_405 | 98 |
| 1185 | 3300059508 | Ga0587088_095075 | Ga0587088_095075_191_493 | 98 |
| 1186 | 3300059628 | Ga0587122_016964 | Ga0587122_016964_320_619 | 98 |
| 1187 | 3300059630 | Ga0587128_096288 | Ga0587128_096288_238_549 | 98 |
| 1188 | 3300059647 | Ga0587079_044421 | Ga0587079_044421_172_474 | 98 |
| 1189 | 3300059647 | Ga0587079_083719 | Ga0587079_083719_285_587 | 98 |
| 1190 | 3300060344 | Ga0587071_043399 | Ga0587071_043399_447_749 | 98 |
| 1191 | 3300061719 | Ga0466962_0056659 | Ga0466962_0056659_1190_1489 | 98 |
| 1192 | 3300061719 | Ga0466962_0058121 | Ga0466962_0058121_1198_1500 | 98 |
| 1193 | 3300004799 | Ga0058863_11921357 | Ga0058863_119213574 | 99 |
| 1194 | 3300004801 | Ga0058860_10054779 | Ga0058860_100547792 | 99 |
| 1195 | 3300004803 | Ga0058862_12635954 | Ga0058862_126359541 | 99 |
| 1196 | 3300005329 | Ga0070683_100688812 | Ga0070683_1006888122 | 99 |
| 1197 | 3300005333 | Ga0070677_10688200 | Ga0070677_106882002 | 99 |
| 1198 | 3300005336 | Ga0070680_100003083 | Ga0070680_1000030837 | 99 |
| 1199 | 3300005366 | Ga0070659_101741183 | Ga0070659_1017411832 | 99 |
| 1200 | 3300005435 | Ga0070714_100622362 | Ga0070714_1006223622 | 99 |
| 1201 | 3300005458 | Ga0070681_10022551 | Ga0070681_100225515 | 99 |
| 1202 | 3300005458 | Ga0070681_12033717 | Ga0070681_120337172 | 99 |
| 1203 | 3300005530 | Ga0070679_100003833 | Ga0070679_1000038334 | 99 |
| 1204 | 3300005530 | Ga0070679_101169937 | Ga0070679_1011699372 | 99 |
| 1205 | 3300005535 | Ga0070684_100351512 | Ga0070684_1003515122 | 99 |
| 1206 | 3300005614 | Ga0068856_102384077 | Ga0068856_1023840772 | 99 |
| 1207 | 3300006038 | Ga0075365_10047376 | Ga0075365_100473765 | 99 |
| 1208 | 3300006048 | Ga0075363_100049887 | Ga0075363_1000498875 | 99 |
| 1209 | 3300006048 | Ga0075363_100135479 | Ga0075363_1001354793 | 99 |
| 1210 | 3300006051 | Ga0075364_10031775 | Ga0075364_100317752 | 99 |
| 1211 | 3300006051 | Ga0075364_10538181 | Ga0075364_105381812 | 99 |
| 1212 | 3300006058 | Ga0075432_10177871 | Ga0075432_101778711 | 99 |
| 1213 | 3300006175 | Ga0070712_100609953 | Ga0070712_1006099532 | 99 |
| 1214 | 3300006177 | Ga0075362_10467932 | Ga0075362_104679322 | 99 |
| 1215 | 3300006353 | Ga0075370_10001554 | Ga0075370_1000155414 | 99 |
| 1216 | 3300006353 | Ga0075370_10137124 | Ga0075370_101371243 | 99 |
| 1217 | 3300006353 | Ga0075370_10629295 | Ga0075370_106292951 | 99 |
| 1218 | 3300009148 | Ga0105243_10000567 | Ga0105243_1000056711 | 99 |
| 1219 | 3300009176 | Ga0105242_13141267 | Ga0105242_131412671 | 99 |
| 1220 | 3300010375 | Ga0105239_11492605 | Ga0105239_114926052 | 99 |
| 1221 | 3300010375 | Ga0105239_11671994 | Ga0105239_116719942 | 99 |
| 1222 | 3300012475 | Ga0157317_1002146 | Ga0157317_10021462 | 99 |
| 1223 | 3300012492 | Ga0157335_1016038 | Ga0157335_10160382 | 99 |
| 1224 | 3300012498 | Ga0157345_1006509 | Ga0157345_10065092 | 99 |
| 1225 | 3300012502 | Ga0157347_1030950 | Ga0157347_10309502 | 99 |
| 1226 | 3300012503 | Ga0157313_1026815 | Ga0157313_10268151 | 99 |
| 1227 | 3300012505 | Ga0157339_1010932 | Ga0157339_10109322 | 99 |
| 1228 | 3300012515 | Ga0157338_1040527 | Ga0157338_10405271 | 99 |
| 1229 | 3300013104 | Ga0157370_10255677 | Ga0157370_102556773 | 99 |
| 1230 | 3300013105 | Ga0157369_10403566 | Ga0157369_104035663 | 99 |
| 1231 | 3300013308 | Ga0157375_12003571 | Ga0157375_120035712 | 99 |
| 1232 | 3300014969 | Ga0157376_10755971 | Ga0157376_107559712 | 99 |
| 1233 | 3300019179 | Ga0184593_109258 | Ga0184593_1092581 | 99 |
| 1234 | 3300020070 | Ga0206356_10806586 | Ga0206356_108065862 | 99 |
| 1235 | 3300020077 | Ga0206351_10046376 | Ga0206351_100463762 | 99 |
| 1236 | 3300020077 | Ga0206351_10517565 | Ga0206351_105175652 | 99 |
| 1237 | 3300020080 | Ga0206350_11285491 | Ga0206350_112854913 | 99 |
| 1238 | 3300020081 | Ga0206354_10394252 | Ga0206354_103942522 | 99 |
| 1239 | 3300020081 | Ga0206354_11140572 | Ga0206354_111405722 | 99 |
| 1240 | 3300022467 | Ga0224712_10078968 | Ga0224712_100789683 | 99 |
| 1241 | 3300025893 | Ga0207682_10298166 | Ga0207682_102981661 | 99 |
| 1242 | 3300025904 | Ga0207647_10350024 | Ga0207647_103500242 | 99 |
| 1243 | 3300025912 | Ga0207707_10001257 | Ga0207707_1000125713 | 99 |
| 1244 | 3300025912 | Ga0207707_11268091 | Ga0207707_112680911 | 99 |
| 1245 | 3300025917 | Ga0207660_10004961 | Ga0207660_100049617 | 99 |
| 1246 | 3300025921 | Ga0207652_10005398 | Ga0207652_100053984 | 99 |
| 1247 | 3300025929 | Ga0207664_10283965 | Ga0207664_102839652 | 99 |
| 1248 | 3300025935 | Ga0207709_10000305 | Ga0207709_1000030510 | 99 |
| 1249 | 3300025949 | Ga0207667_11781227 | Ga0207667_117812272 | 99 |
| 1250 | 3300026078 | Ga0207702_12126807 | Ga0207702_121268072 | 99 |
| 1251 | 3300026095 | Ga0207676_11252210 | Ga0207676_112522101 | 99 |
| 1252 | 3300030521 | Ga0307511_10115089 | Ga0307511_101150892 | 99 |
| 1253 | 3300030745 | Ga0316182_1005526 | Ga0316182_10055261 | 99 |
| 1254 | 3300030762 | Ga0265775_104385 | Ga0265775_1043851 | 99 |
| 1255 | 3300031247 | Ga0265340_10020369 | Ga0265340_100203693 | 99 |
| 1256 | 3300031251 | Ga0265327_10000004 | Ga0265327_10000004775 | 99 |
| 1257 | 3300031727 | Ga0316576_10006920 | Ga0316576_1000692014 | 99 |
| 1258 | 3300031727 | Ga0316576_10071235 | Ga0316576_100712352 | 99 |
| 1259 | 3300032002 | Ga0307416_100725009 | Ga0307416_1007250092 | 99 |
| 1260 | 3300032168 | Ga0316593_10108458 | Ga0316593_101084582 | 99 |
| 1261 | 3300033524 | Ga0316592_1043955 | Ga0316592_10439553 | 99 |
| 1262 | 3300033524 | Ga0316592_1056390 | Ga0316592_10563902 | 99 |
| 1263 | 3300035120 | Ga0373957_0113916 | Ga0373957_0113916_204_503 | 99 |
| 1264 | 3300035691 | Ga0373931_0319446 | Ga0373931_0319446_432_731 | 99 |
| 1265 | 3300036242 | Ga0310104_10746 | Ga0310104_10746_135_434 | 99 |
| 1266 | 3300036712 | Ga0316584_0112590 | Ga0316584_0112590_398_697 | 99 |
| 1267 | 3300041441 | Ga0451787_232286 | Ga0451787_232286_281_580 | 99 |
| 1268 | 3300041446 | Ga0451794_52070 | Ga0451794_52070_159_464 | 99 |
| 1269 | 3300041463 | Ga0451804_0271602 | Ga0451804_0271602_24_323 | 99 |
| 1270 | 3300041486 | Ga0451807_1163869 | Ga0451807_1163869_206_505 | 99 |
| 1271 | 3300041512 | Ga0451853_1676925 | Ga0451853_1676925_132_431 | 99 |
| 1272 | 3300044658 | Ga0466972_0490422 | Ga0466972_0490422_84_389 | 99 |
| 1273 | 3300044684 | Ga0466966_0359716 | Ga0466966_0359716_266_565 | 99 |
| 1274 | 3300044693 | Ga0466961_0750258 | Ga0466961_0750258_16_315 | 99 |
| 1275 | 3300044694 | Ga0466963_0056459 | Ga0466963_0056459_1532_1831 | 99 |
| 1276 | 3300044694 | Ga0466963_0235627 | Ga0466963_0235627_515_814 | 99 |
| 1277 | 3300044694 | Ga0466963_0413597 | Ga0466963_0413597_240_539 | 99 |
| 1278 | 3300044706 | Ga0466964_0329825 | Ga0466964_0329825_109_408 | 99 |
| 1279 | 3300044719 | Ga0466971_0007279 | Ga0466971_0007279_2311_2610 | 99 |
| 1280 | 3300044719 | Ga0466971_0235788 | Ga0466971_0235788_364_663 | 99 |
