F494183

General Info

Members Datasets Scaffolds Average Seq Length
1468 653 1390 59

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100874285|Ga0068859_1008742852
Length 68
Sequence MAVQKSRVTRSRRGMRRSHDALSGPALSVEKTTGATHRRHHVSPDGYYRGRQVLDLSPVTEDDSDNEE

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
8 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
9 2643221556 Massilia sp. Root1485 Isolate Unclassified
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221609 Acidovorax sp. Root217 Isolate Unclassified
13 2643221611 Acidovorax sp. Root219 Isolate Unclassified
14 2643221638 Duganella sp. Root336D2 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221664 Massilia sp. Root418 Isolate Unclassified
18 2643221684 Massilia sp. Root133 Isolate Unclassified
19 2643221717 Acidovorax sp. Root267 Isolate Unclassified
20 2738541280 Massilia sp. GV090 Isolate Unclassified
21 2738541297 Duganella sp. GV083 Isolate Unclassified
22 2738541300 Massilia sp. GV016 Isolate Unclassified
23 2738541357 Duganella sp. GV053 Isolate Unclassified
24 2738543003 Duganella sp. GV066 Isolate Unclassified
25 2738543012 Acidovorax sp. CF301 Isolate Unclassified
26 2738543013 Variovorax sp. BT01 Isolate Unclassified
27 2738543018 Massilia sp. GV045 Isolate Unclassified
28 2738543026 Duganella sp. GV089 Isolate Unclassified
29 2738543029 Duganella sp. GV039 Isolate Unclassified
30 2738543030 Massilia sp. GV097 Isolate Unclassified
31 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
32 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
33 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
34 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
35 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
36 2816332133 Acidovorax radicis 2721A Isolate Unclassified
37 2818991436 Collimonas arenae 515 Isolate Unclassified
38 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
39 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
40 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
41 2842711865 Duganella sp. R-73148 Isolate Unclassified
42 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
43 2842733646 Variovorax sp. R-72446 Isolate Unclassified
44 2842747753 Variovorax sp. R-72060 Isolate Unclassified
45 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
46 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
47 2857553236 Duganella sp. R-74557 Isolate Unclassified
48 2857558681 Duganella sp. R-74565 Isolate Unclassified
49 2857564685 Duganella sp. R-74599 Isolate Unclassified
50 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
51 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
52 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
53 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
54 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
55 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
56 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
57 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
58 2904424332 Duganella sp. 1411 Isolate Rhizosphere
59 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
60 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
61 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
62 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
63 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
64 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
65 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
66 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
67 2919476304 Duganella sp. 3397 Isolate Unclassified
68 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
69 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
70 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
71 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
72 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
73 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
74 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
75 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
76 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
77 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
78 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
79 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
80 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
81 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
82 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
83 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
84 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
85 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
86 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
87 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
88 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
89 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
90 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
91 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
92 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
93 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
94 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
95 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
98 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
99 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
100 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
101 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
102 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
103 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
104 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
105 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
106 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
107 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
108 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
109 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
110 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
111 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
112 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
113 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
114 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
115 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
116 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
117 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
118 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
119 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
120 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
121 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
122 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
123 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
125 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
126 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
127 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
128 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
129 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
130 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
131 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
132 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
133 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
139 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
140 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
141 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
146 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
150 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
154 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
155 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
156 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
157 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
158 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
159 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
160 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
161 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
164 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
165 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
166 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
167 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
168 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
169 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
170 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
171 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
172 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
176 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
181 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
185 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
186 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
187 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
188 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
189 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
190 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
191 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
192 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
193 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
194 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
195 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
196 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
197 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
198 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
199 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
200 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
201 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
206 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
207 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
212 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
215 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
216 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
223 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
224 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
226 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
227 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
230 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
231 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
235 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
236 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
238 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
281 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
283 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
287 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
290 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
291 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
292 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
293 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
294 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
295 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
296 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
297 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
298 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
306 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
307 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
308 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
309 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
310 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
311 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
312 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
313 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
314 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
315 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
316 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
317 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
318 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
319 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
320 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
321 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
323 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
324 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
325 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
326 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
327 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
328 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
329 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
330 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
331 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
342 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
343 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
344 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
345 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
346 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
347 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
348 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
349 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
350 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
351 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
352 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
353 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
354 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
355 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
356 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
357 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
358 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
359 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
360 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
361 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
362 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
363 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
364 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
365 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
366 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
367 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
368 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
369 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
370 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
371 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
372 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
373 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
374 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
375 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
376 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
377 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
378 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
379 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
380 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
381 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
382 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
383 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
384 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
385 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
386 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
387 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
388 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
389 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
390 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
391 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
392 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
393 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
394 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
395 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
396 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
397 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
398 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
399 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
400 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
401 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
402 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
403 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
404 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
405 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
406 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
407 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
408 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
409 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
410 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
411 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
412 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
413 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
414 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
415 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
416 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
417 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
418 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
419 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
420 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
421 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
422 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
423 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
424 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
425 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
426 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
427 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
428 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
429 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
430 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
431 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
432 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
433 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
434 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
435 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
436 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
437 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
438 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
439 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
440 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
441 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
442 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
445 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
446 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
447 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
448 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
449 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
450 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
451 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
452 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
453 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
454 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
455 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
456 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
457 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
458 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
459 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
460 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
463 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
464 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
465 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
466 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
467 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
468 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
469 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
470 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
471 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
472 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
473 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
474 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
475 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
476 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
477 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
478 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
479 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
480 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
481 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
482 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
483 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
484 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
485 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
486 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
487 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
488 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
489 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
490 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
491 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
492 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
493 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
494 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
495 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
496 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
497 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
500 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
501 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
502 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
503 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
504 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
505 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
506 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
507 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
508 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
509 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
510 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
511 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
512 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
513 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
514 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
524 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
525 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
545 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
549 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
550 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