| 1281 | 3300044842 | Ga0466957_0144176 | Ga0466957_0144176_22_321 | 99 |
| 1282 | 3300044842 | Ga0466957_0940242 | Ga0466957_0940242_44_343 | 99 |
| 1283 | 3300045049 | Ga0466959_0321966 | Ga0466959_0321966_369_668 | 99 |
| 1284 | 3300045049 | Ga0466959_0392129 | Ga0466959_0392129_52_351 | 99 |
| 1285 | 3300045049 | Ga0466959_0515044 | Ga0466959_0515044_236_586 | 99 |
| 1286 | 3300045836 | Ga0466958_0019647 | Ga0466958_0019647_1243_1542 | 99 |
| 1287 | 3300045976 | Ga0466967_0106322 | Ga0466967_0106322_1552_1851 | 99 |
| 1288 | 3300045976 | Ga0466967_0115719 | Ga0466967_0115719_1663_1962 | 99 |
| 1289 | 3300045976 | Ga0466967_0243718 | Ga0466967_0243718_687_986 | 99 |
| 1290 | 3300045976 | Ga0466967_0262620 | Ga0466967_0262620_1030_1335 | 99 |
| 1291 | 3300045976 | Ga0466967_0529878 | Ga0466967_0529878_579_878 | 99 |
| 1292 | 3300045976 | Ga0466967_0785193 | Ga0466967_0785193_394_693 | 99 |
| 1293 | 3300046472 | Ga0495580_0244465 | Ga0495580_0244465_113_418 | 99 |
| 1294 | 3300046501 | Ga0495607_0188365 | Ga0495607_0188365_277_582 | 99 |
| 1295 | 3300046531 | Ga0495665_0172337 | Ga0495665_0172337_69_374 | 99 |
| 1296 | 3300046539 | Ga0495621_0010604 | Ga0495621_0010604_187_492 | 99 |
| 1297 | 3300046615 | Ga0495656_0264666 | Ga0495656_0264666_399_704 | 99 |
| 1298 | 3300046616 | Ga0495668_0000509 | Ga0495668_0000509_15306_15611 | 99 |
| 1299 | 3300046674 | Ga0495588_0197050 | Ga0495588_0197050_689_994 | 99 |
| 1300 | 3300047315 | Ga0495581_0023771 | Ga0495581_0023771_167_472 | 99 |
| 1301 | 3300047323 | Ga0495683_0002868 | Ga0495683_0002868_8500_8805 | 99 |
| 1302 | 3300047445 | Ga0495677_0054019 | Ga0495677_0054019_809_1114 | 99 |
| 1303 | 3300048911 | Ga0496108_0026104 | Ga0496108_0026104_1952_2257 | 99 |
| 1304 | 3300048914 | Ga0496111_0662985 | Ga0496111_0662985_235_540 | 99 |
| 1305 | 3300048920 | Ga0496117_0184944 | Ga0496117_0184944_782_1087 | 99 |
| 1306 | 3300048925 | Ga0496122_0172045 | Ga0496122_0172045_639_944 | 99 |
| 1307 | 3300048926 | Ga0496123_0247408 | Ga0496123_0247408_259_564 | 99 |
| 1308 | 3300048928 | Ga0496125_0027838 | Ga0496125_0027838_3459_3764 | 99 |
| 1309 | 3300049127 | Ga0501306_010084 | Ga0501306_010084_344_649 | 99 |
| 1310 | 3300049127 | Ga0501306_056353 | Ga0501306_056353_136_486 | 99 |
| 1311 | 3300049128 | Ga0501308_004882 | Ga0501308_004882_555_860 | 99 |
| 1312 | 3300049128 | Ga0501308_011965 | Ga0501308_011965_155_457 | 99 |
| 1313 | 3300049129 | Ga0501309_013492 | Ga0501309_013492_395_700 | 99 |
| 1314 | 3300049129 | Ga0501309_025796 | Ga0501309_025796_154_459 | 99 |
| 1315 | 3300049130 | Ga0501310_042249 | Ga0501310_042249_268_573 | 99 |
| 1316 | 3300049131 | Ga0501341_02817 | Ga0501341_02817_451_756 | 99 |
| 1317 | 3300049132 | Ga0501343_006371 | Ga0501343_006371_317_622 | 99 |
| 1318 | 3300049134 | Ga0501345_02760 | Ga0501345_02760_143_448 | 99 |
| 1319 | 3300049161 | Ga0501305_035354 | Ga0501305_035354_37_342 | 99 |
| 1320 | 3300049162 | Ga0501307_006265 | Ga0501307_006265_467_772 | 99 |
| 1321 | 3300049527 | Ga0501311_007879 | Ga0501311_007879_820_1122 | 99 |
| 1322 | 3300049528 | Ga0501312_005556 | Ga0501312_005556_412_717 | 99 |
| 1323 | 3300049528 | Ga0501312_007002 | Ga0501312_007002_509_814 | 99 |
| 1324 | 3300049529 | Ga0501313_007646 | Ga0501313_007646_609_914 | 99 |
| 1325 | 3300049531 | Ga0501315_003476 | Ga0501315_003476_810_1115 | 99 |
| 1326 | 3300049531 | Ga0501315_019581 | Ga0501315_019581_352_657 | 99 |
| 1327 | 3300049532 | Ga0501316_002256 | Ga0501316_002256_766_1071 | 99 |
| 1328 | 3300049532 | Ga0501316_015895 | Ga0501316_015895_360_665 | 99 |
| 1329 | 3300049533 | Ga0501317_001119 | Ga0501317_001119_1293_1598 | 99 |
| 1330 | 3300049533 | Ga0501317_003573 | Ga0501317_003573_788_1093 | 99 |
| 1331 | 3300049533 | Ga0501317_005389 | Ga0501317_005389_201_503 | 99 |
| 1332 | 3300049534 | Ga0501318_002761 | Ga0501318_002761_782_1087 | 99 |
| 1333 | 3300049534 | Ga0501318_015033 | Ga0501318_015033_160_510 | 99 |
| 1334 | 3300049534 | Ga0501318_021760 | Ga0501318_021760_297_599 | 99 |
| 1335 | 3300049535 | Ga0501319_002366 | Ga0501319_002366_190_495 | 99 |
| 1336 | 3300049536 | Ga0501320_000888 | Ga0501320_000888_367_672 | 99 |
| 1337 | 3300049536 | Ga0501320_004374 | Ga0501320_004374_246_551 | 99 |
| 1338 | 3300049537 | Ga0501321_001097 | Ga0501321_001097_1549_1848 | 99 |
| 1339 | 3300049537 | Ga0501321_002837 | Ga0501321_002837_412_717 | 99 |
| 1340 | 3300049538 | Ga0501322_009917 | Ga0501322_009917_78_383 | 99 |
| 1341 | 3300049539 | Ga0501323_000539 | Ga0501323_000539_2143_2448 | 99 |
| 1342 | 3300049539 | Ga0501323_023339 | Ga0501323_023339_343_645 | 99 |
| 1343 | 3300049540 | Ga0501324_000010 | Ga0501324_000010_1369_1674 | 99 |
| 1344 | 3300049541 | Ga0501325_001682 | Ga0501325_001682_659_964 | 99 |
| 1345 | 3300049541 | Ga0501325_005394 | Ga0501325_005394_441_746 | 99 |
| 1346 | 3300049542 | Ga0501326_02636 | Ga0501326_02636_436_741 | 99 |
| 1347 | 3300049545 | Ga0501329_01750 | Ga0501329_01750_173_478 | 99 |
| 1348 | 3300049546 | Ga0501330_002423 | Ga0501330_002423_360_665 | 99 |
| 1349 | 3300049546 | Ga0501330_004730 | Ga0501330_004730_256_561 | 99 |
| 1350 | 3300049547 | Ga0501331_01798 | Ga0501331_01798_336_641 | 99 |
| 1351 | 3300049550 | Ga0501334_02717 | Ga0501334_02717_451_756 | 99 |
| 1352 | 3300049551 | Ga0501335_006923 | Ga0501335_006923_266_571 | 99 |
| 1353 | 3300049552 | Ga0501336_003497 | Ga0501336_003497_142_447 | 99 |
| 1354 | 3300049555 | Ga0501339_00289 | Ga0501339_00289_451_756 | 99 |
| 1355 | 3300049556 | Ga0501340_002383 | Ga0501340_002383_528_833 | 99 |
| 1356 | 3300049581 | Ga0501047_0146277 | Ga0501047_0146277_615_914 | 99 |
| 1357 | 3300049585 | Ga0501069_0076429 | Ga0501069_0076429_53_358 | 99 |
| 1358 | 3300049823 | Ga0501044_0186638 | Ga0501044_0186638_1084_1389 | 99 |
| 1359 | 3300050489 | nmdc:mga03683_384112_c1 | nmdc:mga03683_384112_c1_318_623 | 99 |
| 1360 | 3300050490 | nmdc:mga03n38_22870_c1 | nmdc:mga03n38_22870_c1_1816_2139 | 99 |
| 1361 | 3300050490 | nmdc:mga03n38_31633_c1 | nmdc:mga03n38_31633_c1_213_518 | 99 |
| 1362 | 3300050491 | nmdc:mga00v17_48225_c1 | nmdc:mga00v17_48225_c1_479_784 | 99 |
| 1363 | 3300050496 | nmdc:mga07m45_11732_c1 | nmdc:mga07m45_11732_c1_1479_1784 | 99 |
| 1364 | 3300050496 | nmdc:mga07m45_149073_c1 | nmdc:mga07m45_149073_c1_1037_1342 | 99 |
| 1365 | 3300050496 | nmdc:mga07m45_161812_c1 | nmdc:mga07m45_161812_c1_690_995 | 99 |
| 1366 | 3300050496 | nmdc:mga07m45_292859_c2 | nmdc:mga07m45_292859_c2_169_492 | 99 |
| 1367 | 3300053083 | Ga0495655_0251992 | Ga0495655_0251992_76_375 | 99 |
| 1368 | 3300053156 | Ga0500622_0327163 | Ga0500622_0327163_314_619 | 99 |
| 1369 | 3300059478 | Ga0587093_103445 | Ga0587093_103445_68_376 | 99 |
| 1370 | 3300059493 | Ga0587077_116916 | Ga0587077_116916_83_385 | 99 |
| 1371 | 3300059504 | Ga0587082_152991 | Ga0587082_152991_99_398 | 99 |
| 1372 | 3300059654 | Ga0587110_038457 | Ga0587110_038457_28_333 | 99 |
| 1373 | 3300059660 | Ga0587124_008953 | Ga0587124_008953_274_576 | 99 |
| 1374 | 3300060346 | Ga0587111_0018608 | Ga0587111_0018608_659_964 | 99 |
| 1375 | 3300061719 | Ga0466962_0004292 | Ga0466962_0004292_1930_2229 | 99 |
| 1376 | iso_pu_bacteria | 3001119090 | 3001120668 | 99 |
| 1377 | 3300001915 | JGI24741J21665_1041427 | JGI24741J21665_10414271 | 100 |
| 1378 | 3300001977 | JGI24746J21847_1009919 | JGI24746J21847_10099193 | 100 |
| 1379 | 3300001978 | JGI24747J21853_1045559 | JGI24747J21853_10455591 | 100 |
| 1380 | 3300001989 | JGI24739J22299_10012134 | JGI24739J22299_100121345 | 100 |
| 1381 | 3300001989 | JGI24739J22299_10248070 | JGI24739J22299_102480701 | 100 |
| 1382 | 3300001990 | JGI24737J22298_10236133 | JGI24737J22298_102361332 | 100 |
| 1383 | 3300001991 | JGI24743J22301_10000788 | JGI24743J22301_100007884 | 100 |
| 1384 | 3300002067 | JGI24735J21928_10082229 | JGI24735J21928_100822292 | 100 |
| 1385 | 3300002067 | JGI24735J21928_10099913 | JGI24735J21928_100999133 | 100 |
| 1386 | 3300002070 | JGI24750J21931_1003131 | JGI24750J21931_10031314 | 100 |
| 1387 | 3300002075 | JGI24738J21930_10001633 | JGI24738J21930_100016336 | 100 |
| 1388 | 3300002076 | JGI24749J21850_1002100 | JGI24749J21850_10021005 | 100 |
| 1389 | 3300002077 | JGI24744J21845_10001898 | JGI24744J21845_100018984 | 100 |
| 1390 | 3300002155 | JGI24033J26618_1005426 | JGI24033J26618_10054261 | 100 |
| 1391 | 3300002244 | JGI24742J22300_10004109 | JGI24742J22300_100041094 | 100 |
| 1392 | 3300002459 | JGI24751J29686_10112356 | JGI24751J29686_101123562 | 100 |
| 1393 | 3300003162 | Ga0006778J45830_1040387 | Ga0006778J45830_10403872 | 100 |
| 1394 | 3300003568 | Ga0006781J51513_1018983 | Ga0006781J51513_10189832 | 100 |
| 1395 | 3300004799 | Ga0058863_10019893 | Ga0058863_100198932 | 100 |
| 1396 | 3300004799 | Ga0058863_11928268 | Ga0058863_119282681 | 100 |
| 1397 | 3300004800 | Ga0058861_11782082 | Ga0058861_117820821 | 100 |
| 1398 | 3300004800 | Ga0058861_11966061 | Ga0058861_119660612 | 100 |
| 1399 | 3300004800 | Ga0058861_11996887 | Ga0058861_119968872 | 100 |
| 1400 | 3300004800 | Ga0058861_12014623 | Ga0058861_120146232 | 100 |
| 1401 | 3300004801 | Ga0058860_12054507 | Ga0058860_120545071 | 100 |
| 1402 | 3300004801 | Ga0058860_12196300 | Ga0058860_121963002 | 100 |
| 1403 | 3300004803 | Ga0058862_10207258 | Ga0058862_102072581 | 100 |
| 1404 | 3300004803 | Ga0058862_12600277 | Ga0058862_126002771 | 100 |
| 1405 | 3300005327 | Ga0070658_10042114 | Ga0070658_100421145 | 100 |
| 1406 | 3300005327 | Ga0070658_10048072 | Ga0070658_100480726 | 100 |
| 1407 | 3300005327 | Ga0070658_10514568 | Ga0070658_105145682 | 100 |
| 1408 | 3300005328 | Ga0070676_11060840 | Ga0070676_110608402 | 100 |
| 1409 | 3300005329 | Ga0070683_100080739 | Ga0070683_1000807394 | 100 |
| 1410 | 3300005329 | Ga0070683_100221234 | Ga0070683_1002212342 | 100 |
| 1411 | 3300005329 | Ga0070683_100327462 | Ga0070683_1003274622 | 100 |
| 1412 | 3300005329 | Ga0070683_100470219 | Ga0070683_1004702191 | 100 |
| 1413 | 3300005329 | Ga0070683_101167355 | Ga0070683_1011673552 | 100 |
| 1414 | 3300005336 | Ga0070680_100031712 | Ga0070680_1000317125 | 100 |
| 1415 | 3300005337 | Ga0070682_100024938 | Ga0070682_1000249385 | 100 |
| 1416 | 3300005337 | Ga0070682_100059983 | Ga0070682_1000599833 | 100 |
| 1417 | 3300005338 | Ga0068868_100096107 | Ga0068868_1000961072 | 100 |
| 1418 | 3300005338 | Ga0068868_100121089 | Ga0068868_1001210892 | 100 |
| 1419 | 3300005339 | Ga0070660_100300302 | Ga0070660_1003003022 | 100 |
| 1420 | 3300005339 | Ga0070660_100345603 | Ga0070660_1003456032 | 100 |
| 1421 | 3300005339 | Ga0070660_100753900 | Ga0070660_1007539002 | 100 |
| 1422 | 3300005340 | Ga0070689_100188908 | Ga0070689_1001889082 | 100 |
| 1423 | 3300005341 | Ga0070691_10012309 | Ga0070691_100123092 | 100 |
| 1424 | 3300005341 | Ga0070691_11018754 | Ga0070691_110187542 | 100 |
| 1425 | 3300005343 | Ga0070687_101381756 | Ga0070687_1013817561 | 100 |
| 1426 | 3300005344 | Ga0070661_101259793 | Ga0070661_1012597932 | 100 |
| 1427 | 3300005345 | Ga0070692_10049505 | Ga0070692_100495054 | 100 |
| 1428 | 3300005347 | Ga0070668_100003483 | Ga0070668_1000034835 | 100 |
| 1429 | 3300005353 | Ga0070669_100224629 | Ga0070669_1002246292 | 100 |
| 1430 | 3300005354 | Ga0070675_100065082 | Ga0070675_1000650825 | 100 |
| 1431 | 3300005364 | Ga0070673_100273384 | Ga0070673_1002733842 | 100 |
| 1432 | 3300005366 | Ga0070659_100143201 | Ga0070659_1001432012 | 100 |
| 1433 | 3300005406 | Ga0070703_10500187 | Ga0070703_105001871 | 100 |
| 1434 | 3300005434 | Ga0070709_10089315 | Ga0070709_100893152 | 100 |
| 1435 | 3300005435 | Ga0070714_100124276 | Ga0070714_1001242765 | 100 |
| 1436 | 3300005435 | Ga0070714_100255466 | Ga0070714_1002554662 | 100 |
| 1437 | 3300005435 | Ga0070714_101267338 | Ga0070714_1012673382 | 100 |
| 1438 | 3300005436 | Ga0070713_101290112 | Ga0070713_1012901122 | 100 |
| 1439 | 3300005437 | Ga0070710_10026928 | Ga0070710_100269281 | 100 |
| 1440 | 3300005438 | Ga0070701_10001181 | Ga0070701_100011819 | 100 |
| 1441 | 3300005439 | Ga0070711_100144299 | Ga0070711_1001442993 | 100 |
| 1442 | 3300005441 | Ga0070700_100003597 | Ga0070700_1000035972 | 100 |
| 1443 | 3300005441 | Ga0070700_100647746 | Ga0070700_1006477462 | 100 |
| 1444 | 3300005445 | Ga0070708_100964864 | Ga0070708_1009648641 | 100 |
| 1445 | 3300005455 | Ga0070663_100008045 | Ga0070663_1000080457 | 100 |
| 1446 | 3300005455 | Ga0070663_100042970 | Ga0070663_1000429706 | 100 |
| 1447 | 3300005455 | Ga0070663_100117821 | Ga0070663_1001178212 | 100 |
| 1448 | 3300005456 | Ga0070678_100149172 | Ga0070678_1001491723 | 100 |
| 1449 | 3300005456 | Ga0070678_100495008 | Ga0070678_1004950082 | 100 |
| 1450 | 3300005456 | Ga0070678_101925076 | Ga0070678_1019250761 | 100 |
| 1451 | 3300005457 | Ga0070662_100702675 | Ga0070662_1007026752 | 100 |
| 1452 | 3300005458 | Ga0070681_10034186 | Ga0070681_100341865 | 100 |
| 1453 | 3300005458 | Ga0070681_10248490 | Ga0070681_102484903 | 100 |
| 1454 | 3300005459 | Ga0068867_100007380 | Ga0068867_1000073809 | 100 |
| 1455 | 3300005466 | Ga0070685_10031017 | Ga0070685_100310172 | 100 |
| 1456 | 3300005468 | Ga0070707_100017376 | Ga0070707_1000173765 | 100 |
| 1457 | 3300005471 | Ga0070698_100006774 | Ga0070698_10000677421 | 100 |
| 1458 | 3300005530 | Ga0070679_100240378 | Ga0070679_1002403783 | 100 |
| 1459 | 3300005530 | Ga0070679_100571901 | Ga0070679_1005719012 | 100 |
| 1460 | 3300005535 | Ga0070684_100057591 | Ga0070684_1000575912 | 100 |
| 1461 | 3300005535 | Ga0070684_100371632 | Ga0070684_1003716321 | 100 |
| 1462 | 3300005535 | Ga0070684_100410385 | Ga0070684_1004103851 | 100 |
| 1463 | 3300005535 | Ga0070684_100429706 | Ga0070684_1004297062 | 100 |
| 1464 | 3300005535 | Ga0070684_101995532 | Ga0070684_1019955322 | 100 |
| 1465 | 3300005543 | Ga0070672_100002167 | Ga0070672_10000216711 | 100 |