554 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
559 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
560 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
561 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
562 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
563 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
564 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
565 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
566 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
567 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
568 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
569 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
570 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
571 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
572 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
573 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
574 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
575 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
576 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
577 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
579 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
580 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
581 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
582 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
583 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
584 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
585 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
586 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
587 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
588 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
589 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
590 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
591 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
592 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
593 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
594 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
595 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
596 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
597 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
598 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
599 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
600 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
601 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
619 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
620 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
621 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
622 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
623 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
624 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
625 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
626 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
627 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
643 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
651 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
652 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
653 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.28
Metatranscriptomes 22.41
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.13
Nodule 0.54
Rhizoplane 2.72
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 10.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000462 3300001979 Bacteria 17404
2 JGI24740J21852_10000722 3300001979 Bacteria 14380
3 JGI24740J21852_10001385 3300001979 Bacteria 11061
4 JGI24740J21852_10020567 3300001979 Bacteria 2300
5 JGI24740J21852_10124610 3300001979 Bacteria 644
6 JGI24739J22299_10017122 3300001989 Bacteria 2618
7 JGI24739J22299_10055368 3300001989 Bacteria 1268
8 JGI24739J22299_10151185 3300001989 Bacteria 686
9 JGI24737J22298_10028137 3300001990 Bacteria 1768
10 JGI24737J22298_10032661 3300001990 Bacteria 1620
11 JGI24737J22298_10044667 3300001990 Bacteria 1354
12 JGI24735J21928_10000381 3300002067 Bacteria 15526
13 JGI24735J21928_10002924 3300002067 Bacteria 5878
14 JGI24735J21928_10012808 3300002067 Bacteria 2648
15 JGI24738J21930_10002568 3300002075 Bacteria 4705
16 JGI24738J21930_10060147 3300002075 Bacteria 780
17 JGI25156J39149_1007106 3300002705 Bacteria 2977
18 JGI25156J39149_1011215 3300002705 Bacteria 2041
19 JGI25156J39149_1014217 3300002705 Bacteria 1652
20 JGI25156J39149_1019256 3300002705 Bacteria 1234
21 JGI25154J39366_1000446 3300002738 Bacteria 21840
22 JGI25157J39369_1017322 3300002741 Bacteria 875
23 JGI25157J39369_1024694 3300002741 Bacteria 703
24 JGI25164J39214_1010585 3300002772 Bacteria 892
25 Ga0006765J45826_106676 3300003161 Bacteria 831
26 Ga0006778J45830_1030621 3300003162 Bacteria 1423
27 Ga0006759J45824_1026941 3300003163 Bacteria 621
28 Ga0006759J45824_1033546 3300003163 Bacteria 828
29 Ga0006759J45824_1058067 3300003163 Bacteria 671
30 Ga0006759J45824_1063513 3300003163 Bacteria 639
31 Ga0006759J45824_1065469 3300003163 Bacteria 535
32 JGI25165J46597_1002385 3300003214 Bacteria 6223
33 Ga0006758J48902_1015910 3300003300 Bacteria 821
34 Ga0006758J48902_1018924 3300003300 Bacteria 526
35 Ga0006770J48903_1010498 3300003305 Bacteria 525
36 Ga0006770J48903_1025987 3300003305 Bacteria 821
37 Ga0006777J48905_1019728 3300003308 Bacteria 1100
38 rootH2_10009142 3300003320 Bacteria 4952
39 rootH2_10030882 3300003320 Bacteria 2464
40 rootL2_10004981 3300003322 Bacteria 32520
41 rootL2_10014064 3300003322 Bacteria 12412
42 JGI25160J50197_1067253 3300003354 Bacteria 694
43 Ga0006556J51387_1019267 3300003479 Bacteria 2214
44 Ga0006556J51387_1025420 3300003479 Bacteria 2088
45 Ga0007417J51691_1002769 3300003544 Bacteria 2716
46 Ga0007417J51691_1029679 3300003544 Bacteria 804
47 Ga0006560J51390_1014813 3300003565 Bacteria 1917
48 Ga0006560J51390_1028592 3300003565 Bacteria 805
49 Ga0006554J51385_1021491 3300003567 Bacteria 1642
50 Ga0006554J51385_1029024 3300003567 Bacteria 582
51 Ga0007410J51695_1002724 3300003574 Bacteria 1998
52 Ga0007409J51694_1016976 3300003575 Bacteria 853
53 Ga0007416J51690_1016876 3300003577 Bacteria 805
54 Ga0007416J51690_1030315 3300003577 Bacteria 832
55 Ga0006562J51391_1028115 3300003578 Bacteria 1183
56 Ga0007429J51699_1022603 3300003579 Bacteria 1847
57 Ga0007415J51800_106685 3300003613 Bacteria 625
58 Ga0006780_1025422 3300003735 Bacteria 622
59 Ga0055539_1000034 3300003752 Bacteria 223400
60 Ga0055533_1006004 3300003756 Bacteria 1858
61 Ga0055533_1007436 3300003756 Bacteria 1491
62 Ga0055533_1008546 3300003756 Bacteria 1285
63 Ga0055533_1015348 3300003756 Bacteria 755
64 Ga0055532_1000002 3300003758 Bacteria 576000
65 Ga0055532_1000039 3300003758 Bacteria 198049
66 Ga0055532_1011346 3300003758 Bacteria 1050
67 Ga0055525_1000538 3300003759 Bacteria 18074
68 Ga0055527_1000024 3300003760 Bacteria 198049
69 Ga0055527_1001254 3300003760 Bacteria 5582
70 Ga0055535_1000028 3300003761 Bacteria 198049
71 Ga0055535_1031885 3300003761 Bacteria 538
72 Ga0055542_1000047 3300003762 Bacteria 198049
73 Ga0055542_1003250 3300003762 Bacteria 4535
74 Ga0055529_1000028 3300003763 Bacteria 287650
75 Ga0055529_1000054 3300003763 Bacteria 198049
76 Ga0055529_1000146 3300003763 Bacteria 100947
77 Ga0055524_1001224 3300003775 Bacteria 15168
78 Ga0055524_1002725 3300003775 Bacteria 8921
79 Ga0055528_1002393 3300003790 Bacteria 10095
80 Ga0055530_10050039 3300003791 Bacteria 975
81 Ga0055540_1020093 3300003792 Bacteria 1778
82 Ga0055531_10001660 3300003794 Bacteria 16067
83 Ga0055531_10001947 3300003794 Bacteria 14432
84 Ga0055531_10005441 3300003794 Bacteria 7454
85 Ga0055541_1000217 3300003841 Bacteria 23975
86 Ga0055541_1000861 3300003841 Bacteria 7401
87 Ga0055541_1018901 3300003841 Bacteria 842
88 Ga0058692_1006669 3300003856 Bacteria 3142
89 Ga0058692_1049135 3300003856 Bacteria 705
90 Ga0058692_1068129 3300003856 Bacteria 545
91 Ga0065714_10046912 3300005288 Bacteria 821
92 Ga0065714_10084786 3300005288 Bacteria 2180
93 Ga0065714_10224958 3300005288 Bacteria 831
94 Ga0065714_10261913 3300005288 Bacteria 729
95 Ga0065704_10348879 3300005289 Bacteria 813
96 Ga0065704_10520996 3300005289 Bacteria 653
97 Ga0065715_10040010 3300005293 Bacteria 1236
98 Ga0065715_10110556 3300005293 Bacteria 2615
99 Ga0070658_10177134 3300005327 Bacteria 1793
100 Ga0070658_10389801 3300005327 Bacteria 1196
101 Ga0070658_10753222 3300005327 Bacteria 846
102 Ga0070683_101927808 3300005329 Bacteria 568
103 Ga0070666_11279761 3300005335 Bacteria 547
104 Ga0070680_100791418 3300005336 Bacteria 817
105 Ga0070682_100987440 3300005337 Bacteria 698
106 Ga0070660_100000010 3300005339 Bacteria 136324
107 Ga0070660_100277925 3300005339 Bacteria 1370
108 Ga0070661_100000013 3300005344 Bacteria 163010
109 Ga0070661_100093227 3300005344 Bacteria 2232
110 Ga0070692_10499228 3300005345 Bacteria 788
111 Ga0070671_101298003 3300005355 Bacteria 642
112 Ga0070673_100951645 3300005364 Bacteria 798
113 Ga0070659_100000167 3300005366 Bacteria 50757
114 Ga0070659_100004951 3300005366 Bacteria 9532
115 Ga0070667_102343612 3300005367 Bacteria 503
116 Ga0070709_11745908 3300005434 Bacteria 509
117 Ga0070714_101981311 3300005435 Bacteria 568
118 Ga0070700_100022541 3300005441 Bacteria 3674
119 Ga0070694_100115522 3300005444 Bacteria 1918
120 Ga0070663_100000006 3300005455 Bacteria 208068
121 Ga0070663_100000789 3300005455 Bacteria 17198
122 Ga0070663_100209120 3300005455 Bacteria 1527
123 Ga0070663_100220504 3300005455 Bacteria 1489
124 Ga0070678_100250848 3300005456 Bacteria 1484
125 Ga0068867_100011280 3300005459 Bacteria 6303
126 Ga0070698_100022508 3300005471 Bacteria 6593
127 Ga0070684_100112388 3300005535 Bacteria 2444
128 Ga0070665_100152074 3300005548 Bacteria 2317
129 Ga0068855_100200821 3300005563 Bacteria 2244
130 Ga0068855_100647388 3300005563 Bacteria 1135
131 Ga0070664_100000002 3300005564 Bacteria 458815
132 Ga0070664_100289682 3300005564 Bacteria 1478
133 Ga0070664_100694083 3300005564 Bacteria 948
134 Ga0068857_100091892 3300005577 Bacteria 2717
135 Ga0068854_100000004 3300005578 Bacteria 216381
136 Ga0068856_100000294 3300005614 Bacteria 54780
137 Ga0068856_100347853 3300005614 Bacteria 1501
138 Ga0068856_101857231 3300005614 Bacteria 614
139 Ga0068852_100017069 3300005616 Bacteria 5685
140 Ga0068852_100450436 3300005616 Bacteria 1274
141 Ga0068852_101568641 3300005616 Bacteria 681
142 Ga0068852_102763728 3300005616 Bacteria 509
143 Ga0068859_100874285 3300005617 Bacteria 984
144 Ga0068859_101526719 3300005617 Bacteria 737
145 Ga0068859_101745050 3300005617 Bacteria 687
146 Ga0068851_10139601 3300005834 Bacteria 1317
147 Ga0068863_101657777 3300005841 Bacteria 649
148 Ga0068858_100069756 3300005842 Bacteria 3258
149 Ga0070717_10256184 3300006028 Bacteria 1547
150 Ga0075365_10253105 3300006038 Bacteria 1238
151 Ga0075362_10061866 3300006177 Bacteria 1695
152 Ga0075362_10092280 3300006177 Bacteria 1407
153 Ga0075367_10596582 3300006178 Bacteria 702
154 Ga0075366_10000297 3300006195 Bacteria 22376
155 Ga0075366_10004967 3300006195 Bacteria 7174
156 Ga0075366_10153481 3300006195 Bacteria 1395
157 Ga0075366_10353437 3300006195 Bacteria 902
158 Ga0075370_10004264 3300006353 Bacteria 6922
159 Ga0075370_10061586 3300006353 Bacteria 2138
160 Ga0075370_10073600 3300006353 Bacteria 1957
161 Ga0075370_10509261 3300006353 Bacteria 727
162 Ga0075428_100001491 3300006844 Bacteria 25032
163 Ga0075430_100351694 3300006846 Bacteria 1217
164 Ga0075429_100019402 3300006880 Bacteria 5891
165 Ga0097620_100874141 3300006931 Bacteria 984
166 Ga0097620_101526693 3300006931 Bacteria 737
167 Ga0097620_101745101 3300006931 Bacteria 687
168 Ga0099823_1000021 3300006944 Bacteria 76133
169 Ga0079104_1004712 3300006946 Bacteria 5713
170 Ga0105251_10000285 3300009011 Bacteria 50961
171 Ga0105251_10011588 3300009011 Bacteria 5031
172 Ga0105244_10002843 3300009036 Bacteria 12850
173 Ga0105244_10077568 3300009036 Bacteria 1648
174 Ga0105250_10023278 3300009092 Bacteria 2496
175 Ga0105240_10039709 3300009093 Bacteria 6025
176 Ga0105240_10044017 3300009093 Bacteria 5676
177 Ga0105240_10196897 3300009093 Bacteria 2365
178 Ga0105240_10285562 3300009093 Bacteria 1894
179 Ga0105240_10659582 3300009093 Bacteria 1146
180 Ga0105240_12582466 3300009093 Bacteria 525
181 Ga0105245_12487278 3300009098 Bacteria 571
182 Ga0105247_11032429 3300009101 Bacteria 644
183 Ga0105247_11474049 3300009101 Bacteria 554
184 Ga0114129_10469325 3300009147 Bacteria 1648
185 Ga0105243_10394151 3300009148 Bacteria 1284
186 Ga0105241_10242416 3300009174 Bacteria 1525
187 Ga0105241_10587920 3300009174 Bacteria 1004
188 Ga0105241_12254420 3300009174 Bacteria 541
189 Ga0105242_11453379 3300009176 Bacteria 715
190 Ga0105237_10076033 3300009545 Bacteria 3348
191 Ga0105237_10578021 3300009545 Bacteria 1130
192 Ga0105238_10003306 3300009551 Bacteria 16104
193 Ga0105238_10141523 3300009551 Bacteria 2382
194 Ga0105238_11015730 3300009551 Bacteria 850
195 Ga0105238_11444304 3300009551 Bacteria 716
196 Ga0105239_10005044 3300010375 Bacteria 15592
197 Ga0105239_10450556 3300010375 Bacteria 1460
198 Ga0105239_11392114 3300010375 Bacteria 810
199 Ga0105246_10058772 3300011119 Bacteria 2665
200 Ga0105246_10721267 3300011119 Bacteria 876
201 Ga0157317_1006171 3300012475 Bacteria 830
202 Ga0157319_1000027 3300012497 Bacteria 62955
203 Ga0157373_10020184 3300013100 Bacteria 4847
204 Ga0157371_10000123 3300013102 Bacteria 118119
205 Ga0157371_10076165 3300013102 Bacteria 2376
206 Ga0157371_10096288 3300013102 Bacteria 2097
207 Ga0157371_11136901 3300013102 Bacteria 600
208 Ga0157370_10428933 3300013104 Bacteria 1216
209 Ga0157370_10792782 3300013104 Bacteria 862
210 Ga0157370_10798975 3300013104 Bacteria 859
211 Ga0157369_10000799 3300013105 Bacteria 40249
212 Ga0157369_10013524 3300013105 Bacteria 9224
213 Ga0157369_10375809 3300013105 Bacteria 1475
214 Ga0157374_10047490 3300013296 Bacteria 3981
215 Ga0157372_10001159 3300013307 Bacteria 28511
216 Ga0157375_11410527 3300013308 Bacteria 821
217 Ga0157380_11716885 3300014326 Bacteria 686
218 Ga0182008_10077541 3300014497 Bacteria 1635
219 Ga0182008_10135930 3300014497 Bacteria 1228
220 Ga0182008_10549202 3300014497 Bacteria 642
221 Ga0157379_11363739 3300014968 Bacteria 686
222 Ga0157379_12428713 3300014968 Bacteria 523
223 Ga0157376_10222879 3300014969 Bacteria 1747
224 Ga0182006_1000017 3300015261 Bacteria 299454
225 Ga0182006_1015580 3300015261 Bacteria 3257
226 Ga0182007_10002423 3300015262 Bacteria 9311
227 Ga0182007_10009675 3300015262 Bacteria 3867
228 Ga0182005_1000007 3300015265 Bacteria 490994
229 Ga0182005_1044771 3300015265 Bacteria 1202
230 Ga0163161_10021537 3300017792 Bacteria 4529
231 Ga0163161_11574876 3300017792 Bacteria 579
232 Ga0184593_104580 3300019179 Bacteria 724
233 Ga0197907_11246003 3300020069 Bacteria 3458
234 Ga0206356_10127094 3300020070 Bacteria 2619
235 Ga0206356_11033933 3300020070 Bacteria 591
236 Ga0206356_11308868 3300020070 Bacteria 1251
237 Ga0206349_1150076 3300020075 Bacteria 3313
238 Ga0206355_1206374 3300020076 Bacteria 546
239 Ga0206355_1326248 3300020076 Bacteria 4647
240 Ga0206351_10084287 3300020077 Bacteria 517
241 Ga0206351_10167421 3300020077 Bacteria 22180
242 Ga0206351_10400801 3300020077 Bacteria 576
243 Ga0206352_10143491 3300020078 Bacteria 1846
244 Ga0206352_11149020 3300020078 Bacteria 724
245 Ga0206350_10476662 3300020080 Bacteria 1234
246 Ga0206350_10897671 3300020080 Bacteria 613
247 Ga0206350_11588402 3300020080 Bacteria 1829
248 Ga0206354_10009750 3300020081 Bacteria 1842
249 Ga0206354_11478331 3300020081 Bacteria 1013
250 Ga0154015_1099906 3300020610 Bacteria 39484
251 Ga0213872_10001047 3300021361 Bacteria 19247
252 Ga0213872_10002408 3300021361 Bacteria 11037
253 Ga0213872_10005517 3300021361 Bacteria 6485
254 Ga0213872_10128455 3300021361 Bacteria 1117
255 Ga0213872_10454875 3300021361 Bacteria 514
256 Ga0224712_10046990 3300022467 Bacteria 1659
257 Ga0247551_104997 3300023552 Bacteria 543
258 Ga0247516_119814 3300023562 Bacteria 563
259 Ga0209435_103104 3300025206 Bacteria 1908
260 Ga0209435_104748 3300025206 Bacteria 1529
261 Ga0209784_100003 3300025224 Bacteria 1379451
262 Ga0209784_100293 3300025224 Bacteria 27186
263 Ga0209784_100803 3300025224 Bacteria 7383
264 Ga0209566_100002 3300025225 Bacteria 2614868
265 Ga0209566_100370 3300025225 Bacteria 37519
266 Ga0209566_100896 3300025225 Bacteria 14309
267 Ga0209566_101272 3300025225 Bacteria 8471
268 Ga0209674_100008 3300025226 Bacteria 1076909
269 Ga0209674_100013 3300025226 Bacteria 813140
270 Ga0209674_100122 3300025226 Bacteria 131720
271 Ga0209674_100424 3300025226 Bacteria 20459
272 Ga0209674_101948 3300025226 Bacteria 4832
273 Ga0209672_100010 3300025228 Bacteria 873151
274 Ga0209672_100019 3300025228 Bacteria 432215
275 Ga0209672_100051 3300025228 Bacteria 234414
276 Ga0209672_100213 3300025228 Bacteria 45410
277 Ga0209147_100002 3300025229 Bacteria 2158988
278 Ga0209147_100006 3300025229 Bacteria 873276
279 Ga0209147_100026 3300025229 Bacteria 421622
280 Ga0209147_101660 3300025229 Bacteria 7325
281 Ga0209563_100004 3300025230 Bacteria 1814108
282 Ga0209563_100857 3300025230 Bacteria 9043
283 Ga0209563_104817 3300025230 Bacteria 2527
284 Ga0207427_103586 3300025231 Bacteria 3156
285 Ga0209437_109386 3300025233 Bacteria 1527
286 Ga0209437_113794 3300025233 Bacteria 1145
287 Ga0209258_100002 3300025242 Bacteria 2158988
288 Ga0209258_100010 3300025242 Bacteria 873276
289 Ga0209258_100031 3300025242 Bacteria 463572
290 Ga0209258_100253 3300025242 Bacteria 96309
291 Ga0209258_103902 3300025242 Bacteria 3020
292 Ga0209646_1000022 3300025246 Bacteria 446621
293 Ga0209646_1000174 3300025246 Bacteria 84479
294 Ga0209646_1020439 3300025246 Bacteria 956
295 Ga0209646_1025196 3300025246 Bacteria 833
296 Ga0209026_1002115 3300025250 Bacteria 7781
297 Ga0209026_1045405 3300025250 Bacteria 632
298 Ga0209677_100009 3300025253 Bacteria 749530
299 Ga0209677_111617 3300025253 Bacteria 1361
300 Ga0209148_1000018 3300025254 Bacteria 756247
301 Ga0209148_1000021 3300025254 Bacteria 714645
302 Ga0209148_1000027 3300025254 Bacteria 616374
303 Ga0209759_1000327 3300025256 Bacteria 62700
304 Ga0209759_1000804 3300025256 Bacteria 25401
305 Ga0209759_1001294 3300025256 Bacteria 14869
306 Ga0209759_1001771 3300025256 Bacteria 11009
307 Ga0209759_1002181 3300025256 Bacteria 8969
308 Ga0209759_1007195 3300025256 Bacteria 3618
309 Ga0209759_1026741 3300025256 Bacteria 1204
310 Ga0209233_1000135 3300025261 Bacteria 201057
311 Ga0209565_1023806 3300025263 Bacteria 1256
312 Ga0209565_1058772 3300025263 Bacteria 671
313 Ga0209455_1000015 3300025272 Bacteria 756128
314 Ga0209455_1000021 3300025272 Bacteria 699993
315 Ga0209455_1000037 3300025272 Bacteria 464097
316 Ga0209455_1000213 3300025272 Bacteria 82040
317 Ga0209673_1000201 3300025273 Bacteria 120059
318 Ga0209673_1006977 3300025273 Bacteria 5326
319 Ga0209673_1007222 3300025273 Bacteria 5173
320 Ga0209673_1033078 3300025273 Bacteria 1582
321 Ga0209130_1066354 3300025284 Bacteria 612
322 Ga0209675_1037692 3300025291 Bacteria 1084
323 Ga0209676_1004133 3300025292 Bacteria 8268
324 Ga0209676_1093711 3300025292 Bacteria 654
325 Ga0209025_1000003 3300025294 Bacteria 1366495
326 Ga0209564_1000009 3300025295 Bacteria 950196
327 Ga0209564_1000068 3300025295 Bacteria 311171
328 Ga0209564_1002800 3300025295 Bacteria 12995
329 Ga0209050_1003281 3300025298 Bacteria 12153
330 Ga0209050_1003824 3300025298 Bacteria 10743
331 Ga0209256_1000424 3300025299 Bacteria 66333
332 Ga0209256_1002394 3300025299 Bacteria 15451
333 Ga0207426_1003279 3300025302 Bacteria 9024
334 Ga0209051_1000244 3300025303 Bacteria 91505
335 Ga0209051_1000469 3300025303 Bacteria 52936
336 Ga0209051_1139745 3300025303 Bacteria 584
337 Ga0209257_1000144 3300025304 Bacteria 197078
338 Ga0209257_1000946 3300025304 Bacteria 40063
339 Ga0209257_1002583 3300025304 Bacteria 17605
340 Ga0207656_10508006 3300025321 Bacteria 612
341 Ga0207696_1029949 3300025711 Bacteria 1658
342 Ga0207655_1008662 3300025728 Bacteria 6421
343 Ga0207655_1076323 3300025728 Bacteria 1226
344 Ga0207655_1078846 3300025728 Bacteria 1195
345 Ga0207713_1001188 3300025735 Bacteria 21909
346 Ga0207713_1003181 3300025735 Bacteria 11351
347 Ga0207642_10392418 3300025899 Bacteria 829
348 Ga0207710_10547682 3300025900 Bacteria 603
349 Ga0207647_10000835 3300025904 Bacteria 23959
350 Ga0207647_10018639 3300025904 Bacteria 4688
351 Ga0207647_10072504 3300025904 Bacteria 2076
352 Ga0207699_11371450 3300025906 Bacteria 523
353 Ga0207645_11127937 3300025907 Bacteria 528
354 Ga0207705_10114607 3300025909 Bacteria 1994
355 Ga0207705_10189679 3300025909 Bacteria 1554
356 Ga0207654_10363279 3300025911 Bacteria 999
357 Ga0207695_10006070 3300025913 Bacteria 15766
358 Ga0207695_10029964 3300025913 Bacteria 6001
359 Ga0207695_10079796 3300025913 Bacteria 3315
360 Ga0207695_10199467 3300025913 Bacteria 1916
361 Ga0207671_10020134 3300025914 Bacteria 5086
362 Ga0207671_10063258 3300025914 Bacteria 2749
363 Ga0207660_11098842 3300025917 Bacteria 648
364 Ga0207657_10000001 3300025919 Bacteria 458536
365 Ga0207657_10077952 3300025919 Bacteria 2792
366 Ga0207657_11400713 3300025919 Bacteria 525
367 Ga0207649_10000019 3300025920 Bacteria 212682
368 Ga0207649_10241282 3300025920 Bacteria 1297
369 Ga0207681_10018919 3300025923 Bacteria 4344
370 Ga0207694_10010183 3300025924 Bacteria 7086
371 Ga0207694_10066616 3300025924 Bacteria 2810
372 Ga0207694_10598207 3300025924 Bacteria 927
373 Ga0207694_10615137 3300025924 Bacteria 914
374 Ga0207694_11605520 3300025924 Bacteria 548
375 Ga0207650_10917360 3300025925 Bacteria 744
376 Ga0207644_11039168 3300025931 Bacteria 688
377 Ga0207690_10000006 3300025932 Bacteria 433880
378 Ga0207690_10004157 3300025932 Bacteria 8555
379 Ga0207686_11762972 3300025934 Bacteria 512
380 Ga0207709_10326946 3300025935 Bacteria 1150
381 Ga0207709_11064110 3300025935 Bacteria 663
382 Ga0207669_11756621 3300025937 Bacteria 530
383 Ga0207679_10000001 3300025945 Bacteria 777444
384 Ga0207679_10881743 3300025945 Bacteria 818
385 Ga0207679_11188239 3300025945 Bacteria 700
386 Ga0207667_10023086 3300025949 Bacteria 6854
387 Ga0207667_10520474 3300025949 Bacteria 1205
388 Ga0207640_10000240 3300025981 Bacteria 37127
389 Ga0207640_11151542 3300025981 Bacteria 688
390 Ga0207703_10044817 3300026035 Bacteria 3556
391 Ga0207678_10000001 3300026067 Bacteria 433184
392 Ga0207678_10000167 3300026067 Bacteria 55724
393 Ga0207678_10138210 3300026067 Bacteria 2079
394 Ga0207708_10226667 3300026075 Bacteria 1499
395 Ga0207702_10000009 3300026078 Bacteria 305906
396 Ga0207702_10401565 3300026078 Bacteria 1322