| 1466 | 3300005547 | Ga0070693_100070840 | Ga0070693_1000708403 | 100 |
| 1467 | 3300005548 | Ga0070665_102071605 | Ga0070665_1020716052 | 100 |
| 1468 | 3300005564 | Ga0070664_100029753 | Ga0070664_1000297533 | 100 |
| 1469 | 3300005577 | Ga0068857_100573578 | Ga0068857_1005735782 | 100 |
| 1470 | 3300005577 | Ga0068857_101300636 | Ga0068857_1013006362 | 100 |
| 1471 | 3300005578 | Ga0068854_100056171 | Ga0068854_1000561713 | 100 |
| 1472 | 3300005614 | Ga0068856_101904600 | Ga0068856_1019046002 | 100 |
| 1473 | 3300005616 | Ga0068852_100002721 | Ga0068852_1000027215 | 100 |
| 1474 | 3300005617 | Ga0068859_101607613 | Ga0068859_1016076131 | 100 |
| 1475 | 3300005617 | Ga0068859_101719729 | Ga0068859_1017197292 | 100 |
| 1476 | 3300005618 | Ga0068864_100263876 | Ga0068864_1002638762 | 100 |
| 1477 | 3300005718 | Ga0068866_10029184 | Ga0068866_100291843 | 100 |
| 1478 | 3300005719 | Ga0068861_100802200 | Ga0068861_1008022002 | 100 |
| 1479 | 3300005834 | Ga0068851_10964187 | Ga0068851_109641871 | 100 |
| 1480 | 3300005840 | Ga0068870_10000658 | Ga0068870_100006585 | 100 |
| 1481 | 3300005840 | Ga0068870_11264107 | Ga0068870_112641072 | 100 |
| 1482 | 3300005842 | Ga0068858_101691493 | Ga0068858_1016914931 | 100 |
| 1483 | 3300005843 | Ga0068860_100616459 | Ga0068860_1006164592 | 100 |
| 1484 | 3300006028 | Ga0070717_10250533 | Ga0070717_102505332 | 100 |
| 1485 | 3300006038 | Ga0075365_10753603 | Ga0075365_107536032 | 100 |
| 1486 | 3300006051 | Ga0075364_10002085 | Ga0075364_1000208521 | 100 |
| 1487 | 3300006163 | Ga0070715_10017201 | Ga0070715_100172012 | 100 |
| 1488 | 3300006175 | Ga0070712_100411945 | Ga0070712_1004119452 | 100 |
| 1489 | 3300006186 | Ga0075369_10499827 | Ga0075369_104998272 | 100 |
| 1490 | 3300006353 | Ga0075370_10407942 | Ga0075370_104079422 | 100 |
| 1491 | 3300006871 | Ga0075434_101355643 | Ga0075434_1013556432 | 100 |
| 1492 | 3300006881 | Ga0068865_100006802 | Ga0068865_1000068025 | 100 |
| 1493 | 3300006931 | Ga0097620_101607525 | Ga0097620_1016075252 | 100 |
| 1494 | 3300006931 | Ga0097620_101719729 | Ga0097620_1017197292 | 100 |
| 1495 | 3300009094 | Ga0111539_10996282 | Ga0111539_109962821 | 100 |
| 1496 | 3300009098 | Ga0105245_10240303 | Ga0105245_102403032 | 100 |
| 1497 | 3300009098 | Ga0105245_10561875 | Ga0105245_105618752 | 100 |
| 1498 | 3300009098 | Ga0105245_10796479 | Ga0105245_107964792 | 100 |
| 1499 | 3300009148 | Ga0105243_10002648 | Ga0105243_1000264816 | 100 |
| 1500 | 3300009174 | Ga0105241_10810459 | Ga0105241_108104592 | 100 |
| 1501 | 3300009176 | Ga0105242_11180075 | Ga0105242_111800752 | 100 |
| 1502 | 3300009177 | Ga0105248_10129268 | Ga0105248_101292684 | 100 |
| 1503 | 3300009545 | Ga0105237_10229716 | Ga0105237_102297162 | 100 |
| 1504 | 3300009551 | Ga0105238_10117861 | Ga0105238_101178614 | 100 |
| 1505 | 3300010375 | Ga0105239_10020346 | Ga0105239_100203469 | 100 |
| 1506 | 3300012490 | Ga0157322_1013516 | Ga0157322_10135162 | 100 |
| 1507 | 3300012506 | Ga0157324_1018276 | Ga0157324_10182762 | 100 |
| 1508 | 3300013102 | Ga0157371_10216006 | Ga0157371_102160062 | 100 |
| 1509 | 3300013104 | Ga0157370_10149009 | Ga0157370_101490094 | 100 |
| 1510 | 3300013105 | Ga0157369_10141244 | Ga0157369_101412445 | 100 |
| 1511 | 3300013296 | Ga0157374_10131921 | Ga0157374_101319212 | 100 |
| 1512 | 3300013296 | Ga0157374_11632815 | Ga0157374_116328152 | 100 |
| 1513 | 3300013297 | Ga0157378_11824487 | Ga0157378_118244872 | 100 |
| 1514 | 3300013306 | Ga0163162_12258468 | Ga0163162_122584682 | 100 |
| 1515 | 3300013307 | Ga0157372_10977450 | Ga0157372_109774502 | 100 |
| 1516 | 3300013307 | Ga0157372_11442381 | Ga0157372_114423812 | 100 |
| 1517 | 3300013308 | Ga0157375_11008643 | Ga0157375_110086432 | 100 |
| 1518 | 3300013308 | Ga0157375_13751007 | Ga0157375_137510071 | 100 |
| 1519 | 3300014326 | Ga0157380_10037515 | Ga0157380_100375152 | 100 |
| 1520 | 3300014745 | Ga0157377_10218860 | Ga0157377_102188602 | 100 |
| 1521 | 3300014968 | Ga0157379_10899456 | Ga0157379_108994562 | 100 |
| 1522 | 3300014969 | Ga0157376_12092919 | Ga0157376_120929192 | 100 |
| 1523 | 3300015265 | Ga0182005_1186331 | Ga0182005_11863312 | 100 |
| 1524 | 3300020069 | Ga0197907_10781799 | Ga0197907_107817992 | 100 |
| 1525 | 3300020069 | Ga0197907_11047833 | Ga0197907_110478333 | 100 |
| 1526 | 3300020069 | Ga0197907_11348210 | Ga0197907_113482102 | 100 |
| 1527 | 3300020070 | Ga0206356_10482235 | Ga0206356_104822352 | 100 |
| 1528 | 3300020070 | Ga0206356_10562542 | Ga0206356_105625422 | 100 |
| 1529 | 3300020070 | Ga0206356_11355722 | Ga0206356_113557222 | 100 |
| 1530 | 3300020075 | Ga0206349_1265100 | Ga0206349_12651001 | 100 |
| 1531 | 3300020075 | Ga0206349_1464288 | Ga0206349_14642882 | 100 |
| 1532 | 3300020076 | Ga0206355_1205564 | Ga0206355_12055642 | 100 |
| 1533 | 3300020076 | Ga0206355_1654077 | Ga0206355_16540772 | 100 |
| 1534 | 3300020077 | Ga0206351_10219957 | Ga0206351_102199572 | 100 |
| 1535 | 3300020077 | Ga0206351_10414096 | Ga0206351_104140964 | 100 |
| 1536 | 3300020078 | Ga0206352_10333989 | Ga0206352_103339892 | 100 |
| 1537 | 3300020078 | Ga0206352_10725403 | Ga0206352_107254032 | 100 |
| 1538 | 3300020078 | Ga0206352_10725571 | Ga0206352_107255713 | 100 |
| 1539 | 3300020080 | Ga0206350_10382414 | Ga0206350_103824142 | 100 |
| 1540 | 3300020080 | Ga0206350_11655750 | Ga0206350_116557502 | 100 |
| 1541 | 3300020081 | Ga0206354_10378201 | Ga0206354_103782012 | 100 |
| 1542 | 3300020081 | Ga0206354_10670181 | Ga0206354_106701813 | 100 |
| 1543 | 3300020082 | Ga0206353_10865326 | Ga0206353_108653263 | 100 |
| 1544 | 3300020610 | Ga0154015_1350603 | Ga0154015_13506032 | 100 |
| 1545 | 3300020610 | Ga0154015_1581024 | Ga0154015_15810242 | 100 |
| 1546 | 3300021388 | Ga0213875_10000362 | Ga0213875_100003625 | 100 |
| 1547 | 3300021388 | Ga0213875_10130105 | Ga0213875_101301052 | 100 |
| 1548 | 3300022467 | Ga0224712_10004671 | Ga0224712_100046712 | 100 |
| 1549 | 3300022467 | Ga0224712_10048915 | Ga0224712_100489152 | 100 |
| 1550 | 3300022467 | Ga0224712_10252712 | Ga0224712_102527122 | 100 |
| 1551 | 3300025898 | Ga0207692_10005017 | Ga0207692_100050173 | 100 |
| 1552 | 3300025899 | Ga0207642_10154536 | Ga0207642_101545362 | 100 |
| 1553 | 3300025901 | Ga0207688_10042994 | Ga0207688_100429941 | 100 |
| 1554 | 3300025904 | Ga0207647_10107907 | Ga0207647_101079072 | 100 |
| 1555 | 3300025904 | Ga0207647_10177455 | Ga0207647_101774552 | 100 |
| 1556 | 3300025904 | Ga0207647_10401794 | Ga0207647_104017942 | 100 |
| 1557 | 3300025906 | Ga0207699_10021552 | Ga0207699_100215523 | 100 |
| 1558 | 3300025906 | Ga0207699_10370112 | Ga0207699_103701122 | 100 |
| 1559 | 3300025908 | Ga0207643_10001355 | Ga0207643_1000135515 | 100 |
| 1560 | 3300025909 | Ga0207705_10027743 | Ga0207705_100277435 | 100 |
| 1561 | 3300025909 | Ga0207705_10216281 | Ga0207705_102162813 | 100 |
| 1562 | 3300025911 | Ga0207654_10452981 | Ga0207654_104529812 | 100 |
| 1563 | 3300025912 | Ga0207707_10008073 | Ga0207707_1000807314 | 100 |
| 1564 | 3300025912 | Ga0207707_10942357 | Ga0207707_109423572 | 100 |
| 1565 | 3300025914 | Ga0207671_10130693 | Ga0207671_101306932 | 100 |
| 1566 | 3300025916 | Ga0207663_10110103 | Ga0207663_101101032 | 100 |
| 1567 | 3300025916 | Ga0207663_11677928 | Ga0207663_116779281 | 100 |
| 1568 | 3300025917 | Ga0207660_10053168 | Ga0207660_100531683 | 100 |
| 1569 | 3300025917 | Ga0207660_10848599 | Ga0207660_108485992 | 100 |
| 1570 | 3300025919 | Ga0207657_10290547 | Ga0207657_102905472 | 100 |
| 1571 | 3300025919 | Ga0207657_10369061 | Ga0207657_103690612 | 100 |
| 1572 | 3300025919 | Ga0207657_10547404 | Ga0207657_105474042 | 100 |
| 1573 | 3300025920 | Ga0207649_10155879 | Ga0207649_101558791 | 100 |
| 1574 | 3300025920 | Ga0207649_10478211 | Ga0207649_104782112 | 100 |
| 1575 | 3300025921 | Ga0207652_10061156 | Ga0207652_100611565 | 100 |
| 1576 | 3300025921 | Ga0207652_10837371 | Ga0207652_108373712 | 100 |
| 1577 | 3300025922 | Ga0207646_10082391 | Ga0207646_100823914 | 100 |
| 1578 | 3300025924 | Ga0207694_10405590 | Ga0207694_104055902 | 100 |
| 1579 | 3300025926 | Ga0207659_10118329 | Ga0207659_101183293 | 100 |
| 1580 | 3300025927 | Ga0207687_10953729 | Ga0207687_109537292 | 100 |
| 1581 | 3300025928 | Ga0207700_10010456 | Ga0207700_100104565 | 100 |
| 1582 | 3300025929 | Ga0207664_10040828 | Ga0207664_100408283 | 100 |
| 1583 | 3300025932 | Ga0207690_10129601 | Ga0207690_101296013 | 100 |
| 1584 | 3300025932 | Ga0207690_10689245 | Ga0207690_106892452 | 100 |
| 1585 | 3300025933 | Ga0207706_10509293 | Ga0207706_105092931 | 100 |
| 1586 | 3300025934 | Ga0207686_10849427 | Ga0207686_108494272 | 100 |
| 1587 | 3300025935 | Ga0207709_10005029 | Ga0207709_100050295 | 100 |
| 1588 | 3300025936 | Ga0207670_10022974 | Ga0207670_100229745 | 100 |
| 1589 | 3300025937 | Ga0207669_10006873 | Ga0207669_100068735 | 100 |
| 1590 | 3300025937 | Ga0207669_10756249 | Ga0207669_107562492 | 100 |
| 1591 | 3300025938 | Ga0207704_10439993 | Ga0207704_104399932 | 100 |
| 1592 | 3300025940 | Ga0207691_10003431 | Ga0207691_1000343116 | 100 |
| 1593 | 3300025941 | Ga0207711_10224387 | Ga0207711_102243873 | 100 |
| 1594 | 3300025942 | Ga0207689_10281438 | Ga0207689_102814382 | 100 |
| 1595 | 3300025944 | Ga0207661_10050176 | Ga0207661_100501765 | 100 |
| 1596 | 3300025944 | Ga0207661_10104106 | Ga0207661_101041064 | 100 |
| 1597 | 3300025944 | Ga0207661_10109515 | Ga0207661_101095152 | 100 |
| 1598 | 3300025944 | Ga0207661_10402489 | Ga0207661_104024892 | 100 |
| 1599 | 3300025945 | Ga0207679_10087528 | Ga0207679_100875282 | 100 |
| 1600 | 3300025949 | Ga0207667_10748206 | Ga0207667_107482062 | 100 |
| 1601 | 3300025960 | Ga0207651_10608015 | Ga0207651_106080152 | 100 |
| 1602 | 3300025972 | Ga0207668_10001244 | Ga0207668_1000124418 | 100 |
| 1603 | 3300025981 | Ga0207640_10336272 | Ga0207640_103362721 | 100 |
| 1604 | 3300026023 | Ga0207677_10510942 | Ga0207677_105109422 | 100 |
| 1605 | 3300026023 | Ga0207677_10724953 | Ga0207677_107249532 | 100 |
| 1606 | 3300026041 | Ga0207639_10140158 | Ga0207639_101401582 | 100 |
| 1607 | 3300026041 | Ga0207639_11572563 | Ga0207639_115725632 | 100 |
| 1608 | 3300026067 | Ga0207678_10000929 | Ga0207678_1000092919 | 100 |
| 1609 | 3300026067 | Ga0207678_10012875 | Ga0207678_100128756 | 100 |
| 1610 | 3300026067 | Ga0207678_10329902 | Ga0207678_103299022 | 100 |
| 1611 | 3300026075 | Ga0207708_10002425 | Ga0207708_1000242524 | 100 |
| 1612 | 3300026078 | Ga0207702_10914466 | Ga0207702_109144662 | 100 |
| 1613 | 3300026089 | Ga0207648_10007281 | Ga0207648_1000728110 | 100 |
| 1614 | 3300026095 | Ga0207676_10434265 | Ga0207676_104342652 | 100 |
| 1615 | 3300026116 | Ga0207674_10070710 | Ga0207674_100707102 | 100 |
| 1616 | 3300026118 | Ga0207675_100003879 | Ga0207675_10000387916 | 100 |
| 1617 | 3300026118 | Ga0207675_101338561 | Ga0207675_1013385612 | 100 |
| 1618 | 3300026121 | Ga0207683_10074864 | Ga0207683_100748643 | 100 |
| 1619 | 3300026121 | Ga0207683_10683415 | Ga0207683_106834152 | 100 |
| 1620 | 3300026121 | Ga0207683_10995746 | Ga0207683_109957462 | 100 |
| 1621 | 3300026142 | Ga0207698_10072778 | Ga0207698_100727784 | 100 |
| 1622 | 3300028036 | Ga0265355_1007915 | Ga0265355_10079152 | 100 |
| 1623 | 3300028379 | Ga0268266_12384300 | Ga0268266_123843002 | 100 |
| 1624 | 3300028380 | Ga0268265_10597590 | Ga0268265_105975902 | 100 |
| 1625 | 3300030522 | Ga0307512_10086539 | Ga0307512_100865393 | 100 |
| 1626 | 3300030762 | Ga0265775_102055 | Ga0265775_1020552 | 100 |
| 1627 | 3300030763 | Ga0265763_1000738 | Ga0265763_10007382 | 100 |
| 1628 | 3300030763 | Ga0265763_1040469 | Ga0265763_10404691 | 100 |
| 1629 | 3300030863 | Ga0265766_1011257 | Ga0265766_10112572 | 100 |
| 1630 | 3300030882 | Ga0265764_105138 | Ga0265764_1051381 | 100 |
| 1631 | 3300030888 | Ga0265769_101293 | Ga0265769_1012932 | 100 |
| 1632 | 3300030889 | Ga0265761_103183 | Ga0265761_1031832 | 100 |
| 1633 | 3300031018 | Ga0265773_1012166 | Ga0265773_10121662 | 100 |
| 1634 | 3300031043 | Ga0265779_103758 | Ga0265779_1037582 | 100 |
| 1635 | 3300031239 | Ga0265328_10034011 | Ga0265328_100340114 | 100 |
| 1636 | 3300031507 | Ga0307509_10118846 | Ga0307509_101188464 | 100 |
| 1637 | 3300031592 | Ga0310117_117420 | Ga0310117_1174202 | 100 |
| 1638 | 3300031615 | Ga0310107_126959 | Ga0310107_1269592 | 100 |
| 1639 | 3300031731 | Ga0307405_10006223 | Ga0307405_100062237 | 100 |
| 1640 | 3300031731 | Ga0307405_10696521 | Ga0307405_106965212 | 100 |
| 1641 | 3300031731 | Ga0307405_11059571 | Ga0307405_110595711 | 100 |
| 1642 | 3300031731 | Ga0307405_11115298 | Ga0307405_111152982 | 100 |
| 1643 | 3300031731 | Ga0307405_11403736 | Ga0307405_114037362 | 100 |
| 1644 | 3300031731 | Ga0307405_11949736 | Ga0307405_119497362 | 100 |
| 1645 | 3300031824 | Ga0307413_10169880 | Ga0307413_101698802 | 100 |
| 1646 | 3300031852 | Ga0307410_10565557 | Ga0307410_105655572 | 100 |
| 1647 | 3300031852 | Ga0307410_10604991 | Ga0307410_106049911 | 100 |
| 1648 | 3300031852 | Ga0307410_11914898 | Ga0307410_119148982 | 100 |
| 1649 | 3300031903 | Ga0307407_10238165 | Ga0307407_102381652 | 100 |
| 1650 | 3300031903 | Ga0307407_10259715 | Ga0307407_102597152 | 100 |
| 1651 | 3300031911 | Ga0307412_10064406 | Ga0307412_100644063 | 100 |
| 1652 | 3300031995 | Ga0307409_100902359 | Ga0307409_1009023592 | 100 |
| 1653 | 3300032002 | Ga0307416_100079924 | Ga0307416_1000799244 | 100 |
| 1654 | 3300032005 | Ga0307411_10529935 | Ga0307411_105299352 | 100 |
| 1655 | 3300032005 | Ga0307411_10592318 | Ga0307411_105923182 | 100 |
| 1656 | 3300032126 | Ga0307415_100099997 | Ga0307415_1000999972 | 100 |
| 1657 | 3300033180 | Ga0307510_10019413 | Ga0307510_100194139 | 100 |
| 1658 | 3300035086 | Ga0373934_0033978 | Ga0373934_0033978_179_481 | 100 |