397 Ga0207641_11619979 3300026088 Bacteria 649
398 Ga0207648_10145745 3300026089 Bacteria 2088
399 Ga0207648_10356667 3300026089 Bacteria 1319
400 Ga0207674_10017905 3300026116 Bacteria 7722
401 Ga0207674_10163724 3300026116 Bacteria 2178
402 Ga0207683_10204392 3300026121 Bacteria 1796
403 Ga0207698_10020074 3300026142 Bacteria 4591
404 Ga0207698_10261005 3300026142 Bacteria 1591
405 Ga0207698_11228918 3300026142 Bacteria 763
406 Ga0209281_1005251 3300027111 Bacteria 3639
407 Ga0209973_1003908 3300027252 Bacteria 1499
408 Ga0209389_1000341 3300027296 Bacteria 28381
409 Ga0209371_1000297 3300027312 Bacteria 55845
410 Ga0209371_1009283 3300027312 Bacteria 3140
411 Ga0209998_10123810 3300027717 Bacteria 653
412 Ga0209974_10000696 3300027876 Bacteria 11455
413 Ga0209974_10001341 3300027876 Bacteria 8852
414 Ga0209974_10464471 3300027876 Bacteria 504
415 Ga0207428_10001343 3300027907 Bacteria 26179
416 Ga0307515_10000084 3300028794 Bacteria 221434
417 Ga0307515_10094677 3300028794 Bacteria 3686
418 Ga0307515_10235483 3300028794 Bacteria 1613
419 Ga0265338_10856238 3300028800 Bacteria 621
420 Ga0311001_1028972 3300029277 Bacteria 503
421 Ga0268256_1000261 3300030500 Bacteria 55844
422 Ga0268256_1009819 3300030500 Bacteria 3140
423 Ga0268256_1038334 3300030500 Bacteria 1090
424 Ga0307512_10064260 3300030522 Bacteria 2797
425 Ga0316177_1201187 3300030731 Bacteria 620
426 Ga0314311_1115675 3300030733 Bacteria 1364
427 Ga0314311_1176908 3300030733 Bacteria 541
428 Ga0316179_1009805 3300030734 Bacteria 1005
429 Ga0316179_1031030 3300030734 Bacteria 611
430 Ga0316183_1114423 3300030742 Bacteria 1531
431 Ga0316181_1150926 3300030744 Bacteria 769
432 Ga0316181_1220920 3300030744 Bacteria 2819
433 Ga0316182_1362949 3300030745 Bacteria 684
434 Ga0265767_101143 3300030836 Bacteria 1256
435 Ga0265766_1002226 3300030863 Bacteria 1056
436 Ga0265766_1016835 3300030863 Bacteria 576
437 Ga0265766_1021884 3300030863 Bacteria 531
438 Ga0265764_114734 3300030882 Bacteria 531
439 Ga0265769_101647 3300030888 Bacteria 1095
440 Ga0265761_106943 3300030889 Bacteria 612
441 Ga0247549_103512 3300030942 Bacteria 585
442 Ga0265773_1027860 3300031018 Bacteria 592
443 Ga0265332_10009574 3300031238 Bacteria 4322
444 Ga0265328_10185176 3300031239 Bacteria 788
445 Ga0265329_10203737 3300031242 Bacteria 652
446 Ga0265327_10001175 3300031251 Bacteria 35521
447 Ga0265316_10001277 3300031344 Bacteria 27035
448 Ga0307513_10011348 3300031456 Bacteria 11079
449 Ga0307408_100000663 3300031548 Bacteria 28685
450 Ga0307408_100002158 3300031548 Bacteria 14074
451 Ga0307408_100134587 3300031548 Bacteria 1932
452 Ga0307408_101055504 3300031548 Bacteria 751
453 Ga0307514_10000319 3300031649 Bacteria 115327
454 Ga0316575_10002655 3300031665 Bacteria 6026
455 Ga0316575_10119739 3300031665 Bacteria 1076
456 Ga0316575_10138864 3300031665 Bacteria 999
457 Ga0316575_10232613 3300031665 Unclassified 771
458 Ga0310111_120975 3300031667 Bacteria 795
459 Ga0316579_10000223 3300031691 Bacteria 17183
460 Ga0316579_10003497 3300031691 Bacteria 6137
461 Ga0316579_10014597 3300031691 Bacteria 3401
462 Ga0316579_10241042 3300031691 Bacteria 875
463 Ga0316579_10297992 3300031691 Unclassified 779
464 Ga0265314_10467514 3300031711 Bacteria 669
465 Ga0316576_10013047 3300031727 Bacteria 5508
466 Ga0316576_10023215 3300031727 Bacteria 4317
467 Ga0316576_10216585 3300031727 Bacteria 1441
468 Ga0316576_10293236 3300031727 Unclassified 1216
469 Ga0316576_11014721 3300031727 Bacteria 591
470 Ga0316578_10008120 3300031728 Bacteria 5316
471 Ga0316578_10020537 3300031728 Bacteria 3652
472 Ga0316578_10074386 3300031728 Bacteria 2014
473 Ga0316578_10190161 3300031728 Bacteria 1237
474 Ga0316578_10311552 3300031728 Bacteria 940
475 Ga0316578_10430988 3300031728 Bacteria 780
476 Ga0316578_10437514 3300031728 Bacteria 773
477 Ga0316578_10929235 3300031728 Unclassified 502
478 Ga0307405_10113333 3300031731 Bacteria 1841
479 Ga0307405_11251356 3300031731 Bacteria 644
480 Ga0316577_10038905 3300031733 Bacteria 2661
481 Ga0316577_10080598 3300031733 Bacteria 1820
482 Ga0316577_10094394 3300031733 Bacteria 1675
483 Ga0316577_10195069 3300031733 Bacteria 1144
484 Ga0316577_10198272 3300031733 Bacteria 1134
485 Ga0316577_10267531 3300031733 Bacteria 967
486 Ga0247548_105409 3300031814 Bacteria 604
487 Ga0307406_10001789 3300031901 Bacteria 11747
488 Ga0307406_10391076 3300031901 Bacteria 1099
489 Ga0307412_10000008 3300031911 Bacteria 461034
490 Ga0307412_10000845 3300031911 Bacteria 17634
491 Ga0307412_10324403 3300031911 Bacteria 1226
492 Ga0307412_10583511 3300031911 Bacteria 944
493 Ga0307412_12026738 3300031911 Bacteria 533
494 Ga0307409_100059348 3300031995 Bacteria 2977
495 Ga0307416_100381760 3300032002 Bacteria 1439
496 Ga0307414_11636843 3300032004 Bacteria 600
497 Ga0307411_10103964 3300032005 Bacteria 2016
498 Ga0316583_10007592 3300032133 Bacteria 3905
499 Ga0316583_10015794 3300032133 Bacteria 2719
500 Ga0316583_10062211 3300032133 Bacteria 1307
501 Ga0316583_10141379 3300032133 Bacteria 839
502 Ga0316583_10359814 3300032133 Bacteria 503
503 Ga0316585_10001492 3300032137 Bacteria 6198
504 Ga0316585_10002042 3300032137 Bacteria 5413
505 Ga0316580_10002575 3300032139 Bacteria 5019
506 Ga0316580_10010682 3300032139 Bacteria 2780
507 Ga0316580_10115613 3300032139 Unclassified 821
508 Ga0316593_10000184 3300032168 Bacteria 9441
509 Ga0316593_10000461 3300032168 Bacteria 7469
510 Ga0316593_10000850 3300032168 Bacteria 6172
511 Ga0316593_10000905 3300032168 Bacteria 6063
512 Ga0316593_10005627 3300032168 Bacteria 3322
513 Ga0316593_10011079 3300032168 Bacteria 2610
514 Ga0316593_10015927 3300032168 Bacteria 2271
515 Ga0316593_10016257 3300032168 Bacteria 2253
516 Ga0316593_10018048 3300032168 Bacteria 2162
517 Ga0316593_10023063 3300032168 Bacteria 1962
518 Ga0316593_10040179 3300032168 Bacteria 1554
519 Ga0316593_10074069 3300032168 Bacteria 1181
520 Ga0316593_10074693 3300032168 Bacteria 1176
521 Ga0316593_10085717 3300032168 Bacteria 1104
522 Ga0316593_10124271 3300032168 Bacteria 928
523 Ga0316593_10124809 3300032168 Bacteria 926
524 Ga0316593_10161438 3300032168 Unclassified 819
525 Ga0316593_10182502 3300032168 Bacteria 772
526 Ga0316593_10242096 3300032168 Bacteria 673
527 Ga0316593_10246253 3300032168 Bacteria 668
528 Ga0316593_10281050 3300032168 Bacteria 627
529 Ga0316593_10337121 3300032168 Unclassified 575
530 Ga0316592_1000418 3300033524 Bacteria 5762
531 Ga0316592_1000834 3300033524 Bacteria 4628
532 Ga0316592_1001455 3300033524 Bacteria 3816
533 Ga0316592_1002172 3300033524 Bacteria 3344
534 Ga0316592_1005091 3300033524 Bacteria 2479
535 Ga0316592_1007741 3300033524 Bacteria 2103
536 Ga0316592_1008452 3300033524 Bacteria 2036
537 Ga0316592_1015251 3300033524 Bacteria 1598
538 Ga0316592_1027020 3300033524 Bacteria 1240
539 Ga0316592_1056001 3300033524 Bacteria 883
540 Ga0316592_1057814 3300033524 Bacteria 869
541 Ga0316592_1075825 3300033524 Bacteria 763
542 Ga0316586_1002586 3300033527 Bacteria 2276
543 Ga0316586_1004157 3300033527 Bacteria 1956
544 Ga0316586_1048671 3300033527 Bacteria 756
545 Ga0316586_1103135 3300033527 Bacteria 546
546 Ga0316588_1000358 3300033528 Bacteria 5911
547 Ga0316588_1000978 3300033528 Bacteria 4444
548 Ga0316588_1003991 3300033528 Bacteria 2749
549 Ga0316588_1021263 3300033528 Bacteria 1475
550 Ga0316588_1042135 3300033528 Unclassified 1093
551 Ga0316588_1052481 3300033528 Bacteria 990
552 Ga0316588_1059017 3300033528 Unclassified 935
553 Ga0316588_1077066 3300033528 Bacteria 823
554 Ga0316588_1090112 3300033528 Bacteria 763
555 Ga0316587_1000327 3300033529 Bacteria 4482
556 Ga0316587_1001516 3300033529 Bacteria 2886
557 Ga0316587_1002276 3300033529 Bacteria 2543
558 Ga0316587_1009238 3300033529 Bacteria 1561
559 Ga0316587_1010565 3300033529 Bacteria 1478
560 Ga0316587_1029286 3300033529 Unclassified 968
561 Ga0316587_1036032 3300033529 Unclassified 885
562 Ga0316587_1036410 3300033529 Bacteria 881
563 Ga0316587_1097520 3300033529 Bacteria 564
564 Ga0316596_1000420 3300033541 Bacteria 7070
565 Ga0316596_1001044 3300033541 Bacteria 5365
566 Ga0316596_1004668 3300033541 Bacteria 3091
567 Ga0316596_1009739 3300033541 Bacteria 2310
568 Ga0316596_1019773 3300033541 Bacteria 1710
569 Ga0316596_1027444 3300033541 Bacteria 1469
570 Ga0316596_1036210 3300033541 Bacteria 1290
571 Ga0316596_1047590 3300033541 Bacteria 1133
572 Ga0316596_1072695 3300033541 Bacteria 921
573 Ga0316596_1089874 3300033541 Unclassified 827
574 Ga0316596_1098142 3300033541 Unclassified 791
575 Ga0316596_1113804 3300033541 Unclassified 735
576 Ga0316596_1176816 3300033541 Unclassified 590
577 Ga0316596_1231771 3300033541 Unclassified 518
578 Ga0373928_0104388 3300035084 Bacteria 743
579 Ga0316574_0000770 3300035398 Bacteria 13806
580 Ga0316574_0305564 3300035398 Bacteria 1011
581 Ga0316574_0361910 3300035398 Bacteria 917
582 Ga0316574_0497394 3300035398 Bacteria 760
583 Ga0316574_0569701 3300035398 Unclassified 701
584 Ga0316574_0704972 3300035398 Unclassified 619
585 Ga0373924_0015722 3300035410 Bacteria 2880
586 Ga0373931_0010733 3300035691 Bacteria 4410
587 Ga0373931_0617817 3300035691 Bacteria 710
588 Ga0310109_014588 3300036534 Bacteria 1066
589 Ga0316582_0001537 3300036647 Bacteria 10216
590 Ga0316582_0032685 3300036647 Bacteria 3190
591 Ga0316582_0047897 3300036647 Bacteria 2700
592 Ga0316582_0105863 3300036647 Bacteria 1867
593 Ga0316582_0225009 3300036647 Bacteria 1283
594 Ga0316582_0325154 3300036647 Bacteria 1057
595 Ga0316582_0554367 3300036647 Bacteria 792
596 Ga0316582_0901898 3300036647 Unclassified 605
597 Ga0316584_0014853 3300036712 Bacteria 5562
598 Ga0316584_0151535 3300036712 Bacteria 1726
599 Ga0316584_0198220 3300036712 Bacteria 1482
600 Ga0316584_0210336 3300036712 Bacteria 1432
601 Ga0316584_0314431 3300036712 Bacteria 1131
602 Ga0316584_0381218 3300036712 Unclassified 1007
603 Ga0395899_0000041 3300037312 Bacteria 255615
604 Ga0395899_0031186 3300037312 Bacteria 4007
605 Ga0395899_0086705 3300037312 Bacteria 2273
606 Ga0395900_0000797 3300037418 Bacteria 41664
607 Ga0395900_0001690 3300037418 Bacteria 25639
608 Ga0395900_0009723 3300037418 Bacteria 9850
609 Ga0395900_0198721 3300037418 Bacteria 2030
610 Ga0395900_0346672 3300037418 Bacteria 1459
611 Ga0395898_0000220 3300037466 Bacteria 146473
612 Ga0395898_0040162 3300037466 Bacteria 4628
613 Ga0395898_0367817 3300037466 Bacteria 1371
614 Ga0395898_0623605 3300037466 Bacteria 1021
615 Ga0395905_0021181 3300037471 Bacteria 6153
616 Ga0395905_0088384 3300037471 Bacteria 2905
617 Ga0395905_0563467 3300037471 Bacteria 1040
618 Ga0316581_0001281 3300037588 Bacteria 5582
619 Ga0316581_0184420 3300037588 Unclassified 643
620 Ga0395901_0000011 3300038443 Bacteria 400724
621 Ga0395901_0000106 3300038443 Bacteria 114313
622 Ga0395901_0044283 3300038443 Bacteria 4615
623 Ga0395901_0200791 3300038443 Bacteria 2090
624 Ga0400490_46138 3300038726 Bacteria 13561
625 Ga0400490_48203 3300038726 Bacteria 18626
626 Ga0400490_60606 3300038726 Bacteria 8679
627 Ga0400488_57509 3300038741 Bacteria 4330
628 Ga0400483_047628 3300039062 Bacteria 4192
629 Ga0400483_179240 3300039062 Bacteria 6112
630 Ga0400487_50157 3300039110 Bacteria 4858
631 Ga0436365_0005079 3300039437 Bacteria 1836
632 Ga0436360_0518562 3300039438 Bacteria 524
633 Ga0436361_0085296 3300039447 Bacteria 2388
634 Ga0436361_0119299 3300039447 Bacteria 18398
635 Ga0436361_0209693 3300039447 Bacteria 3817
636 Ga0436361_0260589 3300039447 Bacteria 1706
637 Ga0436361_0360842 3300039447 Bacteria 25330
638 Ga0436361_0399282 3300039447 Bacteria 657
639 Ga0436361_0416774 3300039447 Bacteria 925
640 Ga0436361_0508128 3300039447 Bacteria 12467
641 Ga0451793_1402114 3300041452 Bacteria 929
642 Ga0451799_22873 3300041454 Bacteria 512
643 Ga0451805_049160 3300041461 Bacteria 592
644 Ga0451839_0220486 3300041496 Bacteria 516
645 Ga0451853_3370414 3300041512 Bacteria 1147
646 Ga0439445_0047401 3300042004 Bacteria 1154
647 Ga0439445_0207706 3300042004 Bacteria 579
648 Ga0439432_224662 3300042006 Bacteria 541
649 Ga0439454_005931 3300042011 Bacteria 1481
650 Ga0450911_000530 3300042115 Bacteria 12036
651 Ga0450911_024880 3300042115 Bacteria 777
652 Ga0450923_059872 3300042125 Bacteria 829
653 Ga0450890_004781 3300042127 Bacteria 1759
654 Ga0439446_0072906 3300042156 Bacteria 1053
655 Ga0439446_0280482 3300042156 Bacteria 581
656 Ga0439458_0240244 3300042157 Bacteria 502
657 Ga0439459_0000026 3300042438 Bacteria 12841
658 Ga0450901_044632 3300042533 Bacteria 503
659 Ga0466986_0208548 3300044650 Bacteria 1278
660 Ga0466969_0000212 3300044656 Bacteria 31753
661 Ga0466969_0003756 3300044656 Bacteria 8068
662 Ga0466969_0009461 3300044656 Bacteria 5167
663 Ga0466969_0126684 3300044656 Bacteria 1186
664 Ga0466972_0004661 3300044658 Bacteria 6865
665 Ga0466972_0012555 3300044658 Bacteria 4256
666 Ga0466972_0041828 3300044658 Bacteria 2229
667 Ga0466972_0055688 3300044658 Bacteria 1902
668 Ga0466972_0147739 3300044658 Bacteria 1105
669 Ga0466972_0441782 3300044658 Bacteria 611
670 Ga0466973_0008590 3300044659 Bacteria 9269
671 Ga0466980_0148245 3300044668 Bacteria 1563
672 Ga0466978_0027607 3300044671 Bacteria 3428
673 Ga0466982_0250390 3300044672 Bacteria 1036
674 Ga0466982_0265117 3300044672 Bacteria 997
675 Ga0453683_0099868 3300044673 Bacteria 1822
676 Ga0466965_0003246 3300044683 Bacteria 7109
677 Ga0466965_0005740 3300044683 Bacteria 5601
678 Ga0466965_0035070 3300044683 Bacteria 2456
679 Ga0466965_0050704 3300044683 Bacteria 2058
680 Ga0466965_0090269 3300044683 Bacteria 1558
681 Ga0466965_0130703 3300044683 Bacteria 1302
682 Ga0466965_0159994 3300044683 Bacteria 1180
683 Ga0466965_0418414 3300044683 Bacteria 742
684 Ga0466966_0003888 3300044684 Bacteria 9867
685 Ga0466966_0009685 3300044684 Bacteria 6382
686 Ga0466966_0013697 3300044684 Bacteria 5365
687 Ga0466966_0113920 3300044684 Bacteria 1665
688 Ga0466966_0190799 3300044684 Bacteria 1241
689 Ga0466966_0288251 3300044684 Bacteria 987
690 Ga0466966_0412471 3300044684 Bacteria 812
691 Ga0466966_0494582 3300044684 Bacteria 735
692 Ga0466961_0000415 3300044693 Bacteria 27177
693 Ga0466961_0001007 3300044693 Bacteria 17404
694 Ga0466961_0007203 3300044693 Bacteria 7074
695 Ga0466961_0014813 3300044693 Bacteria 5009
696 Ga0466961_0121839 3300044693 Bacteria 1637
697 Ga0466961_0268484 3300044693 Bacteria 1045
698 Ga0466961_0340099 3300044693 Bacteria 914
699 Ga0466961_0532423 3300044693 Bacteria 708
700 Ga0466963_0001278 3300044694 Bacteria 13354
701 Ga0466963_0090391 3300044694 Bacteria 2085
702 Ga0466963_0092180 3300044694 Bacteria 2064
703 Ga0466963_0106552 3300044694 Bacteria 1922
704 Ga0466963_0173523 3300044694 Bacteria 1503
705 Ga0466963_0288155 3300044694 Bacteria 1154
706 Ga0466964_0001878 3300044706 Bacteria 7333
707 Ga0466964_0007716 3300044706 Bacteria 4027
708 Ga0466964_0076040 3300044706 Bacteria 1431
709 Ga0466964_0222730 3300044706 Bacteria 917
710 Ga0466964_0419693 3300044706 Bacteria 703
711 Ga0466971_0001557 3300044719 Bacteria 9682
712 Ga0466971_0024782 3300044719 Bacteria 2677
713 Ga0466971_0071483 3300044719 Bacteria 1576
714 Ga0466971_0423259 3300044719 Bacteria 651
715 Ga0466971_0441195 3300044719 Bacteria 638
716 Ga0466968_0003428 3300044735 Bacteria 5865
717 Ga0466968_0016798 3300044735 Bacteria 2917
718 Ga0466970_0006924 3300044765 Bacteria 5676
719 Ga0466970_0022440 3300044765 Bacteria 3294
720 Ga0466970_0037074 3300044765 Bacteria 2583
721 Ga0466970_0075084 3300044765 Bacteria 1820
722 Ga0466970_0168989 3300044765 Bacteria 1211
723 Ga0466970_0173992 3300044765 Bacteria 1193
724 Ga0466957_0003890 3300044842 Bacteria 8250
725 Ga0466957_0022595 3300044842 Bacteria 3713
726 Ga0466957_0030419 3300044842 Bacteria 3223
727 Ga0466957_0044973 3300044842 Bacteria 2676
728 Ga0466957_0167885 3300044842 Bacteria 1428
729 Ga0466957_0623878 3300044842 Bacteria 756
730 Ga0466960_0040069 3300044901 Bacteria 2213
731 Ga0466960_0260758 3300044901 Bacteria 965
732 Ga0466959_0002179 3300045049 Bacteria 12452
733 Ga0466959_0002658 3300045049 Bacteria 11471
734 Ga0466959_0006378 3300045049 Bacteria 8167
735 Ga0466959_0007553 3300045049 Bacteria 7640
736 Ga0466959_0023160 3300045049 Bacteria 4595
737 Ga0466958_0006562 3300045836 Bacteria 6342
738 Ga0466958_0035137 3300045836 Bacteria 2993
739 Ga0466958_0048644 3300045836 Bacteria 2563
740 Ga0466958_0195199 3300045836 Bacteria 1287
741 Ga0466967_0010385 3300045976 Bacteria 6982
742 Ga0466967_0557058 3300045976 Bacteria 1129
743 Ga0466967_1257985 3300045976 Bacteria 737
744 Ga0495617_000843 3300046452 Bacteria 14581
745 Ga0495617_005276 3300046452 Bacteria 4600
746 Ga0495627_000007 3300046453 Bacteria 575915
747 Ga0495592_0106127 3300046454 Bacteria 1994
748 Ga0495592_0388974 3300046454 Bacteria 886
749 Ga0495603_0027448 3300046455 Bacteria 3436
750 Ga0495590_0002241 3300046457 Bacteria 8071
751 Ga0495590_0010204 3300046457 Bacteria 3537
752 Ga0495590_0044896 3300046457 Bacteria 1541
753 Ga0495591_004107 3300046458 Bacteria 7244
754 Ga0495629_0000060 3300046459 Bacteria 100921
755 Ga0495629_0018287 3300046459 Bacteria 5018
756 Ga0495629_0127038 3300046459 Bacteria 1776
757 Ga0495629_0689902 3300046459 Bacteria 678
758 Ga0495638_0009335 3300046460 Bacteria 6896
759 Ga0495641_0005783 3300046461 Bacteria 8212
760 Ga0495641_0219475 3300046461 Bacteria 853
761 Ga0495651_0022338 3300046462 Bacteria 4917
762 Ga0495651_0334936 3300046462 Bacteria 1004
763 Ga0495653_0026964 3300046463 Bacteria 4601
764 Ga0495653_0146152 3300046463 Bacteria 1656
765 Ga0495653_0148465 3300046463 Bacteria 1640
766 Ga0495653_0519160 3300046463 Bacteria 740
767 Ga0495653_0849521 3300046463 Bacteria 546
768 Ga0495650_0000837 3300046471 Bacteria 37114
769 Ga0495650_0007308 3300046471 Bacteria 6667
770 Ga0495650_0008995 3300046471 Bacteria 5741
771 Ga0495650_0137162 3300046471 Bacteria 888
772 Ga0495580_0000975 3300046472 Bacteria 25069
773 Ga0495580_0009352 3300046472 Bacteria 7709
774 Ga0495580_0048496 3300046472 Bacteria 3006
775 Ga0495580_0052848 3300046472 Bacteria 2868
776 Ga0495580_0109638 3300046472 Bacteria 1917
777 Ga0495582_0002748 3300046473 Bacteria 9822
778 Ga0495582_0037546 3300046473 Bacteria 2664
779 Ga0495605_0019964 3300046474 Bacteria 3567
780 Ga0495605_0046155 3300046474 Bacteria 2143
781 Ga0495605_0064560 3300046474 Bacteria 1743
782 Ga0495605_0168173 3300046474 Bacteria 970
783 Ga0495662_0120824 3300046476 Bacteria 1286
784 Ga0495662_0132942 3300046476 Bacteria 1223
785 Ga0495662_0261704 3300046476 Bacteria 851
786 Ga0495664_0000037 3300046477 Bacteria 70108
787 Ga0495664_0010939 3300046477 Bacteria 5104
788 Ga0495664_0016639 3300046477 Bacteria 4192
789 Ga0495664_0357168 3300046477 Bacteria 879
790 Ga0495584_0002307 3300046491 Bacteria 10888
791 Ga0495584_0413837 3300046491 Bacteria 685
792 Ga0495585_0398843 3300046492 Bacteria 662
793 Ga0495594_0042385 3300046499 Bacteria 2493
794 Ga0495596_0018802 3300046500 Bacteria 2845
795 Ga0495596_0076148 3300046500 Bacteria 1303
796 Ga0495607_0090253 3300046501 Bacteria 1662
797 Ga0495583_0000177 3300046506 Bacteria 108704
798 Ga0495583_0000221 3300046506 Bacteria 96143
799 Ga0495583_0001627 3300046506 Bacteria 21932
800 Ga0495583_0027095 3300046506 Bacteria 2831
801 Ga0495583_0078735 3300046506 Bacteria 1435
802 Ga0495606_0040529 3300046507 Bacteria 3130
803 Ga0495606_0046538 3300046507 Bacteria 2866
804 Ga0495606_0060057 3300046507 Bacteria 2436
805 Ga0495606_0064965 3300046507 Bacteria 2320
806 Ga0495606_0219356 3300046507 Bacteria 1072
807 Ga0495608_0002733 3300046511 Bacteria 12673
808 Ga0495608_0939969 3300046511 Bacteria 504
809 Ga0495610_0003920 3300046512 Bacteria 11276
810 Ga0495610_0045830 3300046512 Bacteria 2161
811 Ga0495616_0026387 3300046513 Bacteria 3093
812 Ga0495616_0431709 3300046513 Bacteria 536
813 Ga0495618_0005010 3300046514 Bacteria 8093
814 Ga0495618_0005105 3300046514 Bacteria 8015
815 Ga0495620_0010464 3300046515 Bacteria 4895
816 Ga0495620_0044545 3300046515 Bacteria 1927
817 Ga0495628_0011261 3300046516 Bacteria 7567
818 Ga0495628_0019283 3300046516 Bacteria 5641
819 Ga0495628_0081905 3300046516 Bacteria 2506
820 Ga0495628_0089721 3300046516 Bacteria 2380
821 Ga0495630_0018087 3300046517 Bacteria 5172
822 Ga0495630_0060980 3300046517 Bacteria 2832
823 Ga0495630_0200148 3300046517 Bacteria 1524
824 Ga0495630_0250715 3300046517 Bacteria 1352
825 Ga0495630_1176338 3300046517 Bacteria 580
826 Ga0495632_0203715 3300046519 Bacteria 900
827 Ga0495632_0259407 3300046519 Bacteria 778
828 Ga0495637_0014142 3300046520 Bacteria 3771
829 Ga0495643_0000123 3300046522 Bacteria 124936
830 Ga0495643_0036541 3300046522 Bacteria 2698
831 Ga0495643_0154126 3300046522 Bacteria 1135
832 Ga0495644_0006676 3300046523 Bacteria 4470
833 Ga0495648_0002540 3300046524 Bacteria 16736
834 Ga0495648_0018998 3300046524 Bacteria 4847
835 Ga0495648_0028053 3300046524 Bacteria 3755
836 Ga0495648_0043051 3300046524 Bacteria 2834
837 Ga0495666_0001885 3300046526 Bacteria 10351
838 Ga0495666_0142952 3300046526 Bacteria 1114
839 Ga0495642_0025247 3300046528 Bacteria 2355
840 Ga0495642_0036504 3300046528 Bacteria 1986
841 Ga0495652_0031410 3300046529 Bacteria 4651
842 Ga0495652_0115948 3300046529 Bacteria 2145
843 Ga0495652_0131756 3300046529 Bacteria 1978
844 Ga0495652_0182733 3300046529 Bacteria 1607
845 Ga0495654_0007194 3300046530 Bacteria 6243
846 Ga0495654_0016009 3300046530 Bacteria 3973
847 Ga0495654_0047831 3300046530 Bacteria 2101
848 Ga0495654_0216948 3300046530 Bacteria 811
849 Ga0495654_0243293 3300046530 Bacteria 752
850 Ga0495665_0027180 3300046531 Bacteria 3072
851 Ga0495665_0088982 3300046531 Bacteria 1622
852 Ga0495665_0233349 3300046531 Bacteria 949
853 Ga0495665_0332830 3300046531 Bacteria 774
854 Ga0495640_0012106 3300046533 Bacteria 6607
855 Ga0495640_0017853 3300046533 Bacteria 5276
856 Ga0495640_0576921 3300046533 Bacteria 680
857 Ga0495586_0004650 3300046535 Bacteria 7337
858 Ga0495586_0133203 3300046535 Bacteria 1392
859 Ga0495587_0003135 3300046536 Bacteria 11060
860 Ga0495587_0083669 3300046536 Bacteria 1848
861 Ga0495609_0000479 3300046538 Bacteria 32080
862 Ga0495609_0207150 3300046538 Bacteria 818
863 Ga0495597_0010421 3300046542 Bacteria 4546
864 Ga0495597_0017578 3300046542 Bacteria 3363
865 Ga0495597_0095922 3300046542 Bacteria 1254
866 Ga0495597_0126266 3300046542 Bacteria 1063
867 Ga0495597_0132415 3300046542 Bacteria 1033
868 Ga0495597_0144854 3300046542 Bacteria 978
869 Ga0495645_0028172 3300046543 Bacteria 4081
870 Ga0495645_0049735 3300046543 Bacteria 3052
871 Ga0495622_0000028 3300046557 Bacteria 133197
872 Ga0495622_0064758 3300046557 Bacteria 1690