| 1659 | 3300035111 | Ga0373923_0187403 | Ga0373923_0187403_152_454 | 100 |
| 1660 | 3300035113 | Ga0373936_0018900 | Ga0373936_0018900_2080_2382 | 100 |
| 1661 | 3300035117 | Ga0373953_0004941 | Ga0373953_0004941_3631_3933 | 100 |
| 1662 | 3300035119 | Ga0373956_0008114 | Ga0373956_0008114_3804_4106 | 100 |
| 1663 | 3300035120 | Ga0373957_0001036 | Ga0373957_0001036_6545_6847 | 100 |
| 1664 | 3300035170 | Ga0373943_0262098 | Ga0373943_0262098_569_871 | 100 |
| 1665 | 3300035172 | Ga0373955_0138702 | Ga0373955_0138702_584_886 | 100 |
| 1666 | 3300035410 | Ga0373924_0051899 | Ga0373924_0051899_146_448 | 100 |
| 1667 | 3300035692 | Ga0373935_0046761 | Ga0373935_0046761_547_849 | 100 |
| 1668 | 3300035724 | Ga0373933_0090081 | Ga0373933_0090081_1346_1648 | 100 |
| 1669 | 3300036401 | Ga0373937_0091252 | Ga0373937_0091252_1975_2277 | 100 |
| 1670 | 3300036459 | Ga0372808_054548 | Ga0372808_054548_68_370 | 100 |
| 1671 | 3300037068 | Ga0373925_0000004 | Ga0373925_0000004_299145_299447 | 100 |
| 1672 | 3300037068 | Ga0373925_0085471 | Ga0373925_0085471_673_975 | 100 |
| 1673 | 3300037068 | Ga0373925_1773439 | Ga0373925_1773439_114_419 | 100 |
| 1674 | 3300037312 | Ga0395899_0004964 | Ga0395899_0004964_2141_2446 | 100 |
| 1675 | 3300037418 | Ga0395900_0437593 | Ga0395900_0437593_28_330 | 100 |
| 1676 | 3300037418 | Ga0395900_1499602 | Ga0395900_1499602_112_417 | 100 |
| 1677 | 3300037588 | Ga0316581_0286595 | Ga0316581_0286595_108_410 | 100 |
| 1678 | 3300037853 | Ga0436364_0508850 | Ga0436364_0508850_763_1065 | 100 |
| 1679 | 3300037853 | Ga0436364_0804097 | Ga0436364_0804097_2248_2550 | 100 |
| 1680 | 3300037853 | Ga0436364_0856491 | Ga0436364_0856491_59_361 | 100 |
| 1681 | 3300039437 | Ga0436365_1560914 | Ga0436365_1560914_825_1127 | 100 |
| 1682 | 3300039438 | Ga0436360_0146467 | Ga0436360_0146467_21_323 | 100 |
| 1683 | 3300039438 | Ga0436360_1002306 | Ga0436360_1002306_1041_1343 | 100 |
| 1684 | 3300039450 | Ga0436363_0713271 | Ga0436363_0713271_825_1127 | 100 |
| 1685 | 3300039453 | Ga0436362_1034091 | Ga0436362_1034091_651_953 | 100 |
| 1686 | 3300041413 | Ga0439465_0224732 | Ga0439465_0224732_275_580 | 100 |
| 1687 | 3300041445 | Ga0451792_10772 | Ga0451792_10772_176_481 | 100 |
| 1688 | 3300041446 | Ga0451794_50020 | Ga0451794_50020_281_586 | 100 |
| 1689 | 3300041451 | Ga0451791_0540367 | Ga0451791_0540367_222_527 | 100 |
| 1690 | 3300041453 | Ga0451797_0934014 | Ga0451797_0934014_165_470 | 100 |
| 1691 | 3300041453 | Ga0451797_1097187 | Ga0451797_1097187_17_322 | 100 |
| 1692 | 3300041456 | Ga0451795_1286801 | Ga0451795_1286801_140_445 | 100 |
| 1693 | 3300041459 | Ga0451800_1157504 | Ga0451800_1157504_26_331 | 100 |
| 1694 | 3300041486 | Ga0451807_1581569 | Ga0451807_1581569_53_358 | 100 |
| 1695 | 3300041492 | Ga0451835_0504333 | Ga0451835_0504333_145_450 | 100 |
| 1696 | 3300041494 | Ga0451837_1596043 | Ga0451837_1596043_227_532 | 100 |
| 1697 | 3300041503 | Ga0451847_0897189 | Ga0451847_0897189_159_464 | 100 |
| 1698 | 3300041509 | Ga0451843_0673582 | Ga0451843_0673582_151_456 | 100 |
| 1699 | 3300041511 | Ga0451855_1437951 | Ga0451855_1437951_226_528 | 100 |
| 1700 | 3300041512 | Ga0451853_1178819 | Ga0451853_1178819_421_726 | 100 |
| 1701 | 3300042004 | Ga0439445_0160488 | Ga0439445_0160488_52_357 | 100 |
| 1702 | 3300042005 | Ga0439448_0053568 | Ga0439448_0053568_521_826 | 100 |
| 1703 | 3300044658 | Ga0466972_0000467 | Ga0466972_0000467_9510_9821 | 100 |
| 1704 | 3300044683 | Ga0466965_0025770 | Ga0466965_0025770_1394_1705 | 100 |
| 1705 | 3300044683 | Ga0466965_0186238 | Ga0466965_0186238_460_765 | 100 |
| 1706 | 3300044683 | Ga0466965_0336110 | Ga0466965_0336110_321_626 | 100 |
| 1707 | 3300044684 | Ga0466966_0138637 | Ga0466966_0138637_184_495 | 100 |
| 1708 | 3300044693 | Ga0466961_0204769 | Ga0466961_0204769_492_803 | 100 |
| 1709 | 3300044694 | Ga0466963_0043465 | Ga0466963_0043465_1138_1440 | 100 |
| 1710 | 3300044694 | Ga0466963_0049392 | Ga0466963_0049392_267_572 | 100 |
| 1711 | 3300044694 | Ga0466963_0153201 | Ga0466963_0153201_720_1025 | 100 |
| 1712 | 3300044706 | Ga0466964_0813611 | Ga0466964_0813611_139_441 | 100 |
| 1713 | 3300044719 | Ga0466971_0204032 | Ga0466971_0204032_143_454 | 100 |
| 1714 | 3300044735 | Ga0466968_0054416 | Ga0466968_0054416_36_338 | 100 |
| 1715 | 3300044735 | Ga0466968_0073253 | Ga0466968_0073253_622_933 | 100 |
| 1716 | 3300044765 | Ga0466970_0071776 | Ga0466970_0071776_1266_1577 | 100 |
| 1717 | 3300044765 | Ga0466970_0164699 | Ga0466970_0164699_393_698 | 100 |
| 1718 | 3300044765 | Ga0466970_0800002 | Ga0466970_0800002_204_527 | 100 |
| 1719 | 3300044842 | Ga0466957_0014920 | Ga0466957_0014920_396_701 | 100 |
| 1720 | 3300044842 | Ga0466957_0179224 | Ga0466957_0179224_350_652 | 100 |
| 1721 | 3300044901 | Ga0466960_0008863 | Ga0466960_0008863_731_1036 | 100 |
| 1722 | 3300044901 | Ga0466960_0159790 | Ga0466960_0159790_535_840 | 100 |
| 1723 | 3300044901 | Ga0466960_0638681 | Ga0466960_0638681_53_364 | 100 |
| 1724 | 3300045049 | Ga0466959_0290843 | Ga0466959_0290843_240_551 | 100 |
| 1725 | 3300045049 | Ga0466959_0977525 | Ga0466959_0977525_231_536 | 100 |
| 1726 | 3300045836 | Ga0466958_0035221 | Ga0466958_0035221_122_427 | 100 |
| 1727 | 3300045836 | Ga0466958_0037294 | Ga0466958_0037294_1996_2298 | 100 |
| 1728 | 3300045976 | Ga0466967_0374581 | Ga0466967_0374581_83_385 | 100 |
| 1729 | 3300045976 | Ga0466967_0486540 | Ga0466967_0486540_560_865 | 100 |
| 1730 | 3300045976 | Ga0466967_1373912 | Ga0466967_1373912_231_542 | 100 |
| 1731 | 3300046454 | Ga0495592_0072146 | Ga0495592_0072146_559_861 | 100 |
| 1732 | 3300046454 | Ga0495592_0367408 | Ga0495592_0367408_501_806 | 100 |
| 1733 | 3300046459 | Ga0495629_0298190 | Ga0495629_0298190_526_831 | 100 |
| 1734 | 3300046459 | Ga0495629_1109646 | Ga0495629_1109646_54_365 | 100 |
| 1735 | 3300046462 | Ga0495651_0891235 | Ga0495651_0891235_89_391 | 100 |
| 1736 | 3300046463 | Ga0495653_0247523 | Ga0495653_0247523_510_812 | 100 |
| 1737 | 3300046473 | Ga0495582_0057796 | Ga0495582_0057796_156_464 | 100 |
| 1738 | 3300046476 | Ga0495662_0008003 | Ga0495662_0008003_4552_4854 | 100 |
| 1739 | 3300046477 | Ga0495664_0214211 | Ga0495664_0214211_693_995 | 100 |
| 1740 | 3300046511 | Ga0495608_0009099 | Ga0495608_0009099_6378_6680 | 100 |
| 1741 | 3300046514 | Ga0495618_0019818 | Ga0495618_0019818_152_454 | 100 |
| 1742 | 3300046516 | Ga0495628_0060116 | Ga0495628_0060116_1738_2040 | 100 |
| 1743 | 3300046517 | Ga0495630_0123303 | Ga0495630_0123303_1163_1465 | 100 |
| 1744 | 3300046529 | Ga0495652_0028241 | Ga0495652_0028241_993_1295 | 100 |
| 1745 | 3300046531 | Ga0495665_0239947 | Ga0495665_0239947_166_468 | 100 |
| 1746 | 3300046533 | Ga0495640_0140168 | Ga0495640_0140168_179_481 | 100 |
| 1747 | 3300046535 | Ga0495586_0007029 | Ga0495586_0007029_502_804 | 100 |
| 1748 | 3300046536 | Ga0495587_0025211 | Ga0495587_0025211_235_537 | 100 |