873 Ga0495633_0001452 3300046558 Bacteria 18400
874 Ga0495633_0003780 3300046558 Bacteria 9929
875 Ga0495633_0045139 3300046558 Bacteria 2087
876 Ga0495633_0133096 3300046558 Bacteria 1151
877 Ga0495633_0185045 3300046558 Bacteria 958
878 Ga0495633_0319569 3300046558 Bacteria 704
879 Ga0495667_0426429 3300046559 Bacteria 834
880 Ga0495656_0003881 3300046615 Bacteria 5084
881 Ga0495656_0109049 3300046615 Bacteria 1292
882 Ga0495656_0144429 3300046615 Bacteria 1144
883 Ga0495668_0464305 3300046616 Bacteria 697
884 Ga0495634_0070463 3300046642 Bacteria 2304
885 Ga0495634_0100657 3300046642 Bacteria 1867
886 Ga0495634_0307495 3300046642 Bacteria 957
887 Ga0495634_0315326 3300046642 Bacteria 942
888 Ga0495611_0017514 3300046648 Bacteria 3065
889 Ga0495611_0085027 3300046648 Bacteria 1458
890 Ga0495625_0010387 3300046660 Bacteria 7709
891 Ga0495625_0098533 3300046660 Bacteria 2011
892 Ga0495635_0001911 3300046663 Bacteria 14154
893 Ga0495635_0582656 3300046663 Bacteria 731
894 Ga0495659_0000284 3300046664 Bacteria 20570
895 Ga0495659_0001733 3300046664 Bacteria 7257
896 Ga0495659_0032379 3300046664 Bacteria 1829
897 Ga0495659_0258790 3300046664 Bacteria 727
898 Ga0495661_0015384 3300046665 Bacteria 5107
899 Ga0495661_0032098 3300046665 Bacteria 3323
900 Ga0495661_0068043 3300046665 Bacteria 2090
901 Ga0495661_0187824 3300046665 Bacteria 1090
902 Ga0495588_0016869 3300046674 Bacteria 3536
903 Ga0495588_0266466 3300046674 Bacteria 902
904 Ga0495657_0012465 3300046675 Bacteria 6317
905 Ga0495599_0015303 3300046678 Bacteria 4759
906 Ga0495599_0158502 3300046678 Bacteria 1399
907 Ga0495623_0007364 3300046679 Bacteria 7144
908 Ga0495623_0021394 3300046679 Bacteria 4176
909 Ga0495646_0004251 3300046680 Bacteria 9011
910 Ga0495646_0064817 3300046680 Bacteria 2164
911 Ga0495669_0110981 3300046684 Bacteria 1280
912 Ga0495613_0022883 3300046689 Bacteria 4656
913 Ga0495613_0907691 3300046689 Bacteria 570
914 Ga0495624_0006795 3300046690 Bacteria 8082
915 Ga0495624_0015717 3300046690 Bacteria 5103
916 Ga0495624_0017723 3300046690 Bacteria 4775
917 Ga0495624_0020284 3300046690 Bacteria 4427
918 Ga0495624_0027317 3300046690 Bacteria 3736
919 Ga0495670_0054856 3300046691 Bacteria 1998
920 Ga0495670_0070743 3300046691 Bacteria 1765
921 Ga0495671_0000108 3300046692 Bacteria 74169
922 Ga0495671_0137186 3300046692 Bacteria 1192
923 Ga0495671_0221131 3300046692 Bacteria 916
924 Ga0495671_0397240 3300046692 Bacteria 660
925 Ga0495649_0042023 3300046694 Bacteria 2498
926 Ga0495649_0047936 3300046694 Bacteria 2322
927 Ga0495649_0113338 3300046694 Bacteria 1437
928 Ga0495589_0002451 3300046794 Bacteria 10415
929 Ga0495589_0042042 3300046794 Bacteria 2278
930 Ga0495600_0002084 3300046809 Bacteria 11290
931 Ga0495600_0060784 3300046809 Bacteria 2467
932 Ga0495600_0769114 3300046809 Bacteria 575
933 Ga0495660_0000705 3300046810 Bacteria 25643
934 Ga0495660_0067675 3300046810 Bacteria 1902
935 Ga0495660_0160847 3300046810 Bacteria 1101
936 Ga0495660_0190688 3300046810 Bacteria 985
937 Ga0495660_0278812 3300046810 Bacteria 765
938 Ga0495581_0004052 3300047315 Bacteria 8436
939 Ga0495581_0102795 3300047315 Bacteria 1660
940 Ga0495581_0149957 3300047315 Bacteria 1361
941 Ga0495604_0011916 3300047317 Bacteria 6914
942 Ga0495604_0065108 3300047317 Bacteria 2775
943 Ga0495604_0095261 3300047317 Bacteria 2199
944 Ga0495636_0012717 3300047318 Bacteria 3333
945 Ga0495636_0016093 3300047318 Bacteria 2984
946 Ga0495674_0006962 3300047319 Bacteria 10818
947 Ga0495674_0007875 3300047319 Bacteria 10175
948 Ga0495674_0030492 3300047319 Bacteria 4903
949 Ga0495674_0064038 3300047319 Bacteria 3197
950 Ga0495674_0302711 3300047319 Bacteria 1305
951 Ga0495674_0951762 3300047319 Bacteria 660
952 Ga0495672_0000181 3300047320 Bacteria 91278
953 Ga0495672_0000366 3300047320 Bacteria 57469
954 Ga0495672_0004977 3300047320 Bacteria 10663
955 Ga0495672_0032552 3300047320 Bacteria 3241
956 Ga0495672_0047636 3300047320 Bacteria 2547
957 Ga0495676_0065694 3300047321 Bacteria 2814
958 Ga0495676_0321395 3300047321 Bacteria 1039
959 Ga0495680_0013833 3300047322 Bacteria 7020
960 Ga0495680_0191214 3300047322 Bacteria 1472
961 Ga0495683_0012933 3300047323 Bacteria 4375
962 Ga0495683_0021720 3300047323 Bacteria 3305
963 Ga0495683_0030717 3300047323 Bacteria 2739
964 Ga0495683_0299903 3300047323 Bacteria 690
965 Ga0495687_005585 3300047443 Bacteria 7962
966 Ga0495687_006712 3300047443 Bacteria 6978
967 Ga0495687_026489 3300047443 Bacteria 2728
968 Ga0495687_040102 3300047443 Bacteria 2066
969 Ga0495675_0002828 3300047444 Bacteria 10396
970 Ga0495675_0010388 3300047444 Bacteria 5818
971 Ga0495675_0343950 3300047444 Bacteria 878
972 Ga0495677_0002355 3300047445 Bacteria 7419
973 Ga0495677_0053591 3300047445 Bacteria 1487
974 Ga0495679_000038 3300047446 Bacteria 157311
975 Ga0495679_001758 3300047446 Bacteria 11895
976 Ga0495679_004370 3300047446 Bacteria 6548
977 Ga0495685_000012 3300047447 Bacteria 80496
978 Ga0495673_0000188 3300047469 Bacteria 99425
979 Ga0495673_0030133 3300047469 Bacteria 2552
980 Ga0495673_0035867 3300047469 Bacteria 2280
981 Ga0495681_0004664 3300047470 Bacteria 9291
982 Ga0495681_0023688 3300047470 Bacteria 3255
983 Ga0495681_0266656 3300047470 Bacteria 671
984 Ga0495684_0099372 3300047471 Bacteria 2200
985 Ga0495684_0981306 3300047471 Bacteria 538
986 Ga0495686_0000380 3300047472 Bacteria 71038
987 Ga0495686_0003712 3300047472 Bacteria 13033
988 Ga0495686_0093464 3300047472 Bacteria 1823
989 Ga0495686_0264767 3300047472 Bacteria 961
990 Ga0495593_0067595 3300047673 Bacteria 1860
991 Ga0495593_0175509 3300047673 Bacteria 1079
992 Ga0495593_0253204 3300047673 Bacteria 881
993 Ga0495602_0075108 3300048088 Bacteria 2869
994 Ga0495602_0108305 3300048088 Bacteria 2262
995 Ga0495602_0139136 3300048088 Bacteria 1924
996 Ga0495602_0369908 3300048088 Bacteria 1029
997 Ga0495614_0003506 3300048089 Bacteria 7027
998 Ga0495614_0009064 3300048089 Bacteria 4410
999 Ga0495614_0023359 3300048089 Bacteria 2667
1000 Ga0495614_0465011 3300048089 Bacteria 599
1001 Ga0495626_0001169 3300048091 Bacteria 21818
1002 Ga0495626_0015633 3300048091 Bacteria 3879
1003 Ga0495626_0020668 3300048091 Bacteria 3277
1004 Ga0495626_0320457 3300048091 Bacteria 609
1005 Ga0496100_0001564 3300048903 Bacteria 11251
1006 Ga0496100_1348507 3300048903 Bacteria 563
1007 Ga0496101_0004610 3300048904 Bacteria 8706
1008 Ga0496101_0328315 3300048904 Bacteria 1201
1009 Ga0496101_0424436 3300048904 Bacteria 1048
1010 Ga0496102_0008702 3300048905 Bacteria 8712
1011 Ga0496102_0014532 3300048905 Bacteria 6841
1012 Ga0496102_0184660 3300048905 Bacteria 1965
1013 Ga0496102_1531281 3300048905 Bacteria 585
1014 Ga0496103_0003074 3300048906 Bacteria 10259
1015 Ga0496103_0009410 3300048906 Bacteria 5789
1016 Ga0496103_0110398 3300048906 Bacteria 1747
1017 Ga0496103_0437231 3300048906 Bacteria 839
1018 Ga0496104_1668037 3300048907 Bacteria 540
1019 Ga0496105_0055064 3300048908 Bacteria 3284
1020 Ga0496105_0212234 3300048908 Bacteria 1578
1021 Ga0496106_0138726 3300048909 Bacteria 1911
1022 Ga0496107_0109583 3300048910 Bacteria 2028
1023 Ga0496108_0900138 3300048911 Bacteria 759
1024 Ga0496109_0195160 3300048912 Bacteria 1903
1025 Ga0496110_0099317 3300048913 Bacteria 2609
1026 Ga0496110_1007485 3300048913 Bacteria 740
1027 Ga0496110_1177451 3300048913 Bacteria 675
1028 Ga0496110_1586065 3300048913 Bacteria 564
1029 Ga0496111_0177460 3300048914 Bacteria 1583
1030 Ga0496111_0238931 3300048914 Bacteria 1349
1031 Ga0496112_0165240 3300048915 Bacteria 2179
1032 Ga0496112_1396035 3300048915 Bacteria 615
1033 Ga0496113_0026351 3300048916 Bacteria 4155
1034 Ga0496113_0912600 3300048916 Bacteria 694
1035 Ga0496113_1482673 3300048916 Unclassified 524
1036 Ga0496113_1514884 3300048916 Bacteria 517
1037 Ga0496114_0168757 3300048917 Bacteria 1906
1038 Ga0496114_0171177 3300048917 Bacteria 1893
1039 Ga0496114_0269836 3300048917 Bacteria 1499
1040 Ga0496115_0217914 3300048918 Bacteria 1575
1041 Ga0496116_0007137 3300048919 Bacteria 9993
1042 Ga0496116_0024774 3300048919 Bacteria 4427
1043 Ga0496116_0040168 3300048919 Bacteria 3224
1044 Ga0496116_0173243 3300048919 Bacteria 1166
1045 Ga0496116_0404592 3300048919 Bacteria 602
1046 Ga0496117_0009193 3300048920 Bacteria 9253
1047 Ga0496117_0012754 3300048920 Bacteria 7375
1048 Ga0496117_0023308 3300048920 Bacteria 4938
1049 Ga0496117_0024619 3300048920 Bacteria 4754
1050 Ga0496117_0041125 3300048920 Bacteria 3391
1051 Ga0496118_0002548 3300048921 Bacteria 24410
1052 Ga0496118_0008041 3300048921 Bacteria 11014
1053 Ga0496118_0017381 3300048921 Bacteria 6548
1054 Ga0496118_0019819 3300048921 Bacteria 5997
1055 Ga0496118_0039449 3300048921 Bacteria 3767
1056 Ga0496118_0063758 3300048921 Bacteria 2709
1057 Ga0496119_0008234 3300048922 Bacteria 9214
1058 Ga0496119_0203713 3300048922 Bacteria 1022
1059 Ga0496120_0006959 3300048923 Bacteria 8524
1060 Ga0496120_0292255 3300048923 Bacteria 749
1061 Ga0496121_0000306 3300048924 Bacteria 102245
1062 Ga0496121_0004537 3300048924 Bacteria 18576
1063 Ga0496121_0007042 3300048924 Bacteria 13657
1064 Ga0496121_0065853 3300048924 Bacteria 2945
1065 Ga0496121_0260830 3300048924 Bacteria 1196
1066 Ga0496121_0296634 3300048924 Bacteria 1099
1067 Ga0496122_0000644 3300048925 Bacteria 70937
1068 Ga0496122_0004387 3300048925 Bacteria 17565
1069 Ga0496122_0034717 3300048925 Bacteria 4120
1070 Ga0496122_0280000 3300048925 Bacteria 912
1071 Ga0496122_0548951 3300048925 Bacteria 551
1072 Ga0496123_0000203 3300048926 Bacteria 121361
1073 Ga0496123_0013893 3300048926 Bacteria 6710
1074 Ga0496123_0124169 3300048926 Bacteria 1444
1075 Ga0496123_0149579 3300048926 Bacteria 1262
1076 Ga0496124_0008511 3300048927 Bacteria 10717
1077 Ga0496124_0009308 3300048927 Bacteria 10124
1078 Ga0496124_0038717 3300048927 Bacteria 4138
1079 Ga0496124_0051693 3300048927 Bacteria 3494
1080 Ga0496124_0055125 3300048927 Bacteria 3361
1081 Ga0496124_0063559 3300048927 Bacteria 3083
1082 Ga0496125_0000011 3300048928 Bacteria 655895
1083 Ga0496125_0003109 3300048928 Bacteria 20660
1084 Ga0496125_0007345 3300048928 Bacteria 11735
1085 Ga0496125_0020259 3300048928 Bacteria 6245
1086 Ga0496125_0035345 3300048928 Bacteria 4385
1087 Ga0496125_0095438 3300048928 Bacteria 2212
1088 Ga0496125_0204583 3300048928 Bacteria 1288
1089 Ga0496125_0278086 3300048928 Bacteria 1039
1090 Ga0496126_0002232 3300048929 Bacteria 26785
1091 Ga0496126_0003420 3300048929 Bacteria 20038
1092 Ga0496126_0038550 3300048929 Bacteria 4445
1093 Ga0496126_0056077 3300048929 Bacteria 3563
1094 Ga0496126_0062435 3300048929 Bacteria 3343
1095 Ga0496126_0552921 3300048929 Bacteria 913
1096 Ga0466983_0920657 3300048986 Bacteria 507
1097 Ga0501306_018797 3300049127 Bacteria 948
1098 Ga0501306_091083 3300049127 Bacteria 536
1099 Ga0501306_093629 3300049127 Bacteria 531
1100 Ga0501308_000315 3300049128 Bacteria 2988
1101 Ga0501308_037032 3300049128 Bacteria 675
1102 Ga0501309_017424 3300049129 Bacteria 986
1103 Ga0501310_017772 3300049130 Bacteria 863
1104 Ga0501341_02833 3300049131 Bacteria 957
1105 Ga0501341_05638 3300049131 Bacteria 753
1106 Ga0501343_006326 3300049132 Bacteria 922
1107 Ga0501304_002330 3300049160 Bacteria 1310
1108 Ga0501304_024903 3300049160 Bacteria 611
1109 Ga0501305_003896 3300049161 Bacteria 1722
1110 Ga0501305_021623 3300049161 Bacteria 952
1111 Ga0501305_095814 3300049161 Bacteria 548
1112 Ga0501307_026574 3300049162 Bacteria 783
1113 Ga0501307_085034 3300049162 Bacteria 521
1114 Ga0495678_000004 3300049459 Bacteria 532920
1115 Ga0495678_043783 3300049459 Bacteria 1775
1116 Ga0495682_0019450 3300049460 Bacteria 2553
1117 Ga0495682_0086305 3300049460 Bacteria 1127
1118 Ga0501311_007961 3300049527 Bacteria 1231
1119 Ga0501312_028442 3300049528 Bacteria 867
1120 Ga0501312_033713 3300049528 Bacteria 813
1121 Ga0501312_087788 3300049528 Bacteria 570
1122 Ga0501313_009046 3300049529 Bacteria 1117
1123 Ga0501313_046959 3300049529 Bacteria 590
1124 Ga0501314_005186 3300049530 Bacteria 1103
1125 Ga0501314_030317 3300049530 Bacteria 599
1126 Ga0501315_002372 3300049531 Bacteria 1761
1127 Ga0501315_009861 3300049531 Bacteria 1137
1128 Ga0501315_037184 3300049531 Bacteria 724
1129 Ga0501315_052119 3300049531 Bacteria 645
1130 Ga0501315_088192 3300049531 Bacteria 535
1131 Ga0501316_038549 3300049532 Bacteria 660
1132 Ga0501316_076814 3300049532 Bacteria 512
1133 Ga0501317_056037 3300049533 Bacteria 637
1134 Ga0501317_101203 3300049533 Bacteria 520
1135 Ga0501318_043630 3300049534 Bacteria 649
1136 Ga0501319_000620 3300049535 Bacteria 1776
1137 Ga0501319_003465 3300049535 Bacteria 1056
1138 Ga0501319_017426 3300049535 Bacteria 623
1139 Ga0501320_001140 3300049536 Bacteria 1850
1140 Ga0501320_007226 3300049536 Bacteria 1063
1141 Ga0501320_020731 3300049536 Bacteria 759
1142 Ga0501321_025190 3300049537 Bacteria 766
1143 Ga0501323_000562 3300049539 Bacteria 2815
1144 Ga0501323_017412 3300049539 Bacteria 923
1145 Ga0501323_025630 3300049539 Bacteria 803
1146 Ga0501324_012443 3300049540 Bacteria 796
1147 Ga0501324_021515 3300049540 Bacteria 662
1148 Ga0501324_044802 3300049540 Bacteria 513
1149 Ga0501325_006584 3300049541 Bacteria 959
1150 Ga0501326_09348 3300049542 Bacteria 578
1151 Ga0501329_10738 3300049545 Bacteria 577
1152 Ga0501329_12003 3300049545 Bacteria 557
1153 Ga0501335_008825 3300049551 Bacteria 953
1154 Ga0501337_011731 3300049553 Bacteria 650
1155 Ga0501337_015195 3300049553 Bacteria 593
1156 Ga0501337_021820 3300049553 Bacteria 524
1157 Ga0501337_025092 3300049553 Bacteria 500
1158 Ga0501338_05164 3300049554 Bacteria 805
1159 Ga0501031_0322400 3300049568 Bacteria 1001
1160 Ga0501032_0166201 3300049569 Bacteria 1448
1161 Ga0501033_0000642 3300049570 Bacteria 32324
1162 Ga0501033_0087505 3300049570 Bacteria 2280
1163 Ga0501033_0638143 3300049570 Bacteria 728
1164 Ga0501034_0004519 3300049571 Bacteria 15470
1165 Ga0501034_0018858 3300049571 Bacteria 7070
1166 Ga0501034_0135557 3300049571 Bacteria 2443
1167 Ga0501034_0503757 3300049571 Bacteria 1124
1168 Ga0501034_0897898 3300049571 Bacteria 774
1169 Ga0501036_0002870 3300049572 Bacteria 13658
1170 Ga0501036_0529773 3300049572 Bacteria 979
1171 Ga0501037_0095024 3300049573 Bacteria 2155
1172 Ga0501037_0145797 3300049573 Bacteria 1693
1173 Ga0501037_0396915 3300049573 Bacteria 946
1174 Ga0501038_0019977 3300049574 Bacteria 6030
1175 Ga0501038_0099781 3300049574 Bacteria 2420
1176 Ga0501038_0614513 3300049574 Bacteria 821
1177 Ga0501038_0854985 3300049574 Bacteria 673
1178 Ga0501038_1316813 3300049574 Bacteria 521
1179 Ga0501039_0066082 3300049575 Bacteria 2807
1180 Ga0501041_0117973 3300049577 Bacteria 1648
1181 Ga0501042_0376229 3300049578 Bacteria 1028
1182 Ga0501043_0029837 3300049579 Bacteria 4284
1183 Ga0501043_0275446 3300049579 Bacteria 1291
1184 Ga0501043_0637405 3300049579 Bacteria 784
1185 Ga0501043_0651096 3300049579 Bacteria 774
1186 Ga0501046_0345873 3300049580 Bacteria 1080
1187 Ga0501047_0251848 3300049581 Bacteria 1614
1188 Ga0501048_0932869 3300049582 Bacteria 624
1189 Ga0501068_0001118 3300049584 Bacteria 14194
1190 Ga0501069_0786040 3300049585 Bacteria 576
1191 Ga0501070_0031743 3300049586 Bacteria 4426
1192 Ga0501071_0955919 3300049587 Bacteria 661
1193 Ga0501071_1339514 3300049587 Bacteria 553
1194 Ga0501072_0001234 3300049588 Bacteria 19087
1195 Ga0501073_0000651 3300049589 Bacteria 24370
1196 Ga0501074_0231440 3300049590 Bacteria 1315
1197 Ga0501076_0374926 3300049592 Bacteria 1169
1198 Ga0501077_0320333 3300049593 Bacteria 988
1199 Ga0501209_000078 3300049656 Bacteria 9704
1200 Ga0501233_198393 3300049668 Bacteria 583
1201 Ga0501235_034034 3300049669 Bacteria 1155
1202 Ga0501249_027340 3300049679 Bacteria 1262
1203 Ga0501080_0000604 3300049742 Bacteria 28440
1204 Ga0501080_0320684 3300049742 Bacteria 1403
1205 Ga0501081_0148790 3300049743 Bacteria 1681
1206 Ga0501081_0887637 3300049743 Bacteria 672
1207 Ga0501083_0259184 3300049744 Bacteria 1131
1208 Ga0501266_000163 3300049763 Bacteria 8551
1209 Ga0501268_075156 3300049765 Bacteria 689
1210 Ga0501035_0099514 3300049822 Bacteria 2552
1211 Ga0501044_0003646 3300049823 Bacteria 17332
1212 Ga0501044_0036229 3300049823 Bacteria 5162
1213 Ga0501044_0245047 3300049823 Bacteria 1735
1214 Ga0501044_0812045 3300049823 Bacteria 814
1215 Ga0501044_1223762 3300049823 Bacteria 618
1216 Ga0501045_0561509 3300049824 Bacteria 846
1217 nmdc:mga03683_220198_c1 3300050489 Bacteria 875
1218 nmdc:mga03683_31242_c1 3300050489 Bacteria 2135
1219 nmdc:mga03n38_530914_c1 3300050490 Bacteria 663
1220 nmdc:mga0yw44_598823_c1 3300050492 Bacteria 749
1221 nmdc:mga0k408_308126_c1 3300050493 Bacteria 945
1222 nmdc:mga0k408_607118_c1 3300050493 Bacteria 645
1223 nmdc:mga0k408_746819_c1 3300050493 Bacteria 572
1224 nmdc:mga0k408_86809_c1 3300050493 Bacteria 1837
1225 nmdc:mga0k408_940_c1 3300050493 Bacteria 15979
1226 nmdc:mga07m45_15021_c1 3300050496 Bacteria 4135
1227 nmdc:mga07m45_212810_c2 3300050496 Bacteria 776
1228 nmdc:mga07m45_729995_c1 3300050496 Bacteria 569
1229 nmdc:mga07m45_786307_c1 3300050496 Bacteria 546
1230 nmdc:mga05p37_1322380_c1 3300050507 Bacteria 733
1231 nmdc:mga09592_9523_c1 3300050508 Bacteria 7896
1232 nmdc:mga0qj67_286042_c1 3300050509 Bacteria 1336
1233 nmdc:mga08y16_1000_c1 3300050511 Bacteria 27606
1234 Ga0495655_0170877 3300053083 Bacteria 696
1235 Ga0500643_035180 3300053087 Bacteria 1504
1236 Ga0500644_0016047 3300053088 Bacteria 2150
1237 Ga0500646_0038494 3300053090 Bacteria 1339
1238 Ga0500562_001613 3300053108 Bacteria 5607
1239 Ga0500569_080694 3300053109 Bacteria 1040
1240 Ga0500594_0005237 3300053118 Bacteria 2873
1241 Ga0500618_000089 3300053125 Bacteria 74800
1242 Ga0500559_0046340 3300053136 Bacteria 1906
1243 Ga0500568_0338118 3300053139 Bacteria 546
1244 Ga0500616_0027216 3300053153 Bacteria 3158
1245 Ga0500622_0033857 3300053156 Bacteria 2679
1246 Ga0501084_0064611 3300054114 Bacteria 3062
1247 Ga0587084_006518 3300059477 Bacteria 1420
1248 Ga0587084_027678 3300059477 Bacteria 893
1249 Ga0587084_030888 3300059477 Bacteria 862
1250 Ga0587084_097968 3300059477 Bacteria 591
1251 Ga0587093_017438 3300059478 Bacteria 926
1252 Ga0587093_026237 3300059478 Bacteria 812
1253 Ga0587093_050875 3300059478 Bacteria 654
1254 Ga0587093_070061 3300059478 Bacteria 588
1255 Ga0587093_076702 3300059478 Bacteria 570
1256 Ga0587066_073682 3300059490 Bacteria 724
1257 Ga0587066_081599 3300059490 Bacteria 702
1258 Ga0587070_001925 3300059491 Bacteria 2258
1259 Ga0587070_003193 3300059491 Bacteria 1945
1260 Ga0587070_045376 3300059491 Bacteria 857
1261 Ga0587070_141909 3300059491 Bacteria 594
1262 Ga0587073_0014350 3300059492 Bacteria 1408
1263 Ga0587077_012119 3300059493 Bacteria 1371
1264 Ga0587077_122502 3300059493 Bacteria 650
1265 Ga0587077_144587 3300059493 Bacteria 616
1266 Ga0587080_024381 3300059503 Bacteria 1015
1267 Ga0587080_046836 3300059503 Bacteria 805
1268 Ga0587080_085853 3300059503 Bacteria 653
1269 Ga0587082_008841 3300059504 Bacteria 1416
1270 Ga0587083_0013579 3300059505 Bacteria 1389
1271 Ga0587083_0019354 3300059505 Bacteria 1242
1272 Ga0587083_0028806 3300059505 Bacteria 1090
1273 Ga0587083_0034614 3300059505 Bacteria 1026
1274 Ga0587083_0194068 3300059505 Bacteria 576
1275 Ga0587083_0269335 3300059505 Bacteria 514
1276 Ga0587085_009816 3300059506 Bacteria 1256
1277 Ga0587085_032916 3300059506 Bacteria 863
1278 Ga0587085_060002 3300059506 Bacteria 717
1279 Ga0587085_108120 3300059506 Bacteria 596
1280 Ga0587085_149440 3300059506 Bacteria 537
1281 Ga0587086_008158 3300059507 Bacteria 1218
1282 Ga0587086_021317 3300059507 Bacteria 887
1283 Ga0587086_033214 3300059507 Bacteria 769
1284 Ga0587086_048555 3300059507 Bacteria 678
1285 Ga0587088_000882 3300059508 Bacteria 2840
1286 Ga0587088_006968 3300059508 Bacteria 1545
1287 Ga0587088_030437 3300059508 Bacteria 961
1288 Ga0587088_045517 3300059508 Bacteria 842
1289 Ga0587088_167628 3300059508 Bacteria 542
1290 Ga0587089_007933 3300059509 Bacteria 1271
1291 Ga0587090_003231 3300059510 Bacteria 1876
1292 Ga0587090_009257 3300059510 Bacteria 1340
1293 Ga0587090_012737 3300059510 Bacteria 1204
1294 Ga0587090_065885 3300059510 Bacteria 697
1295 Ga0587090_164428 3300059510 Bacteria 511
1296 Ga0587091_010895 3300059511 Bacteria 1404
1297 Ga0587091_070940 3300059511 Bacteria 762
1298 Ga0587091_219763 3300059511 Bacteria 519
1299 Ga0587092_088939 3300059512 Bacteria 621
1300 Ga0587094_000788 3300059513 Bacteria 2716
1301 Ga0587094_066580 3300059513 Bacteria 641
1302 Ga0587094_085313 3300059513 Bacteria 590
1303 Ga0587095_014951 3300059514 Bacteria 699
1304 Ga0587097_04718 3300059603 Bacteria 622
1305 Ga0587098_003422 3300059604 Bacteria 1426
1306 Ga0587098_027475 3300059604 Bacteria 764
1307 Ga0587098_064646 3300059604 Bacteria 581
1308 Ga0587106_004918 3300059605 Bacteria 1499
1309 Ga0587106_022386 3300059605 Bacteria 949
1310 Ga0587106_109047 3300059605 Bacteria 574
1311 Ga0587099_009695 3300059622 Bacteria 950
1312 Ga0587101_005345 3300059623 Bacteria 1421
1313 Ga0587101_010389 3300059623 Bacteria 1168
1314 Ga0587101_064865 3300059623 Bacteria 660
1315 Ga0587101_092923 3300059623 Bacteria 589
1316 Ga0587109_013974 3300059624 Bacteria 1340
1317 Ga0587109_037677 3300059624 Bacteria 946
1318 Ga0587109_090453 3300059624 Bacteria 690
1319 Ga0587113_040128 3300059625 Bacteria 558
1320 Ga0587117_012462 3300059627 Bacteria 1073
1321 Ga0587117_068196 3300059627 Bacteria 625
1322 Ga0587117_106426 3300059627 Bacteria 541
1323 Ga0587122_039863 3300059628 Bacteria 581
1324 Ga0587128_006927 3300059630 Bacteria 1414
1325 Ga0587128_047518 3300059630 Bacteria 773
1326 Ga0587128_068546 3300059630 Bacteria 686
1327 Ga0587062_029227 3300059639 Bacteria 834
1328 Ga0587062_090492 3300059639 Bacteria 582
1329 Ga0587067_001455 3300059640 Bacteria 2566
1330 Ga0587067_091754 3300059640 Bacteria 689
1331 Ga0587068_009221 3300059641 Bacteria 1447
1332 Ga0587068_019527 3300059641 Bacteria 1100
1333 Ga0587068_025175 3300059641 Bacteria 1000
1334 Ga0587068_080168 3300059641 Bacteria 658
1335 Ga0587068_160640 3300059641 Bacteria 514
1336 Ga0587069_007418 3300059642 Bacteria 1354
1337 Ga0587069_012315 3300059642 Bacteria 1158
1338 Ga0587069_115643 3300059642 Bacteria 563
1339 Ga0587072_000318 3300059643 Bacteria 4543
1340 Ga0587072_015319 3300059643 Bacteria 1301
1341 Ga0587075_006769 3300059644 Bacteria 1418
1342 Ga0587075_007812 3300059644 Bacteria 1352
1343 Ga0587075_120187 3300059644 Bacteria 543
1344 Ga0587075_129184 3300059644 Bacteria 530
1345 Ga0587076_001018 3300059645 Bacteria 2692
1346 Ga0587076_053980 3300059645 Bacteria 792
1347 Ga0587076_096236 3300059645 Bacteria 655
1348 Ga0587076_154540 3300059645 Bacteria 559
1349 Ga0587078_004582 3300059646 Bacteria 1447
1350 Ga0587078_005901 3300059646 Bacteria 1318
1351 Ga0587078_025270 3300059646 Bacteria 774
1352 Ga0587078_038185 3300059646 Bacteria 671
1353 Ga0587079_005815 3300059647 Bacteria 1764
1354 Ga0587079_008433 3300059647 Bacteria 1576
1355 Ga0587079_040050 3300059647 Bacteria 942
1356 Ga0587079_250102 3300059647 Bacteria 504
1357 Ga0587100_015477 3300059648 Bacteria 699
1358 Ga0587102_002623 3300059649 Bacteria 1407
1359 Ga0587102_003037 3300059649 Bacteria 1341
1360 Ga0587104_000990 3300059650 Bacteria 1402
1361 Ga0587105_008812 3300059651 Bacteria 739
1362 Ga0587105_014206 3300059651 Bacteria 642
1363 Ga0587107_050553 3300059652 Bacteria 703
1364 Ga0587108_004500 3300059653 Bacteria 1023
1365 Ga0587108_007881 3300059653 Bacteria 853
1366 Ga0587110_017285 3300059654 Bacteria 788
1367 Ga0587118_25462 3300059657 Bacteria 505
1368 Ga0587120_011487 3300059659 Bacteria 762
1369 Ga0587124_001169 3300059660 Bacteria 1654
1370 Ga0587124_024105 3300059660 Bacteria 639
1371 Ga0587071_013457 3300060344 Bacteria 1410
1372 Ga0587071_069557 3300060344 Bacteria 764
1373 Ga0587071_086867 3300060344 Bacteria 705
1374 Ga0587071_161341 3300060344 Bacteria 564
1375 Ga0587071_222899 3300060344 Bacteria 502
1376 Ga0587111_0005708 3300060346 Bacteria 1936
1377 Ga0587111_0015287 3300060346 Bacteria 1401
1378 Ga0587111_0023929 3300060346 Bacteria 1198
1379 Ga0587111_0035749 3300060346 Bacteria 1037
1380 Ga0587111_0108202 3300060346 Bacteria 701
1381 Ga0587111_0129360 3300060346 Bacteria 658
1382 Ga0587111_0222049 3300060346 Bacteria 546
1383 Ga0501082_0403934 3300060353 Bacteria 1192
1384 Ga0501082_0726448 3300060353 Bacteria 869
1385 Ga0466962_0018616 3300061719 Bacteria 3340
1386 Ga0466962_0019466 3300061719 Bacteria 3262
1387 Ga0466962_0133377 3300061719 Bacteria 1201
1388 Ga0466962_0174343 3300061719 Bacteria 1048
1389 Ga0466962_0342271 3300061719 Bacteria 744
1390 Ga0530510_0782690 3300061734 Bacteria 728

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2511231003 2511250639 55
2 iso_pu_bacteria 2511231026 2511384947 55
3 iso_pu_bacteria 2521172590 2521557885 55
4 iso_pu_bacteria 2547132374 2548499938 55
5 iso_pu_bacteria 2548876994 2550693924 55
6 iso_pu_bacteria 2551306416 2553003008 55
7 iso_pu_bacteria 2600255292 2601667669 55
8 iso_pu_bacteria 2643221554 2643786927 55
9 iso_pu_bacteria 2643221556 2643802363 55
10 iso_pu_bacteria 2643221570 2643868168 55
11 iso_pu_bacteria 2643221596 2643993837 55
12 iso_pu_bacteria 2643221609 2644059731 55
13 iso_pu_bacteria 2643221611 2644074874 55
14 iso_pu_bacteria 2643221638 2644215984 55
15 iso_pu_bacteria 2643221645 2644254474 55
16 iso_pu_bacteria 2643221652 2644293775 55
17 iso_pu_bacteria 2643221664 2644357861 55
18 iso_pu_bacteria 2643221684 2644475876 55
19 iso_pu_bacteria 2643221717 2644644744 55
20 iso_pu_bacteria 2738541280 2738741281 55
21 iso_pu_bacteria 2738541297 2738829178 55
22 iso_pu_bacteria 2738541300 2738845750 55
23 iso_pu_bacteria 2738541357 2739152974 55
24 iso_pu_bacteria 2738543003 2739194894 55
25 iso_pu_bacteria 2738543012 2739241259 55
26 iso_pu_bacteria 2738543013 2739248155 55
27 iso_pu_bacteria 2738543018 2739277558 55
28 iso_pu_bacteria 2738543026 2739321370 55
29 iso_pu_bacteria 2738543029 2739340074 55
30 iso_pu_bacteria 2738543030 2739346519 55
31 iso_pu_bacteria 2765235838 2765569006 55
32 iso_pu_bacteria 2808606386 2808984486 55
33 iso_pu_bacteria 2808606415 2809131213 55
34 iso_pu_bacteria 2808606418 2809145415 55
35 iso_pu_bacteria 2808606419 2809150452 55
36 iso_pu_bacteria 2816332133 2816473425 55
37 iso_pu_bacteria 2818991436 2819542546 55
38 iso_pu_bacteria 2818991445 2819591174 55
39 iso_pu_bacteria 2818991449 2819614974 55
40 iso_pu_bacteria 2839094727 2839096109 55
41 iso_pu_bacteria 2842711865 2842717744 55
42 iso_pu_bacteria 2842718218 2842721370 55
43 iso_pu_bacteria 2842733646 2842734294 55
44 iso_pu_bacteria 2842747753 2842749455 55
45 iso_pu_bacteria 2852618963 2852621968 55
46 iso_pu_bacteria 2857547612 2857550304 55
47 iso_pu_bacteria 2857553236 2857554476 55
48 iso_pu_bacteria 2857558681 2857559445 55
49 iso_pu_bacteria 2857564685 2857564717 55
50 iso_pu_bacteria 2881101125 2881105478 55
51 iso_pu_bacteria 2884811622 2884812292 55
52 iso_pu_bacteria 2884836552 2884836899 55
53 iso_pu_bacteria 2884852848 2884853190 55
54 iso_pu_bacteria 2885080285 2885085396 55
55 iso_pu_bacteria 2885192300 2885197881 55
56 iso_pu_bacteria 2894023352 2894026947 55
57 iso_pu_bacteria 2896154374 2896155692 55
58 iso_pu_bacteria 2904424332 2904425976 55
59 iso_pu_bacteria 2904439833 2904441349 55
60 iso_pu_bacteria 2904530477 2904531711 55
61 iso_pu_bacteria 2904541872 2904544513 55
62 iso_pu_bacteria 2904584206 2904588064 55
63 iso_pu_bacteria 2904589729 2904589776 55
64 iso_pu_bacteria 2904601388 2904602838 55
65 iso_pu_bacteria 2919046199 2919046347 55
66 iso_pu_bacteria 2919079590 2919079658 55
67 iso_pu_bacteria 2919476304 2919478420 55
68 iso_pu_bacteria 2919704043 2919707237 55
69 iso_pu_bacteria 2923510766 2923511117 55
70 iso_pu_bacteria 2928115317 2928115670 55
71 iso_pu_bacteria 2928130867 2928131053 55
72 iso_pu_bacteria 2929160207 2929161917 55
73 iso_pu_bacteria 2932410948 2932411274 55
74 iso_pu_bacteria 2932416698 2932419159 55
75 iso_pu_bacteria 2932422444 2932423744 55
76 iso_pu_bacteria 2939631187 2939632643 55
77 iso_pu_bacteria 2990710928 2990713472 55
78 iso_pu_bacteria 8047673197 8047673774 55
79 3300031665 Ga0316575_10002655 Ga0316575_100026556 58
80 3300031665 Ga0316575_10138864 Ga0316575_101388642 58
81 3300031691 Ga0316579_10000223 Ga0316579_1000022313 58
82 3300031691 Ga0316579_10003497 Ga0316579_100034972 58
83 3300031691 Ga0316579_10014597 Ga0316579_100145973 58
84 3300031691 Ga0316579_10241042 Ga0316579_102410422 58
85 3300031727 Ga0316576_10013047 Ga0316576_100130474 58
86 3300031727 Ga0316576_10023215 Ga0316576_100232154 58
87 3300031727 Ga0316576_10216585 Ga0316576_102165853 58
88 3300031727 Ga0316576_10293236 Ga0316576_102932362 58
89 3300031727 Ga0316576_11014721 Ga0316576_110147212 58
90 3300031728 Ga0316578_10008120 Ga0316578_100081202 58
91 3300031728 Ga0316578_10020537 Ga0316578_100205372 58
92 3300031728 Ga0316578_10074386 Ga0316578_100743863 58
93 3300031728 Ga0316578_10190161 Ga0316578_101901612 58
94 3300031728 Ga0316578_10311552 Ga0316578_103115522 58
95 3300031728 Ga0316578_10437514 Ga0316578_104375141 58
96 3300031728 Ga0316578_10929235 Ga0316578_109292352 58
97 3300031733 Ga0316577_10038905 Ga0316577_100389054 58
98 3300031733 Ga0316577_10094394 Ga0316577_100943942 58
99 3300031733 Ga0316577_10195069 Ga0316577_101950692 58
100 3300031733 Ga0316577_10198272 Ga0316577_101982721 58
101 3300032133 Ga0316583_10007592 Ga0316583_100075922 58
102 3300032133 Ga0316583_10015794 Ga0316583_100157943 58
103 3300032133 Ga0316583_10141379 Ga0316583_101413791 58
104 3300032133 Ga0316583_10359814 Ga0316583_103598141 58
105 3300032137 Ga0316585_10001492 Ga0316585_100014923 58
106 3300032137 Ga0316585_10002042 Ga0316585_100020426 58
107 3300032139 Ga0316580_10002575 Ga0316580_100025753 58
108 3300032139 Ga0316580_10010682 Ga0316580_100106824 58
109 3300032139 Ga0316580_10115613 Ga0316580_101156132 58
110 3300032168 Ga0316593_10000184 Ga0316593_100001842 58
111 3300032168 Ga0316593_10000461 Ga0316593_100004613 58
112 3300032168 Ga0316593_10000850 Ga0316593_100008503 58
113 3300032168 Ga0316593_10000905 Ga0316593_100009052 58
114 3300032168 Ga0316593_10015927 Ga0316593_100159272 58
115 3300032168 Ga0316593_10018048 Ga0316593_100180483 58
116 3300032168 Ga0316593_10023063 Ga0316593_100230631 58
117 3300032168 Ga0316593_10040179 Ga0316593_100401792 58
118 3300032168 Ga0316593_10074693 Ga0316593_100746932 58
119 3300032168 Ga0316593_10085717 Ga0316593_100857172 58
120 3300032168 Ga0316593_10124271 Ga0316593_101242712 58
121 3300032168 Ga0316593_10124809 Ga0316593_101248092 58
122 3300032168 Ga0316593_10161438 Ga0316593_101614382 58
123 3300032168 Ga0316593_10182502 Ga0316593_101825021 58
124 3300032168 Ga0316593_10242096 Ga0316593_102420961 58
125 3300032168 Ga0316593_10246253 Ga0316593_102462531 58
126 3300032168 Ga0316593_10281050 Ga0316593_102810502 58
127 3300032168 Ga0316593_10337121 Ga0316593_103371211 58
128 3300033524 Ga0316592_1000418 Ga0316592_10004187 58
129 3300033524 Ga0316592_1000834 Ga0316592_10008346 58
130 3300033524 Ga0316592_1001455 Ga0316592_10014554 58
131 3300033524 Ga0316592_1002172 Ga0316592_10021722 58
132 3300033524 Ga0316592_1005091 Ga0316592_10050913 58
133 3300033524 Ga0316592_1007741 Ga0316592_10077412 58
134 3300033524 Ga0316592_1008452 Ga0316592_10084522 58
135 3300033524 Ga0316592_1027020 Ga0316592_10270202 58
136 3300033524 Ga0316592_1056001 Ga0316592_10560012 58
137 3300033524 Ga0316592_1057814 Ga0316592_10578142 58
138 3300033524 Ga0316592_1075825 Ga0316592_10758251 58
139 3300033527 Ga0316586_1002586 Ga0316586_10025863 58
140 3300033527 Ga0316586_1004157 Ga0316586_10041572 58
141 3300033527 Ga0316586_1048671 Ga0316586_10486711 58
142 3300033527 Ga0316586_1103135 Ga0316586_11031352 58
143 3300033528 Ga0316588_1000358 Ga0316588_10003587 58
144 3300033528 Ga0316588_1000978 Ga0316588_10009785 58
145 3300033528 Ga0316588_1003991 Ga0316588_10039913 58
146 3300033528 Ga0316588_1021263 Ga0316588_10212632 58
147 3300033528 Ga0316588_1042135 Ga0316588_10421352 58
148 3300033528 Ga0316588_1052481 Ga0316588_10524812 58
149 3300033528 Ga0316588_1059017 Ga0316588_10590172 58
150 3300033528 Ga0316588_1077066 Ga0316588_10770662 58
151 3300033528 Ga0316588_1090112 Ga0316588_10901121 58
152 3300033529 Ga0316587_1000327 Ga0316587_10003276 58
153 3300033529 Ga0316587_1001516 Ga0316587_10015162 58
154 3300033529 Ga0316587_1002276 Ga0316587_10022763 58
155 3300033529 Ga0316587_1009238 Ga0316587_10092382 58
156 3300033529 Ga0316587_1010565 Ga0316587_10105652 58
157 3300033529 Ga0316587_1036032 Ga0316587_10360321 58
158 3300033529 Ga0316587_1036410 Ga0316587_10364101 58
159 3300033541 Ga0316596_1000420 Ga0316596_10004202 58
160 3300033541 Ga0316596_1001044 Ga0316596_10010446 58
161 3300033541 Ga0316596_1004668 Ga0316596_10046682 58
162 3300033541 Ga0316596_1009739 Ga0316596_10097393 58
163 3300033541 Ga0316596_1019773 Ga0316596_10197732 58
164 3300033541 Ga0316596_1027444 Ga0316596_10274442 58
165 3300033541 Ga0316596_1036210 Ga0316596_10362102 58
166 3300033541 Ga0316596_1047590 Ga0316596_10475902 58
167 3300033541 Ga0316596_1072695 Ga0316596_10726951 58
168 3300033541 Ga0316596_1113804 Ga0316596_11138042 58
169 3300033541 Ga0316596_1176816 Ga0316596_11768162 58
170 3300033541 Ga0316596_1231771 Ga0316596_12317712 58
171 3300035398 Ga0316574_0305564 Ga0316574_0305564_414_590 58
172 3300035398 Ga0316574_0361910 Ga0316574_0361910_79_255 58
173 3300035398 Ga0316574_0569701 Ga0316574_0569701_347_523 58
174 3300036647 Ga0316582_0032685 Ga0316582_0032685_619_795 58
175 3300036647 Ga0316582_0047897 Ga0316582_0047897_1481_1657 58
176 3300036647 Ga0316582_0105863 Ga0316582_0105863_1533_1709 58
177 3300036647 Ga0316582_0325154 Ga0316582_0325154_235_411 58
178 3300036647 Ga0316582_0554367 Ga0316582_0554367_116_292 58
179 3300036712 Ga0316584_0014853 Ga0316584_0014853_4030_4206 58
180 3300036712 Ga0316584_0198220 Ga0316584_0198220_344_520 58
181 3300036712 Ga0316584_0314431 Ga0316584_0314431_636_812 58
182 3300036712 Ga0316584_0381218 Ga0316584_0381218_654_830 58
183 3300037588 Ga0316581_0001281 Ga0316581_0001281_538_714 58
184 3300001979 JGI24740J21852_10000462 JGI24740J21852_100004628 59
185 3300001979 JGI24740J21852_10000722 JGI24740J21852_100007221 59
186 3300001979 JGI24740J21852_10001385 JGI24740J21852_100013853 59
187 3300001979 JGI24740J21852_10020567 JGI24740J21852_100205673 59
188 3300001979 JGI24740J21852_10124610 JGI24740J21852_101246102 59
189 3300001989 JGI24739J22299_10017122 JGI24739J22299_100171222 59
190 3300001989 JGI24739J22299_10055368 JGI24739J22299_100553682 59
191 3300001989 JGI24739J22299_10151185 JGI24739J22299_101511852 59
192 3300001990 JGI24737J22298_10028137 JGI24737J22298_100281373 59
193 3300001990 JGI24737J22298_10032661 JGI24737J22298_100326612 59
194 3300001990 JGI24737J22298_10044667 JGI24737J22298_100446672 59
195 3300002067 JGI24735J21928_10000381 JGI24735J21928_1000038111 59
196 3300002067 JGI24735J21928_10002924 JGI24735J21928_100029248 59
197 3300002067 JGI24735J21928_10012808 JGI24735J21928_100128083 59
198 3300002075 JGI24738J21930_10002568 JGI24738J21930_100025685 59
199 3300002075 JGI24738J21930_10060147 JGI24738J21930_100601472 59
200 3300002705 JGI25156J39149_1007106 JGI25156J39149_10071061 59
201 3300002705 JGI25156J39149_1011215 JGI25156J39149_10112152 59
202 3300002705 JGI25156J39149_1014217 JGI25156J39149_10142171 59
203 3300002705 JGI25156J39149_1019256 JGI25156J39149_10192562 59
204 3300002738 JGI25154J39366_1000446 JGI25154J39366_100044612 59
205 3300002741 JGI25157J39369_1017322 JGI25157J39369_10173222 59
206 3300002741 JGI25157J39369_1024694 JGI25157J39369_10246942 59
207 3300002772 JGI25164J39214_1010585 JGI25164J39214_10105852 59
208 3300003161 Ga0006765J45826_106676 Ga0006765J45826_1066762 59
209 3300003162 Ga0006778J45830_1030621 Ga0006778J45830_10306212 59
210 3300003163 Ga0006759J45824_1026941 Ga0006759J45824_10269411 59
211 3300003163 Ga0006759J45824_1033546 Ga0006759J45824_10335462 59
212 3300003163 Ga0006759J45824_1058067 Ga0006759J45824_10580671 59
213 3300003163 Ga0006759J45824_1063513 Ga0006759J45824_10635132 59
214 3300003163 Ga0006759J45824_1065469 Ga0006759J45824_10654691 59
215 3300003214 JGI25165J46597_1002385 JGI25165J46597_10023855 59
216 3300003300 Ga0006758J48902_1015910 Ga0006758J48902_10159102 59
217 3300003300 Ga0006758J48902_1018924 Ga0006758J48902_10189241 59
218 3300003305 Ga0006770J48903_1010498 Ga0006770J48903_10104981 59
219 3300003305 Ga0006770J48903_1025987 Ga0006770J48903_10259872 59
220 3300003308 Ga0006777J48905_1019728 Ga0006777J48905_10197282 59
221 3300003320 rootH2_10009142 rootH2_100091424 59
222 3300003320 rootH2_10030882 rootH2_100308822 59
223 3300003322 rootL2_10004981 rootL2_1000498123 59
224 3300003322 rootL2_10014064 rootL2_100140649 59
225 3300003354 JGI25160J50197_1067253 JGI25160J50197_10672532 59
226 3300003479 Ga0006556J51387_1019267 Ga0006556J51387_10192672 59
227 3300003479 Ga0006556J51387_1025420 Ga0006556J51387_10254202 59
228 3300003544 Ga0007417J51691_1002769 Ga0007417J51691_10027692 59
229 3300003544 Ga0007417J51691_1029679 Ga0007417J51691_10296792 59
230 3300003565 Ga0006560J51390_1014813 Ga0006560J51390_10148132 59
231 3300003565 Ga0006560J51390_1028592 Ga0006560J51390_10285921 59
232 3300003567 Ga0006554J51385_1021491 Ga0006554J51385_10214912 59
233 3300003567 Ga0006554J51385_1029024 Ga0006554J51385_10290241 59
234 3300003574 Ga0007410J51695_1002724 Ga0007410J51695_10027242 59
235 3300003575 Ga0007409J51694_1016976 Ga0007409J51694_10169761 59
236 3300003577 Ga0007416J51690_1016876 Ga0007416J51690_10168761 59
237 3300003577 Ga0007416J51690_1030315 Ga0007416J51690_10303152 59
238 3300003578 Ga0006562J51391_1028115 Ga0006562J51391_10281152 59
239 3300003579 Ga0007429J51699_1022603 Ga0007429J51699_10226032 59
240 3300003613 Ga0007415J51800_106685 Ga0007415J51800_1066852 59
241 3300003735 Ga0006780_1025422 Ga0006780_10254221 59
242 3300003752 Ga0055539_1000034 Ga0055539_1000034137 59
243 3300003756 Ga0055533_1006004 Ga0055533_10060041 59
244 3300003756 Ga0055533_1007436 Ga0055533_10074361 59
245 3300003756 Ga0055533_1008546 Ga0055533_10085461 59
246 3300003756 Ga0055533_1015348 Ga0055533_10153482 59
247 3300003758 Ga0055532_1000002 Ga0055532_1000002276 59
248 3300003758 Ga0055532_1000039 Ga0055532_100003963 59
249 3300003758 Ga0055532_1011346 Ga0055532_10113462 59
250 3300003759 Ga0055525_1000538 Ga0055525_100053820 59
251 3300003760 Ga0055527_1000024 Ga0055527_100002463 59
252 3300003760 Ga0055527_1001254 Ga0055527_10012548 59
253 3300003761 Ga0055535_1000028 Ga0055535_100002863 59
254 3300003761 Ga0055535_1031885 Ga0055535_10318851 59
255 3300003762 Ga0055542_1000047 Ga0055542_1000047123 59
256 3300003762 Ga0055542_1003250 Ga0055542_10032505 59
257 3300003763 Ga0055529_1000028 Ga0055529_1000028118 59
258 3300003763 Ga0055529_1000054 Ga0055529_100005463 59
259 3300003763 Ga0055529_1000146 Ga0055529_100014697 59
260 3300003775 Ga0055524_1001224 Ga0055524_10012246 59
261 3300003775 Ga0055524_1002725 Ga0055524_10027254 59
262 3300003790 Ga0055528_1002393 Ga0055528_100239310 59
263 3300003791 Ga0055530_10050039 Ga0055530_100500391 59
264 3300003792 Ga0055540_1020093 Ga0055540_10200932 59
265 3300003794 Ga0055531_10001660 Ga0055531_100016605 59
266 3300003794 Ga0055531_10001947 Ga0055531_1000194715 59
267 3300003794 Ga0055531_10005441 Ga0055531_100054415 59
268 3300003841 Ga0055541_1000217 Ga0055541_100021727 59
269 3300003841 Ga0055541_1000861 Ga0055541_10008612 59
270 3300003841 Ga0055541_1018901 Ga0055541_10189012 59
271 3300003856 Ga0058692_1006669 Ga0058692_10066692 59
272 3300003856 Ga0058692_1049135 Ga0058692_10491352 59
273 3300003856 Ga0058692_1068129 Ga0058692_10681292 59
274 3300005288 Ga0065714_10046912 Ga0065714_100469121 59
275 3300005288 Ga0065714_10084786 Ga0065714_100847862 59
276 3300005288 Ga0065714_10224958 Ga0065714_102249582 59
277 3300005288 Ga0065714_10261913 Ga0065714_102619132 59
278 3300005289 Ga0065704_10348879 Ga0065704_103488792 59
279 3300005289 Ga0065704_10520996 Ga0065704_105209962 59
280 3300005293 Ga0065715_10040010 Ga0065715_100400102 59
281 3300005293 Ga0065715_10110556 Ga0065715_101105561 59
282 3300005327 Ga0070658_10177134 Ga0070658_101771342 59
283 3300005327 Ga0070658_10389801 Ga0070658_103898012 59
284 3300005327 Ga0070658_10753222 Ga0070658_107532222 59
285 3300005329 Ga0070683_101927808 Ga0070683_1019278082 59
286 3300005335 Ga0070666_11279761 Ga0070666_112797612 59
287 3300005336 Ga0070680_100791418 Ga0070680_1007914182 59
288 3300005337 Ga0070682_100987440 Ga0070682_1009874402 59
289 3300005339 Ga0070660_100000010 Ga0070660_10000001015 59
290 3300005339 Ga0070660_100277925 Ga0070660_1002779252 59
291 3300005344 Ga0070661_100000013 Ga0070661_100000013133 59
292 3300005344 Ga0070661_100093227 Ga0070661_1000932271 59
293 3300005345 Ga0070692_10499228 Ga0070692_104992281 59
294 3300005355 Ga0070671_101298003 Ga0070671_1012980031 59
295 3300005364 Ga0070673_100951645 Ga0070673_1009516452 59
296 3300005366 Ga0070659_100000167 Ga0070659_10000016733 59
297 3300005366 Ga0070659_100004951 Ga0070659_1000049518 59
298 3300005367 Ga0070667_102343612 Ga0070667_1023436121 59
299 3300005434 Ga0070709_11745908 Ga0070709_117459081 59
300 3300005435 Ga0070714_101981311 Ga0070714_1019813111 59
301 3300005441 Ga0070700_100022541 Ga0070700_1000225412 59
302 3300005444 Ga0070694_100115522 Ga0070694_1001155222 59
303 3300005455 Ga0070663_100000006 Ga0070663_10000000634 59
304 3300005455 Ga0070663_100000789 Ga0070663_10000078912 59
305 3300005455 Ga0070663_100209120 Ga0070663_1002091202 59
306 3300005455 Ga0070663_100220504 Ga0070663_1002205042 59
307 3300005456 Ga0070678_100250848 Ga0070678_1002508482 59
308 3300005459 Ga0068867_100011280 Ga0068867_1000112809 59
309 3300005471 Ga0070698_100022508 Ga0070698_1000225088 59
310 3300005535 Ga0070684_100112388 Ga0070684_1001123884 59
311 3300005548 Ga0070665_100152074 Ga0070665_1001520742 59
312 3300005563 Ga0068855_100200821 Ga0068855_1002008212 59
313 3300005563 Ga0068855_100647388 Ga0068855_1006473882 59
314 3300005564 Ga0070664_100000002 Ga0070664_100000002231 59
315 3300005564 Ga0070664_100289682 Ga0070664_1002896822 59
316 3300005564 Ga0070664_100694083 Ga0070664_1006940832 59
317 3300005577 Ga0068857_100091892 Ga0068857_1000918922 59
318 3300005578 Ga0068854_100000004 Ga0068854_10000000433 59
319 3300005614 Ga0068856_100000294 Ga0068856_10000029419 59
320 3300005614 Ga0068856_100347853 Ga0068856_1003478533 59
321 3300005614 Ga0068856_101857231 Ga0068856_1018572312 59
322 3300005616 Ga0068852_100017069 Ga0068852_1000170693 59
323 3300005616 Ga0068852_100450436 Ga0068852_1004504362 59
324 3300005616 Ga0068852_101568641 Ga0068852_1015686411 59
325 3300005616 Ga0068852_102763728 Ga0068852_1027637282 59
326 3300005617 Ga0068859_100874285 Ga0068859_1008742852 59
327 3300005617 Ga0068859_101526719 Ga0068859_1015267192 59
328 3300005617 Ga0068859_101745050 Ga0068859_1017450501 59
329 3300005834 Ga0068851_10139601 Ga0068851_101396012 59
330 3300005841 Ga0068863_101657777 Ga0068863_1016577772 59
331 3300005842 Ga0068858_100069756 Ga0068858_1000697563 59
332 3300006028 Ga0070717_10256184 Ga0070717_102561842 59
333 3300006038 Ga0075365_10253105 Ga0075365_102531052 59
334 3300006177 Ga0075362_10061866 Ga0075362_100618663 59
335 3300006177 Ga0075362_10092280 Ga0075362_100922802 59
336 3300006178 Ga0075367_10596582 Ga0075367_105965822 59
337 3300006195 Ga0075366_10000297 Ga0075366_1000029714 59
338 3300006195 Ga0075366_10004967 Ga0075366_100049672 59
339 3300006195 Ga0075366_10153481 Ga0075366_101534811 59
340 3300006195 Ga0075366_10353437 Ga0075366_103534372 59
341 3300006353 Ga0075370_10004264 Ga0075370_100042648 59
342 3300006353 Ga0075370_10061586 Ga0075370_100615862 59
343 3300006353 Ga0075370_10073600 Ga0075370_100736001 59
344 3300006353 Ga0075370_10509261 Ga0075370_105092612 59
345 3300006844 Ga0075428_100001491 Ga0075428_10000149123 59
346 3300006846 Ga0075430_100351694 Ga0075430_1003516942 59
347 3300006880 Ga0075429_100019402 Ga0075429_1000194023 59
348 3300006931 Ga0097620_100874141 Ga0097620_1008741412 59
349 3300006931 Ga0097620_101526693 Ga0097620_1015266932 59
350 3300006931 Ga0097620_101745101 Ga0097620_1017451012 59
351 3300006944 Ga0099823_1000021 Ga0099823_100002162 59
352 3300006946 Ga0079104_1004712 Ga0079104_10047126 59
353 3300009011 Ga0105251_10000285 Ga0105251_1000028555 59
354 3300009011 Ga0105251_10011588 Ga0105251_100115881 59
355 3300009036 Ga0105244_10002843 Ga0105244_100028434 59
356 3300009036 Ga0105244_10077568 Ga0105244_100775682 59
357 3300009092 Ga0105250_10023278 Ga0105250_100232782 59
358 3300009093 Ga0105240_10039709 Ga0105240_100397098 59
359 3300009093 Ga0105240_10044017 Ga0105240_100440172 59
360 3300009093 Ga0105240_10196897 Ga0105240_101968972 59
361 3300009093 Ga0105240_10285562 Ga0105240_102855622 59
362 3300009093 Ga0105240_10659582 Ga0105240_106595821 59
363 3300009093 Ga0105240_12582466 Ga0105240_125824661 59
364 3300009098 Ga0105245_12487278 Ga0105245_124872781 59
365 3300009101 Ga0105247_11032429 Ga0105247_110324292 59
366 3300009101 Ga0105247_11474049 Ga0105247_114740491 59
367 3300009147 Ga0114129_10469325 Ga0114129_104693253 59
368 3300009148 Ga0105243_10394151 Ga0105243_103941512 59
369 3300009174 Ga0105241_10242416 Ga0105241_102424162 59
370 3300009174 Ga0105241_10587920 Ga0105241_105879201 59
371 3300009174 Ga0105241_12254420 Ga0105241_122544201 59
372 3300009176 Ga0105242_11453379 Ga0105242_114533792 59
373 3300009545 Ga0105237_10076033 Ga0105237_100760333 59
374 3300009545 Ga0105237_10578021 Ga0105237_105780212 59
375 3300009551 Ga0105238_10003306 Ga0105238_1000330615 59
376 3300009551 Ga0105238_10141523 Ga0105238_101415232 59
377 3300009551 Ga0105238_11015730 Ga0105238_110157302 59
378 3300009551 Ga0105238_11444304 Ga0105238_114443042 59
379 3300010375 Ga0105239_10005044 Ga0105239_100050444 59
380 3300010375 Ga0105239_10450556 Ga0105239_104505563 59
381 3300010375 Ga0105239_11392114 Ga0105239_113921142 59
382 3300011119 Ga0105246_10058772 Ga0105246_100587723 59
383 3300011119 Ga0105246_10721267 Ga0105246_107212672 59
384 3300012475 Ga0157317_1006171 Ga0157317_10061712 59
385 3300012497 Ga0157319_1000027 Ga0157319_100002746 59
386 3300013100 Ga0157373_10020184 Ga0157373_100201843 59
387 3300013102 Ga0157371_10000123 Ga0157371_10000123112 59
388 3300013102 Ga0157371_10076165 Ga0157371_100761652 59
389 3300013102 Ga0157371_10096288 Ga0157371_100962882 59
390 3300013102 Ga0157371_11136901 Ga0157371_111369012 59
391 3300013104 Ga0157370_10428933 Ga0157370_104289332 59
392 3300013104 Ga0157370_10792782 Ga0157370_107927821 59
393 3300013104 Ga0157370_10798975 Ga0157370_107989752 59
394 3300013105 Ga0157369_10000799 Ga0157369_1000079916 59
395 3300013105 Ga0157369_10013524 Ga0157369_100135243 59
396 3300013105 Ga0157369_10375809 Ga0157369_103758092 59
397 3300013296 Ga0157374_10047490 Ga0157374_100474902 59
398 3300013307 Ga0157372_10001159 Ga0157372_100011599 59
399 3300013308 Ga0157375_11410527 Ga0157375_114105272 59
400 3300014326 Ga0157380_11716885 Ga0157380_117168851 59
401 3300014497 Ga0182008_10077541 Ga0182008_100775412 59
402 3300014497 Ga0182008_10135930 Ga0182008_101359302 59
403 3300014497 Ga0182008_10549202 Ga0182008_105492021 59
404 3300014968 Ga0157379_11363739 Ga0157379_113637391 59
405 3300014968 Ga0157379_12428713 Ga0157379_124287132 59
406 3300014969 Ga0157376_10222879 Ga0157376_102228793 59
407 3300015261 Ga0182006_1000017 Ga0182006_1000017268 59
408 3300015261 Ga0182006_1015580 Ga0182006_10155801 59
409 3300015262 Ga0182007_10002423 Ga0182007_1000242311 59
410 3300015262 Ga0182007_10009675 Ga0182007_100096754 59
411 3300015265 Ga0182005_1000007 Ga0182005_1000007136 59
412 3300015265 Ga0182005_1044771 Ga0182005_10447711 59
413 3300017792 Ga0163161_10021537 Ga0163161_100215373 59
414 3300017792 Ga0163161_11574876 Ga0163161_115748761 59
415 3300019179 Ga0184593_104580 Ga0184593_1045801 59
416 3300020069 Ga0197907_11246003 Ga0197907_112460033 59
417 3300020070 Ga0206356_10127094 Ga0206356_101270943 59
418 3300020070 Ga0206356_11033933 Ga0206356_110339332 59
419 3300020070 Ga0206356_11308868 Ga0206356_113088682 59
420 3300020075 Ga0206349_1150076 Ga0206349_11500763 59
421 3300020076 Ga0206355_1206374 Ga0206355_12063741 59
422 3300020076 Ga0206355_1326248 Ga0206355_13262483 59
423 3300020077 Ga0206351_10084287 Ga0206351_100842871 59
424 3300020077 Ga0206351_10167421 Ga0206351_101674215 59
425 3300020077 Ga0206351_10400801 Ga0206351_104008012 59
426 3300020078 Ga0206352_10143491 Ga0206352_101434912 59
427 3300020078 Ga0206352_11149020 Ga0206352_111490201 59
428 3300020080 Ga0206350_10476662 Ga0206350_104766622 59
429 3300020080 Ga0206350_10897671 Ga0206350_108976712 59
430 3300020080 Ga0206350_11588402 Ga0206350_115884022 59
431 3300020081 Ga0206354_10009750 Ga0206354_100097502 59
432 3300020081 Ga0206354_11478331 Ga0206354_114783312 59
433 3300020610 Ga0154015_1099906 Ga0154015_109990622 59
434 3300021361 Ga0213872_10001047 Ga0213872_1000104710 59
435 3300021361 Ga0213872_10002408 Ga0213872_100024087 59
436 3300021361 Ga0213872_10005517 Ga0213872_100055175 59
437 3300021361 Ga0213872_10128455 Ga0213872_101284552 59
438 3300021361 Ga0213872_10454875 Ga0213872_104548751 59
439 3300022467 Ga0224712_10046990 Ga0224712_100469902 59
440 3300023552 Ga0247551_104997 Ga0247551_1049971 59
441 3300023562 Ga0247516_119814 Ga0247516_1198142 59
442 3300025206 Ga0209435_103104 Ga0209435_1031041 59
443 3300025206 Ga0209435_104748 Ga0209435_1047482 59
444 3300025224 Ga0209784_100003 Ga0209784_100003438 59
445 3300025224 Ga0209784_100293 Ga0209784_10029318 59
446 3300025224 Ga0209784_100803 Ga0209784_1008031 59
447 3300025225 Ga0209566_100002 Ga0209566_1000021481 59
448 3300025225 Ga0209566_100370 Ga0209566_10037028 59
449 3300025225 Ga0209566_100896 Ga0209566_1008965 59
450 3300025225 Ga0209566_101272 Ga0209566_1012729 59
451 3300025226 Ga0209674_100008 Ga0209674_100008708 59
452 3300025226 Ga0209674_100013 Ga0209674_100013229 59
453 3300025226 Ga0209674_100122 Ga0209674_10012233 59
454 3300025226 Ga0209674_100424 Ga0209674_1004242 59
455 3300025226 Ga0209674_101948 Ga0209674_1019486 59
456 3300025228 Ga0209672_100010 Ga0209672_100010274 59
457 3300025228 Ga0209672_100019 Ga0209672_100019319 59
458 3300025228 Ga0209672_100051 Ga0209672_10005115 59
459 3300025228 Ga0209672_100213 Ga0209672_10021336 59
460 3300025229 Ga0209147_100002 Ga0209147_1000021806 59
461 3300025229 Ga0209147_100006 Ga0209147_100006274 59
462 3300025229 Ga0209147_100026 Ga0209147_100026319 59
463 3300025229 Ga0209147_101660 Ga0209147_1016602 59
464 3300025230 Ga0209563_100004 Ga0209563_100004894 59
465 3300025230 Ga0209563_100857 Ga0209563_1008574 59
466 3300025230 Ga0209563_104817 Ga0209563_1048171 59
467 3300025231 Ga0207427_103586 Ga0207427_1035863 59
468 3300025233 Ga0209437_109386 Ga0209437_1093863 59
469 3300025233 Ga0209437_113794 Ga0209437_1137942 59
470 3300025242 Ga0209258_100002 Ga0209258_1000021806 59
471 3300025242 Ga0209258_100010 Ga0209258_100010274 59
472 3300025242 Ga0209258_100031 Ga0209258_100031359 59
473 3300025242 Ga0209258_100253 Ga0209258_10025385 59
474 3300025242 Ga0209258_103902 Ga0209258_1039023 59
475 3300025246 Ga0209646_1000022 Ga0209646_1000022203 59
476 3300025246 Ga0209646_1000174 Ga0209646_100017465 59
477 3300025246 Ga0209646_1020439 Ga0209646_10204392 59
478 3300025246 Ga0209646_1025196 Ga0209646_10251962 59
479 3300025250 Ga0209026_1002115 Ga0209026_10021159 59
480 3300025250 Ga0209026_1045405 Ga0209026_10454052 59
481 3300025253 Ga0209677_100009 Ga0209677_100009738 59
482 3300025253 Ga0209677_111617 Ga0209677_1116172 59
483 3300025254 Ga0209148_1000018 Ga0209148_1000018274 59
484 3300025254 Ga0209148_1000021 Ga0209148_1000021556 59
485 3300025254 Ga0209148_1000027 Ga0209148_1000027359 59
486 3300025256 Ga0209759_1000327 Ga0209759_100032755 59
487 3300025256 Ga0209759_1000804 Ga0209759_100080420 59
488 3300025256 Ga0209759_1001294 Ga0209759_10012947 59
489 3300025256 Ga0209759_1001771 Ga0209759_10017719 59
490 3300025256 Ga0209759_1002181 Ga0209759_10021815 59
491 3300025256 Ga0209759_1007195 Ga0209759_10071954 59
492 3300025256 Ga0209759_1026741 Ga0209759_10267412 59
493 3300025261 Ga0209233_1000135 Ga0209233_1000135130 59
494 3300025263 Ga0209565_1023806 Ga0209565_10238062 59
495 3300025263 Ga0209565_1058772 Ga0209565_10587722 59
496 3300025272 Ga0209455_1000015 Ga0209455_1000015274 59
497 3300025272 Ga0209455_1000021 Ga0209455_1000021393 59
498 3300025272 Ga0209455_1000037 Ga0209455_1000037339 59
499 3300025272 Ga0209455_1000213 Ga0209455_100021311 59
500 3300025273 Ga0209673_1000201 Ga0209673_100020167 59
501 3300025273 Ga0209673_1006977 Ga0209673_10069775 59
502 3300025273 Ga0209673_1007222 Ga0209673_10072222 59
503 3300025273 Ga0209673_1033078 Ga0209673_10330782 59
504 3300025284 Ga0209130_1066354 Ga0209130_10663541 59
505 3300025291 Ga0209675_1037692 Ga0209675_10376922 59
506 3300025292 Ga0209676_1004133 Ga0209676_10041333 59
507 3300025292 Ga0209676_1093711 Ga0209676_10937111 59
508 3300025294 Ga0209025_1000003 Ga0209025_1000003336 59
509 3300025295 Ga0209564_1000009 Ga0209564_1000009133 59
510 3300025295 Ga0209564_1000068 Ga0209564_1000068105 59
511 3300025295 Ga0209564_1002800 Ga0209564_10028003 59
512 3300025298 Ga0209050_1003281 Ga0209050_100328110 59
513 3300025298 Ga0209050_1003824 Ga0209050_10038248 59
514 3300025299 Ga0209256_1000424 Ga0209256_100042456 59
515 3300025299 Ga0209256_1002394 Ga0209256_10023944 59
516 3300025302 Ga0207426_1003279 Ga0207426_10032797 59
517 3300025303 Ga0209051_1000244 Ga0209051_10002449 59
518 3300025303 Ga0209051_1000469 Ga0209051_100046910 59
519 3300025303 Ga0209051_1139745 Ga0209051_11397451 59
520 3300025304 Ga0209257_1000144 Ga0209257_1000144170 59
521 3300025304 Ga0209257_1000946 Ga0209257_100094634 59
522 3300025304 Ga0209257_1002583 Ga0209257_100258313 59
523 3300025321 Ga0207656_10508006 Ga0207656_105080062 59
524 3300025711 Ga0207696_1029949 Ga0207696_10299492 59
525 3300025728 Ga0207655_1008662 Ga0207655_10086626 59
526 3300025728 Ga0207655_1076323 Ga0207655_10763232 59
527 3300025728 Ga0207655_1078846 Ga0207655_10788462 59
528 3300025735 Ga0207713_1001188 Ga0207713_10011887 59
529 3300025735 Ga0207713_1003181 Ga0207713_10031814 59
530 3300025899 Ga0207642_10392418 Ga0207642_103924182 59
531 3300025900 Ga0207710_10547682 Ga0207710_105476822 59
532 3300025904 Ga0207647_10000835 Ga0207647_1000083516 59
533 3300025904 Ga0207647_10018639 Ga0207647_100186395 59
534 3300025904 Ga0207647_10072504 Ga0207647_100725042 59
535 3300025906 Ga0207699_11371450 Ga0207699_113714501 59
536 3300025907 Ga0207645_11127937 Ga0207645_111279372 59
537 3300025909 Ga0207705_10114607 Ga0207705_101146073 59
538 3300025909 Ga0207705_10189679 Ga0207705_101896792 59
539 3300025911 Ga0207654_10363279 Ga0207654_103632792 59
540 3300025913 Ga0207695_10006070 Ga0207695_1000607016 59
541 3300025913 Ga0207695_10029964 Ga0207695_100299648 59
542 3300025913 Ga0207695_10079796 Ga0207695_100797964 59
543 3300025913 Ga0207695_10199467 Ga0207695_101994672 59
544 3300025914 Ga0207671_10020134 Ga0207671_100201344 59
545 3300025914 Ga0207671_10063258 Ga0207671_100632583 59
546 3300025917 Ga0207660_11098842 Ga0207660_110988421 59
547 3300025919 Ga0207657_10000001 Ga0207657_10000001340 59
548 3300025919 Ga0207657_10077952 Ga0207657_100779522 59
549 3300025919 Ga0207657_11400713 Ga0207657_114007132 59
550 3300025920 Ga0207649_10000019 Ga0207649_1000001931 59
551 3300025920 Ga0207649_10241282 Ga0207649_102412821 59
552 3300025923 Ga0207681_10018919 Ga0207681_100189196 59
553 3300025924 Ga0207694_10010183 Ga0207694_100101837 59
554 3300025924 Ga0207694_10066616 Ga0207694_100666164 59
555 3300025924 Ga0207694_10598207 Ga0207694_105982071 59
556 3300025924 Ga0207694_10615137 Ga0207694_106151372 59
557 3300025924 Ga0207694_11605520 Ga0207694_116055201 59
558 3300025925 Ga0207650_10917360 Ga0207650_109173602 59
559 3300025931 Ga0207644_11039168 Ga0207644_110391682 59
560 3300025932 Ga0207690_10000006 Ga0207690_10000006314 59
561 3300025932 Ga0207690_10004157 Ga0207690_100041577 59
562 3300025934 Ga0207686_11762972 Ga0207686_117629722 59
563 3300025935 Ga0207709_10326946 Ga0207709_103269462 59
564 3300025935 Ga0207709_11064110 Ga0207709_110641102 59
565 3300025937 Ga0207669_11756621 Ga0207669_117566211 59
566 3300025945 Ga0207679_10000001 Ga0207679_10000001401 59
567 3300025945 Ga0207679_10881743 Ga0207679_108817431 59
568 3300025945 Ga0207679_11188239 Ga0207679_111882392 59
569 3300025949 Ga0207667_10023086 Ga0207667_100230865 59
570 3300025949 Ga0207667_10520474 Ga0207667_105204742 59
571 3300025981 Ga0207640_10000240 Ga0207640_100002409 59
572 3300025981 Ga0207640_11151542 Ga0207640_111515422 59
573 3300026035 Ga0207703_10044817 Ga0207703_100448173 59
574 3300026067 Ga0207678_10000001 Ga0207678_1000000133 59
575 3300026067 Ga0207678_10000167 Ga0207678_1000016739 59
576 3300026067 Ga0207678_10138210 Ga0207678_101382103 59
577 3300026075 Ga0207708_10226667 Ga0207708_102266672 59
578 3300026078 Ga0207702_10000009 Ga0207702_10000009195 59
579 3300026078 Ga0207702_10401565 Ga0207702_104015652 59
580 3300026088 Ga0207641_11619979 Ga0207641_116199791 59
581 3300026089 Ga0207648_10145745 Ga0207648_101457452 59
582 3300026089 Ga0207648_10356667 Ga0207648_103566672 59
583 3300026116 Ga0207674_10017905 Ga0207674_100179059 59
584 3300026116 Ga0207674_10163724 Ga0207674_101637242 59
585 3300026121 Ga0207683_10204392 Ga0207683_102043922 59
586 3300026142 Ga0207698_10020074 Ga0207698_100200743 59
587 3300026142 Ga0207698_10261005 Ga0207698_102610052 59
588 3300026142 Ga0207698_11228918 Ga0207698_112289181 59
589 3300027111 Ga0209281_1005251 Ga0209281_10052515 59
590 3300027252 Ga0209973_1003908 Ga0209973_10039082 59
591 3300027296 Ga0209389_1000341 Ga0209389_100034123 59
592 3300027312 Ga0209371_1000297 Ga0209371_100029748 59
593 3300027312 Ga0209371_1009283 Ga0209371_10092833 59
594 3300027717 Ga0209998_10123810 Ga0209998_101238101 59
595 3300027876 Ga0209974_10000696 Ga0209974_1000069610 59
596 3300027876 Ga0209974_10001341 Ga0209974_100013418 59
597 3300027876 Ga0209974_10464471 Ga0209974_104644711 59
598 3300027907 Ga0207428_10001343 Ga0207428_1000134321 59
599 3300028794 Ga0307515_10000084 Ga0307515_10000084124 59
600 3300028794 Ga0307515_10094677 Ga0307515_100946772 59
601 3300028794 Ga0307515_10235483 Ga0307515_102354832 59
602 3300028800 Ga0265338_10856238 Ga0265338_108562382 59
603 3300029277 Ga0311001_1028972 Ga0311001_10289721 59
604 3300030500 Ga0268256_1000261 Ga0268256_100026115 59
605 3300030500 Ga0268256_1009819 Ga0268256_10098192 59
606 3300030500 Ga0268256_1038334 Ga0268256_10383341 59
607 3300030522 Ga0307512_10064260 Ga0307512_100642604 59
608 3300030731 Ga0316177_1201187 Ga0316177_12011871 59
609 3300030733 Ga0314311_1115675 Ga0314311_11156752 59
610 3300030733 Ga0314311_1176908 Ga0314311_11769082 59
611 3300030734 Ga0316179_1009805 Ga0316179_10098052 59
612 3300030734 Ga0316179_1031030 Ga0316179_10310302 59
613 3300030742 Ga0316183_1114423 Ga0316183_11144232 59
614 3300030744 Ga0316181_1150926 Ga0316181_11509262 59
615 3300030744 Ga0316181_1220920 Ga0316181_12209201 59
616 3300030745 Ga0316182_1362949 Ga0316182_13629491 59
617 3300030836 Ga0265767_101143 Ga0265767_1011432 59
618 3300030863 Ga0265766_1002226 Ga0265766_10022262 59
619 3300030863 Ga0265766_1016835 Ga0265766_10168352 59
620 3300030863 Ga0265766_1021884 Ga0265766_10218841 59
621 3300030882 Ga0265764_114734 Ga0265764_1147341 59
622 3300030888 Ga0265769_101647 Ga0265769_1016472 59
623 3300030889 Ga0265761_106943 Ga0265761_1069432 59
624 3300030942 Ga0247549_103512 Ga0247549_1035122 59
625 3300031018 Ga0265773_1027860 Ga0265773_10278601 59
626 3300031238 Ga0265332_10009574 Ga0265332_100095745 59
627 3300031239 Ga0265328_10185176 Ga0265328_101851761 59
628 3300031242 Ga0265329_10203737 Ga0265329_102037372 59
629 3300031251 Ga0265327_10001175 Ga0265327_1000117534 59
630 3300031344 Ga0265316_10001277 Ga0265316_1000127727 59
631 3300031456 Ga0307513_10011348 Ga0307513_100113486 59
632 3300031548 Ga0307408_100000663 Ga0307408_10000066323 59
633 3300031548 Ga0307408_100002158 Ga0307408_1000021584 59
634 3300031548 Ga0307408_100134587 Ga0307408_1001345872 59
635 3300031548 Ga0307408_101055504 Ga0307408_1010555041 59
636 3300031649 Ga0307514_10000319 Ga0307514_1000031938 59
637 3300031665 Ga0316575_10119739 Ga0316575_101197392 59
638 3300031665 Ga0316575_10232613 Ga0316575_102326132 59
639 3300031667 Ga0310111_120975 Ga0310111_1209751 59
640 3300031691 Ga0316579_10297992 Ga0316579_102979921 59
641 3300031711 Ga0265314_10467514 Ga0265314_104675141 59
642 3300031728 Ga0316578_10430988 Ga0316578_104309882 59
643 3300031731 Ga0307405_10113333 Ga0307405_101133334 59
644 3300031731 Ga0307405_11251356 Ga0307405_112513561 59
645 3300031733 Ga0316577_10080598 Ga0316577_100805982 59
646 3300031733 Ga0316577_10267531 Ga0316577_102675312 59
647 3300031814 Ga0247548_105409 Ga0247548_1054091 59
648 3300031901 Ga0307406_10001789 Ga0307406_100017896 59
649 3300031901 Ga0307406_10391076 Ga0307406_103910761 59
650 3300031911 Ga0307412_10000008 Ga0307412_10000008341 59
651 3300031911 Ga0307412_10000845 Ga0307412_1000084520 59
652 3300031911 Ga0307412_10324403 Ga0307412_103244032 59
653 3300031911 Ga0307412_10583511 Ga0307412_105835112 59
654 3300031911 Ga0307412_12026738 Ga0307412_120267382 59
655 3300031995 Ga0307409_100059348 Ga0307409_1000593484 59
656 3300032002 Ga0307416_100381760 Ga0307416_1003817602 59
657 3300032004 Ga0307414_11636843 Ga0307414_116368432 59
658 3300032005 Ga0307411_10103964 Ga0307411_101039641 59
659 3300032133 Ga0316583_10062211 Ga0316583_100622111 59
660 3300032168 Ga0316593_10005627 Ga0316593_100056274 59
661 3300032168 Ga0316593_10011079 Ga0316593_100110792 59
662 3300032168 Ga0316593_10016257 Ga0316593_100162572 59
663 3300032168 Ga0316593_10074069 Ga0316593_100740692 59
664 3300033524 Ga0316592_1015251 Ga0316592_10152512 59
665 3300033529 Ga0316587_1029286 Ga0316587_10292862 59
666 3300033529 Ga0316587_1097520 Ga0316587_10975202 59
667 3300033541 Ga0316596_1089874 Ga0316596_10898742 59
668 3300033541 Ga0316596_1098142 Ga0316596_10981421 59
669 3300035084 Ga0373928_0104388 Ga0373928_0104388_201_383 59
670 3300035398 Ga0316574_0000770 Ga0316574_0000770_4067_4246 59
671 3300035398 Ga0316574_0497394 Ga0316574_0497394_162_356 59
672 3300035398 Ga0316574_0704972 Ga0316574_0704972_213_392 59
673 3300035410 Ga0373924_0015722 Ga0373924_0015722_2198_2380 59
674 3300035691 Ga0373931_0010733 Ga0373931_0010733_1207_1389 59
675 3300035691 Ga0373931_0617817 Ga0373931_0617817_475_657 59
676 3300036534 Ga0310109_014588 Ga0310109_014588_30_209 59
677 3300036647 Ga0316582_0001537 Ga0316582_0001537_3591_3770 59
678 3300036647 Ga0316582_0225009 Ga0316582_0225009_875_1069 59
679 3300036647 Ga0316582_0901898 Ga0316582_0901898_29_223 59
680 3300036712 Ga0316584_0151535 Ga0316584_0151535_20_214 59
681 3300036712 Ga0316584_0210336 Ga0316584_0210336_400_579 59
682 3300037312 Ga0395899_0000041 Ga0395899_0000041_70093_70272 59
683 3300037312 Ga0395899_0031186 Ga0395899_0031186_509_688 59
684 3300037312 Ga0395899_0086705 Ga0395899_0086705_1381_1560 59
685 3300037418 Ga0395900_0000797 Ga0395900_0000797_41459_41638 59
686 3300037418 Ga0395900_0001690 Ga0395900_0001690_18398_18577 59
687 3300037418 Ga0395900_0009723 Ga0395900_0009723_7075_7254 59
688 3300037418 Ga0395900_0198721 Ga0395900_0198721_805_984 59
689 3300037418 Ga0395900_0346672 Ga0395900_0346672_1254_1433 59
690 3300037466 Ga0395898_0000220 Ga0395898_0000220_76156_76335 59
691 3300037466 Ga0395898_0040162 Ga0395898_0040162_2641_2820 59
692 3300037466 Ga0395898_0367817 Ga0395898_0367817_798_980 59
693 3300037466 Ga0395898_0623605 Ga0395898_0623605_225_404 59
694 3300037471 Ga0395905_0021181 Ga0395905_0021181_1710_1889 59
695 3300037471 Ga0395905_0088384 Ga0395905_0088384_2648_2827 59
696 3300037471 Ga0395905_0563467 Ga0395905_0563467_356_538 59
697 3300037588 Ga0316581_0184420 Ga0316581_0184420_182_361 59
698 3300038443 Ga0395901_0000011 Ga0395901_0000011_63222_63401 59
699 3300038443 Ga0395901_0000106 Ga0395901_0000106_53877_54056 59
700 3300038443 Ga0395901_0044283 Ga0395901_0044283_4318_4497 59
701 3300038443 Ga0395901_0200791 Ga0395901_0200791_1611_1793 59
702 3300038726 Ga0400490_46138 Ga0400490_46138_3421_3600 59
703 3300038726 Ga0400490_48203 Ga0400490_48203_17915_18094 59
704 3300038726 Ga0400490_60606 Ga0400490_60606_3056_3235 59
705 3300038741 Ga0400488_57509 Ga0400488_57509_3611_3790 59
706 3300039062 Ga0400483_047628 Ga0400483_047628_2252_2431 59
707 3300039062 Ga0400483_179240 Ga0400483_179240_4981_5160 59
708 3300039110 Ga0400487_50157 Ga0400487_50157_1648_1827 59
709 3300039437 Ga0436365_0005079 Ga0436365_0005079_730_909 59
710 3300039438 Ga0436360_0518562 Ga0436360_0518562_182_361 59
711 3300039447 Ga0436361_0085296 Ga0436361_0085296_474_653 59
712 3300039447 Ga0436361_0119299 Ga0436361_0119299_13796_13975 59
713 3300039447 Ga0436361_0209693 Ga0436361_0209693_977_1156 59
714 3300039447 Ga0436361_0260589 Ga0436361_0260589_1443_1622 59
715 3300039447 Ga0436361_0360842 Ga0436361_0360842_1957_2136 59
716 3300039447 Ga0436361_0399282 Ga0436361_0399282_74_253 59
717 3300039447 Ga0436361_0416774 Ga0436361_0416774_272_454 59
718 3300039447 Ga0436361_0508128 Ga0436361_0508128_7372_7554 59
719 3300041452 Ga0451793_1402114 Ga0451793_1402114_661_843 59
720 3300041454 Ga0451799_22873 Ga0451799_22873_225_407 59
721 3300041461 Ga0451805_049160 Ga0451805_049160_379_561 59
722 3300041496 Ga0451839_0220486 Ga0451839_0220486_76_258 59
723 3300041512 Ga0451853_3370414 Ga0451853_3370414_868_1047 59
724 3300042004 Ga0439445_0047401 Ga0439445_0047401_945_1127 59
725 3300042004 Ga0439445_0207706 Ga0439445_0207706_352_534 59
726 3300042006 Ga0439432_224662 Ga0439432_224662_319_498 59
727 3300042011 Ga0439454_005931 Ga0439454_005931_488_673 59
728 3300042115 Ga0450911_000530 Ga0450911_000530_11697_11879 59
729 3300042115 Ga0450911_024880 Ga0450911_024880_553_735 59
730 3300042125 Ga0450923_059872 Ga0450923_059872_412_597 59
731 3300042127 Ga0450890_004781 Ga0450890_004781_1019_1204 59
732 3300042156 Ga0439446_0072906 Ga0439446_0072906_187_369 59
733 3300042156 Ga0439446_0280482 Ga0439446_0280482_73_255 59
734 3300042157 Ga0439458_0240244 Ga0439458_0240244_105_284 59
735 3300042438 Ga0439459_0000026 Ga0439459_0000026_3123_3308 59
736 3300042533 Ga0450901_044632 Ga0450901_044632_21_203 59
737 3300044650 Ga0466986_0208548 Ga0466986_0208548_718_897 59
738 3300044656 Ga0466969_0000212 Ga0466969_0000212_19170_19349 59
739 3300044656 Ga0466969_0003756 Ga0466969_0003756_1450_1629 59
740 3300044656 Ga0466969_0009461 Ga0466969_0009461_4288_4467 59
741 3300044656 Ga0466969_0126684 Ga0466969_0126684_192_371 59
742 3300044658 Ga0466972_0004661 Ga0466972_0004661_5128_5310 59
743 3300044658 Ga0466972_0012555 Ga0466972_0012555_780_959 59
744 3300044658 Ga0466972_0041828 Ga0466972_0041828_1898_2077 59
745 3300044658 Ga0466972_0055688 Ga0466972_0055688_963_1142 59
746 3300044658 Ga0466972_0147739 Ga0466972_0147739_588_767 59
747 3300044658 Ga0466972_0441782 Ga0466972_0441782_25_204 59
748 3300044659 Ga0466973_0008590 Ga0466973_0008590_2692_2871 59
749 3300044668 Ga0466980_0148245 Ga0466980_0148245_952_1131 59
750 3300044671 Ga0466978_0027607 Ga0466978_0027607_377_556 59
751 3300044672 Ga0466982_0250390 Ga0466982_0250390_245_424 59
752 3300044672 Ga0466982_0265117 Ga0466982_0265117_557_736 59
753 3300044673 Ga0453683_0099868 Ga0453683_0099868_1508_1687 59
754 3300044683 Ga0466965_0003246 Ga0466965_0003246_2343_2522 59
755 3300044683 Ga0466965_0005740 Ga0466965_0005740_3864_4046 59
756 3300044683 Ga0466965_0035070 Ga0466965_0035070_665_844 59
757 3300044683 Ga0466965_0050704 Ga0466965_0050704_1248_1427 59
758 3300044683 Ga0466965_0090269 Ga0466965_0090269_204_386 59
759 3300044683 Ga0466965_0130703 Ga0466965_0130703_839_1018 59
760 3300044683 Ga0466965_0159994 Ga0466965_0159994_791_970 59
761 3300044683 Ga0466965_0418414 Ga0466965_0418414_176_355 59
762 3300044684 Ga0466966_0003888 Ga0466966_0003888_160_339 59
763 3300044684 Ga0466966_0009685 Ga0466966_0009685_5891_6070 59
764 3300044684 Ga0466966_0013697 Ga0466966_0013697_3763_3942 59
765 3300044684 Ga0466966_0113920 Ga0466966_0113920_483_662 59
766 3300044684 Ga0466966_0190799 Ga0466966_0190799_108_287 59
767 3300044684 Ga0466966_0288251 Ga0466966_0288251_88_270 59
768 3300044684 Ga0466966_0412471 Ga0466966_0412471_589_771 59
769 3300044684 Ga0466966_0494582 Ga0466966_0494582_443_622 59
770 3300044693 Ga0466961_0000415 Ga0466961_0000415_25074_25253 59
771 3300044693 Ga0466961_0001007 Ga0466961_0001007_10996_11175 59
772 3300044693 Ga0466961_0007203 Ga0466961_0007203_2089_2268 59
773 3300044693 Ga0466961_0014813 Ga0466961_0014813_1108_1287 59
774 3300044693 Ga0466961_0121839 Ga0466961_0121839_984_1163 59
775 3300044693 Ga0466961_0268484 Ga0466961_0268484_198_377 59
776 3300044693 Ga0466961_0340099 Ga0466961_0340099_431_610 59
777 3300044693 Ga0466961_0532423 Ga0466961_0532423_114_293 59
778 3300044694 Ga0466963_0001278 Ga0466963_0001278_10812_10991 59
779 3300044694 Ga0466963_0090391 Ga0466963_0090391_1031_1210 59
780 3300044694 Ga0466963_0092180 Ga0466963_0092180_1326_1505 59
781 3300044694 Ga0466963_0106552 Ga0466963_0106552_321_506 59
782 3300044694 Ga0466963_0173523 Ga0466963_0173523_1172_1357 59
783 3300044694 Ga0466963_0288155 Ga0466963_0288155_382_561 59
784 3300044706 Ga0466964_0001878 Ga0466964_0001878_967_1146 59
785 3300044706 Ga0466964_0007716 Ga0466964_0007716_962_1141 59
786 3300044706 Ga0466964_0076040 Ga0466964_0076040_939_1118 59
787 3300044706 Ga0466964_0222730 Ga0466964_0222730_139_318 59
788 3300044706 Ga0466964_0419693 Ga0466964_0419693_322_504 59
789 3300044719 Ga0466971_0001557 Ga0466971_0001557_6241_6420 59
790 3300044719 Ga0466971_0024782 Ga0466971_0024782_1056_1235 59
791 3300044719 Ga0466971_0071483 Ga0466971_0071483_173_352 59
792 3300044719 Ga0466971_0423259 Ga0466971_0423259_223_402 59
793 3300044719 Ga0466971_0441195 Ga0466971_0441195_218_400 59
794 3300044735 Ga0466968_0003428 Ga0466968_0003428_176_355 59
795 3300044735 Ga0466968_0016798 Ga0466968_0016798_94_276 59
796 3300044765 Ga0466970_0006924 Ga0466970_0006924_1038_1217 59
797 3300044765 Ga0466970_0022440 Ga0466970_0022440_598_777 59
798 3300044765 Ga0466970_0037074 Ga0466970_0037074_1331_1510 59
799 3300044765 Ga0466970_0075084 Ga0466970_0075084_977_1156 59
800 3300044765 Ga0466970_0168989 Ga0466970_0168989_704_883 59
801 3300044765 Ga0466970_0173992 Ga0466970_0173992_143_322 59
802 3300044842 Ga0466957_0003890 Ga0466957_0003890_5369_5548 59
803 3300044842 Ga0466957_0022595 Ga0466957_0022595_1575_1754 59
804 3300044842 Ga0466957_0030419 Ga0466957_0030419_2311_2490 59
805 3300044842 Ga0466957_0044973 Ga0466957_0044973_2399_2581 59
806 3300044842 Ga0466957_0167885 Ga0466957_0167885_168_347 59
807 3300044842 Ga0466957_0623878 Ga0466957_0623878_179_361 59
808 3300044901 Ga0466960_0040069 Ga0466960_0040069_993_1172 59
809 3300044901 Ga0466960_0260758 Ga0466960_0260758_496_675 59
810 3300045049 Ga0466959_0002179 Ga0466959_0002179_9459_9638 59
811 3300045049 Ga0466959_0002658 Ga0466959_0002658_404_583 59
812 3300045049 Ga0466959_0006378 Ga0466959_0006378_4485_4664 59
813 3300045049 Ga0466959_0007553 Ga0466959_0007553_838_1017 59
814 3300045049 Ga0466959_0023160 Ga0466959_0023160_3755_3934 59
815 3300045836 Ga0466958_0006562 Ga0466958_0006562_2441_2620 59
816 3300045836 Ga0466958_0035137 Ga0466958_0035137_880_1059 59
817 3300045836 Ga0466958_0048644 Ga0466958_0048644_586_765 59
818 3300045836 Ga0466958_0195199 Ga0466958_0195199_683_862 59
819 3300045976 Ga0466967_0010385 Ga0466967_0010385_6651_6830 59
820 3300045976 Ga0466967_0557058 Ga0466967_0557058_202_381 59
821 3300045976 Ga0466967_1257985 Ga0466967_1257985_450_629 59
822 3300046452 Ga0495617_000843 Ga0495617_000843_3134_3316 59
823 3300046452 Ga0495617_005276 Ga0495617_005276_2180_2362 59
824 3300046453 Ga0495627_000007 Ga0495627_000007_421197_421379 59
825 3300046454 Ga0495592_0106127 Ga0495592_0106127_1311_1490 59
826 3300046454 Ga0495592_0388974 Ga0495592_0388974_471_653 59
827 3300046455 Ga0495603_0027448 Ga0495603_0027448_2281_2460 59
828 3300046457 Ga0495590_0002241 Ga0495590_0002241_1933_2112 59
829 3300046457 Ga0495590_0010204 Ga0495590_0010204_2187_2366 59
830 3300046457 Ga0495590_0044896 Ga0495590_0044896_1345_1527 59
831 3300046458 Ga0495591_004107 Ga0495591_004107_3090_3269 59
832 3300046459 Ga0495629_0000060 Ga0495629_0000060_35468_35647 59
833 3300046459 Ga0495629_0018287 Ga0495629_0018287_516_695 59
834 3300046459 Ga0495629_0127038 Ga0495629_0127038_443_622 59
835 3300046459 Ga0495629_0689902 Ga0495629_0689902_178_357 59
836 3300046460 Ga0495638_0009335 Ga0495638_0009335_1971_2153 59
837 3300046461 Ga0495641_0005783 Ga0495641_0005783_6603_6782 59
838 3300046461 Ga0495641_0219475 Ga0495641_0219475_548_727 59
839 3300046462 Ga0495651_0022338 Ga0495651_0022338_4078_4257 59
840 3300046462 Ga0495651_0334936 Ga0495651_0334936_278_457 59
841 3300046463 Ga0495653_0026964 Ga0495653_0026964_1631_1810 59
842 3300046463 Ga0495653_0146152 Ga0495653_0146152_354_533 59
843 3300046463 Ga0495653_0148465 Ga0495653_0148465_190_369 59
844 3300046463 Ga0495653_0519160 Ga0495653_0519160_39_218 59
845 3300046463 Ga0495653_0849521 Ga0495653_0849521_42_221 59
846 3300046471 Ga0495650_0000837 Ga0495650_0000837_32531_32713 59
847 3300046471 Ga0495650_0007308 Ga0495650_0007308_910_1089 59
848 3300046471 Ga0495650_0008995 Ga0495650_0008995_2356_2535 59
849 3300046471 Ga0495650_0137162 Ga0495650_0137162_173_352 59
850 3300046472 Ga0495580_0000975 Ga0495580_0000975_9129_9308 59
851 3300046472 Ga0495580_0009352 Ga0495580_0009352_2108_2287 59
852 3300046472 Ga0495580_0048496 Ga0495580_0048496_971_1150 59
853 3300046472 Ga0495580_0052848 Ga0495580_0052848_2655_2834 59
854 3300046472 Ga0495580_0109638 Ga0495580_0109638_606_785 59
855 3300046473 Ga0495582_0002748 Ga0495582_0002748_181_360 59
856 3300046473 Ga0495582_0037546 Ga0495582_0037546_114_293 59
857 3300046474 Ga0495605_0019964 Ga0495605_0019964_2246_2428 59
858 3300046474 Ga0495605_0046155 Ga0495605_0046155_1018_1197 59
859 3300046474 Ga0495605_0064560 Ga0495605_0064560_304_483 59
860 3300046474 Ga0495605_0168173 Ga0495605_0168173_596_775 59
861 3300046476 Ga0495662_0120824 Ga0495662_0120824_514_693 59
862 3300046476 Ga0495662_0132942 Ga0495662_0132942_709_888 59
863 3300046476 Ga0495662_0261704 Ga0495662_0261704_342_521 59
864 3300046477 Ga0495664_0000037 Ga0495664_0000037_66925_67104 59
865 3300046477 Ga0495664_0010939 Ga0495664_0010939_1241_1420 59
866 3300046477 Ga0495664_0016639 Ga0495664_0016639_1692_1871 59
867 3300046477 Ga0495664_0357168 Ga0495664_0357168_39_218 59
868 3300046491 Ga0495584_0002307 Ga0495584_0002307_758_940 59
869 3300046491 Ga0495584_0413837 Ga0495584_0413837_373_552 59
870 3300046492 Ga0495585_0398843 Ga0495585_0398843_348_530 59
871 3300046499 Ga0495594_0042385 Ga0495594_0042385_1082_1261 59
872 3300046500 Ga0495596_0018802 Ga0495596_0018802_1642_1821 59
873 3300046500 Ga0495596_0076148 Ga0495596_0076148_259_438 59
874 3300046501 Ga0495607_0090253 Ga0495607_0090253_993_1175 59
875 3300046506 Ga0495583_0000177 Ga0495583_0000177_53928_54110 59
876 3300046506 Ga0495583_0000221 Ga0495583_0000221_6046_6228 59
877 3300046506 Ga0495583_0001627 Ga0495583_0001627_13608_13787 59
878 3300046506 Ga0495583_0027095 Ga0495583_0027095_2239_2421 59
879 3300046506 Ga0495583_0078735 Ga0495583_0078735_1133_1315 59
880 3300046507 Ga0495606_0040529 Ga0495606_0040529_1681_1860 59
881 3300046507 Ga0495606_0046538 Ga0495606_0046538_2074_2253 59
882 3300046507 Ga0495606_0060057 Ga0495606_0060057_2212_2394 59
883 3300046507 Ga0495606_0064965 Ga0495606_0064965_838_1020 59
884 3300046507 Ga0495606_0219356 Ga0495606_0219356_811_990 59
885 3300046511 Ga0495608_0002733 Ga0495608_0002733_6895_7074 59
886 3300046511 Ga0495608_0939969 Ga0495608_0939969_33_212 59
887 3300046512 Ga0495610_0003920 Ga0495610_0003920_2642_2821 59
888 3300046512 Ga0495610_0045830 Ga0495610_0045830_1802_1984 59
889 3300046513 Ga0495616_0026387 Ga0495616_0026387_17_196 59
890 3300046513 Ga0495616_0431709 Ga0495616_0431709_178_360 59
891 3300046514 Ga0495618_0005010 Ga0495618_0005010_1784_1963 59
892 3300046514 Ga0495618_0005105 Ga0495618_0005105_6143_6322 59
893 3300046515 Ga0495620_0010464 Ga0495620_0010464_1549_1728 59
894 3300046515 Ga0495620_0044545 Ga0495620_0044545_309_488 59
895 3300046516 Ga0495628_0011261 Ga0495628_0011261_265_444 59
896 3300046516 Ga0495628_0019283 Ga0495628_0019283_3295_3474 59
897 3300046516 Ga0495628_0081905 Ga0495628_0081905_664_843 59
898 3300046516 Ga0495628_0089721 Ga0495628_0089721_1937_2116 59
899 3300046517 Ga0495630_0018087 Ga0495630_0018087_38_217 59
900 3300046517 Ga0495630_0060980 Ga0495630_0060980_2323_2502 59
901 3300046517 Ga0495630_0200148 Ga0495630_0200148_1036_1215 59
902 3300046517 Ga0495630_0250715 Ga0495630_0250715_650_829 59
903 3300046517 Ga0495630_1176338 Ga0495630_1176338_310_492 59
904 3300046519 Ga0495632_0203715 Ga0495632_0203715_175_354 59
905 3300046519 Ga0495632_0259407 Ga0495632_0259407_342_524 59
906 3300046520 Ga0495637_0014142 Ga0495637_0014142_546_728 59
907 3300046522 Ga0495643_0000123 Ga0495643_0000123_18216_18398 59
908 3300046522 Ga0495643_0036541 Ga0495643_0036541_334_513 59
909 3300046522 Ga0495643_0154126 Ga0495643_0154126_268_450 59
910 3300046523 Ga0495644_0006676 Ga0495644_0006676_357_539 59
911 3300046524 Ga0495648_0002540 Ga0495648_0002540_7208_7390 59
912 3300046524 Ga0495648_0018998 Ga0495648_0018998_2468_2650 59
913 3300046524 Ga0495648_0028053 Ga0495648_0028053_2110_2289 59
914 3300046524 Ga0495648_0043051 Ga0495648_0043051_523_702 59
915 3300046526 Ga0495666_0001885 Ga0495666_0001885_4254_4433 59
916 3300046526 Ga0495666_0142952 Ga0495666_0142952_627_806 59
917 3300046528 Ga0495642_0025247 Ga0495642_0025247_394_573 59
918 3300046528 Ga0495642_0036504 Ga0495642_0036504_59_241 59
919 3300046529 Ga0495652_0031410 Ga0495652_0031410_1035_1214 59
920 3300046529 Ga0495652_0115948 Ga0495652_0115948_203_382 59
921 3300046529 Ga0495652_0131756 Ga0495652_0131756_1348_1527 59
922 3300046529 Ga0495652_0182733 Ga0495652_0182733_778_957 59
923 3300046530 Ga0495654_0007194 Ga0495654_0007194_513_695 59
924 3300046530 Ga0495654_0016009 Ga0495654_0016009_1688_1870 59
925 3300046530 Ga0495654_0047831 Ga0495654_0047831_1099_1281 59
926 3300046530 Ga0495654_0216948 Ga0495654_0216948_373_552 59
927 3300046530 Ga0495654_0243293 Ga0495654_0243293_289_471 59
928 3300046531 Ga0495665_0027180 Ga0495665_0027180_1631_1810 59
929 3300046531 Ga0495665_0088982 Ga0495665_0088982_485_664 59
930 3300046531 Ga0495665_0233349 Ga0495665_0233349_533_712 59
931 3300046531 Ga0495665_0332830 Ga0495665_0332830_63_242 59
932 3300046533 Ga0495640_0012106 Ga0495640_0012106_935_1114 59
933 3300046533 Ga0495640_0017853 Ga0495640_0017853_2576_2755 59
934 3300046533 Ga0495640_0576921 Ga0495640_0576921_197_376 59
935 3300046535 Ga0495586_0004650 Ga0495586_0004650_1792_1971 59
936 3300046535 Ga0495586_0133203 Ga0495586_0133203_384_563 59
937 3300046536 Ga0495587_0003135 Ga0495587_0003135_4275_4454 59
938 3300046536 Ga0495587_0083669 Ga0495587_0083669_1190_1369 59
939 3300046538 Ga0495609_0000479 Ga0495609_0000479_4685_4867 59
940 3300046538 Ga0495609_0207150 Ga0495609_0207150_437_616 59
941 3300046542 Ga0495597_0010421 Ga0495597_0010421_4312_4494 59
942 3300046542 Ga0495597_0017578 Ga0495597_0017578_1071_1250 59
943 3300046542 Ga0495597_0095922 Ga0495597_0095922_309_488 59
944 3300046542 Ga0495597_0126266 Ga0495597_0126266_740_922 59
945 3300046542 Ga0495597_0132415 Ga0495597_0132415_798_980 59
946 3300046542 Ga0495597_0144854 Ga0495597_0144854_118_300 59
947 3300046543 Ga0495645_0028172 Ga0495645_0028172_739_918 59
948 3300046543 Ga0495645_0049735 Ga0495645_0049735_1621_1800 59
949 3300046557 Ga0495622_0000028 Ga0495622_0000028_17676_17858 59
950 3300046557 Ga0495622_0064758 Ga0495622_0064758_1310_1492 59
951 3300046558 Ga0495633_0001452 Ga0495633_0001452_10465_10647 59
952 3300046558 Ga0495633_0003780 Ga0495633_0003780_4357_4539 59
953 3300046558 Ga0495633_0045139 Ga0495633_0045139_367_549 59
954 3300046558 Ga0495633_0133096 Ga0495633_0133096_543_725 59
955 3300046558 Ga0495633_0185045 Ga0495633_0185045_124_306 59
956 3300046558 Ga0495633_0319569 Ga0495633_0319569_454_636 59
957 3300046559 Ga0495667_0426429 Ga0495667_0426429_540_719 59
958 3300046615 Ga0495656_0003881 Ga0495656_0003881_2316_2498 59
959 3300046615 Ga0495656_0109049 Ga0495656_0109049_1071_1253 59
960 3300046615 Ga0495656_0144429 Ga0495656_0144429_385_567 59
961 3300046616 Ga0495668_0464305 Ga0495668_0464305_381_563 59
962 3300046642 Ga0495634_0070463 Ga0495634_0070463_533_712 59
963 3300046642 Ga0495634_0100657 Ga0495634_0100657_1011_1190 59
964 3300046642 Ga0495634_0307495 Ga0495634_0307495_253_432 59
965 3300046642 Ga0495634_0315326 Ga0495634_0315326_231_410 59
966 3300046648 Ga0495611_0017514 Ga0495611_0017514_2602_2784 59
967 3300046648 Ga0495611_0085027 Ga0495611_0085027_269_448 59
968 3300046660 Ga0495625_0010387 Ga0495625_0010387_917_1099 59
969 3300046660 Ga0495625_0098533 Ga0495625_0098533_657_836 59
970 3300046663 Ga0495635_0001911 Ga0495635_0001911_1741_1920 59
971 3300046663 Ga0495635_0582656 Ga0495635_0582656_35_214 59
972 3300046664 Ga0495659_0000284 Ga0495659_0000284_10404_10586 59
973 3300046664 Ga0495659_0001733 Ga0495659_0001733_6512_6694 59
974 3300046664 Ga0495659_0032379 Ga0495659_0032379_826_1008 59
975 3300046664 Ga0495659_0258790 Ga0495659_0258790_121_303 59
976 3300046665 Ga0495661_0015384 Ga0495661_0015384_2212_2394 59
977 3300046665 Ga0495661_0032098 Ga0495661_0032098_2063_2245 59
978 3300046665 Ga0495661_0068043 Ga0495661_0068043_920_1099 59
979 3300046665 Ga0495661_0187824 Ga0495661_0187824_849_1028 59
980 3300046674 Ga0495588_0016869 Ga0495588_0016869_106_288 59
981 3300046674 Ga0495588_0266466 Ga0495588_0266466_226_405 59
982 3300046675 Ga0495657_0012465 Ga0495657_0012465_291_470 59
983 3300046678 Ga0495599_0015303 Ga0495599_0015303_3135_3314 59
984 3300046678 Ga0495599_0158502 Ga0495599_0158502_979_1158 59
985 3300046679 Ga0495623_0007364 Ga0495623_0007364_2122_2301 59
986 3300046679 Ga0495623_0021394 Ga0495623_0021394_2450_2629 59
987 3300046680 Ga0495646_0004251 Ga0495646_0004251_7497_7676 59
988 3300046680 Ga0495646_0064817 Ga0495646_0064817_946_1125 59
989 3300046684 Ga0495669_0110981 Ga0495669_0110981_288_467 59
990 3300046689 Ga0495613_0022883 Ga0495613_0022883_4275_4454 59
991 3300046689 Ga0495613_0907691 Ga0495613_0907691_379_558 59
992 3300046690 Ga0495624_0006795 Ga0495624_0006795_5984_6163 59
993 3300046690 Ga0495624_0015717 Ga0495624_0015717_650_829 59
994 3300046690 Ga0495624_0017723 Ga0495624_0017723_270_449 59
995 3300046690 Ga0495624_0020284 Ga0495624_0020284_2515_2694 59
996 3300046690 Ga0495624_0027317 Ga0495624_0027317_3151_3330 59
997 3300046691 Ga0495670_0054856 Ga0495670_0054856_1790_1972 59
998 3300046691 Ga0495670_0070743 Ga0495670_0070743_575_757 59
999 3300046692 Ga0495671_0000108 Ga0495671_0000108_10704_10886 59
1000 3300046692 Ga0495671_0137186 Ga0495671_0137186_282_464 59
1001 3300046692 Ga0495671_0221131 Ga0495671_0221131_286_465 59
1002 3300046692 Ga0495671_0397240 Ga0495671_0397240_215_394 59
1003 3300046694 Ga0495649_0042023 Ga0495649_0042023_1933_2112 59
1004 3300046694 Ga0495649_0047936 Ga0495649_0047936_540_719 59
1005 3300046694 Ga0495649_0113338 Ga0495649_0113338_42_221 59
1006 3300046794 Ga0495589_0002451 Ga0495589_0002451_3243_3422 59
1007 3300046794 Ga0495589_0042042 Ga0495589_0042042_1564_1743 59
1008 3300046809 Ga0495600_0002084 Ga0495600_0002084_10332_10511 59
1009 3300046809 Ga0495600_0060784 Ga0495600_0060784_180_359 59
1010 3300046809 Ga0495600_0769114 Ga0495600_0769114_164_343 59
1011 3300046810 Ga0495660_0000705 Ga0495660_0000705_10533_10715 59
1012 3300046810 Ga0495660_0067675 Ga0495660_0067675_390_569 59
1013 3300046810 Ga0495660_0160847 Ga0495660_0160847_228_410 59
1014 3300046810 Ga0495660_0190688 Ga0495660_0190688_749_931 59
1015 3300046810 Ga0495660_0278812 Ga0495660_0278812_568_750 59
1016 3300047315 Ga0495581_0004052 Ga0495581_0004052_1750_1929 59
1017 3300047315 Ga0495581_0102795 Ga0495581_0102795_1109_1288 59
1018 3300047315 Ga0495581_0149957 Ga0495581_0149957_650_829 59
1019 3300047317 Ga0495604_0011916 Ga0495604_0011916_4299_4478 59
1020 3300047317 Ga0495604_0065108 Ga0495604_0065108_71_250 59
1021 3300047317 Ga0495604_0095261 Ga0495604_0095261_1737_1916 59
1022 3300047318 Ga0495636_0012717 Ga0495636_0012717_1067_1249 59
1023 3300047318 Ga0495636_0016093 Ga0495636_0016093_2571_2753 59
1024 3300047319 Ga0495674_0006962 Ga0495674_0006962_4601_4780 59
1025 3300047319 Ga0495674_0007875 Ga0495674_0007875_2447_2626 59
1026 3300047319 Ga0495674_0030492 Ga0495674_0030492_1887_2066 59
1027 3300047319 Ga0495674_0064038 Ga0495674_0064038_2754_2933 59
1028 3300047319 Ga0495674_0302711 Ga0495674_0302711_483_662 59
1029 3300047319 Ga0495674_0951762 Ga0495674_0951762_41_220 59
1030 3300047320 Ga0495672_0000181 Ga0495672_0000181_56100_56282 59
1031 3300047320 Ga0495672_0000366 Ga0495672_0000366_55092_55274 59
1032 3300047320 Ga0495672_0004977 Ga0495672_0004977_1602_1781 59
1033 3300047320 Ga0495672_0032552 Ga0495672_0032552_1644_1826 59
1034 3300047320 Ga0495672_0047636 Ga0495672_0047636_1829_2008 59
1035 3300047321 Ga0495676_0065694 Ga0495676_0065694_1381_1560 59
1036 3300047321 Ga0495676_0321395 Ga0495676_0321395_790_969 59
1037 3300047322 Ga0495680_0013833 Ga0495680_0013833_4844_5023 59
1038 3300047322 Ga0495680_0191214 Ga0495680_0191214_552_731 59
1039 3300047323 Ga0495683_0012933 Ga0495683_0012933_2779_2958 59
1040 3300047323 Ga0495683_0021720 Ga0495683_0021720_1672_1851 59
1041 3300047323 Ga0495683_0030717 Ga0495683_0030717_948_1130 59
1042 3300047323 Ga0495683_0299903 Ga0495683_0299903_95_274 59
1043 3300047443 Ga0495687_005585 Ga0495687_005585_1610_1792 59
1044 3300047443 Ga0495687_006712 Ga0495687_006712_4247_4426 59
1045 3300047443 Ga0495687_026489 Ga0495687_026489_2152_2331 59
1046 3300047443 Ga0495687_040102 Ga0495687_040102_1865_2044 59
1047 3300047444 Ga0495675_0002828 Ga0495675_0002828_3937_4116 59
1048 3300047444 Ga0495675_0010388 Ga0495675_0010388_5577_5756 59
1049 3300047444 Ga0495675_0343950 Ga0495675_0343950_44_223 59
1050 3300047445 Ga0495677_0002355 Ga0495677_0002355_2819_3001 59
1051 3300047445 Ga0495677_0053591 Ga0495677_0053591_561_743 59
1052 3300047446 Ga0495679_000038 Ga0495679_000038_152258_152437 59
1053 3300047446 Ga0495679_001758 Ga0495679_001758_4324_4503 59
1054 3300047446 Ga0495679_004370 Ga0495679_004370_3947_4126 59
1055 3300047447 Ga0495685_000012 Ga0495685_000012_54520_54702 59
1056 3300047469 Ga0495673_0000188 Ga0495673_0000188_29737_29919 59
1057 3300047469 Ga0495673_0030133 Ga0495673_0030133_1431_1610 59
1058 3300047469 Ga0495673_0035867 Ga0495673_0035867_498_677 59
1059 3300047470 Ga0495681_0004664 Ga0495681_0004664_9042_9224 59
1060 3300047470 Ga0495681_0023688 Ga0495681_0023688_2588_2767 59
1061 3300047470 Ga0495681_0266656 Ga0495681_0266656_132_311 59
1062 3300047471 Ga0495684_0099372 Ga0495684_0099372_532_711 59
1063 3300047471 Ga0495684_0981306 Ga0495684_0981306_179_358 59
1064 3300047472 Ga0495686_0000380 Ga0495686_0000380_19533_19715 59
1065 3300047472 Ga0495686_0003712 Ga0495686_0003712_11032_11214 59
1066 3300047472 Ga0495686_0093464 Ga0495686_0093464_1141_1320 59
1067 3300047472 Ga0495686_0264767 Ga0495686_0264767_757_939 59
1068 3300047673 Ga0495593_0067595 Ga0495593_0067595_1418_1597 59
1069 3300047673 Ga0495593_0175509 Ga0495593_0175509_40_219 59
1070 3300047673 Ga0495593_0253204 Ga0495593_0253204_664_843 59
1071 3300048088 Ga0495602_0075108 Ga0495602_0075108_2526_2705 59
1072 3300048088 Ga0495602_0108305 Ga0495602_0108305_552_731 59
1073 3300048088 Ga0495602_0139136 Ga0495602_0139136_1012_1191 59
1074 3300048088 Ga0495602_0369908 Ga0495602_0369908_713_892 59
1075 3300048089 Ga0495614_0003506 Ga0495614_0003506_5959_6138 59
1076 3300048089 Ga0495614_0009064 Ga0495614_0009064_3680_3859 59
1077 3300048089 Ga0495614_0023359 Ga0495614_0023359_398_577 59
1078 3300048089 Ga0495614_0465011 Ga0495614_0465011_407_586 59
1079 3300048091 Ga0495626_0001169 Ga0495626_0001169_21432_21614 59
1080 3300048091 Ga0495626_0015633 Ga0495626_0015633_2599_2778 59
1081 3300048091 Ga0495626_0020668 Ga0495626_0020668_1580_1759 59
1082 3300048091 Ga0495626_0320457 Ga0495626_0320457_51_230 59
1083 3300048903 Ga0496100_0001564 Ga0496100_0001564_546_725 59
1084 3300048903 Ga0496100_1348507 Ga0496100_1348507_321_503 59
1085 3300048904 Ga0496101_0004610 Ga0496101_0004610_3459_3638 59
1086 3300048904 Ga0496101_0328315 Ga0496101_0328315_302_481 59
1087 3300048904 Ga0496101_0424436 Ga0496101_0424436_68_250 59
1088 3300048905 Ga0496102_0008702 Ga0496102_0008702_6731_6910 59
1089 3300048905 Ga0496102_0014532 Ga0496102_0014532_1816_1995 59
1090 3300048905 Ga0496102_0184660 Ga0496102_0184660_297_479 59
1091 3300048905 Ga0496102_1531281 Ga0496102_1531281_49_228 59
1092 3300048906 Ga0496103_0003074 Ga0496103_0003074_855_1034 59
1093 3300048906 Ga0496103_0009410 Ga0496103_0009410_2874_3056 59
1094 3300048906 Ga0496103_0110398 Ga0496103_0110398_145_327 59
1095 3300048906 Ga0496103_0437231 Ga0496103_0437231_383_562 59
1096 3300048907 Ga0496104_1668037 Ga0496104_1668037_85_264 59
1097 3300048908 Ga0496105_0055064 Ga0496105_0055064_1203_1382 59
1098 3300048908 Ga0496105_0212234 Ga0496105_0212234_463_645 59
1099 3300048909 Ga0496106_0138726 Ga0496106_0138726_1041_1220 59
1100 3300048910 Ga0496107_0109583 Ga0496107_0109583_1414_1593 59
1101 3300048911 Ga0496108_0900138 Ga0496108_0900138_421_600 59
1102 3300048912 Ga0496109_0195160 Ga0496109_0195160_299_478 59
1103 3300048913 Ga0496110_0099317 Ga0496110_0099317_177_356 59
1104 3300048913 Ga0496110_1007485 Ga0496110_1007485_345_527 59
1105 3300048913 Ga0496110_1177451 Ga0496110_1177451_453_632 59
1106 3300048913 Ga0496110_1586065 Ga0496110_1586065_195_377 59
1107 3300048914 Ga0496111_0177460 Ga0496111_0177460_553_732 59
1108 3300048914 Ga0496111_0238931 Ga0496111_0238931_479_661 59
1109 3300048915 Ga0496112_0165240 Ga0496112_0165240_1795_1974 59
1110 3300048915 Ga0496112_1396035 Ga0496112_1396035_87_266 59
1111 3300048916 Ga0496113_0026351 Ga0496113_0026351_426_605 59
1112 3300048916 Ga0496113_0912600 Ga0496113_0912600_379_558 59
1113 3300048916 Ga0496113_1482673 Ga0496113_1482673_199_399 59
1114 3300048916 Ga0496113_1514884 Ga0496113_1514884_32_211 59
1115 3300048917 Ga0496114_0168757 Ga0496114_0168757_562_744 59
1116 3300048917 Ga0496114_0171177 Ga0496114_0171177_16_195 59
1117 3300048917 Ga0496114_0269836 Ga0496114_0269836_1262_1444 59
1118 3300048918 Ga0496115_0217914 Ga0496115_0217914_631_810 59
1119 3300048919 Ga0496116_0007137 Ga0496116_0007137_4378_4557 59
1120 3300048919 Ga0496116_0024774 Ga0496116_0024774_1825_2004 59
1121 3300048919 Ga0496116_0040168 Ga0496116_0040168_1973_2155 59
1122 3300048919 Ga0496116_0173243 Ga0496116_0173243_156_338 59
1123 3300048919 Ga0496116_0404592 Ga0496116_0404592_380_559 59
1124 3300048920 Ga0496117_0009193 Ga0496117_0009193_6196_6375 59
1125 3300048920 Ga0496117_0012754 Ga0496117_0012754_6401_6580 59
1126 3300048920 Ga0496117_0023308 Ga0496117_0023308_4668_4847 59
1127 3300048920 Ga0496117_0024619 Ga0496117_0024619_3900_4082 59
1128 3300048920 Ga0496117_0041125 Ga0496117_0041125_2636_2815 59
1129 3300048921 Ga0496118_0002548 Ga0496118_0002548_19934_20113 59
1130 3300048921 Ga0496118_0008041 Ga0496118_0008041_4537_4716 59
1131 3300048921 Ga0496118_0017381 Ga0496118_0017381_4201_4383 59
1132 3300048921 Ga0496118_0019819 Ga0496118_0019819_2796_2975 59
1133 3300048921 Ga0496118_0039449 Ga0496118_0039449_2380_2559 59
1134 3300048921 Ga0496118_0063758 Ga0496118_0063758_819_998 59
1135 3300048922 Ga0496119_0008234 Ga0496119_0008234_5190_5372 59
1136 3300048922 Ga0496119_0203713 Ga0496119_0203713_687_866 59
1137 3300048923 Ga0496120_0006959 Ga0496120_0006959_5706_5888 59
1138 3300048923 Ga0496120_0292255 Ga0496120_0292255_276_455 59
1139 3300048924 Ga0496121_0000306 Ga0496121_0000306_63232_63414 59
1140 3300048924 Ga0496121_0004537 Ga0496121_0004537_8616_8795 59
1141 3300048924 Ga0496121_0007042 Ga0496121_0007042_8623_8802 59
1142 3300048924 Ga0496121_0065853 Ga0496121_0065853_507_686 59
1143 3300048924 Ga0496121_0260830 Ga0496121_0260830_666_848 59
1144 3300048924 Ga0496121_0296634 Ga0496121_0296634_699_881 59
1145 3300048925 Ga0496122_0000644 Ga0496122_0000644_72_254 59
1146 3300048925 Ga0496122_0004387 Ga0496122_0004387_9608_9787 59
1147 3300048925 Ga0496122_0034717 Ga0496122_0034717_3867_4049 59
1148 3300048925 Ga0496122_0280000 Ga0496122_0280000_433_615 59
1149 3300048925 Ga0496122_0548951 Ga0496122_0548951_110_289 59
1150 3300048926 Ga0496123_0000203 Ga0496123_0000203_52701_52883 59
1151 3300048926 Ga0496123_0013893 Ga0496123_0013893_2374_2553 59
1152 3300048926 Ga0496123_0124169 Ga0496123_0124169_1228_1410 59
1153 3300048926 Ga0496123_0149579 Ga0496123_0149579_14_193 59
1154 3300048927 Ga0496124_0008511 Ga0496124_0008511_3794_3979 59
1155 3300048927 Ga0496124_0009308 Ga0496124_0009308_3829_4008 59
1156 3300048927 Ga0496124_0038717 Ga0496124_0038717_2199_2381 59
1157 3300048927 Ga0496124_0051693 Ga0496124_0051693_2581_2763 59
1158 3300048927 Ga0496124_0055125 Ga0496124_0055125_1889_2071 59
1159 3300048927 Ga0496124_0063559 Ga0496124_0063559_2279_2461 59
1160 3300048928 Ga0496125_0000011 Ga0496125_0000011_162272_162454 59
1161 3300048928 Ga0496125_0003109 Ga0496125_0003109_6284_6466 59
1162 3300048928 Ga0496125_0007345 Ga0496125_0007345_10841_11023 59
1163 3300048928 Ga0496125_0020259 Ga0496125_0020259_3156_3338 59
1164 3300048928 Ga0496125_0035345 Ga0496125_0035345_72_254 59
1165 3300048928 Ga0496125_0095438 Ga0496125_0095438_1776_1958 59
1166 3300048928 Ga0496125_0204583 Ga0496125_0204583_952_1131 59
1167 3300048928 Ga0496125_0278086 Ga0496125_0278086_723_902 59
1168 3300048929 Ga0496126_0002232 Ga0496126_0002232_4415_4594 59
1169 3300048929 Ga0496126_0003420 Ga0496126_0003420_15223_15402 59
1170 3300048929 Ga0496126_0038550 Ga0496126_0038550_116_298 59
1171 3300048929 Ga0496126_0056077 Ga0496126_0056077_1535_1717 59
1172 3300048929 Ga0496126_0062435 Ga0496126_0062435_1252_1431 59
1173 3300048929 Ga0496126_0552921 Ga0496126_0552921_428_610 59
1174 3300048986 Ga0466983_0920657 Ga0466983_0920657_13_192 59
1175 3300049127 Ga0501306_018797 Ga0501306_018797_754_936 59
1176 3300049127 Ga0501306_091083 Ga0501306_091083_129_311 59
1177 3300049127 Ga0501306_093629 Ga0501306_093629_251_433 59
1178 3300049128 Ga0501308_000315 Ga0501308_000315_784_966 59
1179 3300049128 Ga0501308_037032 Ga0501308_037032_82_264 59
1180 3300049129 Ga0501309_017424 Ga0501309_017424_658_840 59
1181 3300049130 Ga0501310_017772 Ga0501310_017772_420_602 59
1182 3300049131 Ga0501341_02833 Ga0501341_02833_317_499 59
1183 3300049131 Ga0501341_05638 Ga0501341_05638_398_580 59
1184 3300049132 Ga0501343_006326 Ga0501343_006326_130_312 59
1185 3300049160 Ga0501304_002330 Ga0501304_002330_913_1095 59
1186 3300049160 Ga0501304_024903 Ga0501304_024903_168_350 59
1187 3300049161 Ga0501305_003896 Ga0501305_003896_833_1015 59
1188 3300049161 Ga0501305_021623 Ga0501305_021623_368_550 59
1189 3300049161 Ga0501305_095814 Ga0501305_095814_161_343 59
1190 3300049162 Ga0501307_026574 Ga0501307_026574_232_414 59
1191 3300049162 Ga0501307_085034 Ga0501307_085034_91_273 59
1192 3300049459 Ga0495678_000004 Ga0495678_000004_371529_371711 59
1193 3300049459 Ga0495678_043783 Ga0495678_043783_1254_1433 59
1194 3300049460 Ga0495682_0019450 Ga0495682_0019450_1442_1624 59
1195 3300049460 Ga0495682_0086305 Ga0495682_0086305_20_199 59
1196 3300049527 Ga0501311_007961 Ga0501311_007961_354_536 59
1197 3300049528 Ga0501312_028442 Ga0501312_028442_439_621 59
1198 3300049528 Ga0501312_033713 Ga0501312_033713_249_431 59
1199 3300049528 Ga0501312_087788 Ga0501312_087788_305_487 59
1200 3300049529 Ga0501313_009046 Ga0501313_009046_671_853 59
1201 3300049529 Ga0501313_046959 Ga0501313_046959_343_525 59
1202 3300049530 Ga0501314_005186 Ga0501314_005186_461_643 59
1203 3300049530 Ga0501314_030317 Ga0501314_030317_262_444 59
1204 3300049531 Ga0501315_002372 Ga0501315_002372_671_853 59
1205 3300049531 Ga0501315_009861 Ga0501315_009861_692_874 59
1206 3300049531 Ga0501315_037184 Ga0501315_037184_437_619 59
1207 3300049531 Ga0501315_052119 Ga0501315_052119_135_317 59
1208 3300049531 Ga0501315_088192 Ga0501315_088192_181_363 59
1209 3300049532 Ga0501316_038549 Ga0501316_038549_51_233 59
1210 3300049532 Ga0501316_076814 Ga0501316_076814_140_322 59
1211 3300049533 Ga0501317_056037 Ga0501317_056037_67_249 59
1212 3300049533 Ga0501317_101203 Ga0501317_101203_81_263 59
1213 3300049534 Ga0501318_043630 Ga0501318_043630_83_265 59
1214 3300049535 Ga0501319_000620 Ga0501319_000620_41_223 59
1215 3300049535 Ga0501319_003465 Ga0501319_003465_321_503 59
1216 3300049535 Ga0501319_017426 Ga0501319_017426_266_448 59
1217 3300049536 Ga0501320_001140 Ga0501320_001140_114_296 59
1218 3300049536 Ga0501320_007226 Ga0501320_007226_588_770 59
1219 3300049536 Ga0501320_020731 Ga0501320_020731_67_249 59
1220 3300049537 Ga0501321_025190 Ga0501321_025190_200_382 59
1221 3300049539 Ga0501323_000562 Ga0501323_000562_120_302 59
1222 3300049539 Ga0501323_017412 Ga0501323_017412_113_295 59
1223 3300049539 Ga0501323_025630 Ga0501323_025630_507_689 59
1224 3300049540 Ga0501324_012443 Ga0501324_012443_407_589 59
1225 3300049540 Ga0501324_021515 Ga0501324_021515_146_328 59
1226 3300049540 Ga0501324_044802 Ga0501324_044802_269_451 59
1227 3300049541 Ga0501325_006584 Ga0501325_006584_748_930 59
1228 3300049542 Ga0501326_09348 Ga0501326_09348_21_203 59
1229 3300049545 Ga0501329_10738 Ga0501329_10738_108_290 59
1230 3300049545 Ga0501329_12003 Ga0501329_12003_203_385 59
1231 3300049551 Ga0501335_008825 Ga0501335_008825_226_408 59
1232 3300049553 Ga0501337_011731 Ga0501337_011731_300_482 59
1233 3300049553 Ga0501337_015195 Ga0501337_015195_216_398 59
1234 3300049553 Ga0501337_021820 Ga0501337_021820_233_415 59
1235 3300049553 Ga0501337_025092 Ga0501337_025092_69_251 59
1236 3300049554 Ga0501338_05164 Ga0501338_05164_165_347 59
1237 3300049568 Ga0501031_0322400 Ga0501031_0322400_692_874 59
1238 3300049569 Ga0501032_0166201 Ga0501032_0166201_708_890 59
1239 3300049570 Ga0501033_0000642 Ga0501033_0000642_27428_27607 59
1240 3300049570 Ga0501033_0087505 Ga0501033_0087505_1041_1223 59
1241 3300049570 Ga0501033_0638143 Ga0501033_0638143_67_246 59
1242 3300049571 Ga0501034_0004519 Ga0501034_0004519_4975_5154 59
1243 3300049571 Ga0501034_0018858 Ga0501034_0018858_3763_3942 59
1244 3300049571 Ga0501034_0135557 Ga0501034_0135557_293_472 59
1245 3300049571 Ga0501034_0503757 Ga0501034_0503757_715_894 59
1246 3300049571 Ga0501034_0897898 Ga0501034_0897898_307_489 59
1247 3300049572 Ga0501036_0002870 Ga0501036_0002870_9914_10093 59
1248 3300049572 Ga0501036_0529773 Ga0501036_0529773_630_809 59
1249 3300049573 Ga0501037_0095024 Ga0501037_0095024_613_792 59
1250 3300049573 Ga0501037_0145797 Ga0501037_0145797_872_1051 59
1251 3300049573 Ga0501037_0396915 Ga0501037_0396915_694_873 59
1252 3300049574 Ga0501038_0019977 Ga0501038_0019977_3883_4062 59
1253 3300049574 Ga0501038_0099781 Ga0501038_0099781_1913_2092 59
1254 3300049574 Ga0501038_0614513 Ga0501038_0614513_228_407 59
1255 3300049574 Ga0501038_0854985 Ga0501038_0854985_385_567 59
1256 3300049574 Ga0501038_1316813 Ga0501038_1316813_238_417 59
1257 3300049575 Ga0501039_0066082 Ga0501039_0066082_871_1050 59
1258 3300049577 Ga0501041_0117973 Ga0501041_0117973_688_867 59
1259 3300049578 Ga0501042_0376229 Ga0501042_0376229_733_912 59
1260 3300049579 Ga0501043_0029837 Ga0501043_0029837_1041_1220 59
1261 3300049579 Ga0501043_0275446 Ga0501043_0275446_973_1152 59
1262 3300049579 Ga0501043_0637405 Ga0501043_0637405_489_668 59
1263 3300049579 Ga0501043_0651096 Ga0501043_0651096_47_229 59
1264 3300049580 Ga0501046_0345873 Ga0501046_0345873_487_669 59
1265 3300049581 Ga0501047_0251848 Ga0501047_0251848_410_592 59
1266 3300049582 Ga0501048_0932869 Ga0501048_0932869_348_545 59
1267 3300049584 Ga0501068_0001118 Ga0501068_0001118_6005_6184 59
1268 3300049585 Ga0501069_0786040 Ga0501069_0786040_323_502 59
1269 3300049586 Ga0501070_0031743 Ga0501070_0031743_1072_1251 59
1270 3300049587 Ga0501071_0955919 Ga0501071_0955919_128_307 59
1271 3300049587 Ga0501071_1339514 Ga0501071_1339514_117_296 59
1272 3300049588 Ga0501072_0001234 Ga0501072_0001234_10193_10372 59
1273 3300049589 Ga0501073_0000651 Ga0501073_0000651_4559_4738 59
1274 3300049590 Ga0501074_0231440 Ga0501074_0231440_323_502 59
1275 3300049592 Ga0501076_0374926 Ga0501076_0374926_797_976 59
1276 3300049593 Ga0501077_0320333 Ga0501077_0320333_491_670 59
1277 3300049656 Ga0501209_000078 Ga0501209_000078_2474_2653 59
1278 3300049668 Ga0501233_198393 Ga0501233_198393_360_542 59
1279 3300049669 Ga0501235_034034 Ga0501235_034034_338_520 59
1280 3300049679 Ga0501249_027340 Ga0501249_027340_480_662 59
1281 3300049742 Ga0501080_0000604 Ga0501080_0000604_7751_7930 59
1282 3300049742 Ga0501080_0320684 Ga0501080_0320684_208_390 59
1283 3300049743 Ga0501081_0148790 Ga0501081_0148790_620_799 59
1284 3300049743 Ga0501081_0887637 Ga0501081_0887637_23_202 59
1285 3300049744 Ga0501083_0259184 Ga0501083_0259184_331_510 59
1286 3300049763 Ga0501266_000163 Ga0501266_000163_3836_4018 59
1287 3300049765 Ga0501268_075156 Ga0501268_075156_197_379 59
1288 3300049822 Ga0501035_0099514 Ga0501035_0099514_297_479 59
1289 3300049823 Ga0501044_0003646 Ga0501044_0003646_13589_13768 59
1290 3300049823 Ga0501044_0036229 Ga0501044_0036229_2819_2998 59
1291 3300049823 Ga0501044_0245047 Ga0501044_0245047_1191_1370 59
1292 3300049823 Ga0501044_0812045 Ga0501044_0812045_102_281 59
1293 3300049823 Ga0501044_1223762 Ga0501044_1223762_354_536 59
1294 3300049824 Ga0501045_0561509 Ga0501045_0561509_370_549 59
1295 3300050489 nmdc:mga03683_220198_c1 nmdc:mga03683_220198_c1_591_773 59
1296 3300050489 nmdc:mga03683_31242_c1 nmdc:mga03683_31242_c1_970_1152 59
1297 3300050490 nmdc:mga03n38_530914_c1 nmdc:mga03n38_530914_c1_303_488 59
1298 3300050492 nmdc:mga0yw44_598823_c1 nmdc:mga0yw44_598823_c1_520_702 59
1299 3300050493 nmdc:mga0k408_308126_c1 nmdc:mga0k408_308126_c1_38_220 59
1300 3300050493 nmdc:mga0k408_607118_c1 nmdc:mga0k408_607118_c1_330_512 59
1301 3300050493 nmdc:mga0k408_746819_c1 nmdc:mga0k408_746819_c1_154_336 59
1302 3300050493 nmdc:mga0k408_86809_c1 nmdc:mga0k408_86809_c1_1452_1637 59
1303 3300050493 nmdc:mga0k408_940_c1 nmdc:mga0k408_940_c1_14487_14669 59
1304 3300050496 nmdc:mga07m45_15021_c1 nmdc:mga07m45_15021_c1_462_647 59
1305 3300050496 nmdc:mga07m45_212810_c2 nmdc:mga07m45_212810_c2_37_219 59
1306 3300050496 nmdc:mga07m45_729995_c1 nmdc:mga07m45_729995_c1_367_549 59
1307 3300050496 nmdc:mga07m45_786307_c1 nmdc:mga07m45_786307_c1_71_253 59
1308 3300050507 nmdc:mga05p37_1322380_c1 nmdc:mga05p37_1322380_c1_386_565 59
1309 3300050508 nmdc:mga09592_9523_c1 nmdc:mga09592_9523_c1_3422_3601 59
1310 3300050509 nmdc:mga0qj67_286042_c1 nmdc:mga0qj67_286042_c1_710_889 59
1311 3300050511 nmdc:mga08y16_1000_c1 nmdc:mga08y16_1000_c1_9460_9639 59
1312 3300053083 Ga0495655_0170877 Ga0495655_0170877_413_592 59
1313 3300053087 Ga0500643_035180 Ga0500643_035180_1212_1394 59
1314 3300053088 Ga0500644_0016047 Ga0500644_0016047_545_727 59
1315 3300053090 Ga0500646_0038494 Ga0500646_0038494_511_693 59
1316 3300053108 Ga0500562_001613 Ga0500562_001613_1260_1442 59
1317 3300053109 Ga0500569_080694 Ga0500569_080694_551_733 59
1318 3300053118 Ga0500594_0005237 Ga0500594_0005237_1745_1927 59
1319 3300053125 Ga0500618_000089 Ga0500618_000089_6576_6758 59
1320 3300053136 Ga0500559_0046340 Ga0500559_0046340_1483_1665 59
1321 3300053139 Ga0500568_0338118 Ga0500568_0338118_71_253 59
1322 3300053153 Ga0500616_0027216 Ga0500616_0027216_1699_1881 59
1323 3300053156 Ga0500622_0033857 Ga0500622_0033857_2368_2550 59
1324 3300054114 Ga0501084_0064611 Ga0501084_0064611_2151_2330 59
1325 3300059477 Ga0587084_006518 Ga0587084_006518_473_652 59
1326 3300059477 Ga0587084_027678 Ga0587084_027678_186_365 59
1327 3300059477 Ga0587084_030888 Ga0587084_030888_70_249 59
1328 3300059477 Ga0587084_097968 Ga0587084_097968_338_520 59
1329 3300059478 Ga0587093_017438 Ga0587093_017438_575_754 59
1330 3300059478 Ga0587093_026237 Ga0587093_026237_416_598 59
1331 3300059478 Ga0587093_050875 Ga0587093_050875_212_391 59
1332 3300059478 Ga0587093_070061 Ga0587093_070061_230_412 59
1333 3300059478 Ga0587093_076702 Ga0587093_076702_330_509 59
1334 3300059490 Ga0587066_073682 Ga0587066_073682_139_318 59
1335 3300059490 Ga0587066_081599 Ga0587066_081599_59_238 59
1336 3300059491 Ga0587070_001925 Ga0587070_001925_1030_1209 59
1337 3300059491 Ga0587070_003193 Ga0587070_003193_1300_1479 59
1338 3300059491 Ga0587070_045376 Ga0587070_045376_96_275 59
1339 3300059491 Ga0587070_141909 Ga0587070_141909_277_459 59
1340 3300059492 Ga0587073_0014350 Ga0587073_0014350_761_940 59
1341 3300059493 Ga0587077_012119 Ga0587077_012119_767_946 59
1342 3300059493 Ga0587077_122502 Ga0587077_122502_318_497 59
1343 3300059493 Ga0587077_144587 Ga0587077_144587_92_274 59
1344 3300059503 Ga0587080_024381 Ga0587080_024381_459_638 59
1345 3300059503 Ga0587080_046836 Ga0587080_046836_383_562 59
1346 3300059503 Ga0587080_085853 Ga0587080_085853_231_410 59
1347 3300059504 Ga0587082_008841 Ga0587082_008841_469_648 59
1348 3300059505 Ga0587083_0013579 Ga0587083_0013579_742_921 59
1349 3300059505 Ga0587083_0019354 Ga0587083_0019354_218_397 59
1350 3300059505 Ga0587083_0028806 Ga0587083_0028806_208_387 59
1351 3300059505 Ga0587083_0034614 Ga0587083_0034614_341_520 59
1352 3300059505 Ga0587083_0194068 Ga0587083_0194068_276_458 59
1353 3300059505 Ga0587083_0269335 Ga0587083_0269335_289_471 59
1354 3300059506 Ga0587085_009816 Ga0587085_009816_469_648 59
1355 3300059506 Ga0587085_032916 Ga0587085_032916_373_552 59
1356 3300059506 Ga0587085_060002 Ga0587085_060002_317_499 59
1357 3300059506 Ga0587085_108120 Ga0587085_108120_102_284 59
1358 3300059506 Ga0587085_149440 Ga0587085_149440_278_460 59
1359 3300059507 Ga0587086_008158 Ga0587086_008158_571_750 59
1360 3300059507 Ga0587086_021317 Ga0587086_021317_523_702 59
1361 3300059507 Ga0587086_033214 Ga0587086_033214_279_461 59
1362 3300059507 Ga0587086_048555 Ga0587086_048555_230_412 59
1363 3300059508 Ga0587088_000882 Ga0587088_000882_1751_1930 59
1364 3300059508 Ga0587088_006968 Ga0587088_006968_774_953 59
1365 3300059508 Ga0587088_030437 Ga0587088_030437_617_796 59
1366 3300059508 Ga0587088_045517 Ga0587088_045517_238_417 59
1367 3300059508 Ga0587088_167628 Ga0587088_167628_139_318 59
1368 3300059509 Ga0587089_007933 Ga0587089_007933_631_810 59
1369 3300059510 Ga0587090_003231 Ga0587090_003231_234_413 59
1370 3300059510 Ga0587090_009257 Ga0587090_009257_712_891 59
1371 3300059510 Ga0587090_012737 Ga0587090_012737_140_319 59
1372 3300059510 Ga0587090_065885 Ga0587090_065885_466_645 59
1373 3300059510 Ga0587090_164428 Ga0587090_164428_237_419 59
1374 3300059511 Ga0587091_010895 Ga0587091_010895_469_648 59
1375 3300059511 Ga0587091_070940 Ga0587091_070940_302_481 59
1376 3300059511 Ga0587091_219763 Ga0587091_219763_108_290 59
1377 3300059512 Ga0587092_088939 Ga0587092_088939_230_412 59
1378 3300059513 Ga0587094_000788 Ga0587094_000788_2071_2250 59
1379 3300059513 Ga0587094_066580 Ga0587094_066580_270_449 59
1380 3300059513 Ga0587094_085313 Ga0587094_085313_288_470 59
1381 3300059514 Ga0587095_014951 Ga0587095_014951_59_238 59
1382 3300059603 Ga0587097_04718 Ga0587097_04718_57_236 59
1383 3300059604 Ga0587098_003422 Ga0587098_003422_477_656 59
1384 3300059604 Ga0587098_027475 Ga0587098_027475_281_463 59
1385 3300059604 Ga0587098_064646 Ga0587098_064646_241_420 59
1386 3300059605 Ga0587106_004918 Ga0587106_004918_468_647 59
1387 3300059605 Ga0587106_022386 Ga0587106_022386_709_888 59
1388 3300059605 Ga0587106_109047 Ga0587106_109047_282_464 59
1389 3300059622 Ga0587099_009695 Ga0587099_009695_193_372 59
1390 3300059623 Ga0587101_005345 Ga0587101_005345_767_946 59
1391 3300059623 Ga0587101_010389 Ga0587101_010389_118_297 59
1392 3300059623 Ga0587101_064865 Ga0587101_064865_177_359 59
1393 3300059623 Ga0587101_092923 Ga0587101_092923_204_383 59
1394 3300059624 Ga0587109_013974 Ga0587109_013974_733_915 59
1395 3300059624 Ga0587109_037677 Ga0587109_037677_69_248 59
1396 3300059624 Ga0587109_090453 Ga0587109_090453_301_483 59
1397 3300059625 Ga0587113_040128 Ga0587113_040128_277_456 59
1398 3300059627 Ga0587117_012462 Ga0587117_012462_301_480 59
1399 3300059627 Ga0587117_068196 Ga0587117_068196_409_588 59
1400 3300059627 Ga0587117_106426 Ga0587117_106426_288_470 59
1401 3300059628 Ga0587122_039863 Ga0587122_039863_64_243 59
1402 3300059630 Ga0587128_006927 Ga0587128_006927_767_946 59
1403 3300059630 Ga0587128_047518 Ga0587128_047518_318_497 59
1404 3300059630 Ga0587128_068546 Ga0587128_068546_278_457 59
1405 3300059639 Ga0587062_029227 Ga0587062_029227_393_572 59
1406 3300059639 Ga0587062_090492 Ga0587062_090492_229_411 59
1407 3300059640 Ga0587067_001455 Ga0587067_001455_1619_1798 59
1408 3300059640 Ga0587067_091754 Ga0587067_091754_298_477 59
1409 3300059641 Ga0587068_009221 Ga0587068_009221_469_648 59
1410 3300059641 Ga0587068_019527 Ga0587068_019527_446_625 59
1411 3300059641 Ga0587068_025175 Ga0587068_025175_573_752 59
1412 3300059641 Ga0587068_080168 Ga0587068_080168_283_465 59
1413 3300059641 Ga0587068_160640 Ga0587068_160640_198_380 59
1414 3300059642 Ga0587069_007418 Ga0587069_007418_707_886 59
1415 3300059642 Ga0587069_012315 Ga0587069_012315_417_596 59
1416 3300059642 Ga0587069_115643 Ga0587069_115643_123_302 59
1417 3300059643 Ga0587072_000318 Ga0587072_000318_2644_2823 59
1418 3300059643 Ga0587072_015319 Ga0587072_015319_919_1098 59
1419 3300059644 Ga0587075_006769 Ga0587075_006769_469_648 59
1420 3300059644 Ga0587075_007812 Ga0587075_007812_970_1149 59
1421 3300059644 Ga0587075_120187 Ga0587075_120187_290_472 59
1422 3300059644 Ga0587075_129184 Ga0587075_129184_314_493 59
1423 3300059645 Ga0587076_001018 Ga0587076_001018_469_648 59
1424 3300059645 Ga0587076_053980 Ga0587076_053980_172_351 59
1425 3300059645 Ga0587076_096236 Ga0587076_096236_407_586 59
1426 3300059645 Ga0587076_154540 Ga0587076_154540_76_258 59
1427 3300059646 Ga0587078_004582 Ga0587078_004582_337_516 59
1428 3300059646 Ga0587078_005901 Ga0587078_005901_666_845 59
1429 3300059646 Ga0587078_025270 Ga0587078_025270_77_256 59
1430 3300059646 Ga0587078_038185 Ga0587078_038185_278_457 59
1431 3300059647 Ga0587079_005815 Ga0587079_005815_829_1008 59
1432 3300059647 Ga0587079_008433 Ga0587079_008433_375_554 59
1433 3300059647 Ga0587079_040050 Ga0587079_040050_229_408 59
1434 3300059647 Ga0587079_250102 Ga0587079_250102_254_433 59
1435 3300059648 Ga0587100_015477 Ga0587100_015477_56_235 59
1436 3300059649 Ga0587102_002623 Ga0587102_002623_471_650 59
1437 3300059649 Ga0587102_003037 Ga0587102_003037_184_363 59
1438 3300059650 Ga0587104_000990 Ga0587104_000990_466_645 59
1439 3300059651 Ga0587105_008812 Ga0587105_008812_95_274 59
1440 3300059651 Ga0587105_014206 Ga0587105_014206_75_254 59
1441 3300059652 Ga0587107_050553 Ga0587107_050553_59_238 59
1442 3300059653 Ga0587108_004500 Ga0587108_004500_384_563 59
1443 3300059653 Ga0587108_007881 Ga0587108_007881_312_491 59
1444 3300059654 Ga0587110_017285 Ga0587110_017285_463_642 59
1445 3300059657 Ga0587118_25462 Ga0587118_25462_107_289 59
1446 3300059659 Ga0587120_011487 Ga0587120_011487_427_606 59
1447 3300059660 Ga0587124_001169 Ga0587124_001169_953_1132 59
1448 3300059660 Ga0587124_024105 Ga0587124_024105_248_427 59
1449 3300060344 Ga0587071_013457 Ga0587071_013457_768_947 59
1450 3300060344 Ga0587071_069557 Ga0587071_069557_281_463 59
1451 3300060344 Ga0587071_086867 Ga0587071_086867_142_324 59
1452 3300060344 Ga0587071_161341 Ga0587071_161341_189_368 59
1453 3300060344 Ga0587071_222899 Ga0587071_222899_161_340 59
1454 3300060346 Ga0587111_0005708 Ga0587111_0005708_900_1079 59
1455 3300060346 Ga0587111_0015287 Ga0587111_0015287_761_940 59
1456 3300060346 Ga0587111_0023929 Ga0587111_0023929_534_713 59
1457 3300060346 Ga0587111_0035749 Ga0587111_0035749_609_791 59
1458 3300060346 Ga0587111_0108202 Ga0587111_0108202_259_441 59
1459 3300060346 Ga0587111_0129360 Ga0587111_0129360_307_486 59
1460 3300060346 Ga0587111_0222049 Ga0587111_0222049_75_257 59
1461 3300060353 Ga0501082_0403934 Ga0501082_0403934_448_627 59
1462 3300060353 Ga0501082_0726448 Ga0501082_0726448_24_203 59
1463 3300061719 Ga0466962_0018616 Ga0466962_0018616_2131_2310 59
1464 3300061719 Ga0466962_0019466 Ga0466962_0019466_1275_1454 59
1465 3300061719 Ga0466962_0133377 Ga0466962_0133377_123_302 59
1466 3300061719 Ga0466962_0174343 Ga0466962_0174343_597_776 59
1467 3300061719 Ga0466962_0342271 Ga0466962_0342271_261_443 59
1468 3300061734 Ga0530510_0782690 Ga0530510_0782690_264_443 59

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01783

Ribosomal_L32p

Ribosomal L32p protein family

2

55

0.98

Feature Viewer

pLDDT pTM Quality
61.33 0.24 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map