| 1749 | 3300046543 | Ga0495645_0161902 | Ga0495645_0161902_1203_1505 | 100 |
| 1750 | 3300046559 | Ga0495667_0206080 | Ga0495667_0206080_257_559 | 100 |
| 1751 | 3300046642 | Ga0495634_0132120 | Ga0495634_0132120_253_555 | 100 |
| 1752 | 3300046642 | Ga0495634_0371297 | Ga0495634_0371297_187_492 | 100 |
| 1753 | 3300046663 | Ga0495635_0062183 | Ga0495635_0062183_1226_1528 | 100 |
| 1754 | 3300046663 | Ga0495635_0300264 | Ga0495635_0300264_49_354 | 100 |
| 1755 | 3300046675 | Ga0495657_0038575 | Ga0495657_0038575_1245_1547 | 100 |
| 1756 | 3300046678 | Ga0495599_0138887 | Ga0495599_0138887_1164_1466 | 100 |
| 1757 | 3300046679 | Ga0495623_0394141 | Ga0495623_0394141_52_354 | 100 |
| 1758 | 3300046680 | Ga0495646_0025121 | Ga0495646_0025121_349_651 | 100 |
| 1759 | 3300046681 | Ga0495647_0257719 | Ga0495647_0257719_150_452 | 100 |
| 1760 | 3300046683 | Ga0495658_0144979 | Ga0495658_0144979_983_1291 | 100 |
| 1761 | 3300046683 | Ga0495658_0152966 | Ga0495658_0152966_65_373 | 100 |
| 1762 | 3300046683 | Ga0495658_0373522 | Ga0495658_0373522_225_530 | 100 |
| 1763 | 3300046683 | Ga0495658_0401524 | Ga0495658_0401524_449_760 | 100 |
| 1764 | 3300046689 | Ga0495613_0155166 | Ga0495613_0155166_965_1267 | 100 |
| 1765 | 3300046690 | Ga0495624_0310924 | Ga0495624_0310924_511_813 | 100 |
| 1766 | 3300046692 | Ga0495671_0281147 | Ga0495671_0281147_31_336 | 100 |
| 1767 | 3300046809 | Ga0495600_0039666 | Ga0495600_0039666_2092_2394 | 100 |
| 1768 | 3300047317 | Ga0495604_0114479 | Ga0495604_0114479_685_987 | 100 |
| 1769 | 3300047319 | Ga0495674_0032123 | Ga0495674_0032123_680_982 | 100 |
| 1770 | 3300047321 | Ga0495676_0071974 | Ga0495676_0071974_219_527 | 100 |
| 1771 | 3300047322 | Ga0495680_0027683 | Ga0495680_0027683_502_804 | 100 |
| 1772 | 3300047444 | Ga0495675_0331673 | Ga0495675_0331673_239_541 | 100 |
| 1773 | 3300047471 | Ga0495684_0004161 | Ga0495684_0004161_10130_10432 | 100 |
| 1774 | 3300048088 | Ga0495602_0013833 | Ga0495602_0013833_199_501 | 100 |
| 1775 | 3300048089 | Ga0495614_0208677 | Ga0495614_0208677_216_524 | 100 |
| 1776 | 3300048903 | Ga0496100_1434383 | Ga0496100_1434383_178_483 | 100 |
| 1777 | 3300048904 | Ga0496101_0085853 | Ga0496101_0085853_1625_1930 | 100 |
| 1778 | 3300048905 | Ga0496102_0413504 | Ga0496102_0413504_536_841 | 100 |
| 1779 | 3300048906 | Ga0496103_0434505 | Ga0496103_0434505_168_473 | 100 |
| 1780 | 3300048907 | Ga0496104_0323715 | Ga0496104_0323715_467_769 | 100 |
| 1781 | 3300048908 | Ga0496105_0871055 | Ga0496105_0871055_333_638 | 100 |
| 1782 | 3300048910 | Ga0496107_1218803 | Ga0496107_1218803_147_452 | 100 |
| 1783 | 3300048911 | Ga0496108_0028389 | Ga0496108_0028389_3568_3873 | 100 |
| 1784 | 3300048912 | Ga0496109_0025845 | Ga0496109_0025845_3241_3546 | 100 |
| 1785 | 3300048913 | Ga0496110_0193348 | Ga0496110_0193348_730_1035 | 100 |
| 1786 | 3300048914 | Ga0496111_0659842 | Ga0496111_0659842_440_745 | 100 |
| 1787 | 3300048917 | Ga0496114_0296028 | Ga0496114_0296028_1003_1308 | 100 |
| 1788 | 3300048918 | Ga0496115_1285589 | Ga0496115_1285589_179_481 | 100 |
| 1789 | 3300048922 | Ga0496119_0032653 | Ga0496119_0032653_2055_2357 | 100 |
| 1790 | 3300048923 | Ga0496120_0149998 | Ga0496120_0149998_330_632 | 100 |
| 1791 | 3300048927 | Ga0496124_0187875 | Ga0496124_0187875_693_998 | 100 |
| 1792 | 3300049127 | Ga0501306_003491 | Ga0501306_003491_920_1225 | 100 |
| 1793 | 3300049127 | Ga0501306_017435 | Ga0501306_017435_644_949 | 100 |
| 1794 | 3300049130 | Ga0501310_026534 | Ga0501310_026534_362_667 | 100 |
| 1795 | 3300049160 | Ga0501304_005327 | Ga0501304_005327_644_994 | 100 |
| 1796 | 3300049459 | Ga0495678_221531 | Ga0495678_221531_119_424 | 100 |
| 1797 | 3300049527 | Ga0501311_099077 | Ga0501311_099077_38_343 | 100 |
| 1798 | 3300049531 | Ga0501315_022828 | Ga0501315_022828_500_805 | 100 |
| 1799 | 3300049532 | Ga0501316_007989 | Ga0501316_007989_407_712 | 100 |
| 1800 | 3300049532 | Ga0501316_009885 | Ga0501316_009885_132_455 | 100 |
| 1801 | 3300049533 | Ga0501317_016320 | Ga0501317_016320_366_671 | 100 |
| 1802 | 3300049533 | Ga0501317_020993 | Ga0501317_020993_407_763 | 100 |
| 1803 | 3300049534 | Ga0501318_013014 | Ga0501318_013014_441_746 | 100 |
| 1804 | 3300049534 | Ga0501318_014589 | Ga0501318_014589_493_798 | 100 |
| 1805 | 3300049535 | Ga0501319_006520 | Ga0501319_006520_436_741 | 100 |
| 1806 | 3300049536 | Ga0501320_008060 | Ga0501320_008060_662_967 | 100 |
| 1807 | 3300049536 | Ga0501320_035149 | Ga0501320_035149_313_618 | 100 |
| 1808 | 3300049537 | Ga0501321_022906 | Ga0501321_022906_436_741 | 100 |
| 1809 | 3300049538 | Ga0501322_016830 | Ga0501322_016830_169_474 | 100 |
| 1810 | 3300049539 | Ga0501323_027726 | Ga0501323_027726_103_408 | 100 |
| 1811 | 3300049541 | Ga0501325_011325 | Ga0501325_011325_103_408 | 100 |
| 1812 | 3300049568 | Ga0501031_0080470 | Ga0501031_0080470_778_1083 | 100 |
| 1813 | 3300049570 | Ga0501033_0095500 | Ga0501033_0095500_666_971 | 100 |
| 1814 | 3300049571 | Ga0501034_0016509 | Ga0501034_0016509_1192_1494 | 100 |
| 1815 | 3300049571 | Ga0501034_0855009 | Ga0501034_0855009_141_443 | 100 |
| 1816 | 3300049571 | Ga0501034_0882546 | Ga0501034_0882546_15_320 | 100 |
| 1817 | 3300049571 | Ga0501034_0966066 | Ga0501034_0966066_416_721 | 100 |
| 1818 | 3300049572 | Ga0501036_0037401 | Ga0501036_0037401_2158_2460 | 100 |
| 1819 | 3300049572 | Ga0501036_0853537 | Ga0501036_0853537_375_680 | 100 |
| 1820 | 3300049573 | Ga0501037_0063557 | Ga0501037_0063557_2039_2341 | 100 |
| 1821 | 3300049573 | Ga0501037_0485159 | Ga0501037_0485159_221_526 | 100 |
| 1822 | 3300049574 | Ga0501038_0021480 | Ga0501038_0021480_3853_4155 | 100 |
| 1823 | 3300049574 | Ga0501038_0186884 | Ga0501038_0186884_247_552 | 100 |
| 1824 | 3300049575 | Ga0501039_0777360 | Ga0501039_0777360_163_468 | 100 |
| 1825 | 3300049576 | Ga0501040_0613000 | Ga0501040_0613000_292_597 | 100 |
| 1826 | 3300049577 | Ga0501041_0022527 | Ga0501041_0022527_1424_1729 | 100 |
| 1827 | 3300049577 | Ga0501041_0550187 | Ga0501041_0550187_259_561 | 100 |
| 1828 | 3300049578 | Ga0501042_0018748 | Ga0501042_0018748_762_1064 | 100 |
| 1829 | 3300049579 | Ga0501043_0024981 | Ga0501043_0024981_2605_2907 | 100 |
| 1830 | 3300049581 | Ga0501047_0042683 | Ga0501047_0042683_1794_2096 | 100 |
| 1831 | 3300049582 | Ga0501048_0052303 | Ga0501048_0052303_1817_2119 | 100 |
| 1832 | 3300049583 | Ga0501067_0077464 | Ga0501067_0077464_681_986 | 100 |
| 1833 | 3300049584 | Ga0501068_0430597 | Ga0501068_0430597_369_674 | 100 |
| 1834 | 3300049586 | Ga0501070_0004983 | Ga0501070_0004983_1539_1844 | 100 |
| 1835 | 3300049587 | Ga0501071_0075875 | Ga0501071_0075875_499_804 | 100 |
| 1836 | 3300049588 | Ga0501072_0105438 | Ga0501072_0105438_392_697 | 100 |
| 1837 | 3300049589 | Ga0501073_0014388 | Ga0501073_0014388_278_580 | 100 |
| 1838 | 3300049590 | Ga0501074_0002804 | Ga0501074_0002804_10060_10362 | 100 |
| 1839 | 3300049590 | Ga0501074_0045693 | Ga0501074_0045693_2673_2978 | 100 |
| 1840 | 3300049591 | Ga0501075_0134635 | Ga0501075_0134635_624_929 | 100 |
| 1841 | 3300049592 | Ga0501076_0209511 | Ga0501076_0209511_887_1192 | 100 |
| 1842 | 3300049593 | Ga0501077_0063375 | Ga0501077_0063375_1569_1874 | 100 |
| 1843 | 3300049741 | Ga0501079_0099906 | Ga0501079_0099906_1434_1739 | 100 |
| 1844 | 3300049742 | Ga0501080_0329022 | Ga0501080_0329022_766_1068 | 100 |
| 1845 | 3300049822 | Ga0501035_0110254 | Ga0501035_0110254_1664_1969 | 100 |
| 1846 | 3300049823 | Ga0501044_0378589 | Ga0501044_0378589_881_1183 | 100 |
| 1847 | 3300049823 | Ga0501044_1016167 | Ga0501044_1016167_11_313 | 100 |
| 1848 | 3300049824 | Ga0501045_0198872 | Ga0501045_0198872_492_797 | 100 |
| 1849 | 3300050491 | nmdc:mga00v17_958_c1 | nmdc:mga00v17_958_c1_4943_5248 | 100 |
| 1850 | 3300050492 | nmdc:mga0yw44_558839_c1 | nmdc:mga0yw44_558839_c1_274_579 | 100 |
| 1851 | 3300050496 | nmdc:mga07m45_349572_c1 | nmdc:mga07m45_349572_c1_365_670 | 100 |
| 1852 | 3300053077 | Ga0495601_0008187 | Ga0495601_0008187_4905_5210 | 100 |
| 1853 | 3300053077 | Ga0495601_0287144 | Ga0495601_0287144_501_803 | 100 |
| 1854 | 3300053078 | Ga0495612_0034730 | Ga0495612_0034730_1070_1372 | 100 |
| 1855 | 3300053078 | Ga0495612_0122477 | Ga0495612_0122477_663_968 | 100 |
| 1856 | 3300053080 | Ga0500635_0320329 | Ga0500635_0320329_152_475 | 100 |
| 1857 | 3300053084 | Ga0495595_0016795 | Ga0495595_0016795_1122_1424 | 100 |
| 1858 | 3300053085 | Ga0495619_0079703 | Ga0495619_0079703_1009_1311 | 100 |
| 1859 | 3300053085 | Ga0495619_0188604 | Ga0495619_0188604_690_995 | 100 |
| 1860 | 3300053096 | Ga0500641_0000363 | Ga0500641_0000363_9148_9453 | 100 |
| 1861 | 3300053096 | Ga0500641_0285173 | Ga0500641_0285173_163_465 | 100 |
| 1862 | 3300054114 | Ga0501084_0042157 | Ga0501084_0042157_1388_1693 | 100 |
| 1863 | 3300059477 | Ga0587084_005492 | Ga0587084_005492_738_1043 | 100 |
| 1864 | 3300059477 | Ga0587084_108187 | Ga0587084_108187_163_468 | 100 |
| 1865 | 3300059478 | Ga0587093_058207 | Ga0587093_058207_65_370 | 100 |
| 1866 | 3300059491 | Ga0587070_041952 | Ga0587070_041952_302_607 | 100 |
| 1867 | 3300059492 | Ga0587073_0021819 | Ga0587073_0021819_523_828 | 100 |
| 1868 | 3300059503 | Ga0587080_127434 | Ga0587080_127434_103_408 | 100 |
| 1869 | 3300059504 | Ga0587082_017627 | Ga0587082_017627_191_496 | 100 |
| 1870 | 3300059504 | Ga0587082_032324 | Ga0587082_032324_267_569 | 100 |
| 1871 | 3300059505 | Ga0587083_0003149 | Ga0587083_0003149_1171_1476 | 100 |
| 1872 | 3300059507 | Ga0587086_014740 | Ga0587086_014740_467_772 | 100 |
| 1873 | 3300059508 | Ga0587088_055761 | Ga0587088_055761_90_401 | 100 |
| 1874 | 3300059508 | Ga0587088_117981 | Ga0587088_117981_282_584 | 100 |
| 1875 | 3300059508 | Ga0587088_150846 | Ga0587088_150846_115_420 | 100 |
| 1876 | 3300059511 | Ga0587091_009412 | Ga0587091_009412_654_959 | 100 |
| 1877 | 3300059512 | Ga0587092_036111 | Ga0587092_036111_467_772 | 100 |
| 1878 | 3300059514 | Ga0587095_036842 | Ga0587095_036842_79_384 | 100 |
| 1879 | 3300059514 | Ga0587095_038656 | Ga0587095_038656_106_411 | 100 |
| 1880 | 3300059605 | Ga0587106_000824 | Ga0587106_000824_27_332 | 100 |
| 1881 | 3300059609 | Ga0587131_004089 | Ga0587131_004089_231_536 | 100 |
| 1882 | 3300059622 | Ga0587099_048083 | Ga0587099_048083_79_384 | 100 |
| 1883 | 3300059623 | Ga0587101_004376 | Ga0587101_004376_249_554 | 100 |
| 1884 | 3300059626 | Ga0587115_023589 | Ga0587115_023589_437_742 | 100 |
| 1885 | 3300059627 | Ga0587117_041216 | Ga0587117_041216_138_443 | 100 |
| 1886 | 3300059627 | Ga0587117_075804 | Ga0587117_075804_227_532 | 100 |
| 1887 | 3300059628 | Ga0587122_005204 | Ga0587122_005204_360_665 | 100 |
| 1888 | 3300059630 | Ga0587128_045795 | Ga0587128_045795_275_580 | 100 |
| 1889 | 3300059630 | Ga0587128_090712 | Ga0587128_090712_23_328 | 100 |
| 1890 | 3300059639 | Ga0587062_002899 | Ga0587062_002899_912_1217 | 100 |
| 1891 | 3300059639 | Ga0587062_016073 | Ga0587062_016073_271_582 | 100 |
| 1892 | 3300059641 | Ga0587068_001416 | Ga0587068_001416_506_811 | 100 |
| 1893 | 3300059642 | Ga0587069_005095 | Ga0587069_005095_391_696 | 100 |
| 1894 | 3300059643 | Ga0587072_032981 | Ga0587072_032981_229_534 | 100 |
| 1895 | 3300059644 | Ga0587075_045457 | Ga0587075_045457_414_725 | 100 |
| 1896 | 3300059644 | Ga0587075_046182 | Ga0587075_046182_313_621 | 100 |
| 1897 | 3300059644 | Ga0587075_065116 | Ga0587075_065116_52_357 | 100 |
| 1898 | 3300059645 | Ga0587076_145870 | Ga0587076_145870_110_415 | 100 |
| 1899 | 3300059645 | Ga0587076_172177 | Ga0587076_172177_171_476 | 100 |
| 1900 | 3300059652 | Ga0587107_007847 | Ga0587107_007847_631_942 | 100 |
| 1901 | 3300059658 | Ga0587119_016371 | Ga0587119_016371_164_466 | 100 |
| 1902 | 3300059658 | Ga0587119_035124 | Ga0587119_035124_273_578 | 100 |
| 1903 | 3300060344 | Ga0587071_100577 | Ga0587071_100577_331_642 | 100 |
| 1904 | 3300060353 | Ga0501082_0086191 | Ga0501082_0086191_55_360 | 100 |
| 1905 | 3300061719 | Ga0466962_0074020 | Ga0466962_0074020_913_1218 | 100 |
| 1906 | 3300061719 | Ga0466962_0421950 | Ga0466962_0421950_262_573 | 100 |
| 1907 | 3300061734 | Ga0530510_0090696 | Ga0530510_0090696_931_1236 | 100 |
| 1908 | iso_pu_bacteria | 8033684223 | 8033689349 | 100 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9407 | 7 | 93 |
| 7nhm-assembly1.cif.gz_W | 70s ribosome from staphylococcus aureus | 0.9247 | 7 | 95 |
| 6spb-assembly1.cif.gz_T | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9201 | 6 | 93 |
| 2qa4-assembly1.cif.gz_S | a more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit | 0.9178 | 9 | 90 |
| 6ddg-assembly1.cif.gz_F | structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 | 0.916 | 8 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9224 | 7 | 95 | 3.30.70.330 |
| 4qs3X00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9034 | 9 | 93 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9032 | 7 | 95 | 3.30.70.330 |
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9021 | 1 | 88 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8951 | 9 | 93 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537VZX2-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL2; Large ribosomal subunit protein uL23] | 0.9657 | 5 | 92 |
GO:0002181
GO:0003735 GO:0015934 GO:0016740 GO:0019843 |
| AF-A0A0N1C050-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9628 | 7 | 95 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A541BXJ8-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9615 | 7 | 97 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A5USI7-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9609 | 5 | 97 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A419EVM5-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9582 | 5 | 95 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar