F497150

General Info

Members Datasets Scaffolds Average Seq Length
2929 1013 2497 449

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0000009|Ga0496114_0000009_125233_126816
Length 510
Sequence MNPEQGIFDLQGSHPNLSARPAPPETVGTPFCVCAQMLGGWTTPEGETMNDYTATLTVDADTEMISSRERAKNPAEPEFHQAVQEVAESLGPVLERHPEYRHARILERIIEPERVLMFRVPWQDDRGAVQINRGFRIEMNSAIGPYKGGLRFHPSVNLGILKFLAFEQVFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELCRHIGPNTDVPAGDIGVGGREIGYLFGQYKRLRNEFTGVLTGKGLNWGGSLIRPEATGYGCVYFAQEMLATRKQTLDGKTCLVSGSGNVAQYTVEKLLDLGAKPITLSDSSGYIIDEHGIDRERLAYVLDLKNVRRGRIEEYADQFKTAIYIPTTPGASHNPLWDMKADCAFPSATQNEINGKDAENLLRNGVYLVAEGANMPTHIDGVNKFVDAGILYGPGKAANAGGVATSGLEMAQNSMRYSWTREEVDNRLHLIMKSIHKACVETADRFGTPGNYVNGANIAGFLKVADAMMDQGLV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231017 Pseudomonas sp. GM55 Isolate Nodule
15 2511231018 Pseudomonas sp. GM60 Isolate Nodule
16 2511231019 Pseudomonas sp. GM67 Isolate Nodule
17 2511231020 Pseudomonas sp. GM74 Isolate Nodule
18 2511231021 Pseudomonas sp. GM78 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
24 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
25 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
26 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
27 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
28 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
29 2547132181 Kosakonia sacchari SP1 Isolate Stem
30 2547132374 Acidovorax radicis N35 Isolate Unclassified
31 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
32 2547132512 Azospira oryzae 6a3 Isolate Unclassified
33 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
34 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
35 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
36 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
37 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
38 2561511199 Enterobacter sp. R4-368 Isolate Nodule
39 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
40 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
41 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
42 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
43 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
44 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
45 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
46 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
47 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
48 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
49 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
50 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
51 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
52 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
53 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
54 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
55 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
56 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
57 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
58 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
59 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
60 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
61 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
62 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
63 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
64 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
65 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
66 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
67 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
68 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
69 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
70 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
71 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
72 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
73 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
74 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
75 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
76 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
77 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
78 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
79 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
80 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
81 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
82 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
83 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
84 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
85 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
86 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
87 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
88 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
89 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
90 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
91 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
92 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
93 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
94 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
95 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
96 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
97 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
98 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
99 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
100 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
101 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
102 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
103 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
104 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
105 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
106 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
107 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
108 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
109 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
110 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
111 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
112 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
113 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
114 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
115 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
116 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
117 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
118 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
119 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
120 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
121 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
122 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
123 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
124 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
125 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
126 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
127 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
128 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
129 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
130 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
131 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
132 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
133 2636415599 Klebsiella variicola DX120E Isolate Unclassified
134 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
135 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
136 2643221569 Achromobacter sp. Root565 Isolate Unclassified
137 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
138 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
139 2643221594 Achromobacter sp. Root170 Isolate Unclassified
140 2643221596 Acidovorax sp. Root70 Isolate Unclassified
141 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
142 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
143 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
144 2643221609 Acidovorax sp. Root217 Isolate Unclassified
145 2643221611 Acidovorax sp. Root219 Isolate Unclassified
146 2643221621 Achromobacter sp. Root83 Isolate Unclassified
147 2643221652 Acidovorax sp. Root402 Isolate Unclassified
148 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
149 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
150 2643221683 Variovorax sp. Root473 Isolate Unclassified
151 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
152 2643221717 Acidovorax sp. Root267 Isolate Unclassified
153 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
154 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
155 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
156 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
157 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
158 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
159 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
160 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
161 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
162 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
163 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
164 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
165 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
166 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
167 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
168 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
169 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
170 2721755523 Delftia sp. HK171 Isolate Unclassified
171 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
172 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
173 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
174 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
175 2738541277 Variovorax sp. GV051 Isolate Unclassified
176 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
177 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
178 2738541284 Pedobacter sp. YR016 Isolate Unclassified
179 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
180 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
181 2738541307 Variovorax sp. GV008 Isolate Unclassified
182 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
183 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
184 2738543012 Acidovorax sp. CF301 Isolate Unclassified
185 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
186 2738543019 Variovorax sp. GV040 Isolate Unclassified
187 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
188 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
189 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
190 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
191 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
192 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
193 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
194 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
195 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
196 2751185917 Enterobacter sp. HK169 Isolate Unclassified
197 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
198 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
199 2765235841 Pseudomonas putida AA7 Isolate Unclassified
200 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
201 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
202 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
203 2773857673 Pseudomonas sp. 443 Isolate Unclassified
204 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
205 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
206 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
207 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
208 2775507074 Klebsiella sp. D5A Isolate Unclassified
209 2784132063 Pseudomonas sp. 424 Isolate Unclassified
210 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
211 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
212 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
213 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
214 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
215 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
216 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
217 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
218 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
219 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
220 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
221 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
222 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
223 2816332133 Acidovorax radicis 2721A Isolate Unclassified
224 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
225 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
226 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
227 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
228 2821118458 Enterobacter asburiae 609 Isolate Unclassified
229 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
230 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
231 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
232 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
233 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
234 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
235 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
236 2842733646 Variovorax sp. R-72446 Isolate Unclassified
237 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
238 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
239 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
240 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
241 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
242 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
243 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
244 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
245 2847085930 Erwinia persicina B64 Isolate Bulb
246 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
247 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
248 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
249 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
250 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
251 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
252 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
253 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
254 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
255 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
256 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
257 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
258 2858950400 Achromobacter sp. K91 Isolate Unclassified
259 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
260 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
261 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
262 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
263 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
264 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
265 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
266 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
267 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
268 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
269 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
270 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
271 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
272 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
273 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
274 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
275 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
276 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
277 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
278 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
279 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
280 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
281 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
282 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
283 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
284 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
285 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
286 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
287 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
288 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
289 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
290 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
291 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
292 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
293 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
294 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
295 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
296 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
297 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
298 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
299 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
300 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
301 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
302 2919150387 Rahnella aceris 1817 Isolate Unclassified
303 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
304 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
305 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
306 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
307 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
308 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
309 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
310 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
311 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
312 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
313 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
314 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
315 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
316 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
317 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
318 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
319 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
320 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
321 2927143783 Rahnella sp. 2050 Isolate Unclassified
322 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
323 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
324 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
325 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
326 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
327 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
328 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
329 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
330 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
331 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
332 2937539931 Pantoea sp. LS15 Isolate Unclassified
333 2937967321 Serratia sp. YC16 Isolate Unclassified
334 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
335 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
336 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
337 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
338 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
339 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
340 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
341 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
342 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
343 2941479691
344 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
345 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
346 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
347 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
348 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
349 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
350 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
351 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
352 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
353 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
354 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
355 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
356 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
357 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
358 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
359 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
360 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
361 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
362 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
363 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
364 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
365 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
366 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
367 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
368 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
369 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
370 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
371 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
372 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
373 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
374 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
375 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
376 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
377 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
378 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
379 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
380 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
381 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
382 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
383 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
384 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
385 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
386 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
387 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
388 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
389 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
390 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
391 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
392 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
393 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
394 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
395 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
396 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
397 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
398 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
399 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
400 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
401 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
402 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
403 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
404 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
405 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
406 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
407 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
408 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
409 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
410 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
411 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
412 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
413 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
414 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
415 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
416 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
417 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
418 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
419 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
420 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
421 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
422 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
423 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
424 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
425 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
426 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
427 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
428 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
429 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
430 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
431 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
432 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
433 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
434 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
435 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
436 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
437 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
438 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
439 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
440 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
441 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
442 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
443 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
444 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
445 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
446 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
447 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
448 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
449 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
450 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
451 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
452 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
453 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
454 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
455 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
456 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
457 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
458 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
459 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
460 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
461 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
462 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
463 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
464 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
465 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
466 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
467 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
468 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
469 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
470 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
471 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
472 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
473 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
474 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
475 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
476 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
477 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
478 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
479 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
480 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
481 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
482 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
483 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
484 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
485 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
486 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
487 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
488 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
489 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
490 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
491 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
492 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
493 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
494 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
495 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
496 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
497 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
498 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
499 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
500 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
501 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
502 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
503 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
504 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
505 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
506 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
507 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
508 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
509 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
510 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
511 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
512 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
513 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
514 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
515 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
516 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
517 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
518 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
519 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
520 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
521 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
522 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
523 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
524 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
525 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
526 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
527 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
528 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
529 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
530 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
531 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
532 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
533 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
534 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
535 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
536 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
537 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
538 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
539 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
540 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
541 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
542 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
543 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
544 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
545 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
546 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
547 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
548 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
549 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
550 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
551 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
552 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
553 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
554 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
555 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
557 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
558 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
561 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
562 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
563 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
564 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
565 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
566 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
567 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
568 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
569 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
570 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
571 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
572 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
574 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
643 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
644 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
645 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
646 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
647 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
648 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
649 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
650 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
651 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
653 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
654 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
655 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
656 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
658 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
660 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
661 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
662 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
663 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
664 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
665 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
666 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
667 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
668 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
669 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
670 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
671 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
672 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
673 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
674 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
675 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
676 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
677 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
678 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
679 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
680 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
681 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
682 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
683 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
684 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
685 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
686 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
687 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
688 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
689 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
690 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
691 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
692 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
693 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
694 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
695 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
696 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
697 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
698 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
699 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
700 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
701 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
702 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
703 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
704 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
705 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
706 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
707 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
708 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
709 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
710 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
711 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
712 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
713 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
714 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
716 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
718 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
719 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
720 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
721 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
722 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
723 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
724 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
725 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
726 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
727 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
728 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
729 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
730 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
731 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
732 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
733 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
734 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
735 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
736 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
737 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
738 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
739 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
740 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
741 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
742 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
743 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
744 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
745 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
746 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
747 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
748 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
749 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
750 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
751 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
752 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
753 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
754 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
755 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
756 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
757 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
758 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
759 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
760 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
761 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
762 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
763 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
764 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
765 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
766 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
767 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
768 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
769 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
770 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
771 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
772 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
773 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
774 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
775 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
776 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
777 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
778 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
779 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
780 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
781 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
782 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
783 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
784 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
785 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
786 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
787 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
788 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
789 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
790 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
791 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
792 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
793 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
794 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
795 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
796 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
797 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
798 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
799 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
800 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
801 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
802 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
803 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
804 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
805 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
806 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
807 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
808 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
809 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
810 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
811 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
812 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
813 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
814 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
815 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
816 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
817 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
818 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
819 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
820 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
821 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
822 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
823 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
824 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
825 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
826 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
827 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
828 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
829 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
830 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
831 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
832 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
833 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
834 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
835 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
836 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
837 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
838 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
839 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
840 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
841 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
842 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
843 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
844 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
845 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
846 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
847 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
848 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
849 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
850 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
851 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
852 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
853 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
854 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
855 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
856 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
857 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
858 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
859 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
860 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
861 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
862 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
863 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
864 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
865 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
866 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
867 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
868 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
869 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
870 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
871 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
872 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
873 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
874 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
875 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
876 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
877 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
878 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
879 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
880 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
881 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
882 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
883 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
884 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
885 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
886 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
887 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
888 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
889 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
890 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
891 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
892 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
893 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
894 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
895 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
896 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
897 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
898 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
899 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
900 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
901 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
902 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
903 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
904 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
905 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
906 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
907 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
908 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
909 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
910 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
911 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
912 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
913 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
914 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
915 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
916 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
917 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
918 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
919 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
920 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
921 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
922 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
923 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
924 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
925 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
926 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
927 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
928 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
929 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
930 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
931 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
932 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
933 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
934 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
935 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
936 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
937 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
938 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
939 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
940 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
941 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
942 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
943 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
944 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
945 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
946 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
947 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
948 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
949 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
950 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
951 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
952 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
953 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
954 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
955 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
956 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
957 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
958 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
959 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
960 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
961 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
962 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
963 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
964 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
965 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
966 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
967 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
968 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
969 640753048 Serratia proteamaculans 568 Isolate Endosphere
970 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
971 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
972 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
973 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
974 8004592986 Serratia sp. S119 Isolate Unclassified
975 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
976 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
977 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
978 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
979 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
980 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
981 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
982 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
983 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
984 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
985 8052494512 Pseudomonas putida LD6 Isolate Unclassified
986 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
987 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
988 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
989 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
990 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
991 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
992 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
993 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
994 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
995 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
996 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
997 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
998 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
999 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1000 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
1001 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
1002 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1003 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1004 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1005 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1006 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1007 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1008 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1009 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1010 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere
1011 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1012 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
1013 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.42
Metatranscriptomes 0.2
Isolates 14.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0.03
Endosphere 3.79
Nodule 1.5
Rhizoplane 5.5
Rhizosphere 75.18
Stem 0.03
Stem Tuber 0.17
Unclassified 13.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1215741 2162886007 Bacteria 7157
2 MBSR1b_contig_7611668 2162886012 Bacteria 2977
3 CNXas_1000011 3300000545 Bacteria 39332
4 JGI24741J21665_1000421 3300001915 Bacteria 12841
5 JGI24033J26618_1000723 3300002155 Bacteria 3171
6 JGI24751J29686_10001414 3300002459 Bacteria 5030
7 JGI24751J29686_10007421 3300002459 Bacteria 2240
8 JGI25162J39368_1001029 3300002737 Bacteria 17235
9 JGI25163J39215_1000205 3300002771 Bacteria 22705
10 JGI25163J39215_1000395 3300002771 Bacteria 13867
11 JGI25164J39214_1000008 3300002772 Bacteria 311285
12 JGI25164J39214_1000550 3300002772 Bacteria 17235
13 JGI25406J46586_10013161 3300003203 Bacteria 3565
14 JGI25406J46586_10015249 3300003203 Bacteria 3246
15 JGI25165J46597_1000391 3300003214 Bacteria 46730
16 rootH2_10055948 3300003320 Bacteria 3070
17 rootL2_10170469 3300003322 Bacteria 1949
18 Ga0006562J51391_1009174 3300003578 Bacteria 3659
19 Ga0006562J51391_1013379 3300003578 Bacteria 3111
20 Ga0055538_1000014 3300003751 Bacteria 311285
21 Ga0055538_1000065 3300003751 Bacteria 100831
22 Ga0055539_1000020 3300003752 Bacteria 311285
23 Ga0055539_1000099 3300003752 Bacteria 100831
24 Ga0055533_1000027 3300003756 Bacteria 311285
25 Ga0055533_1000109 3300003756 Bacteria 100831
26 Ga0055532_1000094 3300003758 Bacteria 100832
27 Ga0055525_1000032 3300003759 Bacteria 311285
28 Ga0055525_1000143 3300003759 Bacteria 100831
29 Ga0055535_1005097 3300003761 Bacteria 2980
30 Ga0055526_1000233 3300003771 Bacteria 46692
31 Ga0055526_1002689 3300003771 Bacteria 11842
32 Ga0055524_1000159 3300003775 Bacteria 78586
33 Ga0055536_1000059 3300003781 Bacteria 103307
34 Ga0055536_1001131 3300003781 Bacteria 16699
35 Ga0055536_1004497 3300003781 Bacteria 7100
36 Ga0055536_1004850 3300003781 Bacteria 6722
37 Ga0055534_1009665 3300003784 Bacteria 2078
38 Ga0055530_10001818 3300003791 Bacteria 14748
39 Ga0055530_10002957 3300003791 Bacteria 10254
40 Ga0055530_10005896 3300003791 Bacteria 5658
41 Ga0055540_1000023 3300003792 Bacteria 201131
42 Ga0055540_1000084 3300003792 Bacteria 107482
43 Ga0055540_1003017 3300003792 Bacteria 8420
44 Ga0055540_1005110 3300003792 Bacteria 5654
45 Ga0055531_10000213 3300003794 Bacteria 63699
46 Ga0055531_10005322 3300003794 Bacteria 7550
47 Ga0055541_1000014 3300003841 Bacteria 311285
48 Ga0055541_1000066 3300003841 Bacteria 100831
49 Ga0058692_1000014 3300003856 Bacteria 313984
50 Ga0058692_1000796 3300003856 Bacteria 12621
51 Ga0058692_1001239 3300003856 Bacteria 9769
52 Ga0058692_1003345 3300003856 Bacteria 4972
53 Ga0058692_1003397 3300003856 Bacteria 4925
54 Ga0058692_1003486 3300003856 Bacteria 4849
55 Ga0058692_1004114 3300003856 Bacteria 4364
56 Ga0065165_1000539 3300005262 Bacteria 57421
57 Ga0065703_1018772 3300005272 Bacteria 9412
58 Ga0065703_1019024 3300005272 Bacteria 4335
59 Ga0065714_10002224 3300005288 Bacteria 45363
60 Ga0065714_10002661 3300005288 Bacteria 44282
61 Ga0065714_10002760 3300005288 Bacteria 11166
62 Ga0065714_10003556 3300005288 Bacteria 8571
63 Ga0065714_10064639 3300005288 Bacteria 26594
64 Ga0065714_10067571 3300005288 Bacteria 5367
65 Ga0065714_10068318 3300005288 Bacteria 4816
66 Ga0065714_10070672 3300005288 Bacteria 3797
67 Ga0065714_10084095 3300005288 Bacteria 2215
68 Ga0065714_10100057 3300005288 Bacteria 1673
69 Ga0065714_10101317 3300005288 Bacteria 1646
70 Ga0065704_10000562 3300005289 Bacteria 16554
71 Ga0065704_10002082 3300005289 Bacteria 7107
72 Ga0065704_10003382 3300005289 Bacteria 5777
73 Ga0065704_10078770 3300005289 Bacteria 4338
74 Ga0065704_10082107 3300005289 Bacteria 3652
75 Ga0065704_10084957 3300005289 Bacteria 3277
76 Ga0065704_10135794 3300005289 Bacteria 1573
77 Ga0065712_10117391 3300005290 Bacteria 1721
78 Ga0065715_10001484 3300005293 Bacteria 8424
79 Ga0065715_10019057 3300005293 Bacteria 2810
80 Ga0065715_10026204 3300005293 Bacteria 1899
81 Ga0065715_10126408 3300005293 Bacteria 2109
82 Ga0065707_10008614 3300005295 Bacteria 3309
83 Ga0065707_10121134 3300005295 Bacteria 2117
84 Ga0065707_10136519 3300005295 Bacteria 1827
85 Ga0065707_10144561 3300005295 Bacteria 1729
86 Ga0070676_10003061 3300005328 Bacteria 8636
87 Ga0070676_10015658 3300005328 Bacteria 4185
88 Ga0070676_10050231 3300005328 Bacteria 2444
89 Ga0070676_10093862 3300005328 Bacteria 1843
90 Ga0070683_100037047 3300005329 Bacteria 4464
91 Ga0070683_100087539 3300005329 Bacteria 2922
92 Ga0070683_100140797 3300005329 Bacteria 2285
93 Ga0070690_100009715 3300005330 Bacteria 5580
94 Ga0070690_100080595 3300005330 Bacteria 2129
95 Ga0070690_100125984 3300005330 Bacteria 1724
96 Ga0070670_100000189 3300005331 Bacteria 56435
97 Ga0070670_100007325 3300005331 Bacteria 9363
98 Ga0070670_100009786 3300005331 Bacteria 8188
99 Ga0070670_100017994 3300005331 Bacteria 6065
100 Ga0070670_100019496 3300005331 Bacteria 5821
101 Ga0070670_100081900 3300005331 Bacteria 2773
102 Ga0070670_100101339 3300005331 Bacteria 2479
103 Ga0070670_100149293 3300005331 Bacteria 2023
104 Ga0068869_100101382 3300005334 Bacteria 2178
105 Ga0070666_10006496 3300005335 Bacteria 7183
106 Ga0070666_10048619 3300005335 Bacteria 2850
107 Ga0070680_100004033 3300005336 Bacteria 10986
108 Ga0070680_100076216 3300005336 Bacteria 2760
109 Ga0070682_100000015 3300005337 Bacteria 249390
110 Ga0070682_100001862 3300005337 Bacteria 11767
111 Ga0070682_100014412 3300005337 Bacteria 4567
112 Ga0070682_100028533 3300005337 Bacteria 3357
113 Ga0068868_100002429 3300005338 Bacteria 12908
114 Ga0068868_100054873 3300005338 Bacteria 3142
115 Ga0070660_100008148 3300005339 Bacteria 7323
116 Ga0070660_100143983 3300005339 Bacteria 1914
117 Ga0070689_100006764 3300005340 Bacteria 7972
118 Ga0070689_100045716 3300005340 Bacteria 3372
119 Ga0070689_100054345 3300005340 Bacteria 3100
120 Ga0070689_100079510 3300005340 Bacteria 2572
121 Ga0070689_100119361 3300005340 Bacteria 2105
122 Ga0070689_100149461 3300005340 Bacteria 1883
123 Ga0070691_10029888 3300005341 Bacteria 2551
124 Ga0070687_100059499 3300005343 Bacteria 2012
125 Ga0070661_100001680 3300005344 Bacteria 15324
126 Ga0070692_10083966 3300005345 Bacteria 1720
127 Ga0070668_100020911 3300005347 Bacteria 4943
128 Ga0070668_100185899 3300005347 Bacteria 1699
129 Ga0070669_100000002 3300005353 Bacteria 506497
130 Ga0070669_100002540 3300005353 Bacteria 13189
131 Ga0070669_100005374 3300005353 Bacteria 9243
132 Ga0070669_100007453 3300005353 Bacteria 7839
133 Ga0070669_100010572 3300005353 Bacteria 6554
134 Ga0070669_100038114 3300005353 Bacteria 3489
135 Ga0070675_100021663 3300005354 Bacteria 5135
136 Ga0070675_100033490 3300005354 Bacteria 4166
137 Ga0070675_100034683 3300005354 Bacteria 4096
138 Ga0070675_100059434 3300005354 Bacteria 3153
139 Ga0070675_100147001 3300005354 Bacteria 2019
140 Ga0070671_100002469 3300005355 Bacteria 14294
141 Ga0070671_100012326 3300005355 Bacteria 6883
142 Ga0070671_100025279 3300005355 Bacteria 4871
143 Ga0070671_100045314 3300005355 Bacteria 3656
144 Ga0070671_100068159 3300005355 Bacteria 2967
145 Ga0070671_100083951 3300005355 Bacteria 2664
146 Ga0070671_100086392 3300005355 Bacteria 2624
147 Ga0070674_100003746 3300005356 Bacteria 8578
148 Ga0070674_100008167 3300005356 Bacteria 6214
149 Ga0070674_100085340 3300005356 Bacteria 2266
150 Ga0070673_100027228 3300005364 Bacteria 4236
151 Ga0070673_100029158 3300005364 Bacteria 4113
152 Ga0070673_100033180 3300005364 Bacteria 3895
153 Ga0070673_100057777 3300005364 Bacteria 3066
154 Ga0070673_100153400 3300005364 Bacteria 1953
155 Ga0070688_100008929 3300005365 Bacteria 5458
156 Ga0070688_100110024 3300005365 Bacteria 1831
157 Ga0070659_100025516 3300005366 Bacteria 4540
158 Ga0070659_100027673 3300005366 Bacteria 4370
159 Ga0070659_100034003 3300005366 Bacteria 3964
160 Ga0070667_100035493 3300005367 Bacteria 4177
161 Ga0070667_100052614 3300005367 Bacteria 3437
162 Ga0070703_10020319 3300005406 Bacteria 1931
163 Ga0070709_10001725 3300005434 Bacteria 11883
164 Ga0070709_10002168 3300005434 Bacteria 10639
165 Ga0070709_10103649 3300005434 Bacteria 1900
166 Ga0070714_100000060 3300005435 Bacteria 100913
167 Ga0070714_100000531 3300005435 Bacteria 27590
168 Ga0070714_100004116 3300005435 Bacteria 10936
169 Ga0070713_100001174 3300005436 Bacteria 16741
170 Ga0070713_100007027 3300005436 Bacteria 7862
171 Ga0070713_100023927 3300005436 Bacteria 4750
172 Ga0070713_100027544 3300005436 Bacteria 4475
173 Ga0070713_100047633 3300005436 Bacteria 3524
174 Ga0070713_100171450 3300005436 Bacteria 1944
175 Ga0070710_10005313 3300005437 Bacteria 6106
176 Ga0070701_10004411 3300005438 Bacteria 5694
177 Ga0070701_10006353 3300005438 Bacteria 4971
178 Ga0070711_100005895 3300005439 Bacteria 7355
179 Ga0070711_100158986 3300005439 Bacteria 1711
180 Ga0070705_100056768 3300005440 Bacteria 2307
181 Ga0070700_100004050 3300005441 Bacteria 7628
182 Ga0070700_100088227 3300005441 Bacteria 2018
183 Ga0070694_100020058 3300005444 Bacteria 4257
184 Ga0070708_100018696 3300005445 Bacteria 5801
185 Ga0070708_100019125 3300005445 Bacteria 5747
186 Ga0070708_100021917 3300005445 Bacteria 5413
187 Ga0070708_100032717 3300005445 Bacteria 4513
188 Ga0070708_100079345 3300005445 Bacteria 2969
189 Ga0070708_100090608 3300005445 Bacteria 2784
190 Ga0070708_100291261 3300005445 Bacteria 1537
191 Ga0070663_100070110 3300005455 Bacteria 2548
192 Ga0070678_100023462 3300005456 Bacteria 4112
193 Ga0070678_100081831 3300005456 Bacteria 2449
194 Ga0070678_100089453 3300005456 Bacteria 2357
195 Ga0070662_100001386 3300005457 Bacteria 14913
196 Ga0070662_100026299 3300005457 Bacteria 4029
197 Ga0070662_100105116 3300005457 Bacteria 2143
198 Ga0070681_10000172 3300005458 Bacteria 49288
199 Ga0070681_10000495 3300005458 Bacteria 32115
200 Ga0070681_10022247 3300005458 Bacteria 6364
201 Ga0070681_10027448 3300005458 Bacteria 5724
202 Ga0070681_10085711 3300005458 Bacteria 3103
203 Ga0070681_10124630 3300005458 Bacteria 2509
204 Ga0068867_100026060 3300005459 Bacteria 4195
205 Ga0070685_10003429 3300005466 Bacteria 8060
206 Ga0070706_100000060 3300005467 Bacteria 131097
207 Ga0070706_100001072 3300005467 Bacteria 29564
208 Ga0070706_100007318 3300005467 Bacteria 10356
209 Ga0070706_100008244 3300005467 Bacteria 9719
210 Ga0070706_100011145 3300005467 Bacteria 8345
211 Ga0070706_100025389 3300005467 Bacteria 5452
212 Ga0070706_100033458 3300005467 Bacteria 4745
213 Ga0070706_100035898 3300005467 Bacteria 4577
214 Ga0070706_100060806 3300005467 Bacteria 3487
215 Ga0070706_100062989 3300005467 Bacteria 3426
216 Ga0070707_100034163 3300005468 Bacteria 4849
217 Ga0070707_100036019 3300005468 Bacteria 4721
218 Ga0070707_100038068 3300005468 Bacteria 4593
219 Ga0070707_100042560 3300005468 Bacteria 4348
220 Ga0070707_100048349 3300005468 Bacteria 4075
221 Ga0070707_100049763 3300005468 Bacteria 4017
222 Ga0070707_100061094 3300005468 Bacteria 3613
223 Ga0070707_100109597 3300005468 Bacteria 2677
224 Ga0070698_100001426 3300005471 Bacteria 26470
225 Ga0070698_100005312 3300005471 Bacteria 14096
226 Ga0070698_100008064 3300005471 Bacteria 11390
227 Ga0070698_100008930 3300005471 Bacteria 10782
228 Ga0070698_100014479 3300005471 Bacteria 8329
229 Ga0070698_100025959 3300005471 Bacteria 6103
230 Ga0070698_100027732 3300005471 Bacteria 5886
231 Ga0070698_100034898 3300005471 Bacteria 5203
232 Ga0070698_100199202 3300005471 Bacteria 1938
233 Ga0070699_100006077 3300005518 Bacteria 10561
234 Ga0070699_100006860 3300005518 Bacteria 9911
235 Ga0070699_100011665 3300005518 Bacteria 7586
236 Ga0070699_100043920 3300005518 Bacteria 3868
237 Ga0070699_100051172 3300005518 Bacteria 3576
238 Ga0070699_100091272 3300005518 Bacteria 2663
239 Ga0070699_100103345 3300005518 Bacteria 2499
240 Ga0070699_100210724 3300005518 Bacteria 1730
241 Ga0070699_100243734 3300005518 Bacteria 1605
242 Ga0070684_100002299 3300005535 Bacteria 14095
243 Ga0070697_100002882 3300005536 Bacteria 13227
244 Ga0070697_100012468 3300005536 Bacteria 6660
245 Ga0070697_100129784 3300005536 Bacteria 2113
246 Ga0070697_100134395 3300005536 Bacteria 2076
247 Ga0070697_100214454 3300005536 Bacteria 1640
248 Ga0068853_100001735 3300005539 Bacteria 15980
249 Ga0068853_100117004 3300005539 Bacteria 2374
250 Ga0070672_100003894 3300005543 Bacteria 9725
251 Ga0070672_100005318 3300005543 Bacteria 8524
252 Ga0070672_100028350 3300005543 Bacteria 4188
253 Ga0070686_100065481 3300005544 Bacteria 2361
254 Ga0070696_100028410 3300005546 Bacteria 3817
255 Ga0070696_100111662 3300005546 Bacteria 1969
256 Ga0070693_100011413 3300005547 Bacteria 4474
257 Ga0070665_100005369 3300005548 Bacteria 13234
258 Ga0070665_100096789 3300005548 Bacteria 2956
259 Ga0070665_100235460 3300005548 Bacteria 1831
260 Ga0070704_100000472 3300005549 Bacteria 18965
261 Ga0070704_100174140 3300005549 Bacteria 1715
262 Ga0068855_100026120 3300005563 Bacteria 6986
263 Ga0068855_100090625 3300005563 Bacteria 3528
264 Ga0068855_100113023 3300005563 Bacteria 3116
265 Ga0068855_100194281 3300005563 Bacteria 2287
266 Ga0068855_100335573 3300005563 Bacteria 1668
267 Ga0070664_100000749 3300005564 Bacteria 25062
268 Ga0070664_100002405 3300005564 Bacteria 15038
269 Ga0068857_100003295 3300005577 Bacteria 13415
270 Ga0068857_100074806 3300005577 Bacteria 3019
271 Ga0068854_100004716 3300005578 Bacteria 8591
272 Ga0068854_100146062 3300005578 Bacteria 1819
273 Ga0068856_100001235 3300005614 Bacteria 26818
274 Ga0068856_100062067 3300005614 Bacteria 3692
275 Ga0068856_100068869 3300005614 Bacteria 3498
276 Ga0068856_100224725 3300005614 Bacteria 1893
277 Ga0068852_100103199 3300005616 Bacteria 2578
278 Ga0068859_100000021 3300005617 Bacteria 236322
279 Ga0068859_100026993 3300005617 Bacteria 5761
280 Ga0068859_100036793 3300005617 Bacteria 4914
281 Ga0068859_100053293 3300005617 Bacteria 4068
282 Ga0068859_100168190 3300005617 Bacteria 2273
283 Ga0068864_100038194 3300005618 Bacteria 4099
284 Ga0068861_100009201 3300005719 Bacteria 6812
285 Ga0068851_10000002 3300005834 Bacteria 302756
286 Ga0068863_100004355 3300005841 Bacteria 13953
287 Ga0068863_100138624 3300005841 Bacteria 2324
288 Ga0068863_100173707 3300005841 Bacteria 2068
289 Ga0068858_100001664 3300005842 Bacteria 22717
290 Ga0068858_100192582 3300005842 Bacteria 1927
291 Ga0068860_100011657 3300005843 Bacteria 8668
292 Ga0068860_100094445 3300005843 Bacteria 2850
293 Ga0068860_100145563 3300005843 Bacteria 2280
294 Ga0068862_100000907 3300005844 Bacteria 28711
295 Ga0068862_100016065 3300005844 Bacteria 6225
296 Ga0068862_100064830 3300005844 Bacteria 3145
297 Ga0068862_100073044 3300005844 Bacteria 2964
298 Ga0081455_10005178 3300005937 Bacteria 14354
299 Ga0081455_10006550 3300005937 Bacteria 12460
300 Ga0081455_10011929 3300005937 Bacteria 8696
301 Ga0081455_10014792 3300005937 Bacteria 7613
302 Ga0081455_10065679 3300005937 Bacteria 3033
303 Ga0081538_10039199 3300005981 Bacteria 3042
304 Ga0081539_10000403 3300005985 Bacteria 92820
305 Ga0081539_10001964 3300005985 Bacteria 31310
306 Ga0081539_10007470 3300005985 Bacteria 9950
307 Ga0081539_10034847 3300005985 Bacteria 3035
308 Ga0081539_10043424 3300005985 Bacteria 2606
309 Ga0070717_10008912 3300006028 Bacteria 7517
310 Ga0070717_10044430 3300006028 Bacteria 3627
311 Ga0070717_10061999 3300006028 Bacteria 3100
312 Ga0075368_10000340 3300006042 Bacteria 13640
313 Ga0075364_10011474 3300006051 Bacteria 5382
314 Ga0075364_10018889 3300006051 Bacteria 4322
315 Ga0075364_10058625 3300006051 Bacteria 2523
316 Ga0075432_10001455 3300006058 Bacteria 7717
317 Ga0075432_10003602 3300006058 Bacteria 5262
318 Ga0075432_10023012 3300006058 Bacteria 2133
319 Ga0075432_10023990 3300006058 Bacteria 2089
320 Ga0075432_10024517 3300006058 Bacteria 2067
321 Ga0070715_10003585 3300006163 Bacteria 4973
322 Ga0070716_100000137 3300006173 Bacteria 29476
323 Ga0070716_100017145 3300006173 Bacteria 3750
324 Ga0070716_100026127 3300006173 Bacteria 3124
325 Ga0070716_100041663 3300006173 Bacteria 2559
326 Ga0070716_100042413 3300006173 Bacteria 2540
327 Ga0070716_100074147 3300006173 Bacteria 2010
328 Ga0070716_100136924 3300006173 Bacteria 1556
329 Ga0070712_100000057 3300006175 Bacteria 56727
330 Ga0070712_100000154 3300006175 Bacteria 36911
331 Ga0070712_100001792 3300006175 Bacteria 13129
332 Ga0070712_100004923 3300006175 Bacteria 8260
333 Ga0070712_100006229 3300006175 Bacteria 7386
334 Ga0075362_10003824 3300006177 Bacteria 5338
335 Ga0075362_10038665 3300006177 Bacteria 2096
336 Ga0075369_10010212 3300006186 Bacteria 3669
337 Ga0075427_10002640 3300006194 Bacteria 2423
338 Ga0097621_100005910 3300006237 Bacteria 8649
339 Ga0068871_100015542 3300006358 Bacteria 5702
340 Ga0068871_100209699 3300006358 Bacteria 1685
341 Ga0075428_100001508 3300006844 Bacteria 24922
342 Ga0075428_100004126 3300006844 Bacteria 15993
343 Ga0075428_100006849 3300006844 Bacteria 12667
344 Ga0075428_100024446 3300006844 Bacteria 6685
345 Ga0075428_100049140 3300006844 Bacteria 4628
346 Ga0075428_100077354 3300006844 Bacteria 3632
347 Ga0075428_100107266 3300006844 Bacteria 3044
348 Ga0075430_100004750 3300006846 Bacteria 11433
349 Ga0075430_100045750 3300006846 Bacteria 3696
350 Ga0075431_100004236 3300006847 Bacteria 14055
351 Ga0075431_100015576 3300006847 Bacteria 7706
352 Ga0075431_100016188 3300006847 Bacteria 7564
353 Ga0075431_100016399 3300006847 Bacteria 7519
354 Ga0075431_100190491 3300006847 Bacteria 2101
355 Ga0075431_100194569 3300006847 Bacteria 2076
356 Ga0075433_10000856 3300006852 Bacteria 21334
357 Ga0075433_10002698 3300006852 Bacteria 13552
358 Ga0075433_10014389 3300006852 Bacteria 6461
359 Ga0075433_10032336 3300006852 Bacteria 4481
360 Ga0075433_10152001 3300006852 Bacteria 2059
361 Ga0075433_10168316 3300006852 Bacteria 1950
362 Ga0075433_10232388 3300006852 Bacteria 1637
363 Ga0075434_100001763 3300006871 Bacteria 18616
364 Ga0075434_100003148 3300006871 Bacteria 14709
365 Ga0075434_100007797 3300006871 Bacteria 9914
366 Ga0075434_100020162 3300006871 Bacteria 6461
367 Ga0075434_100043160 3300006871 Bacteria 4471
368 Ga0075429_100001560 3300006880 Bacteria 18832
369 Ga0075429_100128339 3300006880 Bacteria 2218
370 Ga0068865_100155757 3300006881 Bacteria 1738
371 Ga0075436_100016359 3300006914 Bacteria 5076
372 Ga0075436_100123164 3300006914 Bacteria 1815
373 Ga0097620_100000021 3300006931 Bacteria 236322
374 Ga0097620_100026994 3300006931 Bacteria 5761
375 Ga0097620_100036795 3300006931 Bacteria 4914
376 Ga0097620_100053296 3300006931 Bacteria 4068
377 Ga0097620_100168190 3300006931 Bacteria 2273
378 Ga0099823_1003937 3300006944 Bacteria 14335
379 Ga0079104_1000002 3300006946 Bacteria 514469
380 Ga0079104_1000071 3300006946 Bacteria 153790
381 Ga0079104_1000156 3300006946 Bacteria 97036
382 Ga0079104_1000157 3300006946 Bacteria 96925
383 Ga0079104_1000707 3300006946 Bacteria 30262
384 Ga0079104_1000804 3300006946 Bacteria 26453
385 Ga0079104_1001098 3300006946 Bacteria 20166
386 Ga0079104_1005686 3300006946 Bacteria 4913
387 Ga0075435_100006566 3300007076 Bacteria 8230
388 Ga0075435_100010771 3300007076 Bacteria 6698
389 Ga0075435_100014550 3300007076 Bacteria 5886
390 Ga0075435_100060378 3300007076 Bacteria 3074
391 Ga0075435_100075483 3300007076 Bacteria 2761
392 Ga0099794_10000025 3300007265 Bacteria 60175
393 Ga0105251_10000230 3300009011 Bacteria 56255
394 Ga0105251_10000713 3300009011 Bacteria 30624
395 Ga0105251_10002968 3300009011 Bacteria 12721
396 Ga0105251_10005208 3300009011 Bacteria 8572
397 Ga0105251_10006896 3300009011 Bacteria 7127
398 Ga0105251_10007894 3300009011 Bacteria 6468
399 Ga0105251_10010179 3300009011 Bacteria 5478
400 Ga0105251_10020652 3300009011 Bacteria 3457
401 Ga0105244_10000005 3300009036 Bacteria 481412
402 Ga0105244_10000038 3300009036 Bacteria 158460
403 Ga0105244_10000287 3300009036 Bacteria 49801
404 Ga0105244_10000380 3300009036 Bacteria 41289
405 Ga0105244_10000900 3300009036 Bacteria 25121
406 Ga0105244_10001172 3300009036 Bacteria 21688
407 Ga0105244_10002028 3300009036 Bacteria 15622
408 Ga0105244_10006729 3300009036 Bacteria 7395
409 Ga0105244_10008634 3300009036 Bacteria 6345
410 Ga0105244_10018941 3300009036 Bacteria 3853
411 Ga0105244_10029149 3300009036 Bacteria 2954
412 Ga0105244_10029411 3300009036 Bacteria 2937
413 Ga0105244_10031344 3300009036 Bacteria 2821
414 Ga0105250_10002294 3300009092 Bacteria 9720
415 Ga0105250_10004947 3300009092 Bacteria 6045
416 Ga0105250_10005194 3300009092 Bacteria 5873
417 Ga0105250_10009457 3300009092 Bacteria 4102
418 Ga0105250_10013887 3300009092 Bacteria 3317
419 Ga0105250_10026095 3300009092 Bacteria 2353
420 Ga0105250_10031892 3300009092 Bacteria 2116
421 Ga0105240_10029012 3300009093 Bacteria 7216
422 Ga0105240_10058712 3300009093 Bacteria 4803
423 Ga0105240_10157301 3300009093 Bacteria 2702
424 Ga0111539_10001894 3300009094 Bacteria 27841
425 Ga0111539_10003743 3300009094 Bacteria 20014
426 Ga0111539_10009531 3300009094 Bacteria 12255
427 Ga0111539_10012199 3300009094 Bacteria 10780
428 Ga0111539_10027092 3300009094 Bacteria 7001
429 Ga0111539_10058473 3300009094 Bacteria 4574
430 Ga0111539_10110048 3300009094 Bacteria 3233
431 Ga0111539_10114668 3300009094 Bacteria 3160
432 Ga0111539_10168462 3300009094 Bacteria 2560
433 Ga0105245_10011710 3300009098 Bacteria 7633
434 Ga0105245_10082913 3300009098 Bacteria 2934
435 Ga0105245_10111168 3300009098 Bacteria 2548
436 Ga0105245_10116985 3300009098 Bacteria 2486
437 Ga0105245_10158585 3300009098 Bacteria 2145
438 Ga0105245_10179920 3300009098 Bacteria 2019
439 Ga0105245_10184047 3300009098 Bacteria 1997
440 Ga0105247_10001413 3300009101 Bacteria 17422
441 Ga0105247_10006981 3300009101 Bacteria 6951
442 Ga0114129_10005945 3300009147 Bacteria 17275
443 Ga0114129_10008249 3300009147 Bacteria 14856
444 Ga0114129_10018324 3300009147 Bacteria 9974
445 Ga0114129_10026057 3300009147 Bacteria 8280
446 Ga0114129_10038347 3300009147 Bacteria 6760
447 Ga0114129_10050450 3300009147 Bacteria 5845
448 Ga0114129_10069504 3300009147 Bacteria 4909
449 Ga0114129_10106461 3300009147 Bacteria 3874
450 Ga0114129_10464939 3300009147 Bacteria 1657
451 Ga0114129_10475494 3300009147 Bacteria 1636
452 Ga0105243_10000007 3300009148 Bacteria 445042
453 Ga0105243_10000048 3300009148 Bacteria 148448
454 Ga0105243_10001529 3300009148 Bacteria 20211
455 Ga0105243_10002094 3300009148 Bacteria 16900
456 Ga0105243_10002720 3300009148 Bacteria 14693
457 Ga0105243_10004604 3300009148 Bacteria 10872
458 Ga0105243_10015831 3300009148 Bacteria 5705
459 Ga0105243_10042741 3300009148 Bacteria 3549
460 Ga0105243_10046667 3300009148 Bacteria 3408
461 Ga0105243_10053681 3300009148 Bacteria 3198
462 Ga0105243_10075822 3300009148 Bacteria 2730
463 Ga0105243_10116769 3300009148 Bacteria 2242
464 Ga0105243_10186576 3300009148 Bacteria 1808
465 Ga0105241_10000013 3300009174 Bacteria 172249
466 Ga0105241_10030979 3300009174 Bacteria 4001
467 Ga0105241_10050628 3300009174 Bacteria 3166
468 Ga0105241_10193482 3300009174 Bacteria 1694
469 Ga0105242_10007107 3300009176 Bacteria 8642
470 Ga0105242_10008850 3300009176 Bacteria 7725
471 Ga0105242_10015408 3300009176 Bacteria 5936
472 Ga0105242_10019091 3300009176 Bacteria 5369
473 Ga0105242_10024669 3300009176 Bacteria 4751
474 Ga0105242_10084905 3300009176 Bacteria 2654
475 Ga0105242_10155692 3300009176 Bacteria 1996
476 Ga0105242_10157935 3300009176 Bacteria 1982
477 Ga0105248_10002310 3300009177 Bacteria 21139
478 Ga0105248_10004739 3300009177 Bacteria 15057
479 Ga0105248_10027355 3300009177 Bacteria 6348
480 Ga0105248_10038991 3300009177 Bacteria 5319
481 Ga0105248_10090133 3300009177 Bacteria 3453
482 Ga0105248_10189276 3300009177 Bacteria 2319
483 Ga0105248_10272889 3300009177 Bacteria 1904
484 Ga0105237_10004364 3300009545 Bacteria 16399
485 Ga0105237_10011045 3300009545 Bacteria 9575
486 Ga0105237_10018913 3300009545 Bacteria 7121
487 Ga0105237_10131801 3300009545 Bacteria 2494
488 Ga0105237_10138542 3300009545 Bacteria 2428
489 Ga0105238_10068203 3300009551 Bacteria 3558
490 Ga0105238_10094839 3300009551 Bacteria 2971
491 Ga0105238_10204885 3300009551 Bacteria 1948
492 Ga0105249_10001559 3300009553 Bacteria 20120
493 Ga0105249_10013235 3300009553 Bacteria 7281
494 Ga0105239_10166554 3300010375 Bacteria 2464
495 Ga0105246_10001472 3300011119 Bacteria 13976
496 Ga0105246_10001828 3300011119 Bacteria 12755
497 Ga0105246_10006800 3300011119 Bacteria 6991
498 Ga0157345_1000341 3300012498 Bacteria 5516
499 Ga0157373_10000016 3300013100 Bacteria 181215
500 Ga0157373_10000094 3300013100 Bacteria 73332
501 Ga0157373_10000158 3300013100 Bacteria 54838
502 Ga0157373_10003540 3300013100 Bacteria 11795
503 Ga0157373_10005904 3300013100 Bacteria 9162
504 Ga0157373_10013594 3300013100 Bacteria 5971
505 Ga0157373_10017496 3300013100 Bacteria 5221
506 Ga0157373_10017678 3300013100 Bacteria 5191
507 Ga0157373_10020808 3300013100 Bacteria 4762
508 Ga0157373_10022021 3300013100 Bacteria 4624
509 Ga0157373_10023034 3300013100 Bacteria 4517
510 Ga0157373_10044939 3300013100 Bacteria 3154
511 Ga0157373_10108123 3300013100 Bacteria 1955
512 Ga0157371_10000056 3300013102 Bacteria 172695
513 Ga0157371_10003173 3300013102 Bacteria 15127
514 Ga0157371_10003333 3300013102 Bacteria 14671
515 Ga0157371_10017174 3300013102 Bacteria 5381
516 Ga0157371_10018757 3300013102 Bacteria 5112
517 Ga0157371_10023729 3300013102 Bacteria 4484
518 Ga0157371_10030734 3300013102 Bacteria 3873
519 Ga0157371_10035887 3300013102 Bacteria 3552
520 Ga0157371_10063603 3300013102 Bacteria 2615
521 Ga0157370_10002149 3300013104 Bacteria 24098
522 Ga0157370_10002520 3300013104 Bacteria 22024
523 Ga0157370_10004138 3300013104 Bacteria 16810
524 Ga0157370_10006949 3300013104 Bacteria 12363
525 Ga0157370_10022805 3300013104 Bacteria 6225
526 Ga0157370_10039461 3300013104 Bacteria 4563
527 Ga0157370_10067570 3300013104 Bacteria 3379
528 Ga0157370_10088769 3300013104 Bacteria 2904
529 Ga0157370_10092036 3300013104 Bacteria 2846
530 Ga0157370_10093062 3300013104 Bacteria 2829
531 Ga0157369_10002012 3300013105 Bacteria 24492
532 Ga0157369_10007119 3300013105 Bacteria 12896
533 Ga0157369_10007270 3300013105 Bacteria 12747
534 Ga0157369_10026460 3300013105 Bacteria 6434
535 Ga0157369_10031368 3300013105 Bacteria 5852
536 Ga0157369_10038599 3300013105 Bacteria 5222
537 Ga0157369_10070399 3300013105 Bacteria 3758
538 Ga0157369_10091905 3300013105 Bacteria 3239
539 Ga0157369_10112452 3300013105 Bacteria 2893
540 Ga0157369_10137644 3300013105 Bacteria 2584
541 Ga0157369_10313026 3300013105 Bacteria 1632
542 Ga0157374_10013735 3300013296 Bacteria 7074
543 Ga0157374_10049162 3300013296 Bacteria 3916
544 Ga0157374_10056586 3300013296 Bacteria 3662
545 Ga0157374_10086823 3300013296 Bacteria 2977
546 Ga0157374_10094321 3300013296 Bacteria 2860
547 Ga0157374_10107312 3300013296 Bacteria 2683
548 Ga0157378_10030675 3300013297 Bacteria 4749
549 Ga0157378_10038076 3300013297 Bacteria 4261
550 Ga0163162_10003825 3300013306 Bacteria 14429
551 Ga0163162_10003912 3300013306 Bacteria 14310
552 Ga0163162_10004734 3300013306 Bacteria 13125
553 Ga0163162_10012289 3300013306 Bacteria 8359
554 Ga0163162_10021609 3300013306 Bacteria 6339
555 Ga0163162_10026444 3300013306 Bacteria 5734
556 Ga0163162_10033999 3300013306 Bacteria 5070
557 Ga0163162_10103350 3300013306 Bacteria 2943
558 Ga0163162_10115192 3300013306 Bacteria 2788
559 Ga0163162_10151284 3300013306 Bacteria 2439
560 Ga0163162_10165119 3300013306 Bacteria 2337
561 Ga0157372_10019838 3300013307 Bacteria 7244
562 Ga0157372_10029402 3300013307 Bacteria 5999
563 Ga0157372_10051174 3300013307 Bacteria 4596
564 Ga0157372_10051427 3300013307 Bacteria 4585
565 Ga0157372_10092413 3300013307 Unclassified 3442
566 Ga0157372_10092620 3300013307 Bacteria 3438
567 Ga0157372_10151887 3300013307 Bacteria 2673
568 Ga0157372_10156663 3300013307 Bacteria 2631
569 Ga0157375_10000576 3300013308 Bacteria 32915
570 Ga0157375_10024997 3300013308 Bacteria 5539
571 Ga0157375_10060947 3300013308 Bacteria 3744
572 Ga0157375_10072977 3300013308 Bacteria 3450
573 Ga0157375_10354262 3300013308 Bacteria 1634
574 Ga0157375_10442899 3300013308 Bacteria 1465
575 Ga0163163_10000071 3300014325 Bacteria 112778
576 Ga0163163_10006618 3300014325 Bacteria 10148
577 Ga0163163_10011041 3300014325 Bacteria 8168
578 Ga0163163_10052418 3300014325 Bacteria 4024
579 Ga0157380_10000020 3300014326 Bacteria 114925
580 Ga0182008_10000005 3300014497 Bacteria 386556
581 Ga0182008_10000008 3300014497 Bacteria 371823
582 Ga0182008_10000287 3300014497 Bacteria 39636
583 Ga0182008_10001232 3300014497 Bacteria 17589
584 Ga0182008_10001739 3300014497 Bacteria 14303
585 Ga0182008_10002163 3300014497 Bacteria 12514
586 Ga0182008_10006185 3300014497 Bacteria 6727
587 Ga0182008_10008061 3300014497 Bacteria 5771
588 Ga0182008_10008200 3300014497 Bacteria 5717
589 Ga0182008_10012007 3300014497 Bacteria 4586
590 Ga0182008_10021111 3300014497 Bacteria 3347
591 Ga0182008_10023807 3300014497 Bacteria 3121
592 Ga0182008_10034808 3300014497 Bacteria 2524
593 Ga0182008_10035331 3300014497 Bacteria 2504
594 Ga0157377_10046203 3300014745 Bacteria 2434
595 Ga0157377_10080988 3300014745 Bacteria 1898
596 Ga0157379_10003726 3300014968 Bacteria 12966
597 Ga0157379_10149854 3300014968 Bacteria 2104
598 Ga0157379_10265055 3300014968 Bacteria 1562
599 Ga0157376_10023599 3300014969 Bacteria 4816
600 Ga0157376_10094358 3300014969 Bacteria 2600
601 Ga0157376_10141868 3300014969 Bacteria 2156
602 Ga0182006_1000033 3300015261 Bacteria 238180
603 Ga0182006_1000047 3300015261 Bacteria 187006
604 Ga0182006_1002152 3300015261 Bacteria 10927
605 Ga0182006_1003239 3300015261 Bacteria 8450
606 Ga0182006_1004345 3300015261 Bacteria 7007
607 Ga0182006_1007907 3300015261 Bacteria 4839
608 Ga0182006_1014114 3300015261 Bacteria 3448
609 Ga0182006_1028816 3300015261 Bacteria 2254
610 Ga0182007_10000042 3300015262 Bacteria 111840
611 Ga0182007_10007143 3300015262 Bacteria 4716
612 Ga0182007_10008911 3300015262 Bacteria 4088
613 Ga0182007_10013674 3300015262 Bacteria 3086
614 Ga0182007_10024410 3300015262 Bacteria 2115
615 Ga0182005_1000024 3300015265 Bacteria 238256
616 Ga0182005_1006401 3300015265 Bacteria 3605
617 Ga0183366_1001 3300015679 Bacteria 2743932
618 Ga0183370_1001 3300015680 Bacteria 2743932
619 Ga0183362_10001 3300015683 Bacteria 2046624
620 Ga0183369_1001 3300015685 Bacteria 2743932
621 Ga0183368_1001 3300015687 Bacteria 2743932
622 Ga0163161_10000019 3300017792 Bacteria 216758
623 Ga0163161_10000028 3300017792 Bacteria 197151
624 Ga0163161_10001759 3300017792 Bacteria 15822
625 Ga0163161_10016644 3300017792 Bacteria 5136
626 Ga0163161_10062002 3300017792 Bacteria 2723
627 Ga0163161_10088082 3300017792 Bacteria 2294
628 Ga0163161_10089081 3300017792 Bacteria 2282
629 Ga0163161_10090177 3300017792 Bacteria 2268
630 Ga0163161_10098387 3300017792 Bacteria 2174
631 Ga0163161_10104171 3300017792 Bacteria 2115
632 Ga0163161_10119078 3300017792 Bacteria 1982
633 Ga0163161_10124234 3300017792 Bacteria 1942
634 Ga0213872_10011172 3300021361 Bacteria 4254
635 Ga0213872_10054637 3300021361 Bacteria 1810
636 Ga0213874_10024427 3300021377 Bacteria 1695
637 Ga0213876_10000191 3300021384 Bacteria 64044
638 Ga0209435_100675 3300025206 Bacteria 5992
639 Ga0209760_100010 3300025207 Bacteria 205106
640 Ga0209760_100157 3300025207 Bacteria 40911
641 Ga0209784_100030 3300025224 Bacteria 327457
642 Ga0209784_100101 3300025224 Bacteria 100885
643 Ga0209566_100034 3300025225 Bacteria 327457
644 Ga0209566_100123 3300025225 Bacteria 100885
645 Ga0209674_100052 3300025226 Bacteria 327457
646 Ga0209674_100145 3300025226 Bacteria 100885
647 Ga0209147_100151 3300025229 Bacteria 100885
648 Ga0209563_100054 3300025230 Bacteria 327457
649 Ga0209563_100128 3300025230 Bacteria 100885
650 Ga0209563_100722 3300025230 Bacteria 10251
651 Ga0207427_100035 3300025231 Bacteria 311526
652 Ga0207427_100092 3300025231 Bacteria 128454
653 Ga0209437_100065 3300025233 Bacteria 332417
654 Ga0209437_100068 3300025233 Bacteria 311526
655 Ga0209258_100241 3300025242 Bacteria 100872
656 Ga0209646_1000354 3300025246 Bacteria 33264
657 Ga0209677_100032 3300025253 Bacteria 327457
658 Ga0209677_100094 3300025253 Bacteria 100885
659 Ga0209129_1000004 3300025258 Bacteria 884499
660 Ga0209233_1000085 3300025261 Bacteria 333078
661 Ga0209130_1004205 3300025284 Bacteria 5611
662 Ga0209675_1000022 3300025291 Bacteria 315280
663 Ga0209675_1000394 3300025291 Bacteria 36250
664 Ga0209675_1007953 3300025291 Bacteria 3968
665 Ga0209675_1009523 3300025291 Bacteria 3424
666 Ga0209675_1010696 3300025291 Bacteria 3108
667 Ga0209676_1000076 3300025292 Bacteria 301393
668 Ga0209676_1000264 3300025292 Bacteria 110593
669 Ga0209676_1000313 3300025292 Bacteria 94925
670 Ga0209676_1000396 3300025292 Bacteria 79502
671 Ga0209676_1000505 3300025292 Bacteria 61665
672 Ga0209676_1000788 3300025292 Bacteria 41882
673 Ga0209676_1003014 3300025292 Bacteria 10954
674 Ga0209676_1005425 3300025292 Bacteria 6668
675 Ga0209025_1000098 3300025294 Bacteria 233886
676 Ga0209025_1000548 3300025294 Bacteria 70257
677 Ga0209564_1000159 3300025295 Bacteria 164319
678 Ga0209564_1000615 3300025295 Bacteria 54694
679 Ga0209050_1000063 3300025298 Bacteria 314955
680 Ga0209050_1000106 3300025298 Bacteria 224396
681 Ga0209050_1001298 3300025298 Bacteria 28251
682 Ga0209050_1005444 3300025298 Bacteria 7992
683 Ga0209050_1005921 3300025298 Bacteria 7454
684 Ga0209050_1008240 3300025298 Bacteria 5620
685 Ga0209256_1000051 3300025299 Bacteria 307241
686 Ga0209051_1000045 3300025303 Bacteria 297882
687 Ga0209051_1000079 3300025303 Bacteria 201183
688 Ga0209051_1000139 3300025303 Bacteria 136281
689 Ga0209051_1000331 3300025303 Bacteria 71198
690 Ga0209051_1017155 3300025303 Bacteria 3245
691 Ga0209257_1000183 3300025304 Bacteria 156618
692 Ga0209257_1000539 3300025304 Bacteria 64964
693 Ga0209257_1010097 3300025304 Bacteria 4874
694 Ga0209257_1021461 3300025304 Bacteria 2344
695 Ga0207697_10000347 3300025315 Bacteria 25853
696 Ga0207697_10002263 3300025315 Bacteria 10065
697 Ga0207697_10005474 3300025315 Bacteria 5899
698 Ga0207656_10000045 3300025321 Bacteria 47492
699 Ga0207696_1000047 3300025711 Bacteria 285005
700 Ga0207696_1000068 3300025711 Bacteria 228017
701 Ga0207696_1000172 3300025711 Bacteria 102404
702 Ga0207696_1000269 3300025711 Bacteria 64683
703 Ga0207696_1000318 3300025711 Bacteria 52161
704 Ga0207696_1002729 3300025711 Bacteria 8414
705 Ga0207696_1003699 3300025711 Bacteria 6863
706 Ga0207696_1003984 3300025711 Bacteria 6491
707 Ga0207696_1005607 3300025711 Bacteria 5181
708 Ga0207696_1006843 3300025711 Bacteria 4537
709 Ga0207696_1007853 3300025711 Bacteria 4136
710 Ga0207696_1015484 3300025711 Bacteria 2584
711 Ga0207655_1000009 3300025728 Bacteria 664676
712 Ga0207655_1000015 3300025728 Bacteria 600662
713 Ga0207655_1000016 3300025728 Bacteria 551476
714 Ga0207655_1000034 3300025728 Bacteria 364737
715 Ga0207655_1000106 3300025728 Bacteria 181416
716 Ga0207655_1000319 3300025728 Bacteria 71324
717 Ga0207655_1000369 3300025728 Bacteria 63434
718 Ga0207655_1000643 3300025728 Bacteria 41715
719 Ga0207655_1001130 3300025728 Bacteria 26034
720 Ga0207655_1001199 3300025728 Bacteria 25008
721 Ga0207655_1001598 3300025728 Bacteria 20275
722 Ga0207655_1001764 3300025728 Bacteria 18906
723 Ga0207655_1002617 3300025728 Bacteria 14299
724 Ga0207655_1002619 3300025728 Bacteria 14296
725 Ga0207655_1002932 3300025728 Bacteria 13119
726 Ga0207655_1003139 3300025728 Bacteria 12500
727 Ga0207655_1004288 3300025728 Bacteria 10203
728 Ga0207655_1008136 3300025728 Bacteria 6707
729 Ga0207655_1008866 3300025728 Bacteria 6320
730 Ga0207655_1010022 3300025728 Bacteria 5806
731 Ga0207655_1010352 3300025728 Bacteria 5662
732 Ga0207655_1012920 3300025728 Bacteria 4834
733 Ga0207655_1035837 3300025728 Bacteria 2209
734 Ga0207655_1038469 3300025728 Bacteria 2091
735 Ga0207655_1049497 3300025728 Bacteria 1715
736 Ga0207713_1000044 3300025735 Bacteria 238074
737 Ga0207713_1000062 3300025735 Bacteria 208832
738 Ga0207713_1000229 3300025735 Bacteria 75343
739 Ga0207713_1000233 3300025735 Bacteria 74522
740 Ga0207713_1002181 3300025735 Bacteria 14511
741 Ga0207713_1002375 3300025735 Bacteria 13763
742 Ga0207713_1002651 3300025735 Bacteria 12849
743 Ga0207713_1003200 3300025735 Bacteria 11310
744 Ga0207713_1003495 3300025735 Bacteria 10666
745 Ga0207713_1003620 3300025735 Bacteria 10412
746 Ga0207713_1004042 3300025735 Bacteria 9688
747 Ga0207713_1005776 3300025735 Bacteria 7661
748 Ga0207713_1006553 3300025735 Bacteria 7068
749 Ga0207713_1007437 3300025735 Bacteria 6464
750 Ga0207713_1010892 3300025735 Bacteria 4994
751 Ga0207713_1011189 3300025735 Bacteria 4904
752 Ga0207713_1011446 3300025735 Bacteria 4823
753 Ga0207713_1020822 3300025735 Bacteria 3163
754 Ga0207653_10000001 3300025885 Bacteria 287007
755 Ga0207653_10004737 3300025885 Bacteria 4257
756 Ga0207692_10010710 3300025898 Bacteria 3876
757 Ga0207692_10014599 3300025898 Bacteria 3435
758 Ga0207692_10026636 3300025898 Bacteria 2714
759 Ga0207710_10000009 3300025900 Bacteria 485205
760 Ga0207710_10000145 3300025900 Bacteria 80941
761 Ga0207688_10001511 3300025901 Bacteria 12224
762 Ga0207680_10017992 3300025903 Bacteria 3745
763 Ga0207647_10029870 3300025904 Bacteria 3521
764 Ga0207685_10004107 3300025905 Bacteria 3649
765 Ga0207699_10003261 3300025906 Bacteria 7729
766 Ga0207699_10003871 3300025906 Bacteria 7153
767 Ga0207699_10013239 3300025906 Bacteria 4217
768 Ga0207645_10000980 3300025907 Bacteria 23596
769 Ga0207645_10006530 3300025907 Bacteria 8353
770 Ga0207643_10000852 3300025908 Bacteria 18473
771 Ga0207684_10000078 3300025910 Bacteria 181899
772 Ga0207684_10000118 3300025910 Bacteria 145120
773 Ga0207684_10003435 3300025910 Bacteria 15464
774 Ga0207684_10012551 3300025910 Bacteria 7363
775 Ga0207684_10018065 3300025910 Bacteria 6044
776 Ga0207684_10019367 3300025910 Bacteria 5823
777 Ga0207684_10024000 3300025910 Bacteria 5203
778 Ga0207684_10028722 3300025910 Bacteria 4738
779 Ga0207684_10043425 3300025910 Bacteria 3811
780 Ga0207684_10148839 3300025910 Bacteria 2014
781 Ga0207684_10177523 3300025910 Bacteria 1836
782 Ga0207684_10193470 3300025910 Bacteria 1754
783 Ga0207654_10000016 3300025911 Bacteria 211550
784 Ga0207707_10009245 3300025912 Bacteria 8551
785 Ga0207707_10086628 3300025912 Bacteria 2737
786 Ga0207707_10139202 3300025912 Bacteria 2122
787 Ga0207707_10169731 3300025912 Bacteria 1907
788 Ga0207695_10015038 3300025913 Bacteria 9132
789 Ga0207695_10018475 3300025913 Bacteria 8061
790 Ga0207695_10070045 3300025913 Bacteria 3587
791 Ga0207671_10000060 3300025914 Bacteria 178435
792 Ga0207671_10071563 3300025914 Bacteria 2587
793 Ga0207693_10000004 3300025915 Bacteria 193261
794 Ga0207693_10000865 3300025915 Bacteria 27049
795 Ga0207693_10001961 3300025915 Bacteria 18051
796 Ga0207693_10013105 3300025915 Bacteria 6689
797 Ga0207693_10018332 3300025915 Bacteria 5577
798 Ga0207663_10001502 3300025916 Bacteria 10877
799 Ga0207663_10005395 3300025916 Bacteria 6438
800 Ga0207663_10068825 3300025916 Bacteria 2275
801 Ga0207660_10014965 3300025917 Bacteria 5112
802 Ga0207660_10121757 3300025917 Bacteria 1977
803 Ga0207662_10083306 3300025918 Bacteria 1955
804 Ga0207657_10001299 3300025919 Bacteria 26510
805 Ga0207657_10015750 3300025919 Bacteria 7311
806 Ga0207657_10033112 3300025919 Bacteria 4662
807 Ga0207649_10000023 3300025920 Bacteria 188467
808 Ga0207652_10077936 3300025921 Bacteria 2893
809 Ga0207652_10133892 3300025921 Bacteria 2212
810 Ga0207646_10003069 3300025922 Bacteria 19206
811 Ga0207646_10003650 3300025922 Bacteria 17205
812 Ga0207646_10003906 3300025922 Bacteria 16548
813 Ga0207646_10008498 3300025922 Bacteria 10275
814 Ga0207646_10026374 3300025922 Bacteria 5304
815 Ga0207646_10026869 3300025922 Bacteria 5249
816 Ga0207646_10035115 3300025922 Bacteria 4530
817 Ga0207646_10037053 3300025922 Bacteria 4399
818 Ga0207646_10061856 3300025922 Bacteria 3342
819 Ga0207646_10076287 3300025922 Bacteria 2995
820 Ga0207646_10106525 3300025922 Bacteria 2514
821 Ga0207646_10117025 3300025922 Bacteria 2394
822 Ga0207646_10144294 3300025922 Bacteria 2145
823 Ga0207681_10000009 3300025923 Bacteria 410736
824 Ga0207681_10000386 3300025923 Bacteria 30907
825 Ga0207681_10007464 3300025923 Bacteria 6701
826 Ga0207681_10008588 3300025923 Bacteria 6238
827 Ga0207681_10012579 3300025923 Bacteria 5225
828 Ga0207650_10000100 3300025925 Bacteria 112181
829 Ga0207650_10000153 3300025925 Bacteria 82970
830 Ga0207650_10003497 3300025925 Bacteria 10790
831 Ga0207650_10012446 3300025925 Bacteria 5874
832 Ga0207650_10025430 3300025925 Bacteria 4217
833 Ga0207650_10055081 3300025925 Bacteria 2951
834 Ga0207650_10196851 3300025925 Bacteria 1612
835 Ga0207659_10066368 3300025926 Bacteria 2618
836 Ga0207659_10189277 3300025926 Bacteria 1637
837 Ga0207659_10201365 3300025926 Bacteria 1590
838 Ga0207659_10250918 3300025926 Bacteria 1436
839 Ga0207687_10044133 3300025927 Bacteria 3075
840 Ga0207687_10048049 3300025927 Bacteria 2960
841 Ga0207687_10092088 3300025927 Bacteria 2213
842 Ga0207700_10000307 3300025928 Bacteria 28738
843 Ga0207700_10001040 3300025928 Bacteria 16020
844 Ga0207700_10049630 3300025928 Bacteria 3123
845 Ga0207700_10129471 3300025928 Bacteria 2058
846 Ga0207700_10190936 3300025928 Bacteria 1721
847 Ga0207664_10000017 3300025929 Bacteria 230967
848 Ga0207664_10007838 3300025929 Bacteria 7419
849 Ga0207664_10008414 3300025929 Bacteria 7195
850 Ga0207664_10044193 3300025929 Bacteria 3488
851 Ga0207644_10005441 3300025931 Bacteria 8303
852 Ga0207644_10014353 3300025931 Bacteria 5298
853 Ga0207690_10040715 3300025932 Bacteria 3040
854 Ga0207706_10000056 3300025933 Bacteria 113022
855 Ga0207706_10059433 3300025933 Bacteria 3366
856 Ga0207706_10228080 3300025933 Bacteria 1630
857 Ga0207686_10006992 3300025934 Bacteria 6072
858 Ga0207686_10010448 3300025934 Bacteria 5056
859 Ga0207686_10011276 3300025934 Bacteria 4889
860 Ga0207686_10150193 3300025934 Bacteria 1621
861 Ga0207709_10000001 3300025935 Bacteria 2228154
862 Ga0207709_10000015 3300025935 Bacteria 493221
863 Ga0207709_10000030 3300025935 Bacteria 331710
864 Ga0207709_10000049 3300025935 Bacteria 237124
865 Ga0207709_10000127 3300025935 Bacteria 112650
866 Ga0207709_10000341 3300025935 Bacteria 48317
867 Ga0207709_10003847 3300025935 Bacteria 8799
868 Ga0207709_10006788 3300025935 Bacteria 6405
869 Ga0207709_10010578 3300025935 Bacteria 5083
870 Ga0207709_10010641 3300025935 Bacteria 5068
871 Ga0207709_10017129 3300025935 Bacteria 4039
872 Ga0207709_10038468 3300025935 Bacteria 2849
873 Ga0207709_10070895 3300025935 Bacteria 2211
874 Ga0207670_10016816 3300025936 Bacteria 4407
875 Ga0207670_10019786 3300025936 Bacteria 4120
876 Ga0207670_10033966 3300025936 Bacteria 3292
877 Ga0207670_10044429 3300025936 Bacteria 2939
878 Ga0207670_10045672 3300025936 Bacteria 2905
879 Ga0207670_10056996 3300025936 Bacteria 2648
880 Ga0207669_10003974 3300025937 Bacteria 6458
881 Ga0207669_10006610 3300025937 Bacteria 5314
882 Ga0207704_10189624 3300025938 Bacteria 1494
883 Ga0207665_10000140 3300025939 Bacteria 48624
884 Ga0207665_10003302 3300025939 Bacteria 10808
885 Ga0207665_10012711 3300025939 Bacteria 5537
886 Ga0207665_10024962 3300025939 Bacteria 3941
887 Ga0207665_10035011 3300025939 Bacteria 3332
888 Ga0207665_10061302 3300025939 Bacteria 2549
889 Ga0207665_10132772 3300025939 Bacteria 1769
890 Ga0207665_10192861 3300025939 Bacteria 1481
891 Ga0207691_10000134 3300025940 Bacteria 67672
892 Ga0207691_10001773 3300025940 Bacteria 21242
893 Ga0207691_10037115 3300025940 Bacteria 4513
894 Ga0207711_10023686 3300025941 Bacteria 5140
895 Ga0207711_10044011 3300025941 Bacteria 3809
896 Ga0207711_10077688 3300025941 Bacteria 2894
897 Ga0207689_10021059 3300025942 Bacteria 5480
898 Ga0207689_10070462 3300025942 Bacteria 2872
899 Ga0207689_10072516 3300025942 Bacteria 2829
900 Ga0207689_10103054 3300025942 Bacteria 2345
901 Ga0207679_10000017 3300025945 Bacteria 253004
902 Ga0207679_10011798 3300025945 Bacteria 5676
903 Ga0207667_10214985 3300025949 Bacteria 1970
904 Ga0207651_10002173 3300025960 Bacteria 9282
905 Ga0207651_10014874 3300025960 Bacteria 4506
906 Ga0207651_10018076 3300025960 Bacteria 4185
907 Ga0207651_10077769 3300025960 Bacteria 2377
908 Ga0207712_10001050 3300025961 Bacteria 19485
909 Ga0207712_10091843 3300025961 Bacteria 2237
910 Ga0207712_10125224 3300025961 Bacteria 1950
911 Ga0207712_10128155 3300025961 Bacteria 1930
912 Ga0207668_10021030 3300025972 Bacteria 4156
913 Ga0207640_10043338 3300025981 Bacteria 2875
914 Ga0207658_10022478 3300025986 Bacteria 4391
915 Ga0207658_10063388 3300025986 Bacteria 2770
916 Ga0207658_10169709 3300025986 Bacteria 1796
917 Ga0207658_10248311 3300025986 Bacteria 1511
918 Ga0207677_10000010 3300026023 Bacteria 218007
919 Ga0207677_10006394 3300026023 Bacteria 6462
920 Ga0207677_10009167 3300026023 Bacteria 5557
921 Ga0207677_10060250 3300026023 Bacteria 2622
922 Ga0207703_10000269 3300026035 Bacteria 57506
923 Ga0207703_10238652 3300026035 Bacteria 1633
924 Ga0207639_10006403 3300026041 Bacteria 7998
925 Ga0207639_10069300 3300026041 Bacteria 2751
926 Ga0207639_10122499 3300026041 Bacteria 2139
927 Ga0207678_10036919 3300026067 Bacteria 4254
928 Ga0207708_10002865 3300026075 Bacteria 12703
929 Ga0207708_10009116 3300026075 Bacteria 7342
930 Ga0207708_10067740 3300026075 Bacteria 2731
931 Ga0207702_10037324 3300026078 Bacteria 4067
932 Ga0207702_10043777 3300026078 Bacteria 3760
933 Ga0207641_10115657 3300026088 Bacteria 2385
934 Ga0207641_10260963 3300026088 Bacteria 1622
935 Ga0207648_10016021 3300026089 Bacteria 6868
936 Ga0207648_10032863 3300026089 Bacteria 4578
937 Ga0207648_10057593 3300026089 Bacteria 3390
938 Ga0207648_10067490 3300026089 Bacteria 3118
939 Ga0207648_10087247 3300026089 Bacteria 2723
940 Ga0207676_10008805 3300026095 Bacteria 7183
941 Ga0207674_10002024 3300026116 Bacteria 25725
942 Ga0207674_10002250 3300026116 Bacteria 24454
943 Ga0207674_10094081 3300026116 Bacteria 2984
944 Ga0207675_100001407 3300026118 Bacteria 24062
945 Ga0207675_100005904 3300026118 Bacteria 11686
946 Ga0207675_100009658 3300026118 Bacteria 9029
947 Ga0207675_100012896 3300026118 Bacteria 7805
948 Ga0207675_100062485 3300026118 Bacteria 3478
949 Ga0207675_100165773 3300026118 Bacteria 2110
950 Ga0207683_10002972 3300026121 Bacteria 14788
951 Ga0207683_10014576 3300026121 Bacteria 6696
952 Ga0207683_10053659 3300026121 Bacteria 3535
953 Ga0207683_10056116 3300026121 Bacteria 3454
954 Ga0207683_10067158 3300026121 Bacteria 3163
955 Ga0207683_10080062 3300026121 Bacteria 2897
956 Ga0207683_10140734 3300026121 Bacteria 2174
957 Ga0207683_10239291 3300026121 Bacteria 1656
958 Ga0207698_10037929 3300026142 Bacteria 3555
959 Ga0207698_10136506 3300026142 Bacteria 2105
960 Ga0209281_1000007 3300027111 Bacteria 938265
961 Ga0209281_1000070 3300027111 Bacteria 277098
962 Ga0209281_1000093 3300027111 Bacteria 240724
963 Ga0209281_1000098 3300027111 Bacteria 226641
964 Ga0209281_1000107 3300027111 Bacteria 218397
965 Ga0209281_1000135 3300027111 Bacteria 183462
966 Ga0209281_1000301 3300027111 Bacteria 89469
967 Ga0209281_1001036 3300027111 Bacteria 21249
968 Ga0209281_1001082 3300027111 Bacteria 20169
969 Ga0209281_1002130 3300027111 Bacteria 8735
970 Ga0209281_1005510 3300027111 Bacteria 3499
971 Ga0209281_1008970 3300027111 Bacteria 2379
972 Ga0209389_1000125 3300027296 Bacteria 68494
973 Ga0209371_1000001 3300027312 Bacteria 2771503
974 Ga0209371_1000002 3300027312 Bacteria 1551985
975 Ga0209371_1000040 3300027312 Bacteria 340804
976 Ga0209371_1000041 3300027312 Bacteria 340377
977 Ga0209371_1000094 3300027312 Bacteria 170815
978 Ga0209371_1000490 3300027312 Bacteria 38556
979 Ga0209371_1001739 3300027312 Bacteria 13722
980 Ga0209371_1005701 3300027312 Bacteria 4862
981 Ga0209371_1006795 3300027312 Bacteria 4143
982 Ga0209371_1008635 3300027312 Bacteria 3351
983 Ga0209996_1000755 3300027395 Bacteria 3848
984 Ga0209984_1000679 3300027424 Bacteria 3629
985 Ga0209995_1000473 3300027471 Bacteria 6139
986 Ga0209982_1004664 3300027552 Bacteria 1969
987 Ga0209970_1001714 3300027614 Bacteria 3803
988 Ga0209983_1001801 3300027665 Bacteria 4761
989 Ga0209588_1000014 3300027671 Bacteria 133062
990 Ga0209971_1000661 3300027682 Bacteria 8976
991 Ga0209974_10003919 3300027876 Bacteria 5322
992 Ga0209974_10011922 3300027876 Bacteria 2913
993 Ga0209974_10018719 3300027876 Bacteria 2297
994 Ga0207428_10004245 3300027907 Bacteria 13710
995 Ga0207428_10006542 3300027907 Bacteria 10745
996 Ga0207428_10017900 3300027907 Bacteria 6072
997 Ga0207428_10020519 3300027907 Bacteria 5612
998 Ga0207428_10021061 3300027907 Bacteria 5525
999 Ga0207428_10030787 3300027907 Bacteria 4434
1000 Ga0207428_10037408 3300027907 Bacteria 3948
1001 Ga0207428_10037783 3300027907 Bacteria 3928
1002 Ga0207428_10066986 3300027907 Bacteria 2828
1003 Ga0207428_10095668 3300027907 Bacteria 2301
1004 Ga0207428_10150176 3300027907 Bacteria 1774
1005 Ga0265354_1001582 3300028016 Bacteria 3189
1006 Ga0268266_10009768 3300028379 Bacteria 8441
1007 Ga0268266_10055749 3300028379 Bacteria 3398
1008 Ga0268266_10175103 3300028379 Bacteria 1950
1009 Ga0268266_10187158 3300028379 Bacteria 1888
1010 Ga0268266_10233738 3300028379 Bacteria 1694
1011 Ga0268265_10000318 3300028380 Bacteria 53047
1012 Ga0268265_10024035 3300028380 Bacteria 4305
1013 Ga0268265_10035784 3300028380 Bacteria 3632
1014 Ga0268265_10122787 3300028380 Bacteria 2143
1015 Ga0268264_10044510 3300028381 Bacteria 3683
1016 Ga0268264_10159370 3300028381 Bacteria 2031
1017 Ga0265337_1009007 3300028556 Bacteria 3590
1018 Ga0265326_10000971 3300028558 Bacteria 10376
1019 Ga0265326_10002053 3300028558 Bacteria 6866
1020 Ga0265326_10002876 3300028558 Bacteria 5751
1021 Ga0265319_1004177 3300028563 Bacteria 7232
1022 Ga0265319_1012546 3300028563 Bacteria 3421
1023 Ga0265334_10003307 3300028573 Bacteria 7352
1024 Ga0265334_10003641 3300028573 Bacteria 6978
1025 Ga0265334_10038425 3300028573 Bacteria 1883
1026 Ga0265318_10000575 3300028577 Bacteria 25839
1027 Ga0265318_10004127 3300028577 Bacteria 7108
1028 Ga0265318_10009692 3300028577 Bacteria 4226
1029 Ga0265323_10000281 3300028653 Bacteria 29505
1030 Ga0265323_10000425 3300028653 Bacteria 24197
1031 Ga0265323_10001023 3300028653 Bacteria 14563
1032 Ga0265323_10037598 3300028653 Bacteria 1773
1033 Ga0265323_10048090 3300028653 Bacteria 1524
1034 Ga0265322_10000028 3300028654 Bacteria 85065
1035 Ga0265322_10000391 3300028654 Bacteria 18201
1036 Ga0265322_10000555 3300028654 Bacteria 14264
1037 Ga0265336_10008113 3300028666 Bacteria 3698
1038 Ga0307515_10010058 3300028794 Bacteria 18195
1039 Ga0307515_10096936 3300028794 Bacteria 3610
1040 Ga0265338_10000517 3300028800 Bacteria 68028
1041 Ga0265338_10001557 3300028800 Bacteria 37035
1042 Ga0265338_10003121 3300028800 Bacteria 23686
1043 Ga0265338_10009321 3300028800 Bacteria 11728
1044 Ga0265338_10012144 3300028800 Bacteria 9842
1045 Ga0265338_10013341 3300028800 Bacteria 9282
1046 Ga0265338_10017026 3300028800 Bacteria 7861
1047 Ga0265338_10047408 3300028800 Bacteria 3925
1048 Ga0265338_10060625 3300028800 Bacteria 3322
1049 Ga0265338_10195697 3300028800 Bacteria 1528
1050 Ga0265324_10000405 3300029957 Bacteria 31070
1051 Ga0265324_10004925 3300029957 Bacteria 5872
1052 Ga0268256_1000001 3300030500 Bacteria 2771065
1053 Ga0268256_1000002 3300030500 Bacteria 1535763
1054 Ga0268256_1000003 3300030500 Bacteria 1289401
1055 Ga0268256_1000041 3300030500 Bacteria 340725
1056 Ga0268256_1000083 3300030500 Bacteria 170829
1057 Ga0268256_1000419 3300030500 Bacteria 38396
1058 Ga0268256_1001517 3300030500 Bacteria 13722
1059 Ga0268256_1006908 3300030500 Bacteria 4143
1060 Ga0268256_1009041 3300030500 Bacteria 3352
1061 Ga0268256_1013462 3300030500 Bacteria 2478
1062 Ga0307511_10072128 3300030521 Bacteria 2511
1063 Ga0316177_1111270 3300030731 Bacteria 9887
1064 Ga0316176_1067105 3300030732 Bacteria 11975
1065 Ga0316178_1096781 3300030735 Bacteria 8104
1066 Ga0316181_1228898 3300030744 Bacteria 15959
1067 Ga0265760_10000424 3300031090 Bacteria 11855
1068 Ga0265330_10000033 3300031235 Bacteria 126931
1069 Ga0265330_10002028 3300031235 Bacteria 11240
1070 Ga0265330_10002320 3300031235 Bacteria 10444
1071 Ga0265330_10002893 3300031235 Bacteria 9164
1072 Ga0265330_10003332 3300031235 Bacteria 8432
1073 Ga0265330_10004778 3300031235 Bacteria 6843
1074 Ga0265330_10005377 3300031235 Bacteria 6382
1075 Ga0265330_10012975 3300031235 Bacteria 3890
1076 Ga0265330_10038142 3300031235 Bacteria 2136
1077 Ga0265332_10000001 3300031238 Bacteria 863783
1078 Ga0265332_10000005 3300031238 Bacteria 377525
1079 Ga0265332_10000013 3300031238 Bacteria 250095
1080 Ga0265332_10001515 3300031238 Bacteria 12907
1081 Ga0265332_10013361 3300031238 Bacteria 3640
1082 Ga0265332_10020571 3300031238 Bacteria 2913
1083 Ga0265328_10002877 3300031239 Bacteria 7679
1084 Ga0265320_10006958 3300031240 Bacteria 7055
1085 Ga0265320_10007370 3300031240 Bacteria 6830
1086 Ga0265325_10000285 3300031241 Bacteria 35898
1087 Ga0265325_10003374 3300031241 Bacteria 10459
1088 Ga0265325_10004570 3300031241 Bacteria 8705
1089 Ga0265325_10004660 3300031241 Bacteria 8605
1090 Ga0265325_10007190 3300031241 Bacteria 6697
1091 Ga0265325_10027145 3300031241 Bacteria 3096
1092 Ga0265329_10000141 3300031242 Bacteria 34866
1093 Ga0265329_10003627 3300031242 Bacteria 6665
1094 Ga0265329_10017969 3300031242 Bacteria 2425
1095 Ga0265340_10000051 3300031247 Bacteria 54481
1096 Ga0265340_10006001 3300031247 Bacteria 6714
1097 Ga0265340_10009806 3300031247 Bacteria 5132
1098 Ga0265340_10010639 3300031247 Bacteria 4918
1099 Ga0265340_10011128 3300031247 Bacteria 4793
1100 Ga0265339_10000154 3300031249 Bacteria 56572
1101 Ga0265339_10030329 3300031249 Bacteria 3062
1102 Ga0265339_10031326 3300031249 Bacteria 3006
1103 Ga0265339_10050630 3300031249 Bacteria 2271
1104 Ga0265331_10006784 3300031250 Bacteria 6708
1105 Ga0265331_10013649 3300031250 Bacteria 4360
1106 Ga0265327_10000293 3300031251 Bacteria 96862
1107 Ga0265327_10000935 3300031251 Bacteria 42778
1108 Ga0265327_10002931 3300031251 Bacteria 17082
1109 Ga0265327_10003245 3300031251 Bacteria 15790
1110 Ga0265327_10009260 3300031251 Bacteria 7142
1111 Ga0265327_10019296 3300031251 Bacteria 4196
1112 Ga0265316_10000073 3300031344 Bacteria 103125
1113 Ga0265316_10000442 3300031344 Bacteria 47118
1114 Ga0265316_10000823 3300031344 Bacteria 34334
1115 Ga0265316_10001627 3300031344 Bacteria 23924
1116 Ga0265316_10003656 3300031344 Bacteria 15481
1117 Ga0265316_10005031 3300031344 Bacteria 12969
1118 Ga0265316_10005290 3300031344 Bacteria 12589
1119 Ga0265316_10012651 3300031344 Bacteria 7554
1120 Ga0265316_10016937 3300031344 Bacteria 6310
1121 Ga0265316_10024038 3300031344 Bacteria 5115
1122 Ga0265316_10051037 3300031344 Bacteria 3250
1123 Ga0265316_10099083 3300031344 Bacteria 2217
1124 Ga0265316_10121393 3300031344 Bacteria 1973
1125 Ga0265316_10157657 3300031344 Bacteria 1698
1126 Ga0265316_10191706 3300031344 Bacteria 1518
1127 Ga0307513_10006370 3300031456 Bacteria 15433
1128 Ga0307513_10033515 3300031456 Bacteria 5772
1129 Ga0307513_10077780 3300031456 Bacteria 3434
1130 Ga0307509_10089224 3300031507 Bacteria 3162
1131 Ga0307509_10137139 3300031507 Bacteria 2390
1132 Ga0307408_100000079 3300031548 Bacteria 108053
1133 Ga0307408_100000178 3300031548 Bacteria 71389
1134 Ga0307408_100000273 3300031548 Bacteria 51911
1135 Ga0307408_100000717 3300031548 Bacteria 26926
1136 Ga0307408_100017915 3300031548 Bacteria 4748
1137 Ga0307408_100018543 3300031548 Bacteria 4673
1138 Ga0307408_100077015 3300031548 Bacteria 2482
1139 Ga0307408_100109746 3300031548 Bacteria 2117
1140 Ga0265313_10004857 3300031595 Bacteria 10100
1141 Ga0265313_10007425 3300031595 Bacteria 7497
1142 Ga0265313_10008077 3300031595 Bacteria 7048
1143 Ga0307508_10033363 3300031616 Bacteria 4646
1144 Ga0316575_10000506 3300031665 Bacteria 11280
1145 Ga0316575_10005591 3300031665 Bacteria 4484
1146 Ga0316579_10002847 3300031691 Bacteria 6619
1147 Ga0316579_10004434 3300031691 Bacteria 5570
1148 Ga0316579_10005421 3300031691 Bacteria 5148
1149 Ga0316579_10008552 3300031691 Bacteria 4273
1150 Ga0316579_10011147 3300031691 Bacteria 3816
1151 Ga0316579_10017282 3300031691 Bacteria 3161
1152 Ga0316579_10029579 3300031691 Bacteria 2500
1153 Ga0316579_10037501 3300031691 Bacteria 2239
1154 Ga0316579_10054146 3300031691 Bacteria 1881
1155 Ga0265314_10000022 3300031711 Bacteria 297299
1156 Ga0265314_10000381 3300031711 Bacteria 60782
1157 Ga0265314_10003723 3300031711 Bacteria 14590
1158 Ga0265314_10008473 3300031711 Bacteria 8802
1159 Ga0265314_10051574 3300031711 Bacteria 2865
1160 Ga0265342_10000202 3300031712 Bacteria 66840
1161 Ga0265342_10001559 3300031712 Bacteria 21200
1162 Ga0265342_10003464 3300031712 Bacteria 12927
1163 Ga0265342_10006108 3300031712 Bacteria 9024
1164 Ga0265342_10008635 3300031712 Bacteria 7282
1165 Ga0265342_10020801 3300031712 Bacteria 4198
1166 Ga0265342_10026904 3300031712 Bacteria 3601
1167 Ga0265342_10033445 3300031712 Bacteria 3161
1168 Ga0265342_10077763 3300031712 Bacteria 1921
1169 Ga0316576_10000753 3300031727 Bacteria 16136
1170 Ga0316576_10002667 3300031727 Bacteria 10207
1171 Ga0316576_10004357 3300031727 Bacteria 8475
1172 Ga0316576_10005272 3300031727 Bacteria 7873
1173 Ga0316576_10006703 3300031727 Bacteria 7196
1174 Ga0316576_10013343 3300031727 Bacteria 5457
1175 Ga0316576_10015060 3300031727 Bacteria 5179
1176 Ga0316576_10015734 3300031727 Bacteria 5085
1177 Ga0316576_10016646 3300031727 Bacteria 4973
1178 Ga0316576_10021425 3300031727 Bacteria 4470
1179 Ga0316576_10025171 3300031727 Bacteria 4163
1180 Ga0316576_10026661 3300031727 Bacteria 4057
1181 Ga0316576_10030660 3300031727 Bacteria 3810
1182 Ga0316576_10033635 3300031727 Bacteria 3651
1183 Ga0316576_10034671 3300031727 Bacteria 3598
1184 Ga0316576_10051745 3300031727 Bacteria 2990
1185 Ga0316576_10066715 3300031727 Bacteria 2647
1186 Ga0316576_10070104 3300031727 Bacteria 2586
1187 Ga0316576_10073820 3300031727 Bacteria 2521
1188 Ga0316576_10076125 3300031727 Bacteria 2483
1189 Ga0316576_10102220 3300031727 Bacteria 2143
1190 Ga0316576_10110847 3300031727 Bacteria 2057
1191 Ga0316576_10137265 3300031727 Bacteria 1840
1192 Ga0316576_10143472 3300031727 Bacteria 1798
1193 Ga0316576_10223752 3300031727 Bacteria 1415
1194 Ga0316578_10000018 3300031728 Bacteria 35033
1195 Ga0316578_10000388 3300031728 Bacteria 14128
1196 Ga0316578_10000482 3300031728 Bacteria 13401
1197 Ga0316578_10001002 3300031728 Bacteria 10799
1198 Ga0316578_10001316 3300031728 Bacteria 9954
1199 Ga0316578_10006072 3300031728 Bacteria 5923
1200 Ga0316578_10016385 3300031728 Bacteria 4010
1201 Ga0316578_10022033 3300031728 Bacteria 3546
1202 Ga0316578_10034918 3300031728 Bacteria 2889
1203 Ga0316578_10039540 3300031728 Bacteria 2724
1204 Ga0316578_10075721 3300031728 Bacteria 1997
1205 Ga0316578_10122308 3300031728 Bacteria 1565
1206 Ga0316578_10132270 3300031728 Bacteria 1501
1207 Ga0316578_10133079 3300031728 Bacteria 1497
1208 Ga0316578_10134419 3300031728 Bacteria 1489
1209 Ga0307405_10007374 3300031731 Bacteria 5493
1210 Ga0316577_10000594 3300031733 Bacteria 14896
1211 Ga0316577_10000999 3300031733 Bacteria 12656
1212 Ga0316577_10001322 3300031733 Bacteria 11615
1213 Ga0316577_10003794 3300031733 Bacteria 7699
1214 Ga0316577_10004155 3300031733 Bacteria 7436
1215 Ga0316577_10005455 3300031733 Bacteria 6672
1216 Ga0316577_10007638 3300031733 Bacteria 5771
1217 Ga0316577_10024994 3300031733 Bacteria 3322
1218 Ga0316577_10026820 3300031733 Bacteria 3210
1219 Ga0316577_10034825 3300031733 Bacteria 2814
1220 Ga0316577_10053732 3300031733 Bacteria 2248
1221 Ga0316577_10067929 3300031733 Bacteria 1990
1222 Ga0316577_10076942 3300031733 Bacteria 1863
1223 Ga0316577_10086345 3300031733 Bacteria 1756
1224 Ga0316577_10103052 3300031733 Bacteria 1600
1225 Ga0307413_10139457 3300031824 Bacteria 1673
1226 Ga0307410_10000031 3300031852 Bacteria 49813
1227 Ga0307406_10000132 3300031901 Bacteria 44227
1228 Ga0307406_10000743 3300031901 Bacteria 18273
1229 Ga0307407_10015746 3300031903 Bacteria 3748
1230 Ga0307412_10000023 3300031911 Bacteria 237005
1231 Ga0307412_10000162 3300031911 Bacteria 47157
1232 Ga0307412_10033731 3300031911 Bacteria 3256
1233 Ga0307412_10047110 3300031911 Bacteria 2829
1234 Ga0307412_10054740 3300031911 Bacteria 2650
1235 Ga0307412_10067954 3300031911 Bacteria 2421
1236 Ga0307409_100050670 3300031995 Bacteria 3172
1237 Ga0307409_100093051 3300031995 Bacteria 2476
1238 Ga0307409_100104524 3300031995 Bacteria 2359
1239 Ga0307416_100004592 3300032002 Bacteria 8353
1240 Ga0307416_100015361 3300032002 Bacteria 5287
1241 Ga0307414_10000064 3300032004 Bacteria 106601
1242 Ga0307414_10000666 3300032004 Bacteria 17595
1243 Ga0307414_10051308 3300032004 Bacteria 2863
1244 Ga0307411_10000009 3300032005 Bacteria 319906
1245 Ga0307411_10098410 3300032005 Bacteria 2061
1246 Ga0307411_10167076 3300032005 Bacteria 1655
1247 Ga0307415_100010246 3300032126 Bacteria 5299
1248 Ga0307415_100146739 3300032126 Bacteria 1810
1249 Ga0316583_10000190 3300032133 Bacteria 15861
1250 Ga0316583_10000700 3300032133 Bacteria 10357
1251 Ga0316583_10001533 3300032133 Bacteria 7749
1252 Ga0316583_10002466 3300032133 Bacteria 6427
1253 Ga0316583_10003925 3300032133 Bacteria 5285
1254 Ga0316583_10006815 3300032133 Bacteria 4116
1255 Ga0316583_10008589 3300032133 Bacteria 3684
1256 Ga0316583_10018032 3300032133 Bacteria 2535
1257 Ga0316583_10040740 3300032133 Bacteria 1644
1258 Ga0316585_10000558 3300032137 Bacteria 9071
1259 Ga0316585_10007713 3300032137 Bacteria 3109
1260 Ga0316585_10023575 3300032137 Bacteria 1899
1261 Ga0316580_10001423 3300032139 Bacteria 6238
1262 Ga0316580_10001520 3300032139 Bacteria 6093
1263 Ga0316580_10002031 3300032139 Bacteria 5485
1264 Ga0316580_10010770 3300032139 Bacteria 2769
1265 Ga0316580_10024878 3300032139 Bacteria 1850
1266 Ga0316593_10038181 3300032168 Bacteria 1589
1267 Ga0307510_10038191 3300033180 Bacteria 5312
1268 Ga0307510_10082397 3300033180 Bacteria 3112
1269 Ga0316587_1002649 3300033529 Bacteria 2417
1270 Ga0373926_0025920 3300035083 Bacteria 2049
1271 Ga0373934_0000687 3300035086 Bacteria 12026
1272 Ga0373934_0000741 3300035086 Bacteria 11676
1273 Ga0373949_0000198 3300035090 Bacteria 23288
1274 Ga0373951_0002387 3300035091 Bacteria 4743
1275 Ga0373923_0002316 3300035111 Bacteria 5827
1276 Ga0373923_0025021 3300035111 Bacteria 2362
1277 Ga0373936_0014976 3300035113 Bacteria 2969
1278 Ga0373945_0002779 3300035116 Bacteria 5494
1279 Ga0373953_0005532 3300035117 Bacteria 4107
1280 Ga0373956_0000757 3300035119 Bacteria 13374
1281 Ga0373956_0002802 3300035119 Bacteria 7046
1282 Ga0373960_0011752 3300035121 Bacteria 2163
1283 Ga0373943_0112437 3300035170 Bacteria 1438
1284 Ga0373946_0028796 3300035171 Bacteria 2206
1285 Ga0373955_0000226 3300035172 Bacteria 23629
1286 Ga0373955_0025135 3300035172 Bacteria 3055
1287 Ga0373961_0000014 3300035241 Bacteria 111529
1288 Ga0373961_0000948 3300035241 Bacteria 9631
1289 Ga0316574_0001001 3300035398 Bacteria 12724
1290 Ga0316574_0001207 3300035398 Bacteria 11999
1291 Ga0316574_0001667 3300035398 Bacteria 10702
1292 Ga0316574_0003253 3300035398 Bacteria 8337
1293 Ga0316574_0008740 3300035398 Bacteria 5639
1294 Ga0316574_0011531 3300035398 Bacteria 5026
1295 Ga0316574_0012596 3300035398 Bacteria 4841
1296 Ga0316574_0023928 3300035398 Bacteria 3652
1297 Ga0316574_0027059 3300035398 Bacteria 3453
1298 Ga0316574_0031028 3300035398 Bacteria 3240
1299 Ga0316574_0034241 3300035398 Bacteria 3096
1300 Ga0316574_0038544 3300035398 Bacteria 2934
1301 Ga0316574_0055698 3300035398 Bacteria 2472
1302 Ga0316574_0058577 3300035398 Bacteria 2413
1303 Ga0316574_0080414 3300035398 Bacteria 2068
1304 Ga0316574_0102916 3300035398 Bacteria 1828
1305 Ga0316574_0109931 3300035398 Bacteria 1766
1306 Ga0373935_0001300 3300035692 Bacteria 13781
1307 Ga0373935_0010391 3300035692 Bacteria 5582
1308 Ga0373935_0022153 3300035692 Bacteria 3893
1309 Ga0373927_0001907 3300035695 Bacteria 15406
1310 Ga0373927_0005146 3300035695 Bacteria 9047
1311 Ga0373927_0025912 3300035695 Bacteria 3832
1312 Ga0373927_0117175 3300035695 Bacteria 1737
1313 Ga0373927_0161969 3300035695 Bacteria 1466
1314 Ga0373933_0000772 3300035724 Bacteria 19513
1315 Ga0373933_0005458 3300035724 Bacteria 6923
1316 Ga0373947_0004919 3300035725 Bacteria 7812
1317 Ga0373947_0008485 3300035725 Bacteria 5918
1318 Ga0373947_0016063 3300035725 Bacteria 4302
1319 Ga0373947_0018745 3300035725 Bacteria 3985
1320 Ga0373937_0000890 3300036401 Bacteria 25608
1321 Ga0373937_0157469 3300036401 Bacteria 2129
1322 Ga0316582_0001543 3300036647 Bacteria 10205
1323 Ga0316582_0006253 3300036647 Bacteria 6232
1324 Ga0316582_0006723 3300036647 Bacteria 6068
1325 Ga0316582_0007635 3300036647 Bacteria 5768
1326 Ga0316582_0008435 3300036647 Bacteria 5539
1327 Ga0316582_0019625 3300036647 Bacteria 3962
1328 Ga0316582_0019801 3300036647 Bacteria 3945
1329 Ga0316582_0020648 3300036647 Bacteria 3877
1330 Ga0316582_0022862 3300036647 Bacteria 3719
1331 Ga0316582_0023699 3300036647 Bacteria 3662
1332 Ga0316582_0033416 3300036647 Bacteria 3160
1333 Ga0316582_0039239 3300036647 Bacteria 2947
1334 Ga0316582_0056789 3300036647 Bacteria 2499
1335 Ga0316582_0060821 3300036647 Bacteria 2422
1336 Ga0316582_0087847 3300036647 Bacteria 2041
1337 Ga0316582_0092088 3300036647 Bacteria 1997
1338 Ga0316582_0109045 3300036647 Bacteria 1841
1339 Ga0316582_0119707 3300036647 Bacteria 1761
1340 Ga0316582_0173291 3300036647 Bacteria 1466
1341 Ga0316584_0000012 3300036712 Bacteria 63927
1342 Ga0316584_0000143 3300036712 Bacteria 32105
1343 Ga0316584_0000613 3300036712 Bacteria 19357
1344 Ga0316584_0002523 3300036712 Bacteria 11602
1345 Ga0316584_0006454 3300036712 Bacteria 7941
1346 Ga0316584_0010505 3300036712 Bacteria 6473
1347 Ga0316584_0016955 3300036712 Bacteria 5227
1348 Ga0316584_0022924 3300036712 Bacteria 4557
1349 Ga0316584_0027667 3300036712 Bacteria 4174
1350 Ga0316584_0032080 3300036712 Bacteria 3886
1351 Ga0316584_0043632 3300036712 Bacteria 3344
1352 Ga0316584_0082825 3300036712 Bacteria 2403
1353 Ga0316584_0083921 3300036712 Bacteria 2386
1354 Ga0316584_0088550 3300036712 Bacteria 2318
1355 Ga0316584_0090352 3300036712 Bacteria 2292
1356 Ga0316584_0092943 3300036712 Unclassified 2258
1357 Ga0316584_0111885 3300036712 Bacteria 2043
1358 Ga0316584_0138321 3300036712 Bacteria 1817
1359 Ga0316584_0169047 3300036712 Bacteria 1623
1360 Ga0316584_0171414 3300036712 Bacteria 1609
1361 Ga0316584_0210360 3300036712 Bacteria 1432
1362 Ga0316584_0214376 3300036712 Bacteria 1416
1363 Ga0373925_0051326 3300037068 Bacteria 3079
1364 Ga0373925_0088118 3300037068 Bacteria 2370
1365 Ga0395899_0005950 3300037312 Bacteria 9474
1366 Ga0395899_0019992 3300037312 Bacteria 5081
1367 Ga0395900_0002207 3300037418 Bacteria 21753
1368 Ga0395900_0070096 3300037418 Bacteria 3604
1369 Ga0395900_0080554 3300037418 Bacteria 3346
1370 Ga0395898_0001975 3300037466 Bacteria 25800
1371 Ga0395905_0004379 3300037471 Bacteria 14697
1372 Ga0395905_0036458 3300037471 Bacteria 4619
1373 Ga0395905_0042134 3300037471 Bacteria 4283
1374 Ga0395905_0089928 3300037471 Bacteria 2878
1375 Ga0316581_0008714 3300037588 Bacteria 2771
1376 Ga0316581_0011615 3300037588 Bacteria 2466
1377 Ga0436364_0855899 3300037853 Bacteria 18206
1378 Ga0395901_0002134 3300038443 Bacteria 20258
1379 Ga0395901_0004888 3300038443 Bacteria 13521
1380 Ga0395901_0008049 3300038443 Bacteria 10647
1381 Ga0395901_0109739 3300038443 Bacteria 2897
1382 Ga0395901_0125849 3300038443 Bacteria 2693
1383 Ga0395901_0172788 3300038443 Bacteria 2267
1384 Ga0395901_0321446 3300038443 Bacteria 1601
1385 Ga0237819_02469 3300038705 Bacteria 3704
1386 Ga0237819_03446 3300038705 Bacteria 2802
1387 Ga0400484_00611 3300038725 Bacteria 14568
1388 Ga0400484_03648 3300038725 Bacteria 7194
1389 Ga0400484_26818 3300038725 Bacteria 9273
1390 Ga0400484_33081 3300038725 Bacteria 3277
1391 Ga0400484_38520 3300038725 Bacteria 13078
1392 Ga0400490_03382 3300038726 Bacteria 17260
1393 Ga0400490_03872 3300038726 Bacteria 23989
1394 Ga0400490_16399 3300038726 Bacteria 2030
1395 Ga0400490_20164 3300038726 Bacteria 20003
1396 Ga0400490_26103 3300038726 Bacteria 26327
1397 Ga0400490_31755 3300038726 Bacteria 9493
1398 Ga0400490_43299 3300038726 Bacteria 5427
1399 Ga0400490_47884 3300038726 Bacteria 4406
1400 Ga0400490_49878 3300038726 Bacteria 2045
1401 Ga0400490_50905 3300038726 Bacteria 65742
1402 Ga0400491_01864 3300038727 Bacteria 5197
1403 Ga0400491_17037 3300038727 Bacteria 1884
1404 Ga0400491_24444 3300038727 Bacteria 1656
1405 Ga0400485_02682 3300038735 Bacteria 38427
1406 Ga0400485_09566 3300038735 Bacteria 11998
1407 Ga0400485_12529 3300038735 Bacteria 52876
1408 Ga0400485_14551 3300038735 Bacteria 14286
1409 Ga0400485_16497 3300038735 Bacteria 5670
1410 Ga0400485_17143 3300038735 Bacteria 18739
1411 Ga0400488_22426 3300038741 Bacteria 11673
1412 Ga0400488_47901 3300038741 Bacteria 2565
1413 Ga0400488_54281 3300038741 Bacteria 2196
1414 Ga0400488_56508 3300038741 Bacteria 7637
1415 Ga0400488_62343 3300038741 Bacteria 2180
1416 Ga0400486_06036 3300038742 Bacteria 20431
1417 Ga0400486_08234 3300038742 Bacteria 5257
1418 Ga0400486_16402 3300038742 Bacteria 35543
1419 Ga0400486_16511 3300038742 Bacteria 11583
1420 Ga0400486_18734 3300038742 Bacteria 45001
1421 Ga0400486_20299 3300038742 Bacteria 15103
1422 Ga0400483_006940 3300039062 Bacteria 2471
1423 Ga0400483_015191 3300039062 Bacteria 15402
1424 Ga0400483_063982 3300039062 Bacteria 2674
1425 Ga0400483_068767 3300039062 Bacteria 84641
1426 Ga0400483_110321 3300039062 Bacteria 12617
1427 Ga0400483_112260 3300039062 Bacteria 6192
1428 Ga0400483_120530 3300039062 Bacteria 1690
1429 Ga0400483_126084 3300039062 Bacteria 8937
1430 Ga0400483_134788 3300039062 Bacteria 1523
1431 Ga0400483_143368 3300039062 Bacteria 16289
1432 Ga0400483_173481 3300039062 Bacteria 60352
1433 Ga0400483_202610 3300039062 Bacteria 1511
1434 Ga0400483_218987 3300039062 Bacteria 1886
1435 Ga0400483_233352 3300039062 Bacteria 2530
1436 Ga0400483_242137 3300039062 Bacteria 2516
1437 Ga0400483_280457 3300039062 Bacteria 17471
1438 Ga0400483_286886 3300039062 Bacteria 3840
1439 Ga0400483_291297 3300039062 Bacteria 5122
1440 Ga0400489_01228 3300039093 Bacteria 3720
1441 Ga0400489_18992 3300039093 Bacteria 15158
1442 Ga0400489_21683 3300039093 Bacteria 11621
1443 Ga0400489_25826 3300039093 Bacteria 5566
1444 Ga0400489_29768 3300039093 Bacteria 87186
1445 Ga0400489_35047 3300039093 Bacteria 73845
1446 Ga0400489_45196 3300039093 Bacteria 7459
1447 Ga0400489_50224 3300039093 Bacteria 2912
1448 Ga0400489_52808 3300039093 Bacteria 13287
1449 Ga0400489_68266 3300039093 Bacteria 3723
1450 Ga0400489_69212 3300039093 Bacteria 2942
1451 Ga0400489_72172 3300039093 Bacteria 21942
1452 Ga0400489_73307 3300039093 Bacteria 22895
1453 Ga0400489_84719 3300039093 Bacteria 2609
1454 Ga0400487_10399 3300039110 Bacteria 2229
1455 Ga0400487_56498 3300039110 Bacteria 53998
1456 Ga0436365_1037676 3300039437 Bacteria 170132
1457 Ga0436365_1337717 3300039437 Bacteria 2256
1458 Ga0436361_0210320 3300039447 Bacteria 6994
1459 Ga0436361_0250104 3300039447 Bacteria 4601
1460 Ga0436361_1107681 3300039447 Bacteria 6320
1461 Ga0439436_0006308 3300041404 Bacteria 3641
1462 Ga0439438_000215 3300041405 Bacteria 26522
1463 Ga0439438_006180 3300041405 Bacteria 4265
1464 Ga0439438_006308 3300041405 Bacteria 4209
1465 Ga0439447_000076 3300041407 Bacteria 34578
1466 Ga0439447_003000 3300041407 Bacteria 6040
1467 Ga0439447_003632 3300041407 Bacteria 5445
1468 Ga0439447_005707 3300041407 Bacteria 4116
1469 Ga0439447_011486 3300041407 Bacteria 2581
1470 Ga0439466_0000784 3300041411 Bacteria 12045
1471 Ga0439466_0007042 3300041411 Bacteria 4260
1472 Ga0439466_0014154 3300041411 Bacteria 2909
1473 Ga0439466_0024629 3300041411 Bacteria 2108
1474 Ga0439465_0000001 3300041413 Bacteria 82718
1475 Ga0451852_27934 3300041508 Bacteria 1430
1476 Ga0439445_0014607 3300042004 Bacteria 1914
1477 Ga0439432_000305 3300042006 Bacteria 17677
1478 Ga0439432_003746 3300042006 Bacteria 5611
1479 Ga0439432_007277 3300042006 Bacteria 3929
1480 Ga0439432_022239 3300042006 Bacteria 2094
1481 Ga0439452_000002 3300042010 Bacteria 1377577
1482 Ga0439452_000008 3300042010 Bacteria 569877
1483 Ga0439452_002710 3300042010 Bacteria 6422
1484 Ga0439452_003663 3300042010 Bacteria 5326
1485 Ga0439452_003877 3300042010 Bacteria 5129
1486 Ga0439452_004760 3300042010 Bacteria 4484
1487 Ga0439452_007031 3300042010 Bacteria 3474
1488 Ga0439452_016691 3300042010 Bacteria 1989
1489 Ga0439456_000475 3300042013 Bacteria 8767
1490 Ga0439456_003873 3300042013 Bacteria 3037
1491 Ga0439456_007062 3300042013 Bacteria 2300
1492 Ga0439463_003270 3300042016 Bacteria 4113
1493 Ga0450911_000790 3300042115 Bacteria 8852
1494 Ga0450911_001274 3300042115 Bacteria 6021
1495 Ga0450920_002487 3300042122 Bacteria 3139
1496 Ga0450923_007695 3300042125 Bacteria 1831
1497 Ga0450902_000703 3300042137 Bacteria 4274
1498 Ga0450902_002473 3300042137 Bacteria 2622
1499 Ga0450903_002126 3300042138 Bacteria 3556
1500 Ga0450907_001138 3300042146 Bacteria 6041
1501 Ga0450907_007951 3300042146 Bacteria 1765
1502 Ga0450910_001712 3300042147 Bacteria 2813
1503 Ga0439446_0005663 3300042156 Bacteria 3220
1504 Ga0439434_0000357 3300042435 Bacteria 13113
1505 Ga0439434_0002560 3300042435 Bacteria 5292
1506 Ga0439435_0006362 3300042436 Bacteria 2651
1507 Ga0439464_0000037 3300042439 Bacteria 16759
1508 Ga0439460_0005120 3300042461 Bacteria 3208
1509 Ga0451577_0000030 3300042876 Bacteria 391423
1510 Ga0451577_0000033 3300042876 Bacteria 378714
1511 Ga0451577_0000037 3300042876 Bacteria 360162
1512 Ga0451577_0000112 3300042876 Bacteria 177581
1513 Ga0451577_0000393 3300042876 Bacteria 80362
1514 Ga0451577_0000866 3300042876 Bacteria 45041
1515 Ga0451577_0001296 3300042876 Bacteria 34405
1516 Ga0451577_0001566 3300042876 Bacteria 29973
1517 Ga0451577_0002979 3300042876 Bacteria 19372
1518 Ga0451577_0006392 3300042876 Bacteria 11760
1519 Ga0451577_0007142 3300042876 Bacteria 11015
1520 Ga0451577_0008077 3300042876 Bacteria 10267
1521 Ga0451577_0008256 3300042876 Bacteria 10143
1522 Ga0451577_0014190 3300042876 Bacteria 7427
1523 Ga0451577_0014601 3300042876 Bacteria 7318
1524 Ga0451577_0028842 3300042876 Bacteria 5019
1525 Ga0451577_0029119 3300042876 Bacteria 4993
1526 Ga0451577_0030167 3300042876 Bacteria 4900
1527 Ga0451577_0030261 3300042876 Bacteria 4892
1528 Ga0451577_0033460 3300042876 Bacteria 4634
1529 Ga0451577_0036504 3300042876 Bacteria 4424
1530 Ga0451577_0038874 3300042876 Bacteria 4278
1531 Ga0451577_0039911 3300042876 Bacteria 4216
1532 Ga0451577_0043362 3300042876 Bacteria 4029
1533 Ga0451577_0043383 3300042876 Bacteria 4029
1534 Ga0451577_0043661 3300042876 Bacteria 4016
1535 Ga0451577_0050652 3300042876 Bacteria 3707
1536 Ga0451577_0070533 3300042876 Bacteria 3116
1537 Ga0451577_0073372 3300042876 Bacteria 3053
1538 Ga0451577_0080389 3300042876 Bacteria 2907
1539 Ga0451577_0083806 3300042876 Bacteria 2844
1540 Ga0451577_0088373 3300042876 Bacteria 2765
1541 Ga0451577_0089277 3300042876 Bacteria 2750
1542 Ga0451577_0099459 3300042876 Bacteria 2598
1543 Ga0451577_0159040 3300042876 Bacteria 2034
1544 Ga0451577_0165854 3300042876 Bacteria 1990
1545 Ga0451577_0203484 3300042876 Bacteria 1787
1546 Ga0451577_0210759 3300042876 Bacteria 1755
1547 Ga0451577_0402802 3300042876 Bacteria 1242
1548 Ga0439440_0003630 3300042993 Bacteria 2990
1549 Ga0439440_0007062 3300042993 Bacteria 2275
1550 Ga0466977_0001752 3300044666 Bacteria 9324
1551 Ga0453683_0000010 3300044673 Bacteria 470890
1552 Ga0453683_0000021 3300044673 Bacteria 284502
1553 Ga0453683_0000082 3300044673 Bacteria 143197
1554 Ga0453683_0000538 3300044673 Bacteria 42284
1555 Ga0453683_0001314 3300044673 Bacteria 21925
1556 Ga0453683_0003752 3300044673 Bacteria 11084
1557 Ga0453683_0003785 3300044673 Bacteria 11023
1558 Ga0453683_0014411 3300044673 Bacteria 5133
1559 Ga0453683_0017683 3300044673 Bacteria 4588
1560 Ga0453683_0019328 3300044673 Bacteria 4366
1561 Ga0453683_0024988 3300044673 Bacteria 3796
1562 Ga0453683_0029763 3300044673 Bacteria 3451
1563 Ga0453683_0030066 3300044673 Bacteria 3434
1564 Ga0453683_0031936 3300044673 Bacteria 3325
1565 Ga0453683_0060920 3300044673 Bacteria 2359
1566 Ga0453683_0123420 3300044673 Bacteria 1630
1567 Ga0466965_0000007 3300044683 Bacteria 131940
1568 Ga0453684_0000109 3300044712 Bacteria 361015
1569 Ga0453684_0000110 3300044712 Bacteria 360542
1570 Ga0453684_0000118 3300044712 Bacteria 346595
1571 Ga0453684_0000143 3300044712 Bacteria 315998
1572 Ga0453684_0000190 3300044712 Bacteria 269203
1573 Ga0453684_0000199 3300044712 Bacteria 264155
1574 Ga0453684_0000202 3300044712 Bacteria 261894
1575 Ga0453684_0000334 3300044712 Bacteria 196444
1576 Ga0453684_0000398 3300044712 Bacteria 178891
1577 Ga0453684_0000433 3300044712 Bacteria 170341
1578 Ga0453684_0000461 3300044712 Bacteria 162371
1579 Ga0453684_0000523 3300044712 Bacteria 146814
1580 Ga0453684_0000547 3300044712 Bacteria 142253
1581 Ga0453684_0000662 3300044712 Bacteria 123698
1582 Ga0453684_0000766 3300044712 Bacteria 111429
1583 Ga0453684_0001189 3300044712 Bacteria 80442
1584 Ga0453684_0001191 3300044712 Bacteria 80362
1585 Ga0453684_0001326 3300044712 Bacteria 73118
1586 Ga0453684_0001522 3300044712 Bacteria 64945
1587 Ga0453684_0001620 3300044712 Bacteria 61605
1588 Ga0453684_0002060 3300044712 Bacteria 51082
1589 Ga0453684_0002074 3300044712 Bacteria 50909
1590 Ga0453684_0002091 3300044712 Bacteria 50553
1591 Ga0453684_0003476 3300044712 Bacteria 35373
1592 Ga0453684_0004507 3300044712 Bacteria 29242
1593 Ga0453684_0004932 3300044712 Bacteria 27213
1594 Ga0453684_0005619 3300044712 Bacteria 24659
1595 Ga0453684_0007194 3300044712 Bacteria 20652
1596 Ga0453684_0008024 3300044712 Bacteria 19107
1597 Ga0453684_0008925 3300044712 Bacteria 17749
1598 Ga0453684_0009951 3300044712 Bacteria 16401
1599 Ga0453684_0011638 3300044712 Bacteria 14689
1600 Ga0453684_0012386 3300044712 Bacteria 14078
1601 Ga0453684_0014214 3300044712 Bacteria 12779
1602 Ga0453684_0016192 3300044712 Bacteria 11685
1603 Ga0453684_0018043 3300044712 Bacteria 10864
1604 Ga0453684_0018414 3300044712 Bacteria 10718
1605 Ga0453684_0020816 3300044712 Bacteria 9856
1606 Ga0453684_0020890 3300044712 Bacteria 9826
1607 Ga0453684_0022434 3300044712 Bacteria 9362
1608 Ga0453684_0023381 3300044712 Bacteria 9109
1609 Ga0453684_0026533 3300044712 Bacteria 8359
1610 Ga0453684_0029463 3300044712 Bacteria 7791
1611 Ga0453684_0029789 3300044712 Bacteria 7734
1612 Ga0453684_0029976 3300044712 Bacteria 7701
1613 Ga0453684_0031511 3300044712 Bacteria 7449
1614 Ga0453684_0033231 3300044712 Bacteria 7195
1615 Ga0453684_0033826 3300044712 Bacteria 7112
1616 Ga0453684_0034083 3300044712 Bacteria 7078
1617 Ga0453684_0035840 3300044712 Bacteria 6848
1618 Ga0453684_0036809 3300044712 Bacteria 6735
1619 Ga0453684_0041770 3300044712 Bacteria 6193
1620 Ga0453684_0044999 3300044712 Bacteria 5893
1621 Ga0453684_0050510 3300044712 Bacteria 5469
1622 Ga0453684_0053415 3300044712 Bacteria 5274
1623 Ga0453684_0055727 3300044712 Bacteria 5137
1624 Ga0453684_0057256 3300044712 Bacteria 5046
1625 Ga0453684_0064284 3300044712 Bacteria 4688
1626 Ga0453684_0064387 3300044712 Bacteria 4684
1627 Ga0453684_0067901 3300044712 Bacteria 4531
1628 Ga0453684_0072636 3300044712 Bacteria 4342
1629 Ga0453684_0074325 3300044712 Bacteria 4280
1630 Ga0453684_0085995 3300044712 Bacteria 3904
1631 Ga0453684_0091920 3300044712 Bacteria 3743
1632 Ga0453684_0096590 3300044712 Bacteria 3629
1633 Ga0453684_0105824 3300044712 Bacteria 3430
1634 Ga0453684_0114846 3300044712 Bacteria 3263
1635 Ga0453684_0132760 3300044712 Bacteria 2986
1636 Ga0453684_0144627 3300044712 Bacteria 2834
1637 Ga0453684_0150975 3300044712 Bacteria 2761
1638 Ga0453684_0157143 3300044712 Bacteria 2694
1639 Ga0453684_0175112 3300044712 Bacteria 2524
1640 Ga0453684_0207395 3300044712 Bacteria 2280
1641 Ga0453684_0213178 3300044712 Bacteria 2243
1642 Ga0453684_0229166 3300044712 Bacteria 2146
1643 Ga0453684_0237542 3300044712 Bacteria 2100
1644 Ga0453684_0273429 3300044712 Bacteria 1929
1645 Ga0453684_0289658 3300044712 Bacteria 1865
1646 Ga0453684_0304556 3300044712 Bacteria 1810
1647 Ga0453684_0351888 3300044712 Bacteria 1661
1648 Ga0451576_0000039 3300045051 Bacteria 360162
1649 Ga0451576_0000052 3300045051 Bacteria 310414
1650 Ga0451576_0000150 3300045051 Bacteria 177361
1651 Ga0451576_0000172 3300045051 Bacteria 162376
1652 Ga0451576_0000232 3300045051 Bacteria 135846
1653 Ga0451576_0000279 3300045051 Bacteria 125074
1654 Ga0451576_0000551 3300045051 Bacteria 80362
1655 Ga0451576_0000729 3300045051 Bacteria 66020
1656 Ga0451576_0001465 3300045051 Bacteria 40000
1657 Ga0451576_0003401 3300045051 Bacteria 21934
1658 Ga0451576_0004777 3300045051 Bacteria 17367
1659 Ga0451576_0007719 3300045051 Bacteria 12784
1660 Ga0451576_0008966 3300045051 Bacteria 11659
1661 Ga0451576_0009750 3300045051 Bacteria 11102
1662 Ga0451576_0010696 3300045051 Bacteria 10507
1663 Ga0451576_0010870 3300045051 Bacteria 10415
1664 Ga0451576_0011533 3300045051 Bacteria 10029
1665 Ga0451576_0014979 3300045051 Bacteria 8613
1666 Ga0451576_0018888 3300045051 Bacteria 7535
1667 Ga0451576_0023935 3300045051 Bacteria 6602
1668 Ga0451576_0025802 3300045051 Bacteria 6330
1669 Ga0451576_0026656 3300045051 Bacteria 6214
1670 Ga0451576_0029479 3300045051 Bacteria 5871
1671 Ga0451576_0031038 3300045051 Bacteria 5699
1672 Ga0451576_0034343 3300045051 Bacteria 5387
1673 Ga0451576_0036078 3300045051 Bacteria 5244
1674 Ga0451576_0039402 3300045051 Bacteria 5001
1675 Ga0451576_0041929 3300045051 Bacteria 4834
1676 Ga0451576_0042296 3300045051 Bacteria 4811
1677 Ga0451576_0052583 3300045051 Bacteria 4268
1678 Ga0451576_0052961 3300045051 Bacteria 4253
1679 Ga0451576_0066910 3300045051 Bacteria 3740
1680 Ga0451576_0082397 3300045051 Bacteria 3346
1681 Ga0451576_0083978 3300045051 Bacteria 3313
1682 Ga0451576_0092807 3300045051 Bacteria 3140
1683 Ga0451576_0094150 3300045051 Bacteria 3115
1684 Ga0451576_0119761 3300045051 Bacteria 2740
1685 Ga0451576_0132490 3300045051 Bacteria 2599
1686 Ga0451576_0182435 3300045051 Bacteria 2191
1687 Ga0451576_0244077 3300045051 Bacteria 1876
1688 Ga0451576_0275088 3300045051 Bacteria 1760
1689 Ga0451576_0477319 3300045051 Bacteria 1310
1690 Ga0466967_0015704 3300045976 Bacteria 5946
1691 Ga0495617_004008 3300046452 Bacteria 5411
1692 Ga0495617_005953 3300046452 Bacteria 4302
1693 Ga0495617_006874 3300046452 Bacteria 3970
1694 Ga0495627_000100 3300046453 Bacteria 106276
1695 Ga0495627_004378 3300046453 Bacteria 5927
1696 Ga0495627_006122 3300046453 Bacteria 4747
1697 Ga0495627_018961 3300046453 Bacteria 2312
1698 Ga0495592_0064374 3300046454 Bacteria 2687
1699 Ga0495603_0005075 3300046455 Bacteria 7864
1700 Ga0495603_0028510 3300046455 Bacteria 3368
1701 Ga0495603_0039995 3300046455 Bacteria 2808
1702 Ga0495603_0044712 3300046455 Bacteria 2642
1703 Ga0495590_0027541 3300046457 Bacteria 1993
1704 Ga0495590_0038853 3300046457 Bacteria 1660
1705 Ga0495591_001456 3300046458 Bacteria 14667
1706 Ga0495591_002164 3300046458 Bacteria 11258
1707 Ga0495591_004279 3300046458 Bacteria 7054
1708 Ga0495591_004387 3300046458 Bacteria 6928
1709 Ga0495591_005738 3300046458 Bacteria 5660
1710 Ga0495591_006124 3300046458 Bacteria 5394
1711 Ga0495591_010220 3300046458 Bacteria 3655
1712 Ga0495591_011055 3300046458 Bacteria 3442
1713 Ga0495591_013285 3300046458 Bacteria 3023
1714 Ga0495629_0004663 3300046459 Bacteria 10262
1715 Ga0495629_0006556 3300046459 Bacteria 8620
1716 Ga0495638_0006392 3300046460 Bacteria 8579
1717 Ga0495638_0006949 3300046460 Bacteria 8168
1718 Ga0495638_0012535 3300046460 Bacteria 5804
1719 Ga0495638_0014166 3300046460 Bacteria 5398
1720 Ga0495638_0015816 3300046460 Bacteria 5055
1721 Ga0495638_0017804 3300046460 Bacteria 4730
1722 Ga0495638_0018086 3300046460 Bacteria 4686
1723 Ga0495638_0046420 3300046460 Bacteria 2728
1724 Ga0495638_0052079 3300046460 Bacteria 2551
1725 Ga0495638_0086592 3300046460 Bacteria 1893
1726 Ga0495641_0014063 3300046461 Bacteria 4351
1727 Ga0495651_0026464 3300046462 Bacteria 4519
1728 Ga0495650_0000120 3300046471 Bacteria 184191
1729 Ga0495650_0007633 3300046471 Bacteria 6458
1730 Ga0495650_0008301 3300046471 Bacteria 6082
1731 Ga0495650_0022496 3300046471 Bacteria 3022
1732 Ga0495650_0024421 3300046471 Bacteria 2854
1733 Ga0495580_0000830 3300046472 Bacteria 26783
1734 Ga0495580_0001031 3300046472 Bacteria 24463
1735 Ga0495580_0003619 3300046472 Bacteria 13093
1736 Ga0495580_0005406 3300046472 Bacteria 10558
1737 Ga0495580_0070641 3300046472 Bacteria 2439
1738 Ga0495582_0000300 3300046473 Bacteria 27352
1739 Ga0495582_0003289 3300046473 Bacteria 9081
1740 Ga0495582_0004324 3300046473 Bacteria 7987
1741 Ga0495605_0009840 3300046474 Bacteria 5363
1742 Ga0495605_0020139 3300046474 Bacteria 3548
1743 Ga0495605_0040674 3300046474 Bacteria 2319
1744 Ga0495639_0003081 3300046475 Bacteria 7253
1745 Ga0495639_0038073 3300046475 Bacteria 2158
1746 Ga0495662_0010418 3300046476 Bacteria 4553
1747 Ga0495584_0010170 3300046491 Bacteria 4830
1748 Ga0495584_0012240 3300046491 Bacteria 4383
1749 Ga0495584_0015199 3300046491 Bacteria 3921
1750 Ga0495584_0026064 3300046491 Bacteria 2962
1751 Ga0495584_0048307 3300046491 Bacteria 2145
1752 Ga0495584_0054098 3300046491 Bacteria 2020
1753 Ga0495585_0009805 3300046492 Bacteria 5728
1754 Ga0495585_0011502 3300046492 Bacteria 5237
1755 Ga0495585_0018945 3300046492 Bacteria 3970
1756 Ga0495585_0055350 3300046492 Bacteria 2192
1757 Ga0495585_0092072 3300046492 Bacteria 1632
1758 Ga0495594_0003270 3300046499 Bacteria 8398
1759 Ga0495594_0042200 3300046499 Bacteria 2498
1760 Ga0495594_0084470 3300046499 Bacteria 1775
1761 Ga0495596_0000189 3300046500 Bacteria 42603
1762 Ga0495596_0014927 3300046500 Bacteria 3264
1763 Ga0495607_0013741 3300046501 Bacteria 5292
1764 Ga0495607_0013932 3300046501 Bacteria 5250
1765 Ga0495607_0014107 3300046501 Bacteria 5214
1766 Ga0495607_0014234 3300046501 Bacteria 5186
1767 Ga0495607_0044852 3300046501 Bacteria 2603
1768 Ga0495607_0044918 3300046501 Bacteria 2601
1769 Ga0495607_0061555 3300046501 Bacteria 2132
1770 Ga0495583_0014711 3300046506 Bacteria 4299
1771 Ga0495583_0015910 3300046506 Bacteria 4068
1772 Ga0495583_0025972 3300046506 Bacteria 2914
1773 Ga0495606_0015488 3300046507 Bacteria 5870
1774 Ga0495606_0019262 3300046507 Bacteria 5084
1775 Ga0495606_0020260 3300046507 Bacteria 4911
1776 Ga0495606_0024485 3300046507 Bacteria 4348
1777 Ga0495606_0027345 3300046507 Bacteria 4047
1778 Ga0495606_0027439 3300046507 Bacteria 4038
1779 Ga0495606_0082900 3300046507 Bacteria 1989
1780 Ga0495608_0016743 3300046511 Bacteria 5072
1781 Ga0495610_0010946 3300046512 Bacteria 5588
1782 Ga0495610_0011169 3300046512 Bacteria 5508
1783 Ga0495610_0012817 3300046512 Bacteria 5015
1784 Ga0495610_0020240 3300046512 Bacteria 3698
1785 Ga0495610_0020280 3300046512 Bacteria 3693
1786 Ga0495610_0028860 3300046512 Bacteria 2929
1787 Ga0495610_0033496 3300046512 Bacteria 2655
1788 Ga0495610_0039843 3300046512 Bacteria 2372
1789 Ga0495610_0049983 3300046512 Bacteria 2043
1790 Ga0495616_0010570 3300046513 Bacteria 5336
1791 Ga0495616_0013655 3300046513 Bacteria 4574
1792 Ga0495616_0024816 3300046513 Bacteria 3210
1793 Ga0495616_0024968 3300046513 Bacteria 3198
1794 Ga0495616_0025984 3300046513 Bacteria 3122
1795 Ga0495616_0034999 3300046513 Bacteria 2602
1796 Ga0495620_0000124 3300046515 Bacteria 62374
1797 Ga0495620_0001973 3300046515 Bacteria 12003
1798 Ga0495620_0003286 3300046515 Bacteria 9271
1799 Ga0495620_0007645 3300046515 Bacteria 5851
1800 Ga0495620_0010587 3300046515 Bacteria 4860
1801 Ga0495620_0013554 3300046515 Bacteria 4171
1802 Ga0495620_0014551 3300046515 Bacteria 3996
1803 Ga0495620_0027450 3300046515 Bacteria 2663
1804 Ga0495630_0000441 3300046517 Bacteria 31615
1805 Ga0495630_0001682 3300046517 Bacteria 15412
1806 Ga0495630_0019865 3300046517 Bacteria 4945
1807 Ga0495630_0080862 3300046517 Bacteria 2452
1808 Ga0495631_0007856 3300046518 Bacteria 5407
1809 Ga0495632_0003308 3300046519 Bacteria 11498
1810 Ga0495632_0009698 3300046519 Bacteria 5779
1811 Ga0495632_0011458 3300046519 Bacteria 5171
1812 Ga0495632_0011514 3300046519 Bacteria 5156
1813 Ga0495632_0070091 3300046519 Bacteria 1686
1814 Ga0495637_0006263 3300046520 Bacteria 5987
1815 Ga0495637_0006861 3300046520 Bacteria 5691
1816 Ga0495637_0008460 3300046520 Bacteria 5052
1817 Ga0495637_0011940 3300046520 Bacteria 4163
1818 Ga0495637_0015289 3300046520 Bacteria 3600
1819 Ga0495637_0018625 3300046520 Bacteria 3218
1820 Ga0495637_0037963 3300046520 Bacteria 2087
1821 Ga0495643_0001239 3300046522 Bacteria 24515
1822 Ga0495643_0007977 3300046522 Bacteria 6751
1823 Ga0495643_0046740 3300046522 Bacteria 2345
1824 Ga0495644_0009846 3300046523 Bacteria 3679
1825 Ga0495644_0010573 3300046523 Bacteria 3556
1826 Ga0495648_0003311 3300046524 Bacteria 14213
1827 Ga0495648_0003771 3300046524 Bacteria 13187
1828 Ga0495648_0014963 3300046524 Bacteria 5651
1829 Ga0495648_0015207 3300046524 Bacteria 5601
1830 Ga0495648_0018204 3300046524 Bacteria 4988
1831 Ga0495648_0040970 3300046524 Bacteria 2930
1832 Ga0495648_0046055 3300046524 Bacteria 2707
1833 Ga0495666_0003807 3300046526 Bacteria 7632
1834 Ga0495666_0004391 3300046526 Bacteria 7128
1835 Ga0495666_0007527 3300046526 Bacteria 5447
1836 Ga0495666_0026280 3300046526 Bacteria 2871
1837 Ga0495642_0003988 3300046528 Bacteria 5768
1838 Ga0495642_0004409 3300046528 Bacteria 5463
1839 Ga0495642_0005976 3300046528 Bacteria 4671
1840 Ga0495654_0000754 3300046530 Bacteria 25055
1841 Ga0495654_0004201 3300046530 Bacteria 8614
1842 Ga0495654_0009595 3300046530 Bacteria 5300
1843 Ga0495654_0009815 3300046530 Bacteria 5231
1844 Ga0495654_0010507 3300046530 Bacteria 5035
1845 Ga0495654_0013668 3300046530 Bacteria 4338
1846 Ga0495654_0017308 3300046530 Bacteria 3791
1847 Ga0495654_0018828 3300046530 Bacteria 3613
1848 Ga0495654_0019548 3300046530 Bacteria 3542
1849 Ga0495654_0027732 3300046530 Bacteria 2899
1850 Ga0495654_0028995 3300046530 Bacteria 2826
1851 Ga0495654_0030987 3300046530 Bacteria 2716
1852 Ga0495654_0032368 3300046530 Bacteria 2651
1853 Ga0495654_0032711 3300046530 Bacteria 2635
1854 Ga0495654_0034108 3300046530 Bacteria 2570
1855 Ga0495665_0009575 3300046531 Bacteria 5249
1856 Ga0495665_0065228 3300046531 Bacteria 1922
1857 Ga0495586_0000729 3300046535 Bacteria 18807
1858 Ga0495586_0041438 3300046535 Bacteria 2480
1859 Ga0495586_0065830 3300046535 Bacteria 1975
1860 Ga0495586_0115384 3300046535 Bacteria 1497
1861 Ga0495587_0000724 3300046536 Bacteria 22064
1862 Ga0495587_0033172 3300046536 Bacteria 3118
1863 Ga0495609_0005656 3300046538 Bacteria 6515
1864 Ga0495609_0006985 3300046538 Bacteria 5691
1865 Ga0495609_0021605 3300046538 Bacteria 2969
1866 Ga0495597_0000129 3300046542 Bacteria 68183
1867 Ga0495597_0009227 3300046542 Bacteria 4888
1868 Ga0495597_0009986 3300046542 Bacteria 4662
1869 Ga0495597_0012580 3300046542 Bacteria 4079
1870 Ga0495597_0016830 3300046542 Bacteria 3449
1871 Ga0495597_0032995 3300046542 Bacteria 2347
1872 Ga0495597_0041344 3300046542 Bacteria 2059
1873 Ga0495645_0043733 3300046543 Bacteria 3268
1874 Ga0495645_0140182 3300046543 Bacteria 1688
1875 Ga0495622_0006735 3300046557 Bacteria 5327
1876 Ga0495622_0007671 3300046557 Bacteria 5012
1877 Ga0495622_0011721 3300046557 Bacteria 4053
1878 Ga0495633_0000708 3300046558 Bacteria 30329
1879 Ga0495633_0010283 3300046558 Bacteria 5115
1880 Ga0495633_0012099 3300046558 Bacteria 4607
1881 Ga0495633_0051083 3300046558 Bacteria 1948
1882 Ga0495667_0013486 3300046559 Bacteria 5531
1883 Ga0495656_0003367 3300046615 Bacteria 5404
1884 Ga0495656_0019046 3300046615 Bacteria 2644
1885 Ga0495656_0036721 3300046615 Bacteria 2019
1886 Ga0495668_0017652 3300046616 Bacteria 4134
1887 Ga0495634_0011875 3300046642 Bacteria 6329
1888 Ga0495634_0017439 3300046642 Bacteria 5122
1889 Ga0495634_0034069 3300046642 Bacteria 3496
1890 Ga0495611_0005437 3300046648 Bacteria 5446
1891 Ga0495625_0014420 3300046660 Bacteria 6309
1892 Ga0495625_0024527 3300046660 Bacteria 4589
1893 Ga0495635_0003892 3300046663 Bacteria 10375
1894 Ga0495635_0076796 3300046663 Bacteria 2289
1895 Ga0495659_0000082 3300046664 Bacteria 40924
1896 Ga0495659_0001726 3300046664 Bacteria 7278
1897 Ga0495659_0015357 3300046664 Bacteria 2516
1898 Ga0495661_0002392 3300046665 Bacteria 14484
1899 Ga0495661_0011545 3300046665 Bacteria 5990
1900 Ga0495661_0021816 3300046665 Bacteria 4169
1901 Ga0495661_0078505 3300046665 Bacteria 1909
1902 Ga0495661_0107267 3300046665 Bacteria 1562
1903 Ga0495588_0010933 3300046674 Bacteria 4245
1904 Ga0495588_0054002 3300046674 Bacteria 2072
1905 Ga0495588_0062744 3300046674 Bacteria 1926
1906 Ga0495623_0035250 3300046679 Bacteria 3207
1907 Ga0495623_0044633 3300046679 Bacteria 2816
1908 Ga0495647_0009939 3300046681 Bacteria 3232
1909 Ga0495658_0000299 3300046683 Bacteria 28208
1910 Ga0495658_0001247 3300046683 Bacteria 13368
1911 Ga0495658_0021292 3300046683 Bacteria 3417
1912 Ga0495669_0009461 3300046684 Bacteria 4110
1913 Ga0495669_0013927 3300046684 Bacteria 3433
1914 Ga0495669_0029949 3300046684 Bacteria 2388
1915 Ga0495613_0002159 3300046689 Bacteria 14909
1916 Ga0495613_0023475 3300046689 Bacteria 4595
1917 Ga0495613_0032446 3300046689 Bacteria 3880
1918 Ga0495613_0157621 3300046689 Bacteria 1616
1919 Ga0495624_0012163 3300046690 Bacteria 5892
1920 Ga0495624_0051867 3300046690 Bacteria 2594
1921 Ga0495624_0112761 3300046690 Bacteria 1672
1922 Ga0495670_0007380 3300046691 Bacteria 5404
1923 Ga0495670_0008272 3300046691 Bacteria 5115
1924 Ga0495670_0012800 3300046691 Bacteria 4124
1925 Ga0495670_0019417 3300046691 Bacteria 3349
1926 Ga0495670_0054752 3300046691 Bacteria 1999
1927 Ga0495671_0011821 3300046692 Bacteria 4784
1928 Ga0495671_0013997 3300046692 Bacteria 4325
1929 Ga0495671_0033202 3300046692 Bacteria 2630
1930 Ga0495671_0039266 3300046692 Bacteria 2391
1931 Ga0495649_0000337 3300046694 Bacteria 40360
1932 Ga0495649_0000416 3300046694 Bacteria 37037
1933 Ga0495649_0008493 3300046694 Bacteria 6172
1934 Ga0495649_0015174 3300046694 Bacteria 4386
1935 Ga0495649_0017485 3300046694 Bacteria 4044
1936 Ga0495649_0023160 3300046694 Bacteria 3469
1937 Ga0495649_0029626 3300046694 Bacteria 3026
1938 Ga0495649_0038945 3300046694 Bacteria 2606
1939 Ga0495589_0000010 3300046794 Bacteria 250407
1940 Ga0495589_0006890 3300046794 Bacteria 5972
1941 Ga0495589_0010897 3300046794 Bacteria 4723
1942 Ga0495660_0000036 3300046810 Bacteria 197450
1943 Ga0495660_0006210 3300046810 Bacteria 7088
1944 Ga0495660_0011059 3300046810 Bacteria 5241
1945 Ga0495660_0020075 3300046810 Bacteria 3832
1946 Ga0495660_0027645 3300046810 Bacteria 3209
1947 Ga0495660_0047263 3300046810 Bacteria 2357
1948 Ga0495581_0003329 3300047315 Bacteria 9229
1949 Ga0495604_0001001 3300047317 Bacteria 23511
1950 Ga0495674_0000587 3300047319 Bacteria 34072
1951 Ga0495674_0005858 3300047319 Bacteria 11788
1952 Ga0495674_0015082 3300047319 Bacteria 7232
1953 Ga0495674_0046877 3300047319 Bacteria 3835
1954 Ga0495674_0046911 3300047319 Bacteria 3833
1955 Ga0495674_0070431 3300047319 Bacteria 3022
1956 Ga0495672_0000027 3300047320 Bacteria 325651
1957 Ga0495672_0015582 3300047320 Bacteria 5156
1958 Ga0495672_0021526 3300047320 Bacteria 4204
1959 Ga0495672_0022548 3300047320 Bacteria 4090
1960 Ga0495672_0024245 3300047320 Bacteria 3912
1961 Ga0495672_0024662 3300047320 Bacteria 3869
1962 Ga0495672_0024897 3300047320 Bacteria 3844
1963 Ga0495672_0034358 3300047320 Bacteria 3133
1964 Ga0495672_0041329 3300047320 Bacteria 2789
1965 Ga0495672_0068591 3300047320 Bacteria 2015
1966 Ga0495676_0027015 3300047321 Bacteria 4930
1967 Ga0495676_0043153 3300047321 Bacteria 3694
1968 Ga0495676_0075211 3300047321 Bacteria 2584
1969 Ga0495680_0012958 3300047322 Bacteria 7301
1970 Ga0495680_0028168 3300047322 Bacteria 4608
1971 Ga0495680_0050624 3300047322 Bacteria 3246
1972 Ga0495680_0137510 3300047322 Bacteria 1790
1973 Ga0495683_0017310 3300047323 Bacteria 3738
1974 Ga0495683_0030474 3300047323 Bacteria 2751
1975 Ga0495683_0052295 3300047323 Bacteria 2039
1976 Ga0495687_009508 3300047443 Bacteria 5426
1977 Ga0495687_009631 3300047443 Bacteria 5380
1978 Ga0495675_0017338 3300047444 Bacteria 4563
1979 Ga0495675_0030782 3300047444 Bacteria 3424
1980 Ga0495677_0021241 3300047445 Bacteria 2352
1981 Ga0495679_000019 3300047446 Bacteria 231072
1982 Ga0495679_001498 3300047446 Bacteria 13187
1983 Ga0495679_005362 3300047446 Bacteria 5693
1984 Ga0495679_030774 3300047446 Bacteria 1738
1985 Ga0495673_0009235 3300047469 Bacteria 5471
1986 Ga0495673_0009240 3300047469 Bacteria 5469
1987 Ga0495673_0009939 3300047469 Bacteria 5215
1988 Ga0495673_0010243 3300047469 Bacteria 5114
1989 Ga0495673_0010973 3300047469 Bacteria 4900
1990 Ga0495673_0017918 3300047469 Bacteria 3583
1991 Ga0495673_0018453 3300047469 Bacteria 3516
1992 Ga0495673_0029145 3300047469 Bacteria 2608
1993 Ga0495673_0037046 3300047469 Bacteria 2231
1994 Ga0495681_0003395 3300047470 Bacteria 11088
1995 Ga0495681_0005954 3300047470 Bacteria 8088
1996 Ga0495681_0009718 3300047470 Bacteria 5895
1997 Ga0495681_0010523 3300047470 Bacteria 5596
1998 Ga0495681_0010998 3300047470 Bacteria 5428
1999 Ga0495681_0012145 3300047470 Bacteria 5074
2000 Ga0495681_0013501 3300047470 Bacteria 4733
2001 Ga0495681_0013679 3300047470 Bacteria 4695
2002 Ga0495681_0018169 3300047470 Bacteria 3881
2003 Ga0495681_0018998 3300047470 Bacteria 3767
2004 Ga0495681_0020977 3300047470 Bacteria 3530
2005 Ga0495681_0024404 3300047470 Bacteria 3187
2006 Ga0495681_0025844 3300047470 Bacteria 3067
2007 Ga0495684_0017361 3300047471 Bacteria 5539
2008 Ga0495684_0161494 3300047471 Bacteria 1671
2009 Ga0495686_0016545 3300047472 Bacteria 4999
2010 Ga0495686_0018995 3300047472 Bacteria 4598
2011 Ga0495593_0005574 3300047673 Bacteria 7434
2012 Ga0495593_0008906 3300047673 Bacteria 5824
2013 Ga0495593_0061352 3300047673 Bacteria 1966
2014 Ga0495602_0018454 3300048088 Bacteria 6967
2015 Ga0495602_0024479 3300048088 Bacteria 5856
2016 Ga0495602_0047607 3300048088 Bacteria 3862
2017 Ga0495614_0005873 3300048089 Bacteria 5530
2018 Ga0495626_0001279 3300048091 Bacteria 20538
2019 Ga0495626_0007774 3300048091 Bacteria 5941
2020 Ga0495626_0007837 3300048091 Bacteria 5915
2021 Ga0495626_0007975 3300048091 Bacteria 5850
2022 Ga0495626_0025223 3300048091 Bacteria 2908
2023 Ga0496100_0008015 3300048903 Bacteria 5869
2024 Ga0496100_0020495 3300048903 Bacteria 3965
2025 Ga0496101_0005879 3300048904 Bacteria 7856
2026 Ga0496101_0029344 3300048904 Bacteria 3846
2027 Ga0496101_0061519 3300048904 Bacteria 2727
2028 Ga0496101_0069223 3300048904 Bacteria 2581
2029 Ga0496102_0017528 3300048905 Bacteria 6272
2030 Ga0496102_0023148 3300048905 Bacteria 5513
2031 Ga0496102_0028405 3300048905 Bacteria 4996
2032 Ga0496102_0033956 3300048905 Bacteria 4587
2033 Ga0496102_0083735 3300048905 Bacteria 2943
2034 Ga0496103_0008474 3300048906 Bacteria 6108
2035 Ga0496103_0025431 3300048906 Bacteria 3579
2036 Ga0496103_0030251 3300048906 Bacteria 3295
2037 Ga0496103_0056365 3300048906 Bacteria 2439
2038 Ga0496103_0156066 3300048906 Bacteria 1463
2039 Ga0496104_0001118 3300048907 Bacteria 22956
2040 Ga0496104_0003113 3300048907 Bacteria 14308
2041 Ga0496104_0008000 3300048907 Bacteria 9374
2042 Ga0496104_0030612 3300048907 Bacteria 5002
2043 Ga0496104_0049314 3300048907 Bacteria 3971
2044 Ga0496104_0077858 3300048907 Bacteria 3159
2045 Ga0496104_0261113 3300048907 Bacteria 1645
2046 Ga0496105_0001878 3300048908 Bacteria 15073
2047 Ga0496105_0031254 3300048908 Bacteria 4365
2048 Ga0496105_0132219 3300048908 Bacteria 2057
2049 Ga0496106_0003524 3300048909 Bacteria 11661
2050 Ga0496106_0017299 3300048909 Bacteria 5337
2051 Ga0496106_0019949 3300048909 Bacteria 4971
2052 Ga0496106_0024654 3300048909 Bacteria 4473
2053 Ga0496106_0039521 3300048909 Bacteria 3533
2054 Ga0496107_0001542 3300048910 Bacteria 14312
2055 Ga0496107_0002329 3300048910 Bacteria 12260
2056 Ga0496107_0047532 3300048910 Bacteria 3090
2057 Ga0496107_0049763 3300048910 Bacteria 3020
2058 Ga0496108_0042068 3300048911 Bacteria 3813
2059 Ga0496108_0044548 3300048911 Bacteria 3703
2060 Ga0496108_0054847 3300048911 Bacteria 3345
2061 Ga0496108_0164942 3300048911 Bacteria 1915
2062 Ga0496109_0035058 3300048912 Bacteria 4524
2063 Ga0496109_0109184 3300048912 Bacteria 2571
2064 Ga0496109_0244626 3300048912 Bacteria 1689
2065 Ga0496110_0014135 3300048913 Bacteria 6620
2066 Ga0496110_0023376 3300048913 Bacteria 5255
2067 Ga0496110_0026357 3300048913 Bacteria 4973
2068 Ga0496110_0046454 3300048913 Bacteria 3799
2069 Ga0496110_0070048 3300048913 Bacteria 3106
2070 Ga0496110_0083396 3300048913 Bacteria 2851
2071 Ga0496110_0161388 3300048913 Bacteria 2032
2072 Ga0496110_0232403 3300048913 Bacteria 1677
2073 Ga0496111_0010757 3300048914 Bacteria 6151
2074 Ga0496111_0024059 3300048914 Bacteria 4283
2075 Ga0496111_0037096 3300048914 Bacteria 3488
2076 Ga0496111_0218646 3300048914 Bacteria 1415
2077 Ga0496112_0039999 3300048915 Bacteria 4584
2078 Ga0496112_0159814 3300048915 Bacteria 2219
2079 Ga0496112_0199197 3300048915 Bacteria 1962
2080 Ga0496113_0018647 3300048916 Bacteria 4837
2081 Ga0496113_0023346 3300048916 Bacteria 4386
2082 Ga0496113_0052537 3300048916 Bacteria 3044
2083 Ga0496113_0060347 3300048916 Bacteria 2859
2084 Ga0496113_0063545 3300048916 Bacteria 2790
2085 Ga0496113_0066451 3300048916 Bacteria 2731
2086 Ga0496114_0000009 3300048917 Bacteria 370373
2087 Ga0496114_0001722 3300048917 Bacteria 16602
2088 Ga0496114_0079460 3300048917 Bacteria 2768
2089 Ga0496114_0081556 3300048917 Bacteria 2733
2090 Ga0496115_0000563 3300048918 Bacteria 28787
2091 Ga0496115_0000589 3300048918 Bacteria 27866
2092 Ga0496115_0009252 3300048918 Bacteria 7319
2093 Ga0496115_0015282 3300048918 Bacteria 5821
2094 Ga0496115_0071595 3300048918 Bacteria 2812
2095 Ga0496115_0202228 3300048918 Bacteria 1641
2096 Ga0496116_0000051 3300048919 Bacteria 305038
2097 Ga0496116_0000075 3300048919 Bacteria 231674
2098 Ga0496116_0000077 3300048919 Bacteria 227959
2099 Ga0496116_0000096 3300048919 Bacteria 202230
2100 Ga0496116_0000181 3300048919 Bacteria 126124
2101 Ga0496116_0003506 3300048919 Bacteria 15451
2102 Ga0496116_0005939 3300048919 Bacteria 11197
2103 Ga0496116_0010913 3300048919 Bacteria 7569
2104 Ga0496116_0014431 3300048919 Bacteria 6308
2105 Ga0496116_0016278 3300048919 Bacteria 5827
2106 Ga0496116_0027419 3300048919 Bacteria 4147
2107 Ga0496116_0038970 3300048919 Bacteria 3291
2108 Ga0496116_0075287 3300048919 Bacteria 2119
2109 Ga0496116_0082396 3300048919 Bacteria 1990
2110 Ga0496117_0000005 3300048920 Bacteria 777468
2111 Ga0496117_0000007 3300048920 Bacteria 720505
2112 Ga0496117_0001792 3300048920 Bacteria 29238
2113 Ga0496117_0002904 3300048920 Bacteria 20735
2114 Ga0496117_0003141 3300048920 Bacteria 19694
2115 Ga0496117_0004669 3300048920 Bacteria 14887
2116 Ga0496117_0006894 3300048920 Bacteria 11271
2117 Ga0496117_0006961 3300048920 Bacteria 11212
2118 Ga0496117_0007471 3300048920 Bacteria 10664
2119 Ga0496117_0007796 3300048920 Bacteria 10315
2120 Ga0496117_0009888 3300048920 Bacteria 8781
2121 Ga0496117_0011818 3300048920 Bacteria 7771
2122 Ga0496117_0014842 3300048920 Bacteria 6684
2123 Ga0496117_0028413 3300048920 Bacteria 4331
2124 Ga0496117_0035280 3300048920 Bacteria 3755
2125 Ga0496117_0039136 3300048920 Bacteria 3503
2126 Ga0496117_0054119 3300048920 Bacteria 2814
2127 Ga0496117_0098861 3300048920 Bacteria 1854
2128 Ga0496118_0000031 3300048921 Bacteria 339329
2129 Ga0496118_0000140 3300048921 Bacteria 128335
2130 Ga0496118_0000767 3300048921 Bacteria 51508
2131 Ga0496118_0001845 3300048921 Bacteria 30340
2132 Ga0496118_0004066 3300048921 Bacteria 17735
2133 Ga0496118_0009800 3300048921 Bacteria 9602
2134 Ga0496118_0010081 3300048921 Bacteria 9400
2135 Ga0496118_0012713 3300048921 Bacteria 8048
2136 Ga0496118_0014028 3300048921 Bacteria 7525
2137 Ga0496118_0016470 3300048921 Bacteria 6780
2138 Ga0496118_0022406 3300048921 Bacteria 5521
2139 Ga0496118_0039714 3300048921 Bacteria 3752
2140 Ga0496118_0039971 3300048921 Bacteria 3735
2141 Ga0496118_0085899 3300048921 Bacteria 2188
2142 Ga0496118_0089177 3300048921 Bacteria 2130
2143 Ga0496118_0116090 3300048921 Bacteria 1760
2144 Ga0496118_0155707 3300048921 Bacteria 1422
2145 Ga0496119_0000007 3300048922 Bacteria 475920
2146 Ga0496119_0000066 3300048922 Bacteria 162680
2147 Ga0496119_0000069 3300048922 Bacteria 155265
2148 Ga0496119_0000160 3300048922 Bacteria 93515
2149 Ga0496119_0000759 3300048922 Bacteria 43300
2150 Ga0496119_0001223 3300048922 Bacteria 31981
2151 Ga0496119_0008246 3300048922 Bacteria 9207
2152 Ga0496119_0010770 3300048922 Bacteria 7656
2153 Ga0496119_0033494 3300048922 Bacteria 3404
2154 Ga0496119_0038070 3300048922 Bacteria 3113
2155 Ga0496120_0000038 3300048923 Bacteria 204168
2156 Ga0496120_0000112 3300048923 Bacteria 136735
2157 Ga0496120_0000139 3300048923 Bacteria 120489
2158 Ga0496120_0000192 3300048923 Bacteria 104239
2159 Ga0496120_0000243 3300048923 Bacteria 92536
2160 Ga0496120_0001402 3300048923 Bacteria 29168
2161 Ga0496120_0013007 3300048923 Bacteria 5628
2162 Ga0496120_0019386 3300048923 Bacteria 4352
2163 Ga0496120_0019523 3300048923 Bacteria 4333
2164 Ga0496120_0036780 3300048923 Bacteria 2909
2165 Ga0496120_0106176 3300048923 Bacteria 1475
2166 Ga0496121_0000195 3300048924 Bacteria 136162
2167 Ga0496121_0002186 3300048924 Bacteria 30608
2168 Ga0496121_0006282 3300048924 Bacteria 14853
2169 Ga0496121_0008513 3300048924 Bacteria 12038
2170 Ga0496121_0011352 3300048924 Bacteria 9903
2171 Ga0496121_0014973 3300048924 Bacteria 8167
2172 Ga0496121_0016438 3300048924 Bacteria 7643
2173 Ga0496121_0020957 3300048924 Bacteria 6432
2174 Ga0496121_0021741 3300048924 Bacteria 6268
2175 Ga0496121_0024685 3300048924 Bacteria 5737
2176 Ga0496121_0030925 3300048924 Bacteria 4906
2177 Ga0496121_0041719 3300048924 Bacteria 4006
2178 Ga0496121_0059953 3300048924 Bacteria 3134
2179 Ga0496121_0060172 3300048924 Bacteria 3126
2180 Ga0496121_0074555 3300048924 Bacteria 2713
2181 Ga0496122_0000237 3300048925 Bacteria 123935
2182 Ga0496122_0000280 3300048925 Bacteria 113606
2183 Ga0496122_0000291 3300048925 Bacteria 111096
2184 Ga0496122_0000416 3300048925 Bacteria 90497
2185 Ga0496122_0000588 3300048925 Bacteria 74588
2186 Ga0496122_0001745 3300048925 Bacteria 33579
2187 Ga0496122_0009251 3300048925 Bacteria 10423
2188 Ga0496122_0018025 3300048925 Bacteria 6547
2189 Ga0496122_0019412 3300048925 Bacteria 6210
2190 Ga0496122_0022915 3300048925 Bacteria 5529
2191 Ga0496122_0070124 3300048925 Bacteria 2506
2192 Ga0496123_0000078 3300048926 Bacteria 191819
2193 Ga0496123_0000104 3300048926 Bacteria 168230
2194 Ga0496123_0000229 3300048926 Bacteria 113606
2195 Ga0496123_0000790 3300048926 Bacteria 51132
2196 Ga0496123_0001434 3300048926 Bacteria 33265
2197 Ga0496123_0001470 3300048926 Bacteria 32701
2198 Ga0496123_0003754 3300048926 Bacteria 16653
2199 Ga0496123_0003867 3300048926 Bacteria 16291
2200 Ga0496123_0004168 3300048926 Bacteria 15462
2201 Ga0496123_0006711 3300048926 Bacteria 11079
2202 Ga0496123_0011646 3300048926 Bacteria 7592
2203 Ga0496123_0016608 3300048926 Bacteria 5964
2204 Ga0496123_0018797 3300048926 Bacteria 5475
2205 Ga0496123_0058495 3300048926 Bacteria 2499
2206 Ga0496123_0060014 3300048926 Bacteria 2454
2207 Ga0496124_0000026 3300048927 Bacteria 385387
2208 Ga0496124_0000100 3300048927 Bacteria 181404
2209 Ga0496124_0002438 3300048927 Bacteria 24375
2210 Ga0496124_0002570 3300048927 Bacteria 23528
2211 Ga0496124_0004397 3300048927 Bacteria 16453
2212 Ga0496124_0004407 3300048927 Bacteria 16429
2213 Ga0496124_0005203 3300048927 Bacteria 14774
2214 Ga0496124_0009296 3300048927 Bacteria 10133
2215 Ga0496124_0014416 3300048927 Bacteria 7643
2216 Ga0496124_0022157 3300048927 Bacteria 5831
2217 Ga0496124_0028884 3300048927 Bacteria 4951
2218 Ga0496124_0052243 3300048927 Bacteria 3472
2219 Ga0496124_0052313 3300048927 Bacteria 3469
2220 Ga0496124_0066797 3300048927 Bacteria 2994
2221 Ga0496124_0077974 3300048927 Bacteria 2731
2222 Ga0496124_0083586 3300048927 Bacteria 2618
2223 Ga0496124_0088808 3300048927 Bacteria 2525
2224 Ga0496124_0145000 3300048927 Bacteria 1869
2225 Ga0496125_0000024 3300048928 Bacteria 442149
2226 Ga0496125_0000070 3300048928 Bacteria 245793
2227 Ga0496125_0000226 3300048928 Bacteria 115358
2228 Ga0496125_0000364 3300048928 Bacteria 85440
2229 Ga0496125_0001029 3300048928 Bacteria 43266
2230 Ga0496125_0003184 3300048928 Bacteria 20311
2231 Ga0496125_0004744 3300048928 Bacteria 15491
2232 Ga0496125_0006488 3300048928 Bacteria 12634
2233 Ga0496125_0008479 3300048928 Bacteria 10756
2234 Ga0496125_0009455 3300048928 Bacteria 10010
2235 Ga0496125_0010323 3300048928 Bacteria 9455
2236 Ga0496125_0017357 3300048928 Bacteria 6865
2237 Ga0496125_0017588 3300048928 Bacteria 6810
2238 Ga0496125_0018023 3300048928 Bacteria 6712
2239 Ga0496125_0021748 3300048928 Bacteria 5970
2240 Ga0496125_0029031 3300048928 Bacteria 4979
2241 Ga0496125_0050170 3300048928 Bacteria 3458
2242 Ga0496125_0088607 3300048928 Bacteria 2331
2243 Ga0496126_0001297 3300048929 Bacteria 39818
2244 Ga0496126_0002437 3300048929 Bacteria 25124
2245 Ga0496126_0004899 3300048929 Bacteria 15641
2246 Ga0496126_0007430 3300048929 Bacteria 12018
2247 Ga0496126_0008317 3300048929 Bacteria 11204
2248 Ga0496126_0010844 3300048929 Bacteria 9502
2249 Ga0496126_0024727 3300048929 Bacteria 5794
2250 Ga0496126_0071011 3300048929 Bacteria 3101
2251 Ga0496126_0141242 3300048929 Bacteria 2072
2252 Ga0496126_0141525 3300048929 Bacteria 2070
2253 Ga0496126_0163117 3300048929 Bacteria 1903
2254 Ga0495678_008428 3300049459 Bacteria 5200
2255 Ga0495678_013561 3300049459 Bacteria 3820
2256 Ga0495678_020866 3300049459 Bacteria 2892
2257 Ga0495678_022516 3300049459 Bacteria 2753
2258 Ga0495682_0000174 3300049460 Bacteria 54279
2259 Ga0495682_0002927 3300049460 Bacteria 7820
2260 Ga0495682_0009057 3300049460 Bacteria 3903
2261 Ga0495682_0016005 3300049460 Bacteria 2838
2262 Ga0501031_0001325 3300049568 Bacteria 15233
2263 Ga0501031_0005851 3300049568 Bacteria 8014
2264 Ga0501031_0025303 3300049568 Bacteria 3872
2265 Ga0501031_0093645 3300049568 Bacteria 1960
2266 Ga0501031_0112069 3300049568 Bacteria 1781
2267 Ga0501031_0154283 3300049568 Bacteria 1501
2268 Ga0501032_0000445 3300049569 Bacteria 33791
2269 Ga0501032_0003475 3300049569 Bacteria 12061
2270 Ga0501032_0004498 3300049569 Bacteria 10495
2271 Ga0501032_0011737 3300049569 Bacteria 6281
2272 Ga0501032_0036144 3300049569 Bacteria 3373
2273 Ga0501032_0055175 3300049569 Bacteria 2673
2274 Ga0501032_0061670 3300049569 Bacteria 2513
2275 Ga0501032_0075830 3300049569 Bacteria 2239
2276 Ga0501032_0084985 3300049569 Bacteria 2104
2277 Ga0501032_0095117 3300049569 Bacteria 1975
2278 Ga0501033_0000336 3300049570 Bacteria 44898
2279 Ga0501033_0001087 3300049570 Bacteria 24599
2280 Ga0501033_0003106 3300049570 Bacteria 13783
2281 Ga0501033_0038813 3300049570 Bacteria 3557
2282 Ga0501033_0051034 3300049570 Bacteria 3066
2283 Ga0501034_0000131 3300049571 Bacteria 139479
2284 Ga0501034_0000548 3300049571 Bacteria 59619
2285 Ga0501034_0001019 3300049571 Bacteria 40140
2286 Ga0501034_0001617 3300049571 Bacteria 29242
2287 Ga0501034_0015924 3300049571 Bacteria 7717
2288 Ga0501034_0031493 3300049571 Bacteria 5386
2289 Ga0501034_0036253 3300049571 Bacteria 4996
2290 Ga0501034_0038453 3300049571 Bacteria 4844
2291 Ga0501034_0041254 3300049571 Bacteria 4669
2292 Ga0501034_0090297 3300049571 Bacteria 3061
2293 Ga0501034_0162502 3300049571 Bacteria 2203
2294 Ga0501034_0163817 3300049571 Bacteria 2193
2295 Ga0501034_0209669 3300049571 Bacteria 1904
2296 Ga0501034_0216823 3300049571 Bacteria 1867
2297 Ga0501036_0002923 3300049572 Bacteria 13569
2298 Ga0501036_0008830 3300049572 Bacteria 8274
2299 Ga0501036_0009281 3300049572 Bacteria 8085
2300 Ga0501036_0019941 3300049572 Bacteria 5629
2301 Ga0501036_0024204 3300049572 Bacteria 5118
2302 Ga0501036_0033632 3300049572 Bacteria 4335
2303 Ga0501036_0065007 3300049572 Bacteria 3087
2304 Ga0501036_0156047 3300049572 Bacteria 1925
2305 Ga0501036_0282770 3300049572 Bacteria 1388
2306 Ga0501037_0002801 3300049573 Bacteria 12633
2307 Ga0501037_0017651 3300049573 Bacteria 5253
2308 Ga0501037_0022108 3300049573 Bacteria 4706
2309 Ga0501037_0026946 3300049573 Bacteria 4246
2310 Ga0501037_0041557 3300049573 Bacteria 3381
2311 Ga0501037_0071651 3300049573 Bacteria 2521
2312 Ga0501038_0001663 3300049574 Bacteria 20620
2313 Ga0501038_0002148 3300049574 Bacteria 18309
2314 Ga0501038_0003198 3300049574 Bacteria 15280
2315 Ga0501038_0003797 3300049574 Bacteria 14059
2316 Ga0501038_0013910 3300049574 Bacteria 7334
2317 Ga0501038_0027577 3300049574 Bacteria 5052
2318 Ga0501038_0028765 3300049574 Bacteria 4934
2319 Ga0501038_0037237 3300049574 Bacteria 4266
2320 Ga0501038_0138724 3300049574 Bacteria 1991
2321 Ga0501038_0148614 3300049574 Bacteria 1911
2322 Ga0501039_0014159 3300049575 Bacteria 6107
2323 Ga0501039_0035046 3300049575 Bacteria 3873
2324 Ga0501039_0043620 3300049575 Bacteria 3464
2325 Ga0501039_0057060 3300049575 Bacteria 3025
2326 Ga0501039_0175473 3300049575 Bacteria 1685
2327 Ga0501040_0003730 3300049576 Bacteria 9875
2328 Ga0501040_0007334 3300049576 Bacteria 7141
2329 Ga0501040_0068964 3300049576 Bacteria 2439
2330 Ga0501041_0013008 3300049577 Bacteria 4929
2331 Ga0501041_0126008 3300049577 Bacteria 1594
2332 Ga0501042_0002736 3300049578 Bacteria 10875
2333 Ga0501042_0007788 3300049578 Bacteria 7039
2334 Ga0501042_0022536 3300049578 Bacteria 4399
2335 Ga0501042_0031755 3300049578 Bacteria 3736
2336 Ga0501042_0221007 3300049578 Bacteria 1366
2337 Ga0501043_0000018 3300049579 Bacteria 161101
2338 Ga0501043_0004020 3300049579 Bacteria 12023
2339 Ga0501043_0011974 3300049579 Bacteria 6785
2340 Ga0501043_0015548 3300049579 Bacteria 5964
2341 Ga0501043_0039870 3300049579 Bacteria 3692
2342 Ga0501046_0000042 3300049580 Bacteria 151850
2343 Ga0501046_0002908 3300049580 Bacteria 15880
2344 Ga0501046_0006873 3300049580 Bacteria 10032
2345 Ga0501046_0044594 3300049580 Bacteria 3526
2346 Ga0501046_0176577 3300049580 Bacteria 1600
2347 Ga0501047_0000047 3300049581 Bacteria 168242
2348 Ga0501047_0000052 3300049581 Bacteria 153448
2349 Ga0501047_0024356 3300049581 Bacteria 5811
2350 Ga0501047_0032402 3300049581 Bacteria 5045
2351 Ga0501047_0090693 3300049581 Bacteria 2933
2352 Ga0501047_0161863 3300049581 Bacteria 2109
2353 Ga0501048_0000459 3300049582 Bacteria 28550
2354 Ga0501048_0010416 3300049582 Bacteria 6943
2355 Ga0501048_0016477 3300049582 Bacteria 5448
2356 Ga0501048_0031426 3300049582 Bacteria 3840
2357 Ga0501048_0032987 3300049582 Bacteria 3742
2358 Ga0501048_0038268 3300049582 Bacteria 3442
2359 Ga0501067_0017430 3300049583 Bacteria 3970
2360 Ga0501068_0005998 3300049584 Bacteria 6673
2361 Ga0501068_0015768 3300049584 Bacteria 4347
2362 Ga0501069_0036462 3300049585 Bacteria 2712
2363 Ga0501069_0080689 3300049585 Bacteria 1832
2364 Ga0501070_0016000 3300049586 Bacteria 6304
2365 Ga0501070_0020320 3300049586 Bacteria 5571
2366 Ga0501070_0034633 3300049586 Bacteria 4220
2367 Ga0501070_0260804 3300049586 Bacteria 1416
2368 Ga0501071_0002077 3300049587 Bacteria 12006
2369 Ga0501072_0064796 3300049588 Bacteria 2881
2370 Ga0501072_0069734 3300049588 Bacteria 2775
2371 Ga0501074_0004078 3300049590 Bacteria 10424
2372 Ga0501074_0189071 3300049590 Bacteria 1468
2373 Ga0501074_0193386 3300049590 Bacteria 1450
2374 Ga0501075_0000261 3300049591 Bacteria 28643
2375 Ga0501075_0004727 3300049591 Bacteria 9254
2376 Ga0501075_0013701 3300049591 Bacteria 5794
2377 Ga0501075_0018650 3300049591 Bacteria 5024
2378 Ga0501076_0072219 3300049592 Bacteria 2761
2379 Ga0501076_0116128 3300049592 Bacteria 2166
2380 Ga0501077_0002214 3300049593 Bacteria 11722
2381 Ga0501077_0005964 3300049593 Bacteria 7442
2382 Ga0501223_000485 3300049663 Bacteria 9597
2383 Ga0501238_000050 3300049671 Bacteria 19623
2384 Ga0501242_000458 3300049674 Bacteria 3553
2385 Ga0501249_000007 3300049679 Bacteria 198318
2386 Ga0501249_003071 3300049679 Bacteria 3357
2387 Ga0501225_0002034 3300049705 Bacteria 6293
2388 Ga0501079_0027813 3300049741 Bacteria 4337
2389 Ga0501079_0072467 3300049741 Bacteria 2662
2390 Ga0501079_0103836 3300049741 Bacteria 2205
2391 Ga0501079_0117663 3300049741 Bacteria 2066
2392 Ga0501080_0010735 3300049742 Bacteria 8378
2393 Ga0501080_0018399 3300049742 Bacteria 6467
2394 Ga0501080_0306575 3300049742 Bacteria 1439
2395 Ga0501081_0004957 3300049743 Bacteria 8564
2396 Ga0501081_0040821 3300049743 Bacteria 3176
2397 Ga0501083_0005941 3300049744 Bacteria 8638
2398 Ga0501241_001008 3300049758 Bacteria 5929
2399 Ga0501241_002000 3300049758 Bacteria 3997
2400 Ga0501241_003386 3300049758 Bacteria 3009
2401 Ga0501266_000018 3300049763 Bacteria 135236
2402 Ga0501269_000002 3300049766 Bacteria 118370
2403 Ga0501280_000506 3300049776 Bacteria 9203
2404 Ga0501035_0001410 3300049822 Bacteria 24651
2405 Ga0501035_0004116 3300049822 Bacteria 13822
2406 Ga0501035_0008857 3300049822 Bacteria 9363
2407 Ga0501035_0035070 3300049822 Bacteria 4555
2408 Ga0501035_0064043 3300049822 Bacteria 3268
2409 Ga0501035_0216777 3300049822 Bacteria 1636
2410 Ga0501044_0000455 3300049823 Bacteria 49850
2411 Ga0501044_0001189 3300049823 Bacteria 30850
2412 Ga0501044_0003592 3300049823 Bacteria 17453
2413 Ga0501044_0003750 3300049823 Bacteria 17079
2414 Ga0501044_0012073 3300049823 Bacteria 9357
2415 Ga0501044_0034791 3300049823 Bacteria 5281
2416 Ga0501044_0061250 3300049823 Bacteria 3850
2417 Ga0501044_0099800 3300049823 Bacteria 2921
2418 Ga0501044_0109621 3300049823 Bacteria 2769
2419 Ga0501044_0213320 3300049823 Bacteria 1884
2420 Ga0501045_0006811 3300049824 Bacteria 7917
2421 Ga0501045_0034838 3300049824 Bacteria 3654
2422 Ga0501045_0040309 3300049824 Bacteria 3399
2423 Ga0501045_0076025 3300049824 Bacteria 2474
2424 Ga0501045_0099230 3300049824 Bacteria 2155
2425 nmdc:mga03683_49956_c1 3300050489 Bacteria 1743
2426 nmdc:mga00v17_53670_c1 3300050491 Bacteria 2457
2427 nmdc:mga00v17_844_c1 3300050491 Bacteria 16611
2428 nmdc:mga07m45_16413_c1 3300050496 Bacteria 3965
2429 nmdc:mga05p37_105663_c1 3300050507 Bacteria 3463
2430 nmdc:mga05p37_12638_c1 3300050507 Bacteria 10084
2431 nmdc:mga05p37_13094_c1 3300050507 Bacteria 9926
2432 nmdc:mga05p37_163367_c1 3300050507 Bacteria 2718
2433 nmdc:mga05p37_29036_c2 3300050507 Bacteria 4128
2434 nmdc:mga05p37_330_c1 3300050507 Bacteria 50725
2435 nmdc:mga05p37_343480_c1 3300050507 Bacteria 1759
2436 nmdc:mga05p37_50528_c1 3300050507 Bacteria 5113
2437 nmdc:mga05p37_65821_c1 3300050507 Bacteria 4459
2438 nmdc:mga05p37_68193_c1 3300050507 Bacteria 4375
2439 nmdc:mga05p37_71694_c1 3300050507 Bacteria 4262
2440 nmdc:mga09592_144047_c1 3300050508 Bacteria 2054
2441 nmdc:mga09592_236270_c1 3300050508 Bacteria 1583
2442 nmdc:mga09592_3709_c1 3300050508 Bacteria 12313
2443 nmdc:mga0qj67_174233_c1 3300050509 Bacteria 1747
2444 nmdc:mga0qj67_178283_c1 3300050509 Bacteria 1726
2445 nmdc:mga0qj67_210207_c1 3300050509 Bacteria 1581
2446 nmdc:mga0qj67_21372_c1 3300050509 Bacteria 4965
2447 nmdc:mga0qj67_27538_c1 3300050509 Bacteria 4407
2448 nmdc:mga06r32_169822_c1 3300050510 Bacteria 2165
2449 nmdc:mga06r32_25301_c1 3300050510 Bacteria 5522
2450 nmdc:mga06r32_27670_c1 3300050510 Bacteria 5299
2451 nmdc:mga06r32_297242_c1 3300050510 Bacteria 1601
2452 nmdc:mga06r32_32416_c1 3300050510 Bacteria 4916
2453 nmdc:mga06r32_74846_c1 3300050510 Bacteria 3284
2454 nmdc:mga08y16_120853_c1 3300050511 Bacteria 2726
2455 nmdc:mga08y16_16966_c1 3300050511 Bacteria 7667
2456 nmdc:mga08y16_221477_c1 3300050511 Bacteria 1959
2457 nmdc:mga08y16_2422_c1 3300050511 Bacteria 19162
2458 nmdc:mga08y16_303358_c1 3300050511 Bacteria 1646
2459 nmdc:mga08y16_341015_c1 3300050511 Bacteria 1540
2460 nmdc:mga08y16_354501_c1 3300050511 Bacteria 1507
2461 nmdc:mga08y16_9087_c1 3300050511 Bacteria 10433
2462 nmdc:mga0n895_118814_c1 3300050512 Bacteria 2664
2463 nmdc:mga0n895_1992_c1 3300050512 Bacteria 15671
2464 nmdc:mga0n895_245_c1 3300050512 Bacteria 34670
2465 nmdc:mga0n895_85408_c1 3300050512 Bacteria 3151
2466 nmdc:mga0n895_86088_c1 3300050512 Bacteria 3139
2467 nmdc:mga0rr50_123089_c1 3300050513 Bacteria 2067
2468 nmdc:mga0rr50_131928_c1 3300050513 Bacteria 2001
2469 nmdc:mga0rr50_153510_c1 3300050513 Bacteria 1863
2470 nmdc:mga0rr50_3942_c1 3300050513 Bacteria 8633
2471 nmdc:mga0rr50_75335_c1 3300050513 Bacteria 2586
2472 nmdc:mga08x19_19782_c1 3300050514 Bacteria 4137
2473 nmdc:mga08x19_30553_c1 3300050514 Bacteria 3385
2474 nmdc:mga08x19_96135_c1 3300050514 Bacteria 1960
2475 nmdc:mga0a205_20587_c1 3300050515 Bacteria 6227
2476 nmdc:mga0a205_233616_c1 3300050515 Bacteria 1721
2477 nmdc:mga0a205_321_c1 3300050515 Bacteria 35828
2478 nmdc:mga0a205_6744_c1 3300050515 Bacteria 8461
2479 nmdc:mga0a205_7958_c1 3300050515 Bacteria 9629
2480 nmdc:mga0a205_8110_c1 3300050515 Bacteria 9545
2481 nmdc:mga0a205_8280_c1 3300050515 Bacteria 9454
2482 nmdc:mga0sz30_4776_c1 3300050516 Bacteria 4926
2483 Ga0495655_0013096 3300053083 Bacteria 1707
2484 Ga0495619_0007786 3300053085 Bacteria 6782
2485 Ga0500646_0000532 3300053090 Bacteria 11160
2486 Ga0500651_0000253 3300053093 Bacteria 32192
2487 Ga0500641_0000012 3300053096 Bacteria 164908
2488 Ga0500641_0000164 3300053096 Bacteria 24825
2489 Ga0500641_0000293 3300053096 Bacteria 18720
2490 Ga0500658_0000005 3300053134 Bacteria 369268
2491 Ga0500634_0030676 3300053161 Bacteria 2929
2492 Ga0501084_0006998 3300054114 Bacteria 9295
2493 Ga0501082_0004682 3300060353 Bacteria 11930
2494 Ga0501082_0043387 3300060353 Bacteria 3878
2495 Ga0501082_0070194 3300060353 Bacteria 3017
2496 Ga0501082_0169480 3300060353 Bacteria 1898
2497 Ga0530510_0006988 3300061734 Bacteria 7862

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0155707 Ga0496118_0155707_230_1315 358
2 3300042876 Ga0451577_0402802 Ga0451577_0402802_97_1215 370
3 3300049572 Ga0501036_0282770 Ga0501036_0282770_54_1202 372
4 3300045051 Ga0451576_0001465 Ga0451576_0001465_10750_12132 383
5 3300044712 Ga0453684_0008925 Ga0453684_0008925_1880_3217 386
6 3300036647 Ga0316582_0023699 Ga0316582_0023699_18_1205 393
7 3300046531 Ga0495665_0065228 Ga0495665_0065228_381_1652 394
8 3300015261 Ga0182006_1000047 Ga0182006_1000047149 395
9 3300031733 Ga0316577_10053732 Ga0316577_100537322 395
10 3300042010 Ga0439452_000002 Ga0439452_000002_1338385_1339728 395
11 3300027312 Ga0209371_1006795 Ga0209371_10067953 396
12 3300030500 Ga0268256_1006908 Ga0268256_10069083 396
13 3300039062 Ga0400483_202610 Ga0400483_202610_83_1303 397
14 3300039093 Ga0400489_50224 Ga0400489_50224_1388_2734 402
15 3300025728 Ga0207655_1000009 Ga0207655_1000009257 406
16 3300038726 Ga0400490_16399 Ga0400490_16399_563_1918 406
17 iso_pu_bacteria 2513237150 2513955353 410
18 iso_pu_bacteria 2513237165 2514040681 410
19 3300025913 Ga0207695_10018475 Ga0207695_100184755 411
20 3300028794 Ga0307515_10096936 Ga0307515_100969361 411
21 3300033180 Ga0307510_10038191 Ga0307510_100381911 411
22 3300035398 Ga0316574_0102916 Ga0316574_0102916_258_1496 411
23 3300036712 Ga0316584_0043632 Ga0316584_0043632_1550_2788 411
24 3300044712 Ga0453684_0035840 Ga0453684_0035840_2672_4030 411
25 3300045051 Ga0451576_0008966 Ga0451576_0008966_1077_2435 411
26 3300048924 Ga0496121_0020957 Ga0496121_0020957_1383_2726 411
27 3300049679 Ga0501249_000007 Ga0501249_000007_156729_158075 411
28 3300053096 Ga0500641_0000164 Ga0500641_0000164_15151_16497 411
29 3300005436 Ga0070713_100023927 Ga0070713_1000239274 412
30 3300025910 Ga0207684_10028722 Ga0207684_100287223 412
31 3300035111 Ga0373923_0025021 Ga0373923_0025021_23_1264 412
32 iso_pu_bacteria 3003233435 3003235361 412
33 3300039062 Ga0400483_242137 Ga0400483_242137_1257_2504 413
34 3300047469 Ga0495673_0029145 Ga0495673_0029145_441_1706 413
35 iso_pu_bacteria 640427133 640486892 413
36 iso_pu_bacteria 651053060 651174748 413
37 3300003771 Ga0055526_1000233 Ga0055526_100023337 414
38 3300003771 Ga0055526_1002689 Ga0055526_10026898 414
39 3300025295 Ga0209564_1000615 Ga0209564_100061542 414
40 3300025303 Ga0209051_1017155 Ga0209051_10171552 414
41 3300048904 Ga0496101_0061519 Ga0496101_0061519_1451_2701 414
42 3300006846 Ga0075430_100004750 Ga0075430_1000047506 415
43 3300006847 Ga0075431_100016188 Ga0075431_1000161883 415
44 3300006880 Ga0075429_100128339 Ga0075429_1001283392 415
45 3300009147 Ga0114129_10008249 Ga0114129_100082497 415
46 3300046665 Ga0495661_0078505 Ga0495661_0078505_110_1450 415
47 3300048923 Ga0496120_0106176 Ga0496120_0106176_142_1395 415
48 3300049573 Ga0501037_0071651 Ga0501037_0071651_26_1279 415
49 3300050507 nmdc:mga05p37_12638_c1 nmdc:mga05p37_12638_c1_3395_4792 415
50 3300050509 nmdc:mga0qj67_27538_c1 nmdc:mga0qj67_27538_c1_241_1638 415
51 3300053096 Ga0500641_0000293 Ga0500641_0000293_5140_6456 416
52 3300035725 Ga0373947_0018745 Ga0373947_0018745_2693_3970 417
53 3300046674 Ga0495588_0062744 Ga0495588_0062744_636_1913 417
54 3300042876 Ga0451577_0000393 Ga0451577_0000393_6260_7594 418
55 3300044673 Ga0453683_0000538 Ga0453683_0000538_34691_36025 418
56 3300044712 Ga0453684_0001191 Ga0453684_0001191_72769_74103 418
57 3300045051 Ga0451576_0000551 Ga0451576_0000551_6260_7594 418
58 3300035241 Ga0373961_0000948 Ga0373961_0000948_7986_9422 419
59 3300039062 Ga0400483_063982 Ga0400483_063982_33_1316 419
60 3300045051 Ga0451576_0042296 Ga0451576_0042296_1512_2858 419
61 3300003578 Ga0006562J51391_1009174 Ga0006562J51391_10091741 420
62 3300005364 Ga0070673_100033180 Ga0070673_1000331801 420
63 3300005337 Ga0070682_100028533 Ga0070682_1000285332 421
64 3300013102 Ga0157371_10017174 Ga0157371_100171742 421
65 3300013105 Ga0157369_10002012 Ga0157369_100020125 421
66 3300015261 Ga0182006_1014114 Ga0182006_10141143 421
67 3300031616 Ga0307508_10033363 Ga0307508_100333632 421
68 3300038443 Ga0395901_0321446 Ga0395901_0321446_13_1284 421
69 3300048919 Ga0496116_0000075 Ga0496116_0000075_106464_107807 421
70 3300048921 Ga0496118_0039714 Ga0496118_0039714_788_2131 421
71 3300048927 Ga0496124_0004397 Ga0496124_0004397_13595_14938 421
72 3300048928 Ga0496125_0000070 Ga0496125_0000070_126459_127802 421
73 3300048929 Ga0496126_0010844 Ga0496126_0010844_5986_7329 421
74 3300005288 Ga0065714_10003556 Ga0065714_100035564 422
75 3300005288 Ga0065714_10070672 Ga0065714_100706722 422
76 3300009036 Ga0105244_10000038 Ga0105244_1000003897 422
77 3300013100 Ga0157373_10000016 Ga0157373_1000001688 422
78 3300013104 Ga0157370_10002149 Ga0157370_1000214914 422
79 3300013104 Ga0157370_10002520 Ga0157370_1000252011 422
80 3300015261 Ga0182006_1002152 Ga0182006_10021527 422
81 3300017792 Ga0163161_10000019 Ga0163161_10000019106 422
82 3300025728 Ga0207655_1000034 Ga0207655_100003497 422
83 3300031548 Ga0307408_100000717 Ga0307408_1000007177 422
84 3300031852 Ga0307410_10000031 Ga0307410_1000003123 422
85 3300031901 Ga0307406_10000743 Ga0307406_1000074313 422
86 3300032004 Ga0307414_10000064 Ga0307414_100000645 422
87 3300032005 Ga0307411_10000009 Ga0307411_1000000991 422
88 3300041407 Ga0439447_000076 Ga0439447_000076_18523_19866 422
89 3300042004 Ga0439445_0014607 Ga0439445_0014607_183_1526 422
90 3300046512 Ga0495610_0028860 Ga0495610_0028860_460_1803 422
91 3300049671 Ga0501238_000050 Ga0501238_000050_14336_15679 422
92 3300049679 Ga0501249_003071 Ga0501249_003071_904_2247 422
93 3300049763 Ga0501266_000018 Ga0501266_000018_28842_30185 422
94 3300049776 Ga0501280_000506 Ga0501280_000506_6796_8139 422
95 3300053090 Ga0500646_0000532 Ga0500646_0000532_7444_8787 422
96 3300053096 Ga0500641_0000012 Ga0500641_0000012_86798_88141 422
97 3300053134 Ga0500658_0000005 Ga0500658_0000005_224838_226181 422
98 3300045051 Ga0451576_0029479 Ga0451576_0029479_409_1758 423
99 3300038726 Ga0400490_43299 Ga0400490_43299_3704_5053 424
100 3300027614 Ga0209970_1001714 Ga0209970_10017142 425
101 3300048918 Ga0496115_0009252 Ga0496115_0009252_3049_4392 425
102 3300048928 Ga0496125_0000024 Ga0496125_0000024_44898_46241 425
103 3300028577 Ga0265318_10004127 Ga0265318_100041273 426
104 3300031242 Ga0265329_10017969 Ga0265329_100179692 426
105 3300031595 Ga0265313_10004857 Ga0265313_100048574 426
106 3300045051 Ga0451576_0477319 Ga0451576_0477319_10_1296 426
107 3300049572 Ga0501036_0156047 Ga0501036_0156047_584_1888 426
108 3300049578 Ga0501042_0221007 Ga0501042_0221007_43_1347 426
109 3300049824 Ga0501045_0040309 Ga0501045_0040309_660_1964 426
110 3300031727 Ga0316576_10015060 Ga0316576_100150603 427
111 3300042876 Ga0451577_0083806 Ga0451577_0083806_512_1867 427
112 3300044673 Ga0453683_0123420 Ga0453683_0123420_49_1386 428
113 3300044712 Ga0453684_0050510 Ga0453684_0050510_3918_5261 428
114 3300042876 Ga0451577_0165854 Ga0451577_0165854_300_1679 429
115 3300044712 Ga0453684_0020816 Ga0453684_0020816_3067_4446 429
116 3300046517 Ga0495630_0000441 Ga0495630_0000441_634_1971 429
117 3300046526 Ga0495666_0004391 Ga0495666_0004391_59_1396 429
118 3300046535 Ga0495586_0000729 Ga0495586_0000729_2377_3714 429
119 3300046642 Ga0495634_0011875 Ga0495634_0011875_4354_5691 429
120 3300047319 Ga0495674_0000587 Ga0495674_0000587_7960_9297 429
121 3300044673 Ga0453683_0003752 Ga0453683_0003752_3711_5048 430
122 3300045051 Ga0451576_0119761 Ga0451576_0119761_282_1619 430
123 3300009148 Ga0105243_10000007 Ga0105243_10000007224 431
124 3300025935 Ga0207709_10000049 Ga0207709_10000049169 431
125 3300039062 Ga0400483_112260 Ga0400483_112260_2423_3769 431
126 3300042876 Ga0451577_0000030 Ga0451577_0000030_338944_340281 431
127 3300044712 Ga0453684_0000461 Ga0453684_0000461_51143_52480 431
128 3300045051 Ga0451576_0000172 Ga0451576_0000172_109883_111220 431
129 3300048919 Ga0496116_0038970 Ga0496116_0038970_680_2011 431
130 3300048920 Ga0496117_0035280 Ga0496117_0035280_682_2013 431
131 3300048925 Ga0496122_0018025 Ga0496122_0018025_430_1761 431
132 3300048927 Ga0496124_0066797 Ga0496124_0066797_1239_2570 431
133 iso_pu_bacteria 2721755487 2722728454 431
134 iso_pu_bacteria 2904780799 2904785224 431
135 iso_pu_bacteria 2919177583 2919181034 431
136 3300028573 Ga0265334_10038425 Ga0265334_100384251 432
137 3300031727 Ga0316576_10066715 Ga0316576_100667152 432
138 3300050510 nmdc:mga06r32_74846_c1 nmdc:mga06r32_74846_c1_34_1359 432
139 iso_pu_bacteria 2890737413 2890738535 432
140 iso_pu_bacteria 2896317667 2896317870 432
141 iso_pu_bacteria 2896344016 2896344954 432
142 iso_pu_bacteria 2898713307 2898715498 432
143 3300003203 JGI25406J46586_10013161 JGI25406J46586_100131615 433
144 3300005549 Ga0070704_100174140 Ga0070704_1001741401 433
145 3300005985 Ga0081539_10001964 Ga0081539_1000196435 433
146 3300006194 Ga0075427_10002640 Ga0075427_100026401 433
147 3300006847 Ga0075431_100015576 Ga0075431_1000155763 433
148 3300009147 Ga0114129_10069504 Ga0114129_100695044 433
149 3300009176 Ga0105242_10019091 Ga0105242_100190913 433
150 3300009553 Ga0105249_10013235 Ga0105249_100132355 433
151 3300013104 Ga0157370_10022805 Ga0157370_100228053 433
152 3300014497 Ga0182008_10002163 Ga0182008_100021639 433
153 3300025934 Ga0207686_10011276 Ga0207686_100112762 433
154 3300025961 Ga0207712_10128155 Ga0207712_101281551 433
155 3300031903 Ga0307407_10015746 Ga0307407_100157462 433
156 3300031911 Ga0307412_10054740 Ga0307412_100547402 433
157 3300031995 Ga0307409_100104524 Ga0307409_1001045241 433
158 3300038726 Ga0400490_03382 Ga0400490_03382_3974_5299 433
159 3300042876 Ga0451577_0000112 Ga0451577_0000112_54153_55505 433
160 3300044712 Ga0453684_0000398 Ga0453684_0000398_54002_55354 433
161 3300044712 Ga0453684_0022434 Ga0453684_0022434_1243_2580 433
162 3300045051 Ga0451576_0000150 Ga0451576_0000150_65296_66648 433
163 3300046460 Ga0495638_0006949 Ga0495638_0006949_5181_6488 433
164 3300046558 Ga0495633_0012099 Ga0495633_0012099_1889_3196 433
165 3300046558 Ga0495633_0051083 Ga0495633_0051083_366_1673 433
166 3300047470 Ga0495681_0024404 Ga0495681_0024404_1297_2604 433
167 3300048913 Ga0496110_0161388 Ga0496110_0161388_311_1618 433
168 3300048920 Ga0496117_0006961 Ga0496117_0006961_2775_4082 433
169 3300048921 Ga0496118_0001845 Ga0496118_0001845_26026_27333 433
170 3300048924 Ga0496121_0030925 Ga0496121_0030925_1925_3232 433
171 3300048924 Ga0496121_0041719 Ga0496121_0041719_325_1632 433
172 3300048925 Ga0496122_0009251 Ga0496122_0009251_2002_3309 433
173 3300048926 Ga0496123_0011646 Ga0496123_0011646_4276_5583 433
174 3300048928 Ga0496125_0008479 Ga0496125_0008479_7240_8547 433
175 3300048928 Ga0496125_0010323 Ga0496125_0010323_1744_3051 433
176 3300036712 Ga0316584_0010505 Ga0316584_0010505_643_1974 434
177 3300039062 Ga0400483_006940 Ga0400483_006940_762_2093 434
178 3300039062 Ga0400483_173481 Ga0400483_173481_10753_12084 434
179 3300039093 Ga0400489_01228 Ga0400489_01228_21_1391 434
180 3300041508 Ga0451852_27934 Ga0451852_27934_31_1377 434
181 3300044683 Ga0466965_0000007 Ga0466965_0000007_126896_128239 434
182 3300048929 Ga0496126_0004899 Ga0496126_0004899_13665_15032 434
183 3300049569 Ga0501032_0055175 Ga0501032_0055175_649_1992 434
184 3300049571 Ga0501034_0038453 Ga0501034_0038453_993_2336 434
185 3300049572 Ga0501036_0033632 Ga0501036_0033632_2577_3920 434
186 3300049573 Ga0501037_0041557 Ga0501037_0041557_1896_3239 434
187 3300049574 Ga0501038_0002148 Ga0501038_0002148_1580_2923 434
188 3300049579 Ga0501043_0039870 Ga0501043_0039870_1777_3120 434
189 3300049586 Ga0501070_0020320 Ga0501070_0020320_45_1388 434
190 3300049823 Ga0501044_0034791 Ga0501044_0034791_564_1907 434
191 3300049823 Ga0501044_0213320 Ga0501044_0213320_475_1818 434
192 iso_pu_bacteria 2548877040 2550901297 434
193 iso_pu_bacteria 2571042143 2571528154 434
194 iso_pu_bacteria 2728368933 2728534705 434
195 iso_pu_bacteria 2939660829 2939661793 434
196 iso_pu_bacteria 8054465665 8054468194 434
197 3300002771 JGI25163J39215_1000205 JGI25163J39215_100020512 435
198 3300002772 JGI25164J39214_1000008 JGI25164J39214_1000008142 435
199 3300003751 Ga0055538_1000014 Ga0055538_1000014142 435
200 3300003752 Ga0055539_1000020 Ga0055539_1000020155 435
201 3300003756 Ga0055533_1000027 Ga0055533_1000027142 435
202 3300003759 Ga0055525_1000032 Ga0055525_1000032155 435
203 3300003841 Ga0055541_1000014 Ga0055541_1000014155 435
204 3300003856 Ga0058692_1000796 Ga0058692_100079610 435
205 3300003856 Ga0058692_1001239 Ga0058692_10012396 435
206 3300003856 Ga0058692_1003345 Ga0058692_10033452 435
207 3300003856 Ga0058692_1003397 Ga0058692_10033972 435
208 3300003856 Ga0058692_1004114 Ga0058692_10041142 435
209 3300005272 Ga0065703_1019024 Ga0065703_10190243 435
210 3300005289 Ga0065704_10078770 Ga0065704_100787705 435
211 3300005539 Ga0068853_100117004 Ga0068853_1001170042 435
212 3300005543 Ga0070672_100005318 Ga0070672_1000053184 435
213 3300005577 Ga0068857_100003295 Ga0068857_1000032952 435
214 3300006042 Ga0075368_10000340 Ga0075368_1000034013 435
215 3300006051 Ga0075364_10018889 Ga0075364_100188893 435
216 3300006177 Ga0075362_10003824 Ga0075362_100038242 435
217 3300006186 Ga0075369_10010212 Ga0075369_100102122 435
218 3300006946 Ga0079104_1000157 Ga0079104_100015737 435
219 3300006946 Ga0079104_1000804 Ga0079104_100080420 435
220 3300006946 Ga0079104_1001098 Ga0079104_10010982 435
221 3300009011 Ga0105251_10000230 Ga0105251_1000023047 435
222 3300009011 Ga0105251_10000713 Ga0105251_1000071321 435
223 3300009036 Ga0105244_10000287 Ga0105244_1000028713 435
224 3300009036 Ga0105244_10000380 Ga0105244_1000038020 435
225 3300009036 Ga0105244_10001172 Ga0105244_1000117212 435
226 3300009036 Ga0105244_10002028 Ga0105244_1000202810 435
227 3300009092 Ga0105250_10002294 Ga0105250_100022945 435
228 3300009101 Ga0105247_10001413 Ga0105247_1000141311 435
229 3300009148 Ga0105243_10053681 Ga0105243_100536811 435
230 3300009174 Ga0105241_10000013 Ga0105241_1000001321 435
231 3300013100 Ga0157373_10005904 Ga0157373_100059046 435
232 3300013102 Ga0157371_10000056 Ga0157371_10000056166 435
233 3300013105 Ga0157369_10112452 Ga0157369_101124521 435
234 3300013307 Ga0157372_10092620 Ga0157372_100926202 435
235 3300014497 Ga0182008_10001232 Ga0182008_1000123212 435
236 3300015679 Ga0183366_1001 Ga0183366_1001998 435
237 3300015680 Ga0183370_1001 Ga0183370_1001998 435
238 3300015685 Ga0183369_1001 Ga0183369_1001998 435
239 3300015687 Ga0183368_1001 Ga0183368_1001998 435
240 3300017792 Ga0163161_10000028 Ga0163161_1000002843 435
241 3300021384 Ga0213876_10000191 Ga0213876_1000019126 435
242 3300025207 Ga0209760_100010 Ga0209760_100010142 435
243 3300025224 Ga0209784_100030 Ga0209784_100030142 435
244 3300025225 Ga0209566_100034 Ga0209566_100034142 435
245 3300025226 Ga0209674_100052 Ga0209674_100052142 435
246 3300025230 Ga0209563_100054 Ga0209563_100054142 435
247 3300025231 Ga0207427_100035 Ga0207427_100035142 435
248 3300025233 Ga0209437_100068 Ga0209437_100068142 435
249 3300025253 Ga0209677_100032 Ga0209677_100032142 435
250 3300025258 Ga0209129_1000004 Ga0209129_10000048 435
251 3300025711 Ga0207696_1000068 Ga0207696_100006867 435
252 3300025711 Ga0207696_1000269 Ga0207696_10002697 435
253 3300025711 Ga0207696_1003984 Ga0207696_10039846 435
254 3300025728 Ga0207655_1000106 Ga0207655_100010613 435
255 3300025728 Ga0207655_1000643 Ga0207655_100064328 435
256 3300025728 Ga0207655_1001130 Ga0207655_10011309 435
257 3300025728 Ga0207655_1001199 Ga0207655_100119913 435
258 3300025735 Ga0207713_1000044 Ga0207713_100004482 435
259 3300025735 Ga0207713_1000062 Ga0207713_100006251 435
260 3300025735 Ga0207713_1003620 Ga0207713_100362011 435
261 3300025735 Ga0207713_1004042 Ga0207713_10040428 435
262 3300025735 Ga0207713_1010892 Ga0207713_10108926 435
263 3300025900 Ga0207710_10000145 Ga0207710_1000014534 435
264 3300025911 Ga0207654_10000016 Ga0207654_1000001652 435
265 3300025940 Ga0207691_10001773 Ga0207691_1000177322 435
266 3300026041 Ga0207639_10122499 Ga0207639_101224992 435
267 3300026116 Ga0207674_10002024 Ga0207674_100020245 435
268 3300027111 Ga0209281_1000093 Ga0209281_100009336 435
269 3300027111 Ga0209281_1000107 Ga0209281_100010752 435
270 3300027111 Ga0209281_1000301 Ga0209281_100030184 435
271 3300027111 Ga0209281_1001036 Ga0209281_100103622 435
272 3300027111 Ga0209281_1001082 Ga0209281_100108220 435
273 3300027111 Ga0209281_1002130 Ga0209281_10021304 435
274 3300027312 Ga0209371_1000001 Ga0209371_1000001922 435
275 3300027312 Ga0209371_1000002 Ga0209371_100000295 435
276 3300027312 Ga0209371_1000041 Ga0209371_1000041142 435
277 3300027312 Ga0209371_1001739 Ga0209371_10017394 435
278 3300027312 Ga0209371_1005701 Ga0209371_10057012 435
279 3300027312 Ga0209371_1008635 Ga0209371_10086351 435
280 3300030500 Ga0268256_1000001 Ga0268256_10000011718 435
281 3300030500 Ga0268256_1000002 Ga0268256_10000021369 435
282 3300030500 Ga0268256_1000003 Ga0268256_1000003966 435
283 3300030500 Ga0268256_1001517 Ga0268256_10015174 435
284 3300030500 Ga0268256_1009041 Ga0268256_10090414 435
285 3300031456 Ga0307513_10033515 Ga0307513_100335159 435
286 3300039437 Ga0436365_1037676 Ga0436365_1037676_26145_27488 435
287 3300041405 Ga0439438_000215 Ga0439438_000215_17348_18691 435
288 3300042006 Ga0439432_000305 Ga0439432_000305_9203_10546 435
289 3300042010 Ga0439452_000008 Ga0439452_000008_63531_64874 435
290 3300042013 Ga0439456_007062 Ga0439456_007062_818_2161 435
291 3300044712 Ga0453684_0001620 Ga0453684_0001620_57509_58855 435
292 3300046453 Ga0495627_000100 Ga0495627_000100_43346_44689 435
293 3300046458 Ga0495591_002164 Ga0495591_002164_8377_9720 435
294 3300046460 Ga0495638_0018086 Ga0495638_0018086_2716_4059 435
295 3300046471 Ga0495650_0000120 Ga0495650_0000120_171953_173296 435
296 3300046515 Ga0495620_0001973 Ga0495620_0001973_10222_11565 435
297 3300046530 Ga0495654_0000754 Ga0495654_0000754_394_1737 435
298 3300046530 Ga0495654_0034108 Ga0495654_0034108_409_1752 435
299 3300046542 Ga0495597_0000129 Ga0495597_0000129_2888_4231 435
300 3300046674 Ga0495588_0054002 Ga0495588_0054002_434_1777 435
301 3300046683 Ga0495658_0021292 Ga0495658_0021292_1445_2776 435
302 3300046694 Ga0495649_0000337 Ga0495649_0000337_27995_29338 435
303 3300046694 Ga0495649_0000416 Ga0495649_0000416_11005_12348 435
304 3300046794 Ga0495589_0000010 Ga0495589_0000010_91467_92837 435
305 3300046810 Ga0495660_0000036 Ga0495660_0000036_16335_17678 435
306 3300047320 Ga0495672_0000027 Ga0495672_0000027_67535_68878 435
307 3300047446 Ga0495679_000019 Ga0495679_000019_157715_159058 435
308 3300047446 Ga0495679_001498 Ga0495679_001498_3472_4815 435
309 3300048906 Ga0496103_0056365 Ga0496103_0056365_424_1767 435
310 3300048907 Ga0496104_0001118 Ga0496104_0001118_18309_19652 435
311 3300048907 Ga0496104_0003113 Ga0496104_0003113_4594_5937 435
312 3300048908 Ga0496105_0031254 Ga0496105_0031254_1611_2954 435
313 3300048919 Ga0496116_0000077 Ga0496116_0000077_75947_77290 435
314 3300048919 Ga0496116_0000096 Ga0496116_0000096_145150_146493 435
315 3300048919 Ga0496116_0000181 Ga0496116_0000181_4977_6320 435
316 3300048920 Ga0496117_0001792 Ga0496117_0001792_25783_27126 435
317 3300048920 Ga0496117_0003141 Ga0496117_0003141_9773_11116 435
318 3300048920 Ga0496117_0007796 Ga0496117_0007796_2928_4271 435
319 3300048920 Ga0496117_0009888 Ga0496117_0009888_767_2110 435
320 3300048920 Ga0496117_0011818 Ga0496117_0011818_1033_2376 435
321 3300048920 Ga0496117_0039136 Ga0496117_0039136_1910_3253 435
322 3300048921 Ga0496118_0000767 Ga0496118_0000767_10503_11846 435
323 3300048921 Ga0496118_0004066 Ga0496118_0004066_9773_11116 435
324 3300048921 Ga0496118_0009800 Ga0496118_0009800_3876_5219 435
325 3300048921 Ga0496118_0010081 Ga0496118_0010081_2928_4271 435
326 3300048921 Ga0496118_0039971 Ga0496118_0039971_280_1623 435
327 3300048922 Ga0496119_0000066 Ga0496119_0000066_63532_64875 435
328 3300048922 Ga0496119_0000160 Ga0496119_0000160_77611_78954 435
329 3300048922 Ga0496119_0000759 Ga0496119_0000759_7998_9341 435
330 3300048922 Ga0496119_0001223 Ga0496119_0001223_5076_6419 435
331 3300048922 Ga0496119_0008246 Ga0496119_0008246_3674_5017 435
332 3300048922 Ga0496119_0010770 Ga0496119_0010770_590_1933 435
333 3300048922 Ga0496119_0033494 Ga0496119_0033494_378_1721 435
334 3300048923 Ga0496120_0000038 Ga0496120_0000038_197731_199074 435
335 3300048923 Ga0496120_0000112 Ga0496120_0000112_84818_86161 435
336 3300048923 Ga0496120_0000139 Ga0496120_0000139_19913_21256 435
337 3300048923 Ga0496120_0000192 Ga0496120_0000192_25286_26629 435
338 3300048923 Ga0496120_0001402 Ga0496120_0001402_9851_11194 435
339 3300048923 Ga0496120_0013007 Ga0496120_0013007_527_1870 435
340 3300048923 Ga0496120_0019386 Ga0496120_0019386_1144_2487 435
341 3300048923 Ga0496120_0036780 Ga0496120_0036780_606_1949 435
342 3300048924 Ga0496121_0008513 Ga0496121_0008513_2943_4286 435
343 3300048924 Ga0496121_0014973 Ga0496121_0014973_5698_7041 435
344 3300048924 Ga0496121_0024685 Ga0496121_0024685_1533_2876 435
345 3300048925 Ga0496122_0000280 Ga0496122_0000280_27089_28432 435
346 3300048925 Ga0496122_0000291 Ga0496122_0000291_9079_10422 435
347 3300048926 Ga0496123_0000078 Ga0496123_0000078_101157_102500 435
348 3300048926 Ga0496123_0000229 Ga0496123_0000229_85175_86518 435
349 3300048926 Ga0496123_0003754 Ga0496123_0003754_4547_5890 435
350 3300048926 Ga0496123_0004168 Ga0496123_0004168_8520_9863 435
351 3300048926 Ga0496123_0006711 Ga0496123_0006711_8211_9554 435
352 3300048926 Ga0496123_0018797 Ga0496123_0018797_1588_2931 435
353 3300048927 Ga0496124_0000026 Ga0496124_0000026_201339_202682 435
354 3300048927 Ga0496124_0000100 Ga0496124_0000100_155795_157138 435
355 3300048927 Ga0496124_0002438 Ga0496124_0002438_7927_9270 435
356 3300048927 Ga0496124_0002570 Ga0496124_0002570_10434_11768 435
357 3300048927 Ga0496124_0028884 Ga0496124_0028884_1903_3246 435
358 3300048927 Ga0496124_0052243 Ga0496124_0052243_90_1433 435
359 3300048928 Ga0496125_0000226 Ga0496125_0000226_3411_4754 435
360 3300048928 Ga0496125_0009455 Ga0496125_0009455_1160_2503 435
361 3300048929 Ga0496126_0001297 Ga0496126_0001297_3126_4469 435
362 3300048929 Ga0496126_0007430 Ga0496126_0007430_7853_9196 435
363 3300049570 Ga0501033_0051034 Ga0501033_0051034_1081_2421 435
364 3300049571 Ga0501034_0216823 Ga0501034_0216823_69_1409 435
365 3300049573 Ga0501037_0002801 Ga0501037_0002801_3707_5047 435
366 3300049574 Ga0501038_0037237 Ga0501038_0037237_2243_3583 435
367 3300049580 Ga0501046_0002908 Ga0501046_0002908_655_1995 435
368 3300049581 Ga0501047_0161863 Ga0501047_0161863_599_1939 435
369 3300049823 Ga0501044_0061250 Ga0501044_0061250_563_1903 435
370 3300050489 nmdc:mga03683_49956_c1 nmdc:mga03683_49956_c1_34_1374 435
371 3300050496 nmdc:mga07m45_16413_c1 nmdc:mga07m45_16413_c1_616_1956 435
372 3300050516 nmdc:mga0sz30_4776_c1 nmdc:mga0sz30_4776_c1_1828_3168 435
373 iso_pu_bacteria 2506520007 2506580899 435
374 iso_pu_bacteria 2506520008 2506586038 435
375 iso_pu_bacteria 2508501071 2508854700 435
376 iso_pu_bacteria 2537561728 2538424584 435
377 iso_pu_bacteria 2547132181 2547695109 435
378 iso_pu_bacteria 2547132416 2548648835 435
379 iso_pu_bacteria 2561511199 2562463025 435
380 iso_pu_bacteria 2585427591 2585825999 435
381 iso_pu_bacteria 2585427592 2585831783 435
382 iso_pu_bacteria 2599185169 2599410951 435
383 iso_pu_bacteria 2600255254 2601521581 435
384 iso_pu_bacteria 2600255255 2601526606 435
385 iso_pu_bacteria 2600255256 2601535199 435
386 iso_pu_bacteria 2600255257 2601540762 435
387 iso_pu_bacteria 2600255280 2601613436 435
388 iso_pu_bacteria 2600255281 2601622339 435
389 iso_pu_bacteria 2600255287 2601643146 435
390 iso_pu_bacteria 2600255288 2601650375 435
391 iso_pu_bacteria 2600255289 2601655664 435
392 iso_pu_bacteria 2600255290 2601656911 435
393 iso_pu_bacteria 2600255291 2601662967 435
394 iso_pu_bacteria 2600255298 2601695926 435
395 iso_pu_bacteria 2600255299 2601700600 435
396 iso_pu_bacteria 2600255300 2601704708 435
397 iso_pu_bacteria 2600255301 2601709737 435
398 iso_pu_bacteria 2600255302 2601714749 435
399 iso_pu_bacteria 2600255303 2601720951 435
400 iso_pu_bacteria 2600255304 2601725155 435
401 iso_pu_bacteria 2600255305 2601729697 435
402 iso_pu_bacteria 2600255306 2601734714 435
403 iso_pu_bacteria 2600255307 2601743660 435
404 iso_pu_bacteria 2600255309 2601753208 435
405 iso_pu_bacteria 2600255310 2601758381 435
406 iso_pu_bacteria 2600255311 2601764490 435
407 iso_pu_bacteria 2600255392 2602020943 435
408 iso_pu_bacteria 2602042046 2603638259 435
409 iso_pu_bacteria 2602042047 2603642783 435
410 iso_pu_bacteria 2602042052 2603660341 435
411 iso_pu_bacteria 2602042053 2603665616 435
412 iso_pu_bacteria 2602042066 2603698174 435
413 iso_pu_bacteria 2602042067 2603703385 435
414 iso_pu_bacteria 2602042103 2603837070 435
415 iso_pu_bacteria 2602042104 2603842146 435
416 iso_pu_bacteria 2602042105 2603847219 435
417 iso_pu_bacteria 2602042106 2603852289 435
418 iso_pu_bacteria 2602042109 2603864507 435
419 iso_pu_bacteria 2602042110 2603870343 435
420 iso_pu_bacteria 2602042111 2603875357 435
421 iso_pu_bacteria 2603880178 2606047534 435
422 iso_pu_bacteria 2603880184 2606070047 435
423 iso_pu_bacteria 2603880202 2606145963 435
424 iso_pu_bacteria 2603880211 2606174935 435
425 iso_pu_bacteria 2609459761 2609910176 435
426 iso_pu_bacteria 2636415599 2637225797 435
427 iso_pu_bacteria 2654587920 2656276733 435
428 iso_pu_bacteria 2667528172 2671103315 435
429 iso_pu_bacteria 2667528173 2671109515 435
430 iso_pu_bacteria 2671180115 2671585358 435
431 iso_pu_bacteria 2675903046 2676407944 435
432 iso_pu_bacteria 2681812866 2681997550 435
433 iso_pu_bacteria 2681812869 2682006940 435
434 iso_pu_bacteria 2687453601 2689447450 435
435 iso_pu_bacteria 2711768156 2712469617 435
436 iso_pu_bacteria 2739367655 2739609964 435
437 iso_pu_bacteria 2751185917 2753855628 435
438 iso_pu_bacteria 2765235842 2765588610 435
439 iso_pu_bacteria 2772190666 2772441264 435
440 iso_pu_bacteria 2775506706 2775538616 435
441 iso_pu_bacteria 2775507074 2777023647 435
442 iso_pu_bacteria 2791355010 2792311384 435
443 iso_pu_bacteria 2791355275 2793405811 435
444 iso_pu_bacteria 2811995292 2813729293 435
445 iso_pu_bacteria 2814123068 2814696803 435
446 iso_pu_bacteria 2821118458 2821119433 435
447 iso_pu_bacteria 2823373977 2823374398 435
448 iso_pu_bacteria 2844425489 2844427170 435
449 iso_pu_bacteria 2846540461 2846540833 435
450 iso_pu_bacteria 2847085930 2847089452 435
451 iso_pu_bacteria 2852103415 2852105597 435
452 iso_pu_bacteria 2855195626 2855196763 435
453 iso_pu_bacteria 2858466076 2858468271 435
454 iso_pu_bacteria 2869551831 2869556885 435
455 iso_pu_bacteria 2871272651 2871277102 435
456 iso_pu_bacteria 2871282230 2871284203 435
457 iso_pu_bacteria 2881927736 2881930877 435
458 iso_pu_bacteria 2884086401 2884089295 435
459 iso_pu_bacteria 2887375801 2887378546 435
460 iso_pu_bacteria 2888366609 2888371384 435
461 iso_pu_bacteria 2888373701 2888375968 435
462 iso_pu_bacteria 2891670763 2891674988 435
463 iso_pu_bacteria 2900051742 2900055155 435
464 iso_pu_bacteria 2904474040 2904477933 435
465 iso_pu_bacteria 2904513164 2904513349 435
466 iso_pu_bacteria 2908669403 2908671584 435
467 iso_pu_bacteria 2919108558 2919112104 435
468 iso_pu_bacteria 2919150387 2919154103 435
469 iso_pu_bacteria 2923634449 2923634494 435
470 iso_pu_bacteria 2927143783 2927147640 435
471 iso_pu_bacteria 2927833300 2927834449 435
472 iso_pu_bacteria 2935625433 2935626959 435
473 iso_pu_bacteria 2937539931 2937543091 435
474 iso_pu_bacteria 2937967321 2937968928 435
475 iso_pu_bacteria 2939573065 2939573926 435
476 iso_pu_bacteria 2939607340 2939607787 435
477 iso_pu_bacteria 2939617950 2939619297 435
478 iso_pu_bacteria 2939642701 2939644127 435
479 iso_pu_bacteria 2945874760 2945877378 435
480 iso_pu_bacteria 2969079654 2969082795 435
481 iso_pu_bacteria 2971820967 2971824133 435
482 iso_pu_bacteria 2974310843 2974312472 435
483 iso_pu_bacteria 2974435778 2974438174 435
484 iso_pu_bacteria 2984559226 2984559860 435
485 iso_pu_bacteria 2984595703 2984597941 435
486 iso_pu_bacteria 640753048 640940258 435
487 iso_pu_bacteria 8002392321 8002394749 435
488 iso_pu_bacteria 8004592986 8004593943 435
489 iso_pu_bacteria 8015394850 8015395120 435
490 iso_pu_bacteria 8018405270 8018408501 435
491 iso_pu_bacteria 8019504834 8019506181 435
492 iso_pu_bacteria 8048746797 8048747787 435
493 iso_pu_bacteria 8054844752 8054847276 435
494 iso_pu_bacteria 8054849141 8054854220 435
495 iso_pu_bacteria 8055087960 8055091117 435
496 iso_pu_bacteria 8055092621 8055094385 435
497 iso_pu_bacteria 8055097453 8055099799 435
498 iso_pu_bacteria 8055693939 8055698154 435
499 iso_pu_bacteria 8057304971 8057308943 435
500 3300003775 Ga0055524_1000159 Ga0055524_100015944 436
501 3300003781 Ga0055536_1001131 Ga0055536_10011315 436
502 3300003784 Ga0055534_1009665 Ga0055534_10096652 436
503 3300003791 Ga0055530_10001818 Ga0055530_100018187 436
504 3300003792 Ga0055540_1000023 Ga0055540_100002316 436
505 3300003792 Ga0055540_1003017 Ga0055540_10030177 436
506 3300003794 Ga0055531_10005322 Ga0055531_100053226 436
507 3300003856 Ga0058692_1000014 Ga0058692_1000014116 436
508 3300003856 Ga0058692_1003486 Ga0058692_10034862 436
509 3300005272 Ga0065703_1018772 Ga0065703_10187721 436
510 3300005288 Ga0065714_10100057 Ga0065714_101000571 436
511 3300005289 Ga0065704_10003382 Ga0065704_100033823 436
512 3300005353 Ga0070669_100010572 Ga0070669_1000105726 436
513 3300005366 Ga0070659_100034003 Ga0070659_1000340034 436
514 3300005435 Ga0070714_100000531 Ga0070714_1000005315 436
515 3300005456 Ga0070678_100089453 Ga0070678_1000894532 436
516 3300005458 Ga0070681_10000172 Ga0070681_1000017233 436
517 3300005543 Ga0070672_100028350 Ga0070672_1000283503 436
518 3300005548 Ga0070665_100005369 Ga0070665_10000536913 436
519 3300005563 Ga0068855_100090625 Ga0068855_1000906251 436
520 3300005614 Ga0068856_100062067 Ga0068856_1000620674 436
521 3300006051 Ga0075364_10011474 Ga0075364_100114742 436
522 3300006175 Ga0070712_100004923 Ga0070712_1000049234 436
523 3300006946 Ga0079104_1000002 Ga0079104_1000002201 436
524 3300006946 Ga0079104_1000071 Ga0079104_100007194 436
525 3300009036 Ga0105244_10006729 Ga0105244_100067298 436
526 3300009092 Ga0105250_10013887 Ga0105250_100138872 436
527 3300009093 Ga0105240_10029012 Ga0105240_100290123 436
528 3300009094 Ga0111539_10110048 Ga0111539_101100482 436
529 3300009101 Ga0105247_10006981 Ga0105247_100069815 436
530 3300009148 Ga0105243_10000048 Ga0105243_1000004852 436
531 3300009148 Ga0105243_10002094 Ga0105243_100020946 436
532 3300009148 Ga0105243_10004604 Ga0105243_100046045 436
533 3300009148 Ga0105243_10186576 Ga0105243_101865762 436
534 3300009545 Ga0105237_10011045 Ga0105237_100110453 436
535 3300009551 Ga0105238_10094839 Ga0105238_100948393 436
536 3300009553 Ga0105249_10001559 Ga0105249_100015594 436
537 3300013100 Ga0157373_10108123 Ga0157373_101081232 436
538 3300013102 Ga0157371_10003173 Ga0157371_1000317315 436
539 3300013102 Ga0157371_10063603 Ga0157371_100636032 436
540 3300013104 Ga0157370_10006949 Ga0157370_100069497 436
541 3300013104 Ga0157370_10092036 Ga0157370_100920363 436
542 3300013105 Ga0157369_10007119 Ga0157369_100071198 436
543 3300013306 Ga0163162_10021609 Ga0163162_100216095 436
544 3300013308 Ga0157375_10442899 Ga0157375_104428991 436
545 3300014969 Ga0157376_10094358 Ga0157376_100943582 436
546 3300015261 Ga0182006_1000033 Ga0182006_100003344 436
547 3300015262 Ga0182007_10000042 Ga0182007_1000004241 436
548 3300015262 Ga0182007_10013674 Ga0182007_100136744 436
549 3300015265 Ga0182005_1000024 Ga0182005_1000024178 436
550 3300015683 Ga0183362_10001 Ga0183362_10001143 436
551 3300021361 Ga0213872_10011172 Ga0213872_100111722 436
552 3300021361 Ga0213872_10054637 Ga0213872_100546371 436
553 3300025284 Ga0209130_1004205 Ga0209130_10042053 436
554 3300025291 Ga0209675_1000394 Ga0209675_100039432 436
555 3300025291 Ga0209675_1009523 Ga0209675_10095233 436
556 3300025291 Ga0209675_1010696 Ga0209675_10106962 436
557 3300025292 Ga0209676_1000505 Ga0209676_10005055 436
558 3300025292 Ga0209676_1005425 Ga0209676_10054256 436
559 3300025294 Ga0209025_1000098 Ga0209025_100009868 436
560 3300025294 Ga0209025_1000548 Ga0209025_100054851 436
561 3300025295 Ga0209564_1000159 Ga0209564_100015911 436
562 3300025298 Ga0209050_1001298 Ga0209050_100129813 436
563 3300025298 Ga0209050_1005444 Ga0209050_10054443 436
564 3300025298 Ga0209050_1005921 Ga0209050_10059214 436
565 3300025298 Ga0209050_1008240 Ga0209050_10082407 436
566 3300025299 Ga0209256_1000051 Ga0209256_1000051148 436
567 3300025303 Ga0209051_1000079 Ga0209051_1000079170 436
568 3300025303 Ga0209051_1000331 Ga0209051_100033117 436
569 3300025304 Ga0209257_1000183 Ga0209257_1000183128 436
570 3300025304 Ga0209257_1010097 Ga0209257_10100973 436
571 3300025304 Ga0209257_1021461 Ga0209257_10214612 436
572 3300025711 Ga0207696_1015484 Ga0207696_10154841 436
573 3300025728 Ga0207655_1002617 Ga0207655_100261713 436
574 3300025728 Ga0207655_1002619 Ga0207655_100261913 436
575 3300025728 Ga0207655_1004288 Ga0207655_10042886 436
576 3300025728 Ga0207655_1010022 Ga0207655_10100226 436
577 3300025728 Ga0207655_1038469 Ga0207655_10384691 436
578 3300025735 Ga0207713_1005776 Ga0207713_10057763 436
579 3300025900 Ga0207710_10000009 Ga0207710_10000009388 436
580 3300025913 Ga0207695_10015038 Ga0207695_100150385 436
581 3300025915 Ga0207693_10013105 Ga0207693_100131054 436
582 3300025923 Ga0207681_10007464 Ga0207681_100074641 436
583 3300025929 Ga0207664_10008414 Ga0207664_100084149 436
584 3300025932 Ga0207690_10040715 Ga0207690_100407154 436
585 3300025933 Ga0207706_10228080 Ga0207706_102280801 436
586 3300025935 Ga0207709_10000001 Ga0207709_100000011936 436
587 3300025935 Ga0207709_10000015 Ga0207709_10000015194 436
588 3300025935 Ga0207709_10000341 Ga0207709_1000034117 436
589 3300025935 Ga0207709_10070895 Ga0207709_100708952 436
590 3300025940 Ga0207691_10037115 Ga0207691_100371155 436
591 3300025949 Ga0207667_10214985 Ga0207667_102149852 436
592 3300025961 Ga0207712_10001050 Ga0207712_1000105020 436
593 3300026078 Ga0207702_10037324 Ga0207702_100373242 436
594 3300026121 Ga0207683_10140734 Ga0207683_101407342 436
595 3300027111 Ga0209281_1000007 Ga0209281_1000007419 436
596 3300027111 Ga0209281_1000098 Ga0209281_1000098110 436
597 3300027111 Ga0209281_1000135 Ga0209281_1000135113 436
598 3300027312 Ga0209371_1000040 Ga0209371_1000040175 436
599 3300027312 Ga0209371_1000094 Ga0209371_1000094134 436
600 3300027876 Ga0209974_10003919 Ga0209974_100039193 436
601 3300027876 Ga0209974_10018719 Ga0209974_100187192 436
602 3300027907 Ga0207428_10066986 Ga0207428_100669862 436
603 3300028379 Ga0268266_10009768 Ga0268266_100097682 436
604 3300028653 Ga0265323_10048090 Ga0265323_100480901 436
605 3300030500 Ga0268256_1000041 Ga0268256_1000041139 436
606 3300030500 Ga0268256_1000083 Ga0268256_1000083134 436
607 3300031235 Ga0265330_10000033 Ga0265330_1000003382 436
608 3300031238 Ga0265332_10000001 Ga0265332_10000001206 436
609 3300031238 Ga0265332_10000005 Ga0265332_1000000564 436
610 3300031251 Ga0265327_10000293 Ga0265327_1000029376 436
611 3300031344 Ga0265316_10016937 Ga0265316_100169372 436
612 3300031548 Ga0307408_100000079 Ga0307408_10000007927 436
613 3300031691 Ga0316579_10017282 Ga0316579_100172822 436
614 3300031711 Ga0265314_10000022 Ga0265314_10000022211 436
615 3300031727 Ga0316576_10021425 Ga0316576_100214254 436
616 3300031727 Ga0316576_10051745 Ga0316576_100517452 436
617 3300031727 Ga0316576_10073820 Ga0316576_100738201 436
618 3300031727 Ga0316576_10102220 Ga0316576_101022201 436
619 3300031733 Ga0316577_10000999 Ga0316577_100009995 436
620 3300031901 Ga0307406_10000132 Ga0307406_1000013227 436
621 3300031911 Ga0307412_10000162 Ga0307412_1000016240 436
622 3300032133 Ga0316583_10008589 Ga0316583_100085893 436
623 3300035398 Ga0316574_0001667 Ga0316574_0001667_4923_6242 436
624 3300036647 Ga0316582_0020648 Ga0316582_0020648_443_1762 436
625 3300036712 Ga0316584_0002523 Ga0316584_0002523_8460_9779 436
626 3300037471 Ga0395905_0042134 Ga0395905_0042134_514_1857 436
627 3300038443 Ga0395901_0002134 Ga0395901_0002134_10305_11648 436
628 3300038443 Ga0395901_0109739 Ga0395901_0109739_128_1471 436
629 3300038705 Ga0237819_02469 Ga0237819_02469_1908_3257 436
630 3300038725 Ga0400484_00611 Ga0400484_00611_6760_8109 436
631 3300038725 Ga0400484_03648 Ga0400484_03648_1909_3261 436
632 3300038725 Ga0400484_26818 Ga0400484_26818_1140_2489 436
633 3300038726 Ga0400490_47884 Ga0400490_47884_1555_2898 436
634 3300038735 Ga0400485_16497 Ga0400485_16497_1941_3260 436
635 3300038741 Ga0400488_54281 Ga0400488_54281_778_2133 436
636 3300038741 Ga0400488_56508 Ga0400488_56508_5793_7142 436
637 3300039062 Ga0400483_126084 Ga0400483_126084_4389_5738 436
638 3300039062 Ga0400483_233352 Ga0400483_233352_1169_2518 436
639 3300039062 Ga0400483_286886 Ga0400483_286886_2160_3509 436
640 3300039093 Ga0400489_45196 Ga0400489_45196_356_1699 436
641 3300039093 Ga0400489_69212 Ga0400489_69212_364_1713 436
642 3300039093 Ga0400489_72172 Ga0400489_72172_4951_6300 436
643 3300039447 Ga0436361_0210320 Ga0436361_0210320_1477_2826 436
644 3300039447 Ga0436361_0250104 Ga0436361_0250104_3004_4341 436
645 3300039447 Ga0436361_1107681 Ga0436361_1107681_1290_2618 436
646 3300041404 Ga0439436_0006308 Ga0439436_0006308_164_1498 436
647 3300042006 Ga0439432_007277 Ga0439432_007277_1019_2353 436
648 3300042010 Ga0439452_016691 Ga0439452_016691_546_1880 436
649 3300042115 Ga0450911_000790 Ga0450911_000790_235_1578 436
650 3300042125 Ga0450923_007695 Ga0450923_007695_71_1414 436
651 3300042435 Ga0439434_0000357 Ga0439434_0000357_6216_7550 436
652 3300042876 Ga0451577_0000033 Ga0451577_0000033_12625_13974 436
653 3300042876 Ga0451577_0000866 Ga0451577_0000866_11603_12964 436
654 3300042876 Ga0451577_0030167 Ga0451577_0030167_3555_4889 436
655 3300042876 Ga0451577_0043661 Ga0451577_0043661_495_1832 436
656 3300042876 Ga0451577_0080389 Ga0451577_0080389_1522_2862 436
657 3300042876 Ga0451577_0210759 Ga0451577_0210759_345_1682 436
658 3300044666 Ga0466977_0001752 Ga0466977_0001752_1793_3190 436
659 3300044673 Ga0453683_0000010 Ga0453683_0000010_96305_97639 436
660 3300044673 Ga0453683_0017683 Ga0453683_0017683_627_1961 436
661 3300044712 Ga0453684_0000109 Ga0453684_0000109_348112_349461 436
662 3300044712 Ga0453684_0000199 Ga0453684_0000199_250411_251745 436
663 3300044712 Ga0453684_0000202 Ga0453684_0000202_79736_81097 436
664 3300044712 Ga0453684_0000334 Ga0453684_0000334_169701_171038 436
665 3300044712 Ga0453684_0000547 Ga0453684_0000547_17445_18782 436
666 3300044712 Ga0453684_0016192 Ga0453684_0016192_9962_11308 436
667 3300044712 Ga0453684_0018414 Ga0453684_0018414_2148_3482 436
668 3300044712 Ga0453684_0033231 Ga0453684_0033231_1340_2680 436
669 3300044712 Ga0453684_0144627 Ga0453684_0144627_427_1770 436
670 3300044712 Ga0453684_0237542 Ga0453684_0237542_584_1918 436
671 3300045051 Ga0451576_0000232 Ga0451576_0000232_79736_81097 436
672 3300045051 Ga0451576_0000729 Ga0451576_0000729_27477_28811 436
673 3300045051 Ga0451576_0004777 Ga0451576_0004777_8762_10099 436
674 3300045051 Ga0451576_0010870 Ga0451576_0010870_228_1562 436
675 3300045051 Ga0451576_0025802 Ga0451576_0025802_2332_3666 436
676 3300045051 Ga0451576_0182435 Ga0451576_0182435_19_1377 436
677 3300045051 Ga0451576_0275088 Ga0451576_0275088_182_1516 436
678 3300046475 Ga0495639_0003081 Ga0495639_0003081_244_1587 436
679 3300046499 Ga0495594_0003270 Ga0495594_0003270_1508_2905 436
680 3300046528 Ga0495642_0005976 Ga0495642_0005976_680_2023 436
681 3300046535 Ga0495586_0041438 Ga0495586_0041438_663_2060 436
682 3300046557 Ga0495622_0011721 Ga0495622_0011721_1413_2756 436
683 3300046558 Ga0495633_0000708 Ga0495633_0000708_191_1534 436
684 3300046615 Ga0495656_0003367 Ga0495656_0003367_695_2038 436
685 3300046674 Ga0495588_0010933 Ga0495588_0010933_1456_2799 436
686 3300046691 Ga0495670_0019417 Ga0495670_0019417_1942_3285 436
687 3300047444 Ga0495675_0017338 Ga0495675_0017338_2042_3439 436
688 3300048903 Ga0496100_0008015 Ga0496100_0008015_2313_3656 436
689 3300048904 Ga0496101_0005879 Ga0496101_0005879_897_2240 436
690 3300048905 Ga0496102_0033956 Ga0496102_0033956_2338_3681 436
691 3300048906 Ga0496103_0008474 Ga0496103_0008474_872_2215 436
692 3300048907 Ga0496104_0008000 Ga0496104_0008000_2463_3806 436
693 3300048907 Ga0496104_0261113 Ga0496104_0261113_290_1633 436
694 3300048908 Ga0496105_0001878 Ga0496105_0001878_1632_2975 436
695 3300048908 Ga0496105_0132219 Ga0496105_0132219_126_1469 436
696 3300048909 Ga0496106_0017299 Ga0496106_0017299_78_1421 436
697 3300048910 Ga0496107_0047532 Ga0496107_0047532_1663_3006 436
698 3300048911 Ga0496108_0054847 Ga0496108_0054847_511_1854 436
699 3300048911 Ga0496108_0164942 Ga0496108_0164942_510_1853 436
700 3300048912 Ga0496109_0035058 Ga0496109_0035058_692_2035 436
701 3300048913 Ga0496110_0046454 Ga0496110_0046454_2142_3485 436
702 3300048913 Ga0496110_0083396 Ga0496110_0083396_1236_2579 436
703 3300048914 Ga0496111_0037096 Ga0496111_0037096_1397_2740 436
704 3300048915 Ga0496112_0039999 Ga0496112_0039999_1939_3336 436
705 3300048917 Ga0496114_0001722 Ga0496114_0001722_1383_2726 436
706 3300048917 Ga0496114_0081556 Ga0496114_0081556_722_2065 436
707 3300048919 Ga0496116_0005939 Ga0496116_0005939_8611_9954 436
708 3300048919 Ga0496116_0010913 Ga0496116_0010913_3782_5170 436
709 3300048919 Ga0496116_0014431 Ga0496116_0014431_3188_4531 436
710 3300048919 Ga0496116_0027419 Ga0496116_0027419_140_1483 436
711 3300048919 Ga0496116_0075287 Ga0496116_0075287_556_1899 436
712 3300048920 Ga0496117_0000005 Ga0496117_0000005_729620_730963 436
713 3300048920 Ga0496117_0054119 Ga0496117_0054119_294_1637 436
714 3300048921 Ga0496118_0000031 Ga0496118_0000031_46506_47849 436
715 3300048921 Ga0496118_0012713 Ga0496118_0012713_6536_7882 436
716 3300048921 Ga0496118_0089177 Ga0496118_0089177_523_1866 436
717 3300048921 Ga0496118_0116090 Ga0496118_0116090_21_1364 436
718 3300048922 Ga0496119_0000069 Ga0496119_0000069_67585_68928 436
719 3300048922 Ga0496119_0038070 Ga0496119_0038070_1062_2411 436
720 3300048923 Ga0496120_0000243 Ga0496120_0000243_15235_16578 436
721 3300048924 Ga0496121_0000195 Ga0496121_0000195_104514_105860 436
722 3300048924 Ga0496121_0002186 Ga0496121_0002186_20321_21664 436
723 3300048924 Ga0496121_0011352 Ga0496121_0011352_3931_5274 436
724 3300048924 Ga0496121_0016438 Ga0496121_0016438_5068_6456 436
725 3300048924 Ga0496121_0059953 Ga0496121_0059953_1254_2597 436
726 3300048925 Ga0496122_0000416 Ga0496122_0000416_80609_81958 436
727 3300048925 Ga0496122_0000588 Ga0496122_0000588_44479_45822 436
728 3300048925 Ga0496122_0001745 Ga0496122_0001745_8918_10306 436
729 3300048925 Ga0496122_0022915 Ga0496122_0022915_2107_3450 436
730 3300048926 Ga0496123_0000104 Ga0496123_0000104_54517_55866 436
731 3300048926 Ga0496123_0001434 Ga0496123_0001434_23263_24651 436
732 3300048926 Ga0496123_0001470 Ga0496123_0001470_3279_4622 436
733 3300048927 Ga0496124_0052313 Ga0496124_0052313_1177_2520 436
734 3300048927 Ga0496124_0088808 Ga0496124_0088808_1070_2413 436
735 3300048928 Ga0496125_0000364 Ga0496125_0000364_17665_19008 436
736 3300048928 Ga0496125_0001029 Ga0496125_0001029_33993_35336 436
737 3300048928 Ga0496125_0006488 Ga0496125_0006488_5587_6915 436
738 3300048928 Ga0496125_0017588 Ga0496125_0017588_1435_2778 436
739 3300048928 Ga0496125_0018023 Ga0496125_0018023_1565_2908 436
740 3300048928 Ga0496125_0050170 Ga0496125_0050170_1173_2519 436
741 3300048929 Ga0496126_0008317 Ga0496126_0008317_8288_9631 436
742 3300048929 Ga0496126_0024727 Ga0496126_0024727_3030_4367 436
743 3300048929 Ga0496126_0071011 Ga0496126_0071011_888_2231 436
744 3300048929 Ga0496126_0141525 Ga0496126_0141525_98_1441 436
745 3300049460 Ga0495682_0002927 Ga0495682_0002927_30_1373 436
746 3300049568 Ga0501031_0001325 Ga0501031_0001325_7175_8536 436
747 3300049568 Ga0501031_0005851 Ga0501031_0005851_151_1494 436
748 3300049568 Ga0501031_0025303 Ga0501031_0025303_582_1925 436
749 3300049569 Ga0501032_0000445 Ga0501032_0000445_8079_9422 436
750 3300049569 Ga0501032_0004498 Ga0501032_0004498_9061_10404 436
751 3300049569 Ga0501032_0036144 Ga0501032_0036144_1886_3229 436
752 3300049569 Ga0501032_0061670 Ga0501032_0061670_706_2049 436
753 3300049569 Ga0501032_0084985 Ga0501032_0084985_234_1580 436
754 3300049569 Ga0501032_0095117 Ga0501032_0095117_144_1487 436
755 3300049570 Ga0501033_0001087 Ga0501033_0001087_5491_6834 436
756 3300049570 Ga0501033_0003106 Ga0501033_0003106_9873_11216 436
757 3300049571 Ga0501034_0000548 Ga0501034_0000548_52509_53972 436
758 3300049571 Ga0501034_0001617 Ga0501034_0001617_16412_17758 436
759 3300049571 Ga0501034_0015924 Ga0501034_0015924_697_2043 436
760 3300049571 Ga0501034_0041254 Ga0501034_0041254_931_2274 436
761 3300049571 Ga0501034_0090297 Ga0501034_0090297_768_2111 436
762 3300049571 Ga0501034_0162502 Ga0501034_0162502_582_1925 436
763 3300049572 Ga0501036_0002923 Ga0501036_0002923_7629_8972 436
764 3300049572 Ga0501036_0009281 Ga0501036_0009281_1474_2817 436
765 3300049572 Ga0501036_0065007 Ga0501036_0065007_1434_2777 436
766 3300049573 Ga0501037_0017651 Ga0501037_0017651_582_1925 436
767 3300049573 Ga0501037_0022108 Ga0501037_0022108_1980_3323 436
768 3300049574 Ga0501038_0001663 Ga0501038_0001663_3327_4670 436
769 3300049574 Ga0501038_0003198 Ga0501038_0003198_2318_3661 436
770 3300049574 Ga0501038_0003797 Ga0501038_0003797_9206_10549 436
771 3300049574 Ga0501038_0027577 Ga0501038_0027577_3248_4591 436
772 3300049574 Ga0501038_0028765 Ga0501038_0028765_717_2060 436
773 3300049574 Ga0501038_0148614 Ga0501038_0148614_404_1747 436
774 3300049575 Ga0501039_0035046 Ga0501039_0035046_582_1925 436
775 3300049575 Ga0501039_0057060 Ga0501039_0057060_1138_2484 436
776 3300049576 Ga0501040_0007334 Ga0501040_0007334_4600_5943 436
777 3300049578 Ga0501042_0022536 Ga0501042_0022536_1505_2848 436
778 3300049579 Ga0501043_0000018 Ga0501043_0000018_34823_36166 436
779 3300049579 Ga0501043_0004020 Ga0501043_0004020_9828_11171 436
780 3300049579 Ga0501043_0011974 Ga0501043_0011974_582_1925 436
781 3300049580 Ga0501046_0000042 Ga0501046_0000042_34823_36166 436
782 3300049580 Ga0501046_0006873 Ga0501046_0006873_7928_9271 436
783 3300049581 Ga0501047_0000052 Ga0501047_0000052_117283_118626 436
784 3300049581 Ga0501047_0032402 Ga0501047_0032402_3615_4958 436
785 3300049581 Ga0501047_0090693 Ga0501047_0090693_150_1493 436
786 3300049582 Ga0501048_0000459 Ga0501048_0000459_25971_27314 436
787 3300049582 Ga0501048_0010416 Ga0501048_0010416_601_1944 436
788 3300049590 Ga0501074_0193386 Ga0501074_0193386_24_1370 436
789 3300049592 Ga0501076_0116128 Ga0501076_0116128_465_1811 436
790 3300049742 Ga0501080_0306575 Ga0501080_0306575_39_1385 436
791 3300049822 Ga0501035_0001410 Ga0501035_0001410_20060_21403 436
792 3300049822 Ga0501035_0008857 Ga0501035_0008857_4156_5499 436
793 3300049822 Ga0501035_0035070 Ga0501035_0035070_3063_4406 436
794 3300049822 Ga0501035_0216777 Ga0501035_0216777_248_1591 436
795 3300049823 Ga0501044_0001189 Ga0501044_0001189_24533_25876 436
796 3300049823 Ga0501044_0003592 Ga0501044_0003592_857_2200 436
797 3300049823 Ga0501044_0003750 Ga0501044_0003750_14296_15639 436
798 3300049823 Ga0501044_0099800 Ga0501044_0099800_830_2173 436
799 3300049824 Ga0501045_0006811 Ga0501045_0006811_3637_4980 436
800 3300050491 nmdc:mga00v17_844_c1 nmdc:mga00v17_844_c1_5947_7290 436
801 3300050511 nmdc:mga08y16_303358_c1 nmdc:mga08y16_303358_c1_71_1465 436
802 3300053161 Ga0500634_0030676 Ga0500634_0030676_1552_2913 436
803 iso_pu_bacteria 2523533628 2524000831 436
804 iso_pu_bacteria 2526164512 2526213468 436
805 iso_pu_bacteria 2547132374 2548500085 436
806 iso_pu_bacteria 2551306352 2552746275 436
807 iso_pu_bacteria 2574179768 2574431783 436
808 iso_pu_bacteria 2576861471 2578457085 436
809 iso_pu_bacteria 2599185292 2599904262 436
810 iso_pu_bacteria 2600255292 2601672246 436
811 iso_pu_bacteria 2639762793 2640733423 436
812 iso_pu_bacteria 2643221569 2643859411 436
813 iso_pu_bacteria 2643221594 2643979682 436
814 iso_pu_bacteria 2643221596 2643991236 436
815 iso_pu_bacteria 2643221598 2643997954 436
816 iso_pu_bacteria 2643221603 2644028419 436
817 iso_pu_bacteria 2643221609 2644059856 436
818 iso_pu_bacteria 2643221611 2644074514 436
819 iso_pu_bacteria 2643221621 2644123172 436
820 iso_pu_bacteria 2643221652 2644293889 436
821 iso_pu_bacteria 2643221665 2644365284 436
822 iso_pu_bacteria 2643221683 2644468948 436
823 iso_pu_bacteria 2643221717 2644644597 436
824 iso_pu_bacteria 2675903507 2678230459 436
825 iso_pu_bacteria 2721755523 2722882349 436
826 iso_pu_bacteria 2738541277 2738719715 436
827 iso_pu_bacteria 2738541307 2738879867 436
828 iso_pu_bacteria 2738543012 2739241390 436
829 iso_pu_bacteria 2738543019 2739278914 436
830 iso_pu_bacteria 2744054655 2745161558 436
831 iso_pu_bacteria 2747842428 2747949200 436
832 iso_pu_bacteria 2765235840 2765580410 436
833 iso_pu_bacteria 2773857761 2774388990 436
834 iso_pu_bacteria 2773857770 2774439187 436
835 iso_pu_bacteria 2808606373 2808906636 436
836 iso_pu_bacteria 2808606395 2809033587 436
837 iso_pu_bacteria 2811994881 2812368737 436
838 iso_pu_bacteria 2816332133 2816473554 436
839 iso_pu_bacteria 2834641062 2834642450 436
840 iso_pu_bacteria 2839138175 2839138204 436
841 iso_pu_bacteria 2842718218 2842719116 436
842 iso_pu_bacteria 2852649853 2852652221 436
843 iso_pu_bacteria 2857537821 2857537930 436
844 iso_pu_bacteria 2857547612 2857549278 436
845 iso_pu_bacteria 2858688981 2858689645 436
846 iso_pu_bacteria 2858950400 2858954321 436
847 iso_pu_bacteria 2881101125 2881102121 436
848 iso_pu_bacteria 2885080285 2885083344 436
849 iso_pu_bacteria 2891633521 2891637377 436
850 iso_pu_bacteria 2894023352 2894024503 436
851 iso_pu_bacteria 2895498888 2895499680 436
852 iso_pu_bacteria 2895511927 2895512704 436
853 iso_pu_bacteria 2895522137 2895522718 436
854 iso_pu_bacteria 2895525241 2895525520 436
855 iso_pu_bacteria 2901300506 2901312169 436
856 iso_pu_bacteria 2902682994 2902683152 436
857 iso_pu_bacteria 2904479285 2904482524 436
858 iso_pu_bacteria 2904541872 2904548827 436
859 iso_pu_bacteria 2916699645 2916701642 436
860 iso_pu_bacteria 2919182534 2919185246 436
861 iso_pu_bacteria 2919493220 2919496084 436
862 iso_pu_bacteria 2919506607 2919509409 436
863 iso_pu_bacteria 2919543075 2919544362 436
864 iso_pu_bacteria 2919704043 2919705080 436
865 iso_pu_bacteria 2923519811 2923522802 436
866 iso_pu_bacteria 2923525760 2923527880 436
867 iso_pu_bacteria 2928515477 2928515810 436
868 iso_pu_bacteria 2929160207 2929166756 436
869 iso_pu_bacteria 2932410948 2932416325 436
870 iso_pu_bacteria 2932416698 2932422282 436
871 iso_pu_bacteria 2939631187 2939635087 436
872 iso_pu_bacteria 2941475908 2941478844 436
873 iso_pu_bacteria 2941479691 2941484157 436
874 iso_pu_bacteria 2974320154 2974324244 436
875 iso_pu_bacteria 2984568884 2984568936 436
876 iso_pu_bacteria 2987605356 2987608694 436
877 iso_pu_bacteria 2990710928 2990711680 436
878 iso_pu_bacteria 3000376612 3000378672 436
879 iso_pu_bacteria 3007252601 3007254234 436
880 iso_pu_bacteria 3007315729 3007317024 436
881 iso_pu_bacteria 644736347 644751668 436
882 iso_pu_bacteria 8003400568 8003403436 436
883 iso_pu_bacteria 8011350971 8011353816 436
884 iso_pu_bacteria 8033232454 8033233816 436
885 iso_pu_bacteria 8055225921 8055229119 436
886 2162886012 MBSR1b_contig_7611668 MBSR1b_0061.00003130 437
887 3300000545 CNXas_1000011 CNXas_100001122 437
888 3300001915 JGI24741J21665_1000421 JGI24741J21665_10004212 437
889 3300002155 JGI24033J26618_1000723 JGI24033J26618_10007234 437
890 3300002459 JGI24751J29686_10001414 JGI24751J29686_100014144 437
891 3300002459 JGI24751J29686_10007421 JGI24751J29686_100074211 437
892 3300002737 JGI25162J39368_1001029 JGI25162J39368_100102915 437
893 3300002771 JGI25163J39215_1000395 JGI25163J39215_10003953 437
894 3300002772 JGI25164J39214_1000550 JGI25164J39214_10005503 437
895 3300003203 JGI25406J46586_10015249 JGI25406J46586_100152494 437
896 3300003214 JGI25165J46597_1000391 JGI25165J46597_100039130 437
897 3300003578 Ga0006562J51391_1013379 Ga0006562J51391_10133792 437
898 3300003751 Ga0055538_1000065 Ga0055538_100006523 437
899 3300003752 Ga0055539_1000099 Ga0055539_100009923 437
900 3300003756 Ga0055533_1000109 Ga0055533_100010923 437
901 3300003758 Ga0055532_1000094 Ga0055532_100009423 437
902 3300003759 Ga0055525_1000143 Ga0055525_100014323 437
903 3300003761 Ga0055535_1005097 Ga0055535_10050971 437
904 3300003781 Ga0055536_1000059 Ga0055536_100005985 437
905 3300003781 Ga0055536_1004497 Ga0055536_10044975 437
906 3300003781 Ga0055536_1004850 Ga0055536_10048505 437
907 3300003791 Ga0055530_10002957 Ga0055530_100029574 437
908 3300003791 Ga0055530_10005896 Ga0055530_100058962 437
909 3300003792 Ga0055540_1000084 Ga0055540_100008414 437
910 3300003792 Ga0055540_1005110 Ga0055540_10051102 437
911 3300003794 Ga0055531_10000213 Ga0055531_1000021364 437
912 3300003841 Ga0055541_1000066 Ga0055541_100006668 437
913 3300005288 Ga0065714_10002224 Ga0065714_1000222410 437
914 3300005288 Ga0065714_10064639 Ga0065714_1006463922 437
915 3300005288 Ga0065714_10067571 Ga0065714_100675712 437
916 3300005288 Ga0065714_10068318 Ga0065714_100683184 437
917 3300005288 Ga0065714_10084095 Ga0065714_100840952 437
918 3300005289 Ga0065704_10084957 Ga0065704_100849571 437
919 3300005290 Ga0065712_10117391 Ga0065712_101173912 437
920 3300005293 Ga0065715_10001484 Ga0065715_100014844 437
921 3300005293 Ga0065715_10019057 Ga0065715_100190572 437
922 3300005293 Ga0065715_10026204 Ga0065715_100262042 437
923 3300005293 Ga0065715_10126408 Ga0065715_101264082 437
924 3300005295 Ga0065707_10008614 Ga0065707_100086142 437
925 3300005295 Ga0065707_10121134 Ga0065707_101211342 437
926 3300005295 Ga0065707_10136519 Ga0065707_101365192 437
927 3300005295 Ga0065707_10144561 Ga0065707_101445611 437
928 3300005328 Ga0070676_10003061 Ga0070676_100030612 437
929 3300005328 Ga0070676_10015658 Ga0070676_100156583 437
930 3300005328 Ga0070676_10050231 Ga0070676_100502312 437
931 3300005328 Ga0070676_10093862 Ga0070676_100938622 437
932 3300005329 Ga0070683_100037047 Ga0070683_1000370472 437
933 3300005329 Ga0070683_100087539 Ga0070683_1000875394 437
934 3300005329 Ga0070683_100140797 Ga0070683_1001407972 437
935 3300005330 Ga0070690_100009715 Ga0070690_1000097152 437
936 3300005330 Ga0070690_100080595 Ga0070690_1000805952 437
937 3300005330 Ga0070690_100125984 Ga0070690_1001259841 437
938 3300005331 Ga0070670_100000189 Ga0070670_1000001892 437
939 3300005331 Ga0070670_100007325 Ga0070670_1000073255 437
940 3300005331 Ga0070670_100009786 Ga0070670_1000097862 437
941 3300005331 Ga0070670_100017994 Ga0070670_1000179946 437
942 3300005331 Ga0070670_100019496 Ga0070670_1000194964 437
943 3300005331 Ga0070670_100081900 Ga0070670_1000819002 437
944 3300005331 Ga0070670_100101339 Ga0070670_1001013392 437
945 3300005331 Ga0070670_100149293 Ga0070670_1001492931 437
946 3300005334 Ga0068869_100101382 Ga0068869_1001013823 437
947 3300005335 Ga0070666_10006496 Ga0070666_100064966 437
948 3300005335 Ga0070666_10048619 Ga0070666_100486192 437
949 3300005337 Ga0070682_100000015 Ga0070682_100000015187 437
950 3300005337 Ga0070682_100001862 Ga0070682_1000018626 437
951 3300005337 Ga0070682_100014412 Ga0070682_1000144123 437
952 3300005338 Ga0068868_100002429 Ga0068868_1000024293 437
953 3300005338 Ga0068868_100054873 Ga0068868_1000548732 437
954 3300005339 Ga0070660_100143983 Ga0070660_1001439832 437
955 3300005340 Ga0070689_100006764 Ga0070689_1000067646 437
956 3300005340 Ga0070689_100045716 Ga0070689_1000457162 437
957 3300005340 Ga0070689_100054345 Ga0070689_1000543453 437
958 3300005340 Ga0070689_100079510 Ga0070689_1000795101 437
959 3300005340 Ga0070689_100119361 Ga0070689_1001193612 437
960 3300005340 Ga0070689_100149461 Ga0070689_1001494612 437
961 3300005341 Ga0070691_10029888 Ga0070691_100298882 437
962 3300005343 Ga0070687_100059499 Ga0070687_1000594992 437
963 3300005344 Ga0070661_100001680 Ga0070661_1000016807 437
964 3300005345 Ga0070692_10083966 Ga0070692_100839661 437
965 3300005347 Ga0070668_100020911 Ga0070668_1000209111 437
966 3300005347 Ga0070668_100185899 Ga0070668_1001858992 437
967 3300005353 Ga0070669_100000002 Ga0070669_10000000294 437
968 3300005353 Ga0070669_100002540 Ga0070669_1000025407 437
969 3300005353 Ga0070669_100005374 Ga0070669_1000053745 437
970 3300005353 Ga0070669_100007453 Ga0070669_1000074536 437
971 3300005353 Ga0070669_100038114 Ga0070669_1000381143 437
972 3300005354 Ga0070675_100021663 Ga0070675_1000216631 437
973 3300005354 Ga0070675_100033490 Ga0070675_1000334903 437
974 3300005354 Ga0070675_100034683 Ga0070675_1000346832 437
975 3300005354 Ga0070675_100059434 Ga0070675_1000594343 437
976 3300005354 Ga0070675_100147001 Ga0070675_1001470012 437
977 3300005355 Ga0070671_100002469 Ga0070671_1000024699 437
978 3300005355 Ga0070671_100012326 Ga0070671_1000123262 437
979 3300005355 Ga0070671_100025279 Ga0070671_1000252793 437
980 3300005355 Ga0070671_100045314 Ga0070671_1000453143 437
981 3300005355 Ga0070671_100068159 Ga0070671_1000681592 437
982 3300005355 Ga0070671_100086392 Ga0070671_1000863922 437
983 3300005356 Ga0070674_100003746 Ga0070674_1000037465 437
984 3300005356 Ga0070674_100008167 Ga0070674_1000081675 437
985 3300005356 Ga0070674_100085340 Ga0070674_1000853402 437
986 3300005364 Ga0070673_100027228 Ga0070673_1000272285 437
987 3300005364 Ga0070673_100029158 Ga0070673_1000291582 437
988 3300005364 Ga0070673_100057777 Ga0070673_1000577773 437
989 3300005364 Ga0070673_100153400 Ga0070673_1001534002 437
990 3300005365 Ga0070688_100008929 Ga0070688_1000089291 437
991 3300005365 Ga0070688_100110024 Ga0070688_1001100242 437
992 3300005366 Ga0070659_100027673 Ga0070659_1000276733 437
993 3300005367 Ga0070667_100035493 Ga0070667_1000354935 437
994 3300005367 Ga0070667_100052614 Ga0070667_1000526142 437
995 3300005406 Ga0070703_10020319 Ga0070703_100203192 437
996 3300005434 Ga0070709_10001725 Ga0070709_100017252 437
997 3300005434 Ga0070709_10002168 Ga0070709_100021683 437
998 3300005434 Ga0070709_10103649 Ga0070709_101036492 437
999 3300005435 Ga0070714_100000060 Ga0070714_10000006023 437
1000 3300005435 Ga0070714_100004116 Ga0070714_1000041169 437
1001 3300005436 Ga0070713_100001174 Ga0070713_1000011743 437
1002 3300005436 Ga0070713_100007027 Ga0070713_1000070276 437
1003 3300005436 Ga0070713_100027544 Ga0070713_1000275442 437
1004 3300005436 Ga0070713_100047633 Ga0070713_1000476333 437
1005 3300005436 Ga0070713_100171450 Ga0070713_1001714502 437
1006 3300005437 Ga0070710_10005313 Ga0070710_100053136 437
1007 3300005438 Ga0070701_10004411 Ga0070701_100044112 437
1008 3300005438 Ga0070701_10006353 Ga0070701_100063534 437
1009 3300005439 Ga0070711_100005895 Ga0070711_1000058954 437
1010 3300005439 Ga0070711_100158986 Ga0070711_1001589862 437
1011 3300005440 Ga0070705_100056768 Ga0070705_1000567682 437
1012 3300005441 Ga0070700_100004050 Ga0070700_1000040506 437
1013 3300005441 Ga0070700_100088227 Ga0070700_1000882272 437
1014 3300005444 Ga0070694_100020058 Ga0070694_1000200584 437
1015 3300005445 Ga0070708_100018696 Ga0070708_1000186964 437
1016 3300005445 Ga0070708_100019125 Ga0070708_1000191252 437
1017 3300005445 Ga0070708_100021917 Ga0070708_1000219174 437
1018 3300005445 Ga0070708_100032717 Ga0070708_1000327173 437
1019 3300005445 Ga0070708_100079345 Ga0070708_1000793453 437
1020 3300005445 Ga0070708_100090608 Ga0070708_1000906084 437
1021 3300005445 Ga0070708_100291261 Ga0070708_1002912611 437
1022 3300005455 Ga0070663_100070110 Ga0070663_1000701104 437
1023 3300005456 Ga0070678_100023462 Ga0070678_1000234625 437
1024 3300005456 Ga0070678_100081831 Ga0070678_1000818311 437
1025 3300005457 Ga0070662_100001386 Ga0070662_1000013864 437
1026 3300005457 Ga0070662_100026299 Ga0070662_1000262992 437
1027 3300005457 Ga0070662_100105116 Ga0070662_1001051163 437
1028 3300005458 Ga0070681_10000495 Ga0070681_1000049522 437
1029 3300005458 Ga0070681_10022247 Ga0070681_100222475 437
1030 3300005458 Ga0070681_10027448 Ga0070681_100274482 437
1031 3300005458 Ga0070681_10124630 Ga0070681_101246301 437
1032 3300005459 Ga0068867_100026060 Ga0068867_1000260603 437
1033 3300005466 Ga0070685_10003429 Ga0070685_100034292 437
1034 3300005467 Ga0070706_100000060 Ga0070706_100000060103 437
1035 3300005467 Ga0070706_100001072 Ga0070706_10000107220 437
1036 3300005467 Ga0070706_100007318 Ga0070706_10000731812 437
1037 3300005467 Ga0070706_100008244 Ga0070706_1000082447 437
1038 3300005467 Ga0070706_100011145 Ga0070706_1000111454 437
1039 3300005467 Ga0070706_100025389 Ga0070706_1000253892 437
1040 3300005467 Ga0070706_100033458 Ga0070706_1000334582 437
1041 3300005467 Ga0070706_100035898 Ga0070706_1000358982 437
1042 3300005467 Ga0070706_100060806 Ga0070706_1000608064 437
1043 3300005467 Ga0070706_100062989 Ga0070706_1000629892 437
1044 3300005468 Ga0070707_100034163 Ga0070707_1000341632 437
1045 3300005468 Ga0070707_100036019 Ga0070707_1000360192 437
1046 3300005468 Ga0070707_100038068 Ga0070707_1000380682 437
1047 3300005468 Ga0070707_100042560 Ga0070707_1000425604 437
1048 3300005468 Ga0070707_100048349 Ga0070707_1000483491 437
1049 3300005468 Ga0070707_100049763 Ga0070707_1000497634 437
1050 3300005468 Ga0070707_100061094 Ga0070707_1000610942 437
1051 3300005468 Ga0070707_100109597 Ga0070707_1001095971 437
1052 3300005471 Ga0070698_100001426 Ga0070698_10000142623 437
1053 3300005471 Ga0070698_100005312 Ga0070698_1000053122 437
1054 3300005471 Ga0070698_100008064 Ga0070698_1000080645 437
1055 3300005471 Ga0070698_100008930 Ga0070698_1000089308 437
1056 3300005471 Ga0070698_100014479 Ga0070698_1000144793 437
1057 3300005471 Ga0070698_100025959 Ga0070698_1000259594 437
1058 3300005471 Ga0070698_100027732 Ga0070698_1000277322 437
1059 3300005471 Ga0070698_100034898 Ga0070698_1000348983 437
1060 3300005471 Ga0070698_100199202 Ga0070698_1001992022 437
1061 3300005518 Ga0070699_100006077 Ga0070699_1000060772 437
1062 3300005518 Ga0070699_100006860 Ga0070699_1000068602 437
1063 3300005518 Ga0070699_100011665 Ga0070699_1000116655 437
1064 3300005518 Ga0070699_100043920 Ga0070699_1000439202 437
1065 3300005518 Ga0070699_100051172 Ga0070699_1000511721 437
1066 3300005518 Ga0070699_100091272 Ga0070699_1000912722 437
1067 3300005518 Ga0070699_100103345 Ga0070699_1001033452 437
1068 3300005518 Ga0070699_100210724 Ga0070699_1002107242 437
1069 3300005518 Ga0070699_100243734 Ga0070699_1002437341 437
1070 3300005535 Ga0070684_100002299 Ga0070684_10000229915 437
1071 3300005536 Ga0070697_100002882 Ga0070697_1000028829 437
1072 3300005536 Ga0070697_100012468 Ga0070697_1000124684 437
1073 3300005536 Ga0070697_100129784 Ga0070697_1001297842 437
1074 3300005536 Ga0070697_100134395 Ga0070697_1001343951 437
1075 3300005536 Ga0070697_100214454 Ga0070697_1002144542 437
1076 3300005539 Ga0068853_100001735 Ga0068853_10000173510 437
1077 3300005543 Ga0070672_100003894 Ga0070672_1000038945 437
1078 3300005546 Ga0070696_100028410 Ga0070696_1000284102 437
1079 3300005546 Ga0070696_100111662 Ga0070696_1001116621 437
1080 3300005548 Ga0070665_100096789 Ga0070665_1000967892 437
1081 3300005548 Ga0070665_100235460 Ga0070665_1002354601 437
1082 3300005549 Ga0070704_100000472 Ga0070704_1000004724 437
1083 3300005563 Ga0068855_100026120 Ga0068855_1000261203 437
1084 3300005563 Ga0068855_100194281 Ga0068855_1001942812 437
1085 3300005563 Ga0068855_100335573 Ga0068855_1003355731 437
1086 3300005564 Ga0070664_100000749 Ga0070664_1000007493 437
1087 3300005564 Ga0070664_100002405 Ga0070664_1000024057 437
1088 3300005577 Ga0068857_100074806 Ga0068857_1000748061 437
1089 3300005578 Ga0068854_100004716 Ga0068854_10000471610 437
1090 3300005578 Ga0068854_100146062 Ga0068854_1001460622 437
1091 3300005614 Ga0068856_100001235 Ga0068856_10000123516 437
1092 3300005614 Ga0068856_100068869 Ga0068856_1000688692 437
1093 3300005614 Ga0068856_100224725 Ga0068856_1002247252 437
1094 3300005616 Ga0068852_100103199 Ga0068852_1001031992 437
1095 3300005617 Ga0068859_100000021 Ga0068859_10000002114 437
1096 3300005617 Ga0068859_100026993 Ga0068859_1000269932 437
1097 3300005617 Ga0068859_100036793 Ga0068859_1000367934 437
1098 3300005617 Ga0068859_100053293 Ga0068859_1000532932 437
1099 3300005617 Ga0068859_100168190 Ga0068859_1001681902 437
1100 3300005618 Ga0068864_100038194 Ga0068864_1000381943 437
1101 3300005719 Ga0068861_100009201 Ga0068861_1000092015 437
1102 3300005834 Ga0068851_10000002 Ga0068851_10000002206 437
1103 3300005841 Ga0068863_100004355 Ga0068863_1000043554 437
1104 3300005841 Ga0068863_100138624 Ga0068863_1001386242 437
1105 3300005841 Ga0068863_100173707 Ga0068863_1001737072 437
1106 3300005842 Ga0068858_100001664 Ga0068858_10000166413 437
1107 3300005842 Ga0068858_100192582 Ga0068858_1001925822 437
1108 3300005843 Ga0068860_100011657 Ga0068860_1000116572 437
1109 3300005843 Ga0068860_100094445 Ga0068860_1000944453 437
1110 3300005843 Ga0068860_100145563 Ga0068860_1001455632 437
1111 3300005844 Ga0068862_100000907 Ga0068862_10000090711 437
1112 3300005844 Ga0068862_100016065 Ga0068862_1000160652 437
1113 3300005844 Ga0068862_100064830 Ga0068862_1000648302 437
1114 3300005844 Ga0068862_100073044 Ga0068862_1000730442 437
1115 3300005937 Ga0081455_10005178 Ga0081455_1000517813 437
1116 3300005937 Ga0081455_10006550 Ga0081455_100065505 437
1117 3300005937 Ga0081455_10011929 Ga0081455_100119298 437
1118 3300005937 Ga0081455_10014792 Ga0081455_100147923 437
1119 3300005937 Ga0081455_10065679 Ga0081455_100656792 437
1120 3300005981 Ga0081538_10039199 Ga0081538_100391993 437
1121 3300005985 Ga0081539_10000403 Ga0081539_1000040379 437
1122 3300005985 Ga0081539_10007470 Ga0081539_100074707 437
1123 3300005985 Ga0081539_10034847 Ga0081539_100348472 437
1124 3300005985 Ga0081539_10043424 Ga0081539_100434244 437
1125 3300006028 Ga0070717_10008912 Ga0070717_1000891210 437
1126 3300006028 Ga0070717_10044430 Ga0070717_100444303 437
1127 3300006028 Ga0070717_10061999 Ga0070717_100619993 437
1128 3300006051 Ga0075364_10058625 Ga0075364_100586252 437
1129 3300006058 Ga0075432_10001455 Ga0075432_100014557 437
1130 3300006058 Ga0075432_10003602 Ga0075432_100036025 437
1131 3300006058 Ga0075432_10023012 Ga0075432_100230122 437
1132 3300006058 Ga0075432_10023990 Ga0075432_100239901 437
1133 3300006058 Ga0075432_10024517 Ga0075432_100245172 437
1134 3300006163 Ga0070715_10003585 Ga0070715_100035856 437
1135 3300006173 Ga0070716_100000137 Ga0070716_1000001371 437
1136 3300006173 Ga0070716_100017145 Ga0070716_1000171452 437
1137 3300006173 Ga0070716_100026127 Ga0070716_1000261272 437
1138 3300006173 Ga0070716_100041663 Ga0070716_1000416632 437
1139 3300006173 Ga0070716_100042413 Ga0070716_1000424131 437
1140 3300006173 Ga0070716_100074147 Ga0070716_1000741471 437
1141 3300006173 Ga0070716_100136924 Ga0070716_1001369242 437
1142 3300006175 Ga0070712_100000057 Ga0070712_10000005745 437
1143 3300006175 Ga0070712_100000154 Ga0070712_10000015427 437
1144 3300006175 Ga0070712_100001792 Ga0070712_1000017928 437
1145 3300006175 Ga0070712_100006229 Ga0070712_1000062295 437
1146 3300006177 Ga0075362_10038665 Ga0075362_100386652 437
1147 3300006237 Ga0097621_100005910 Ga0097621_1000059105 437
1148 3300006358 Ga0068871_100015542 Ga0068871_1000155425 437
1149 3300006358 Ga0068871_100209699 Ga0068871_1002096992 437
1150 3300006844 Ga0075428_100001508 Ga0075428_10000150820 437
1151 3300006844 Ga0075428_100004126 Ga0075428_1000041266 437
1152 3300006844 Ga0075428_100006849 Ga0075428_1000068492 437
1153 3300006844 Ga0075428_100024446 Ga0075428_1000244461 437
1154 3300006844 Ga0075428_100049140 Ga0075428_1000491404 437
1155 3300006844 Ga0075428_100077354 Ga0075428_1000773543 437
1156 3300006844 Ga0075428_100107266 Ga0075428_1001072662 437
1157 3300006846 Ga0075430_100045750 Ga0075430_1000457502 437
1158 3300006847 Ga0075431_100016399 Ga0075431_1000163997 437
1159 3300006847 Ga0075431_100190491 Ga0075431_1001904912 437
1160 3300006847 Ga0075431_100194569 Ga0075431_1001945692 437
1161 3300006852 Ga0075433_10000856 Ga0075433_100008562 437
1162 3300006852 Ga0075433_10002698 Ga0075433_100026989 437
1163 3300006852 Ga0075433_10014389 Ga0075433_100143893 437
1164 3300006852 Ga0075433_10032336 Ga0075433_100323362 437
1165 3300006852 Ga0075433_10152001 Ga0075433_101520011 437
1166 3300006852 Ga0075433_10168316 Ga0075433_101683161 437
1167 3300006852 Ga0075433_10232388 Ga0075433_102323882 437
1168 3300006871 Ga0075434_100001763 Ga0075434_10000176312 437
1169 3300006871 Ga0075434_100003148 Ga0075434_10000314810 437
1170 3300006871 Ga0075434_100007797 Ga0075434_1000077971 437
1171 3300006871 Ga0075434_100020162 Ga0075434_1000201623 437
1172 3300006871 Ga0075434_100043160 Ga0075434_1000431602 437
1173 3300006880 Ga0075429_100001560 Ga0075429_10000156011 437
1174 3300006881 Ga0068865_100155757 Ga0068865_1001557572 437
1175 3300006914 Ga0075436_100016359 Ga0075436_1000163593 437
1176 3300006914 Ga0075436_100123164 Ga0075436_1001231641 437
1177 3300006931 Ga0097620_100000021 Ga0097620_10000002114 437
1178 3300006931 Ga0097620_100026994 Ga0097620_1000269942 437
1179 3300006931 Ga0097620_100036795 Ga0097620_1000367954 437
1180 3300006931 Ga0097620_100053296 Ga0097620_1000532962 437
1181 3300006931 Ga0097620_100168190 Ga0097620_1001681902 437
1182 3300006946 Ga0079104_1000156 Ga0079104_100015635 437
1183 3300006946 Ga0079104_1000707 Ga0079104_100070712 437
1184 3300006946 Ga0079104_1005686 Ga0079104_10056864 437
1185 3300007076 Ga0075435_100006566 Ga0075435_1000065664 437
1186 3300007076 Ga0075435_100010771 Ga0075435_1000107713 437
1187 3300007076 Ga0075435_100014550 Ga0075435_1000145503 437
1188 3300007076 Ga0075435_100060378 Ga0075435_1000603782 437
1189 3300007076 Ga0075435_100075483 Ga0075435_1000754832 437
1190 3300007265 Ga0099794_10000025 Ga0099794_1000002539 437
1191 3300009011 Ga0105251_10002968 Ga0105251_1000296813 437
1192 3300009011 Ga0105251_10005208 Ga0105251_100052082 437
1193 3300009011 Ga0105251_10006896 Ga0105251_100068962 437
1194 3300009011 Ga0105251_10010179 Ga0105251_100101792 437
1195 3300009011 Ga0105251_10020652 Ga0105251_100206522 437
1196 3300009036 Ga0105244_10000005 Ga0105244_10000005120 437
1197 3300009036 Ga0105244_10000900 Ga0105244_100009002 437
1198 3300009036 Ga0105244_10029149 Ga0105244_100291492 437
1199 3300009036 Ga0105244_10029411 Ga0105244_100294112 437
1200 3300009036 Ga0105244_10031344 Ga0105244_100313443 437
1201 3300009092 Ga0105250_10004947 Ga0105250_100049477 437
1202 3300009092 Ga0105250_10005194 Ga0105250_100051945 437
1203 3300009092 Ga0105250_10009457 Ga0105250_100094572 437
1204 3300009092 Ga0105250_10031892 Ga0105250_100318922 437
1205 3300009093 Ga0105240_10058712 Ga0105240_100587123 437
1206 3300009093 Ga0105240_10157301 Ga0105240_101573013 437
1207 3300009094 Ga0111539_10001894 Ga0111539_1000189413 437
1208 3300009094 Ga0111539_10003743 Ga0111539_1000374311 437
1209 3300009094 Ga0111539_10009531 Ga0111539_100095316 437
1210 3300009094 Ga0111539_10012199 Ga0111539_100121996 437
1211 3300009094 Ga0111539_10027092 Ga0111539_100270922 437
1212 3300009094 Ga0111539_10058473 Ga0111539_100584732 437
1213 3300009094 Ga0111539_10114668 Ga0111539_101146683 437
1214 3300009094 Ga0111539_10168462 Ga0111539_101684622 437
1215 3300009098 Ga0105245_10011710 Ga0105245_100117103 437
1216 3300009098 Ga0105245_10082913 Ga0105245_100829132 437
1217 3300009098 Ga0105245_10111168 Ga0105245_101111683 437
1218 3300009098 Ga0105245_10116985 Ga0105245_101169852 437
1219 3300009098 Ga0105245_10158585 Ga0105245_101585852 437
1220 3300009098 Ga0105245_10179920 Ga0105245_101799202 437
1221 3300009098 Ga0105245_10184047 Ga0105245_101840472 437
1222 3300009147 Ga0114129_10005945 Ga0114129_1000594516 437
1223 3300009147 Ga0114129_10018324 Ga0114129_100183246 437
1224 3300009147 Ga0114129_10026057 Ga0114129_100260574 437
1225 3300009147 Ga0114129_10038347 Ga0114129_100383472 437
1226 3300009147 Ga0114129_10050450 Ga0114129_100504504 437
1227 3300009147 Ga0114129_10106461 Ga0114129_101064613 437
1228 3300009147 Ga0114129_10464939 Ga0114129_104649391 437
1229 3300009147 Ga0114129_10475494 Ga0114129_104754941 437
1230 3300009148 Ga0105243_10001529 Ga0105243_100015294 437
1231 3300009148 Ga0105243_10002720 Ga0105243_100027202 437
1232 3300009148 Ga0105243_10015831 Ga0105243_100158315 437
1233 3300009148 Ga0105243_10042741 Ga0105243_100427412 437
1234 3300009148 Ga0105243_10046667 Ga0105243_100466671 437
1235 3300009148 Ga0105243_10075822 Ga0105243_100758222 437
1236 3300009174 Ga0105241_10030979 Ga0105241_100309792 437
1237 3300009174 Ga0105241_10050628 Ga0105241_100506282 437
1238 3300009174 Ga0105241_10193482 Ga0105241_101934822 437
1239 3300009176 Ga0105242_10007107 Ga0105242_100071077 437
1240 3300009176 Ga0105242_10008850 Ga0105242_100088508 437
1241 3300009176 Ga0105242_10015408 Ga0105242_100154085 437
1242 3300009176 Ga0105242_10084905 Ga0105242_100849052 437
1243 3300009176 Ga0105242_10155692 Ga0105242_101556922 437
1244 3300009176 Ga0105242_10157935 Ga0105242_101579352 437
1245 3300009177 Ga0105248_10002310 Ga0105248_1000231016 437
1246 3300009177 Ga0105248_10004739 Ga0105248_1000473916 437
1247 3300009177 Ga0105248_10027355 Ga0105248_100273553 437
1248 3300009177 Ga0105248_10038991 Ga0105248_100389915 437
1249 3300009177 Ga0105248_10090133 Ga0105248_100901333 437
1250 3300009177 Ga0105248_10189276 Ga0105248_101892761 437
1251 3300009177 Ga0105248_10272889 Ga0105248_102728892 437
1252 3300009545 Ga0105237_10004364 Ga0105237_100043647 437
1253 3300009545 Ga0105237_10018913 Ga0105237_100189133 437
1254 3300009545 Ga0105237_10131801 Ga0105237_101318012 437
1255 3300009545 Ga0105237_10138542 Ga0105237_101385422 437
1256 3300009551 Ga0105238_10068203 Ga0105238_100682033 437
1257 3300009551 Ga0105238_10204885 Ga0105238_102048852 437
1258 3300010375 Ga0105239_10166554 Ga0105239_101665543 437
1259 3300011119 Ga0105246_10001472 Ga0105246_100014721 437
1260 3300011119 Ga0105246_10001828 Ga0105246_100018285 437
1261 3300011119 Ga0105246_10006800 Ga0105246_100068005 437
1262 3300012498 Ga0157345_1000341 Ga0157345_10003412 437
1263 3300013100 Ga0157373_10000158 Ga0157373_1000015825 437
1264 3300013100 Ga0157373_10013594 Ga0157373_100135946 437
1265 3300013100 Ga0157373_10017496 Ga0157373_100174966 437
1266 3300013100 Ga0157373_10017678 Ga0157373_100176782 437
1267 3300013100 Ga0157373_10020808 Ga0157373_100208082 437
1268 3300013100 Ga0157373_10022021 Ga0157373_100220214 437
1269 3300013100 Ga0157373_10044939 Ga0157373_100449392 437
1270 3300013102 Ga0157371_10003333 Ga0157371_1000333314 437
1271 3300013102 Ga0157371_10035887 Ga0157371_100358874 437
1272 3300013104 Ga0157370_10004138 Ga0157370_1000413819 437
1273 3300013104 Ga0157370_10039461 Ga0157370_100394614 437
1274 3300013104 Ga0157370_10088769 Ga0157370_100887693 437
1275 3300013104 Ga0157370_10093062 Ga0157370_100930621 437
1276 3300013105 Ga0157369_10007270 Ga0157369_100072706 437
1277 3300013105 Ga0157369_10026460 Ga0157369_100264602 437
1278 3300013105 Ga0157369_10031368 Ga0157369_100313686 437
1279 3300013105 Ga0157369_10038599 Ga0157369_100385995 437
1280 3300013105 Ga0157369_10070399 Ga0157369_100703995 437
1281 3300013105 Ga0157369_10091905 Ga0157369_100919053 437
1282 3300013105 Ga0157369_10137644 Ga0157369_101376442 437
1283 3300013105 Ga0157369_10313026 Ga0157369_103130262 437
1284 3300013296 Ga0157374_10013735 Ga0157374_100137355 437
1285 3300013296 Ga0157374_10049162 Ga0157374_100491623 437
1286 3300013296 Ga0157374_10056586 Ga0157374_100565865 437
1287 3300013296 Ga0157374_10086823 Ga0157374_100868231 437
1288 3300013296 Ga0157374_10094321 Ga0157374_100943212 437
1289 3300013296 Ga0157374_10107312 Ga0157374_101073122 437
1290 3300013297 Ga0157378_10030675 Ga0157378_100306752 437
1291 3300013297 Ga0157378_10038076 Ga0157378_100380762 437
1292 3300013306 Ga0163162_10003825 Ga0163162_100038252 437
1293 3300013306 Ga0163162_10003912 Ga0163162_1000391210 437
1294 3300013306 Ga0163162_10004734 Ga0163162_100047345 437
1295 3300013306 Ga0163162_10012289 Ga0163162_100122895 437
1296 3300013306 Ga0163162_10026444 Ga0163162_100264442 437
1297 3300013306 Ga0163162_10033999 Ga0163162_100339995 437
1298 3300013306 Ga0163162_10103350 Ga0163162_101033502 437
1299 3300013306 Ga0163162_10115192 Ga0163162_101151922 437
1300 3300013306 Ga0163162_10151284 Ga0163162_101512842 437
1301 3300013306 Ga0163162_10165119 Ga0163162_101651192 437
1302 3300013307 Ga0157372_10019838 Ga0157372_100198382 437
1303 3300013307 Ga0157372_10029402 Ga0157372_100294022 437
1304 3300013307 Ga0157372_10051174 Ga0157372_100511743 437
1305 3300013307 Ga0157372_10092413 Ga0157372_100924133 437
1306 3300013308 Ga0157375_10000576 Ga0157375_1000057624 437
1307 3300013308 Ga0157375_10024997 Ga0157375_100249975 437
1308 3300013308 Ga0157375_10060947 Ga0157375_100609472 437
1309 3300013308 Ga0157375_10072977 Ga0157375_100729772 437
1310 3300013308 Ga0157375_10354262 Ga0157375_103542621 437
1311 3300014325 Ga0163163_10000071 Ga0163163_1000007192 437
1312 3300014325 Ga0163163_10006618 Ga0163163_100066182 437
1313 3300014325 Ga0163163_10011041 Ga0163163_100110417 437
1314 3300014325 Ga0163163_10052418 Ga0163163_100524183 437
1315 3300014326 Ga0157380_10000020 Ga0157380_1000002059 437
1316 3300014497 Ga0182008_10000005 Ga0182008_10000005136 437
1317 3300014497 Ga0182008_10000287 Ga0182008_1000028731 437
1318 3300014497 Ga0182008_10001739 Ga0182008_1000173914 437
1319 3300014497 Ga0182008_10006185 Ga0182008_100061852 437
1320 3300014497 Ga0182008_10008061 Ga0182008_100080616 437
1321 3300014497 Ga0182008_10008200 Ga0182008_100082006 437
1322 3300014497 Ga0182008_10012007 Ga0182008_100120073 437
1323 3300014497 Ga0182008_10023807 Ga0182008_100238072 437
1324 3300014497 Ga0182008_10034808 Ga0182008_100348082 437
1325 3300014745 Ga0157377_10046203 Ga0157377_100462032 437
1326 3300014745 Ga0157377_10080988 Ga0157377_100809881 437
1327 3300014968 Ga0157379_10003726 Ga0157379_100037268 437
1328 3300014968 Ga0157379_10149854 Ga0157379_101498542 437
1329 3300014968 Ga0157379_10265055 Ga0157379_102650551 437
1330 3300014969 Ga0157376_10023599 Ga0157376_100235992 437
1331 3300014969 Ga0157376_10141868 Ga0157376_101418681 437
1332 3300015261 Ga0182006_1004345 Ga0182006_10043457 437
1333 3300015261 Ga0182006_1007907 Ga0182006_10079072 437
1334 3300015261 Ga0182006_1028816 Ga0182006_10288162 437
1335 3300015262 Ga0182007_10007143 Ga0182007_100071432 437
1336 3300015262 Ga0182007_10008911 Ga0182007_100089111 437
1337 3300015265 Ga0182005_1006401 Ga0182005_10064014 437
1338 3300017792 Ga0163161_10001759 Ga0163161_100017595 437
1339 3300017792 Ga0163161_10016644 Ga0163161_100166444 437
1340 3300017792 Ga0163161_10062002 Ga0163161_100620023 437
1341 3300017792 Ga0163161_10088082 Ga0163161_100880823 437
1342 3300017792 Ga0163161_10089081 Ga0163161_100890812 437
1343 3300017792 Ga0163161_10090177 Ga0163161_100901771 437
1344 3300017792 Ga0163161_10098387 Ga0163161_100983872 437
1345 3300017792 Ga0163161_10104171 Ga0163161_101041712 437
1346 3300017792 Ga0163161_10119078 Ga0163161_101190782 437
1347 3300017792 Ga0163161_10124234 Ga0163161_101242341 437
1348 3300021377 Ga0213874_10024427 Ga0213874_100244272 437
1349 3300025206 Ga0209435_100675 Ga0209435_1006752 437
1350 3300025207 Ga0209760_100157 Ga0209760_10015730 437
1351 3300025224 Ga0209784_100101 Ga0209784_10010168 437
1352 3300025225 Ga0209566_100123 Ga0209566_10012368 437
1353 3300025226 Ga0209674_100145 Ga0209674_10014568 437
1354 3300025229 Ga0209147_100151 Ga0209147_10015168 437
1355 3300025230 Ga0209563_100128 Ga0209563_10012868 437
1356 3300025230 Ga0209563_100722 Ga0209563_1007225 437
1357 3300025231 Ga0207427_100092 Ga0207427_10009297 437
1358 3300025233 Ga0209437_100065 Ga0209437_100065212 437
1359 3300025242 Ga0209258_100241 Ga0209258_10024168 437
1360 3300025246 Ga0209646_1000354 Ga0209646_100035412 437
1361 3300025253 Ga0209677_100094 Ga0209677_10009468 437
1362 3300025261 Ga0209233_1000085 Ga0209233_1000085212 437
1363 3300025291 Ga0209675_1000022 Ga0209675_100002278 437
1364 3300025291 Ga0209675_1007953 Ga0209675_10079534 437
1365 3300025292 Ga0209676_1000076 Ga0209676_100007697 437
1366 3300025292 Ga0209676_1000264 Ga0209676_100026414 437
1367 3300025292 Ga0209676_1000313 Ga0209676_100031372 437
1368 3300025292 Ga0209676_1003014 Ga0209676_10030148 437
1369 3300025298 Ga0209050_1000063 Ga0209050_1000063221 437
1370 3300025298 Ga0209050_1000106 Ga0209050_1000106196 437
1371 3300025303 Ga0209051_1000045 Ga0209051_1000045194 437
1372 3300025303 Ga0209051_1000139 Ga0209051_1000139113 437
1373 3300025304 Ga0209257_1000539 Ga0209257_100053915 437
1374 3300025315 Ga0207697_10000347 Ga0207697_1000034723 437
1375 3300025315 Ga0207697_10002263 Ga0207697_100022635 437
1376 3300025315 Ga0207697_10005474 Ga0207697_100054745 437
1377 3300025321 Ga0207656_10000045 Ga0207656_1000004523 437
1378 3300025711 Ga0207696_1000047 Ga0207696_100004792 437
1379 3300025711 Ga0207696_1000318 Ga0207696_100031839 437
1380 3300025711 Ga0207696_1003699 Ga0207696_10036992 437
1381 3300025711 Ga0207696_1005607 Ga0207696_10056075 437
1382 3300025711 Ga0207696_1007853 Ga0207696_10078531 437
1383 3300025728 Ga0207655_1000015 Ga0207655_100001562 437
1384 3300025728 Ga0207655_1000016 Ga0207655_1000016119 437
1385 3300025728 Ga0207655_1000319 Ga0207655_10003192 437
1386 3300025728 Ga0207655_1000369 Ga0207655_100036948 437
1387 3300025728 Ga0207655_1001598 Ga0207655_100159815 437
1388 3300025728 Ga0207655_1003139 Ga0207655_10031397 437
1389 3300025728 Ga0207655_1008136 Ga0207655_10081361 437
1390 3300025728 Ga0207655_1010352 Ga0207655_10103523 437
1391 3300025728 Ga0207655_1012920 Ga0207655_10129204 437
1392 3300025728 Ga0207655_1035837 Ga0207655_10358372 437
1393 3300025728 Ga0207655_1049497 Ga0207655_10494972 437
1394 3300025735 Ga0207713_1000229 Ga0207713_100022948 437
1395 3300025735 Ga0207713_1000233 Ga0207713_100023315 437
1396 3300025735 Ga0207713_1002181 Ga0207713_10021814 437
1397 3300025735 Ga0207713_1002375 Ga0207713_10023758 437
1398 3300025735 Ga0207713_1003495 Ga0207713_10034954 437
1399 3300025735 Ga0207713_1006553 Ga0207713_10065532 437
1400 3300025735 Ga0207713_1011189 Ga0207713_10111892 437
1401 3300025735 Ga0207713_1011446 Ga0207713_10114463 437
1402 3300025735 Ga0207713_1020822 Ga0207713_10208223 437
1403 3300025885 Ga0207653_10000001 Ga0207653_1000000135 437
1404 3300025885 Ga0207653_10004737 Ga0207653_100047371 437
1405 3300025898 Ga0207692_10010710 Ga0207692_100107103 437
1406 3300025898 Ga0207692_10014599 Ga0207692_100145994 437
1407 3300025898 Ga0207692_10026636 Ga0207692_100266362 437
1408 3300025901 Ga0207688_10001511 Ga0207688_100015116 437
1409 3300025903 Ga0207680_10017992 Ga0207680_100179923 437
1410 3300025904 Ga0207647_10029870 Ga0207647_100298704 437
1411 3300025905 Ga0207685_10004107 Ga0207685_100041076 437
1412 3300025906 Ga0207699_10003261 Ga0207699_100032617 437
1413 3300025906 Ga0207699_10003871 Ga0207699_100038714 437
1414 3300025906 Ga0207699_10013239 Ga0207699_100132392 437
1415 3300025907 Ga0207645_10000980 Ga0207645_100009805 437
1416 3300025907 Ga0207645_10006530 Ga0207645_100065303 437
1417 3300025908 Ga0207643_10000852 Ga0207643_1000085216 437
1418 3300025910 Ga0207684_10000078 Ga0207684_1000007830 437
1419 3300025910 Ga0207684_10000118 Ga0207684_10000118110 437
1420 3300025910 Ga0207684_10003435 Ga0207684_1000343513 437
1421 3300025910 Ga0207684_10012551 Ga0207684_100125512 437
1422 3300025910 Ga0207684_10018065 Ga0207684_100180654 437
1423 3300025910 Ga0207684_10019367 Ga0207684_100193674 437
1424 3300025910 Ga0207684_10024000 Ga0207684_100240006 437
1425 3300025910 Ga0207684_10043425 Ga0207684_100434252 437
1426 3300025910 Ga0207684_10148839 Ga0207684_101488391 437
1427 3300025910 Ga0207684_10177523 Ga0207684_101775231 437
1428 3300025910 Ga0207684_10193470 Ga0207684_101934701 437
1429 3300025912 Ga0207707_10009245 Ga0207707_100092452 437
1430 3300025912 Ga0207707_10086628 Ga0207707_100866283 437
1431 3300025912 Ga0207707_10139202 Ga0207707_101392021 437
1432 3300025912 Ga0207707_10169731 Ga0207707_101697313 437
1433 3300025913 Ga0207695_10070045 Ga0207695_100700455 437
1434 3300025914 Ga0207671_10000060 Ga0207671_10000060146 437
1435 3300025914 Ga0207671_10071563 Ga0207671_100715632 437
1436 3300025915 Ga0207693_10000004 Ga0207693_10000004137 437
1437 3300025915 Ga0207693_10000865 Ga0207693_1000086513 437
1438 3300025915 Ga0207693_10001961 Ga0207693_1000196116 437
1439 3300025915 Ga0207693_10018332 Ga0207693_100183324 437
1440 3300025916 Ga0207663_10001502 Ga0207663_100015025 437
1441 3300025916 Ga0207663_10005395 Ga0207663_100053953 437
1442 3300025916 Ga0207663_10068825 Ga0207663_100688252 437
1443 3300025918 Ga0207662_10083306 Ga0207662_100833062 437
1444 3300025919 Ga0207657_10001299 Ga0207657_1000129919 437
1445 3300025920 Ga0207649_10000023 Ga0207649_10000023107 437
1446 3300025921 Ga0207652_10133892 Ga0207652_101338922 437
1447 3300025922 Ga0207646_10003069 Ga0207646_1000306910 437
1448 3300025922 Ga0207646_10003650 Ga0207646_100036505 437
1449 3300025922 Ga0207646_10003906 Ga0207646_1000390616 437
1450 3300025922 Ga0207646_10008498 Ga0207646_100084988 437
1451 3300025922 Ga0207646_10026374 Ga0207646_100263743 437
1452 3300025922 Ga0207646_10026869 Ga0207646_100268691 437
1453 3300025922 Ga0207646_10035115 Ga0207646_100351152 437
1454 3300025922 Ga0207646_10037053 Ga0207646_100370533 437
1455 3300025922 Ga0207646_10061856 Ga0207646_100618562 437
1456 3300025922 Ga0207646_10076287 Ga0207646_100762873 437
1457 3300025922 Ga0207646_10106525 Ga0207646_101065252 437
1458 3300025922 Ga0207646_10117025 Ga0207646_101170251 437
1459 3300025922 Ga0207646_10144294 Ga0207646_101442942 437
1460 3300025923 Ga0207681_10000009 Ga0207681_1000000994 437
1461 3300025923 Ga0207681_10000386 Ga0207681_100003862 437
1462 3300025923 Ga0207681_10008588 Ga0207681_100085883 437
1463 3300025923 Ga0207681_10012579 Ga0207681_100125792 437
1464 3300025925 Ga0207650_10000100 Ga0207650_1000010022 437
1465 3300025925 Ga0207650_10000153 Ga0207650_1000015315 437
1466 3300025925 Ga0207650_10003497 Ga0207650_100034972 437
1467 3300025925 Ga0207650_10012446 Ga0207650_100124464 437
1468 3300025925 Ga0207650_10025430 Ga0207650_100254302 437
1469 3300025925 Ga0207650_10055081 Ga0207650_100550813 437
1470 3300025925 Ga0207650_10196851 Ga0207650_101968511 437
1471 3300025926 Ga0207659_10066368 Ga0207659_100663683 437
1472 3300025926 Ga0207659_10189277 Ga0207659_101892772 437
1473 3300025926 Ga0207659_10201365 Ga0207659_102013651 437
1474 3300025926 Ga0207659_10250918 Ga0207659_102509181 437
1475 3300025927 Ga0207687_10044133 Ga0207687_100441334 437
1476 3300025927 Ga0207687_10048049 Ga0207687_100480492 437
1477 3300025927 Ga0207687_10092088 Ga0207687_100920881 437
1478 3300025928 Ga0207700_10000307 Ga0207700_1000030718 437
1479 3300025928 Ga0207700_10001040 Ga0207700_100010401 437
1480 3300025928 Ga0207700_10049630 Ga0207700_100496302 437
1481 3300025928 Ga0207700_10129471 Ga0207700_101294712 437
1482 3300025928 Ga0207700_10190936 Ga0207700_101909361 437
1483 3300025929 Ga0207664_10000017 Ga0207664_10000017139 437
1484 3300025929 Ga0207664_10007838 Ga0207664_100078384 437
1485 3300025929 Ga0207664_10044193 Ga0207664_100441932 437
1486 3300025931 Ga0207644_10005441 Ga0207644_100054415 437
1487 3300025931 Ga0207644_10014353 Ga0207644_100143533 437
1488 3300025933 Ga0207706_10000056 Ga0207706_1000005634 437
1489 3300025933 Ga0207706_10059433 Ga0207706_100594333 437
1490 3300025934 Ga0207686_10006992 Ga0207686_100069924 437
1491 3300025934 Ga0207686_10010448 Ga0207686_100104482 437
1492 3300025934 Ga0207686_10150193 Ga0207686_101501931 437
1493 3300025935 Ga0207709_10000030 Ga0207709_10000030222 437
1494 3300025935 Ga0207709_10000127 Ga0207709_1000012714 437
1495 3300025935 Ga0207709_10006788 Ga0207709_100067885 437
1496 3300025935 Ga0207709_10010578 Ga0207709_100105784 437
1497 3300025935 Ga0207709_10017129 Ga0207709_100171292 437
1498 3300025935 Ga0207709_10038468 Ga0207709_100384684 437
1499 3300025936 Ga0207670_10016816 Ga0207670_100168161 437
1500 3300025936 Ga0207670_10019786 Ga0207670_100197862 437
1501 3300025936 Ga0207670_10033966 Ga0207670_100339662 437
1502 3300025936 Ga0207670_10044429 Ga0207670_100444292 437
1503 3300025936 Ga0207670_10045672 Ga0207670_100456723 437
1504 3300025936 Ga0207670_10056996 Ga0207670_100569962 437
1505 3300025937 Ga0207669_10003974 Ga0207669_100039743 437
1506 3300025937 Ga0207669_10006610 Ga0207669_100066105 437
1507 3300025938 Ga0207704_10189624 Ga0207704_101896242 437
1508 3300025939 Ga0207665_10000140 Ga0207665_1000014019 437
1509 3300025939 Ga0207665_10003302 Ga0207665_100033026 437
1510 3300025939 Ga0207665_10012711 Ga0207665_100127112 437
1511 3300025939 Ga0207665_10024962 Ga0207665_100249623 437
1512 3300025939 Ga0207665_10035011 Ga0207665_100350113 437
1513 3300025939 Ga0207665_10061302 Ga0207665_100613022 437
1514 3300025939 Ga0207665_10132772 Ga0207665_101327721 437
1515 3300025939 Ga0207665_10192861 Ga0207665_101928611 437
1516 3300025940 Ga0207691_10000134 Ga0207691_1000013447 437
1517 3300025941 Ga0207711_10023686 Ga0207711_100236863 437
1518 3300025941 Ga0207711_10044011 Ga0207711_100440112 437
1519 3300025941 Ga0207711_10077688 Ga0207711_100776883 437
1520 3300025942 Ga0207689_10021059 Ga0207689_100210592 437
1521 3300025942 Ga0207689_10070462 Ga0207689_100704623 437
1522 3300025942 Ga0207689_10072516 Ga0207689_100725162 437
1523 3300025942 Ga0207689_10103054 Ga0207689_101030543 437
1524 3300025945 Ga0207679_10000017 Ga0207679_10000017107 437
1525 3300025945 Ga0207679_10011798 Ga0207679_100117981 437
1526 3300025960 Ga0207651_10002173 Ga0207651_100021733 437
1527 3300025960 Ga0207651_10014874 Ga0207651_100148742 437
1528 3300025960 Ga0207651_10018076 Ga0207651_100180763 437
1529 3300025960 Ga0207651_10077769 Ga0207651_100777693 437
1530 3300025961 Ga0207712_10091843 Ga0207712_100918433 437
1531 3300025961 Ga0207712_10125224 Ga0207712_101252242 437
1532 3300025972 Ga0207668_10021030 Ga0207668_100210303 437
1533 3300025981 Ga0207640_10043338 Ga0207640_100433382 437
1534 3300025986 Ga0207658_10022478 Ga0207658_100224783 437
1535 3300025986 Ga0207658_10063388 Ga0207658_100633882 437
1536 3300025986 Ga0207658_10169709 Ga0207658_101697093 437
1537 3300025986 Ga0207658_10248311 Ga0207658_102483111 437
1538 3300026023 Ga0207677_10000010 Ga0207677_10000010167 437
1539 3300026023 Ga0207677_10006394 Ga0207677_100063945 437
1540 3300026023 Ga0207677_10009167 Ga0207677_100091672 437
1541 3300026023 Ga0207677_10060250 Ga0207677_100602502 437
1542 3300026035 Ga0207703_10000269 Ga0207703_1000026928 437
1543 3300026035 Ga0207703_10238652 Ga0207703_102386521 437
1544 3300026041 Ga0207639_10006403 Ga0207639_100064033 437
1545 3300026067 Ga0207678_10036919 Ga0207678_100369194 437
1546 3300026075 Ga0207708_10002865 Ga0207708_100028658 437
1547 3300026075 Ga0207708_10009116 Ga0207708_100091163 437
1548 3300026075 Ga0207708_10067740 Ga0207708_100677402 437
1549 3300026078 Ga0207702_10043777 Ga0207702_100437771 437
1550 3300026088 Ga0207641_10115657 Ga0207641_101156572 437
1551 3300026088 Ga0207641_10260963 Ga0207641_102609631 437
1552 3300026089 Ga0207648_10016021 Ga0207648_100160213 437
1553 3300026089 Ga0207648_10032863 Ga0207648_100328634 437
1554 3300026089 Ga0207648_10057593 Ga0207648_100575932 437
1555 3300026089 Ga0207648_10067490 Ga0207648_100674902 437
1556 3300026089 Ga0207648_10087247 Ga0207648_100872472 437
1557 3300026095 Ga0207676_10008805 Ga0207676_100088052 437
1558 3300026116 Ga0207674_10002250 Ga0207674_100022506 437
1559 3300026118 Ga0207675_100001407 Ga0207675_10000140716 437
1560 3300026118 Ga0207675_100005904 Ga0207675_1000059047 437
1561 3300026118 Ga0207675_100009658 Ga0207675_1000096589 437
1562 3300026118 Ga0207675_100012896 Ga0207675_1000128963 437
1563 3300026118 Ga0207675_100062485 Ga0207675_1000624854 437
1564 3300026118 Ga0207675_100165773 Ga0207675_1001657732 437
1565 3300026121 Ga0207683_10002972 Ga0207683_1000297210 437
1566 3300026121 Ga0207683_10014576 Ga0207683_100145762 437
1567 3300026121 Ga0207683_10053659 Ga0207683_100536592 437
1568 3300026121 Ga0207683_10056116 Ga0207683_100561161 437
1569 3300026121 Ga0207683_10067158 Ga0207683_100671582 437
1570 3300026121 Ga0207683_10080062 Ga0207683_100800623 437
1571 3300026121 Ga0207683_10239291 Ga0207683_102392911 437
1572 3300026142 Ga0207698_10136506 Ga0207698_101365062 437
1573 3300027111 Ga0209281_1000070 Ga0209281_1000070172 437
1574 3300027111 Ga0209281_1005510 Ga0209281_10055102 437
1575 3300027111 Ga0209281_1008970 Ga0209281_10089702 437
1576 3300027395 Ga0209996_1000755 Ga0209996_10007554 437
1577 3300027424 Ga0209984_1000679 Ga0209984_10006792 437
1578 3300027471 Ga0209995_1000473 Ga0209995_10004735 437
1579 3300027552 Ga0209982_1004664 Ga0209982_10046642 437
1580 3300027665 Ga0209983_1001801 Ga0209983_10018015 437
1581 3300027671 Ga0209588_1000014 Ga0209588_100001497 437
1582 3300027682 Ga0209971_1000661 Ga0209971_10006613 437
1583 3300027876 Ga0209974_10011922 Ga0209974_100119222 437
1584 3300027907 Ga0207428_10004245 Ga0207428_100042459 437
1585 3300027907 Ga0207428_10006542 Ga0207428_100065426 437
1586 3300027907 Ga0207428_10017900 Ga0207428_100179005 437
1587 3300027907 Ga0207428_10020519 Ga0207428_100205195 437
1588 3300027907 Ga0207428_10021061 Ga0207428_100210614 437
1589 3300027907 Ga0207428_10030787 Ga0207428_100307872 437
1590 3300027907 Ga0207428_10037783 Ga0207428_100377834 437
1591 3300027907 Ga0207428_10095668 Ga0207428_100956681 437
1592 3300027907 Ga0207428_10150176 Ga0207428_101501761 437
1593 3300028016 Ga0265354_1001582 Ga0265354_10015824 437
1594 3300028379 Ga0268266_10055749 Ga0268266_100557494 437
1595 3300028379 Ga0268266_10175103 Ga0268266_101751032 437
1596 3300028379 Ga0268266_10187158 Ga0268266_101871581 437
1597 3300028379 Ga0268266_10233738 Ga0268266_102337381 437
1598 3300028380 Ga0268265_10000318 Ga0268265_1000031811 437
1599 3300028380 Ga0268265_10024035 Ga0268265_100240354 437
1600 3300028380 Ga0268265_10035784 Ga0268265_100357843 437
1601 3300028380 Ga0268265_10122787 Ga0268265_101227872 437
1602 3300028381 Ga0268264_10044510 Ga0268264_100445102 437
1603 3300028381 Ga0268264_10159370 Ga0268264_101593701 437
1604 3300028556 Ga0265337_1009007 Ga0265337_10090073 437
1605 3300028558 Ga0265326_10000971 Ga0265326_100009719 437
1606 3300028558 Ga0265326_10002053 Ga0265326_100020532 437
1607 3300028563 Ga0265319_1004177 Ga0265319_10041772 437
1608 3300028563 Ga0265319_1012546 Ga0265319_10125462 437
1609 3300028573 Ga0265334_10003641 Ga0265334_100036413 437
1610 3300028577 Ga0265318_10000575 Ga0265318_100005759 437
1611 3300028577 Ga0265318_10009692 Ga0265318_100096922 437
1612 3300028653 Ga0265323_10000425 Ga0265323_1000042517 437
1613 3300028653 Ga0265323_10001023 Ga0265323_100010232 437
1614 3300028653 Ga0265323_10037598 Ga0265323_100375982 437
1615 3300028654 Ga0265322_10000028 Ga0265322_100000284 437
1616 3300028654 Ga0265322_10000391 Ga0265322_100003916 437
1617 3300028654 Ga0265322_10000555 Ga0265322_100005552 437
1618 3300028666 Ga0265336_10008113 Ga0265336_100081132 437
1619 3300028794 Ga0307515_10010058 Ga0307515_100100582 437
1620 3300028800 Ga0265338_10000517 Ga0265338_1000051719 437
1621 3300028800 Ga0265338_10001557 Ga0265338_1000155717 437
1622 3300028800 Ga0265338_10003121 Ga0265338_1000312121 437
1623 3300028800 Ga0265338_10009321 Ga0265338_1000932113 437
1624 3300028800 Ga0265338_10012144 Ga0265338_100121443 437
1625 3300028800 Ga0265338_10013341 Ga0265338_100133415 437
1626 3300028800 Ga0265338_10017026 Ga0265338_100170265 437
1627 3300028800 Ga0265338_10060625 Ga0265338_100606252 437
1628 3300028800 Ga0265338_10195697 Ga0265338_101956971 437
1629 3300029957 Ga0265324_10000405 Ga0265324_100004055 437
1630 3300029957 Ga0265324_10004925 Ga0265324_100049255 437
1631 3300030521 Ga0307511_10072128 Ga0307511_100721282 437
1632 3300030735 Ga0316178_1096781 Ga0316178_10967813 437
1633 3300031090 Ga0265760_10000424 Ga0265760_100004245 437
1634 3300031235 Ga0265330_10002028 Ga0265330_100020285 437
1635 3300031235 Ga0265330_10004778 Ga0265330_100047782 437
1636 3300031235 Ga0265330_10005377 Ga0265330_100053774 437
1637 3300031235 Ga0265330_10012975 Ga0265330_100129752 437
1638 3300031238 Ga0265332_10001515 Ga0265332_100015157 437
1639 3300031238 Ga0265332_10013361 Ga0265332_100133612 437
1640 3300031238 Ga0265332_10020571 Ga0265332_100205712 437
1641 3300031239 Ga0265328_10002877 Ga0265328_100028774 437
1642 3300031240 Ga0265320_10006958 Ga0265320_100069583 437
1643 3300031240 Ga0265320_10007370 Ga0265320_100073702 437
1644 3300031241 Ga0265325_10000285 Ga0265325_100002852 437
1645 3300031241 Ga0265325_10003374 Ga0265325_100033747 437
1646 3300031241 Ga0265325_10004570 Ga0265325_100045707 437
1647 3300031241 Ga0265325_10004660 Ga0265325_100046605 437
1648 3300031241 Ga0265325_10007190 Ga0265325_100071905 437
1649 3300031241 Ga0265325_10027145 Ga0265325_100271456 437
1650 3300031242 Ga0265329_10003627 Ga0265329_100036274 437
1651 3300031247 Ga0265340_10000051 Ga0265340_100000515 437
1652 3300031247 Ga0265340_10006001 Ga0265340_100060012 437
1653 3300031247 Ga0265340_10009806 Ga0265340_100098061 437
1654 3300031247 Ga0265340_10010639 Ga0265340_100106393 437
1655 3300031247 Ga0265340_10011128 Ga0265340_100111283 437
1656 3300031249 Ga0265339_10000154 Ga0265339_1000015413 437
1657 3300031249 Ga0265339_10030329 Ga0265339_100303292 437
1658 3300031249 Ga0265339_10031326 Ga0265339_100313262 437
1659 3300031249 Ga0265339_10050630 Ga0265339_100506301 437
1660 3300031250 Ga0265331_10006784 Ga0265331_100067844 437
1661 3300031250 Ga0265331_10013649 Ga0265331_100136493 437
1662 3300031251 Ga0265327_10002931 Ga0265327_100029318 437
1663 3300031251 Ga0265327_10003245 Ga0265327_100032457 437
1664 3300031251 Ga0265327_10009260 Ga0265327_100092603 437
1665 3300031251 Ga0265327_10019296 Ga0265327_100192961 437
1666 3300031344 Ga0265316_10001627 Ga0265316_100016274 437
1667 3300031344 Ga0265316_10005031 Ga0265316_100050319 437
1668 3300031344 Ga0265316_10005290 Ga0265316_1000529011 437
1669 3300031344 Ga0265316_10012651 Ga0265316_100126512 437
1670 3300031344 Ga0265316_10051037 Ga0265316_100510372 437
1671 3300031344 Ga0265316_10121393 Ga0265316_101213932 437
1672 3300031344 Ga0265316_10157657 Ga0265316_101576571 437
1673 3300031344 Ga0265316_10191706 Ga0265316_101917061 437
1674 3300031456 Ga0307513_10006370 Ga0307513_100063706 437
1675 3300031456 Ga0307513_10077780 Ga0307513_100777804 437
1676 3300031507 Ga0307509_10089224 Ga0307509_100892242 437
1677 3300031507 Ga0307509_10137139 Ga0307509_101371393 437
1678 3300031548 Ga0307408_100000178 Ga0307408_10000017833 437
1679 3300031548 Ga0307408_100017915 Ga0307408_1000179151 437
1680 3300031548 Ga0307408_100018543 Ga0307408_1000185432 437
1681 3300031548 Ga0307408_100077015 Ga0307408_1000770152 437
1682 3300031548 Ga0307408_100109746 Ga0307408_1001097461 437
1683 3300031595 Ga0265313_10007425 Ga0265313_100074254 437
1684 3300031595 Ga0265313_10008077 Ga0265313_100080772 437
1685 3300031665 Ga0316575_10000506 Ga0316575_100005064 437
1686 3300031665 Ga0316575_10005591 Ga0316575_100055912 437
1687 3300031691 Ga0316579_10004434 Ga0316579_100044342 437
1688 3300031691 Ga0316579_10005421 Ga0316579_100054214 437
1689 3300031691 Ga0316579_10008552 Ga0316579_100085521 437
1690 3300031691 Ga0316579_10011147 Ga0316579_100111473 437
1691 3300031691 Ga0316579_10037501 Ga0316579_100375012 437
1692 3300031691 Ga0316579_10054146 Ga0316579_100541462 437
1693 3300031711 Ga0265314_10000381 Ga0265314_100003819 437
1694 3300031711 Ga0265314_10003723 Ga0265314_100037236 437
1695 3300031711 Ga0265314_10008473 Ga0265314_100084734 437
1696 3300031711 Ga0265314_10051574 Ga0265314_100515742 437
1697 3300031712 Ga0265342_10001559 Ga0265342_100015592 437
1698 3300031712 Ga0265342_10003464 Ga0265342_100034647 437
1699 3300031712 Ga0265342_10020801 Ga0265342_100208012 437
1700 3300031712 Ga0265342_10033445 Ga0265342_100334452 437
1701 3300031712 Ga0265342_10077763 Ga0265342_100777631 437
1702 3300031727 Ga0316576_10000753 Ga0316576_100007536 437
1703 3300031727 Ga0316576_10004357 Ga0316576_100043576 437
1704 3300031727 Ga0316576_10005272 Ga0316576_100052723 437
1705 3300031727 Ga0316576_10013343 Ga0316576_100133432 437
1706 3300031727 Ga0316576_10015734 Ga0316576_100157342 437
1707 3300031727 Ga0316576_10016646 Ga0316576_100166463 437
1708 3300031727 Ga0316576_10025171 Ga0316576_100251712 437
1709 3300031727 Ga0316576_10026661 Ga0316576_100266612 437
1710 3300031727 Ga0316576_10033635 Ga0316576_100336354 437
1711 3300031727 Ga0316576_10034671 Ga0316576_100346712 437
1712 3300031727 Ga0316576_10070104 Ga0316576_100701042 437
1713 3300031727 Ga0316576_10076125 Ga0316576_100761252 437
1714 3300031727 Ga0316576_10110847 Ga0316576_101108472 437
1715 3300031727 Ga0316576_10137265 Ga0316576_101372651 437
1716 3300031727 Ga0316576_10143472 Ga0316576_101434722 437
1717 3300031727 Ga0316576_10223752 Ga0316576_102237521 437
1718 3300031728 Ga0316578_10000018 Ga0316578_1000001818 437
1719 3300031728 Ga0316578_10000388 Ga0316578_100003883 437
1720 3300031728 Ga0316578_10001002 Ga0316578_100010024 437
1721 3300031728 Ga0316578_10001316 Ga0316578_100013166 437
1722 3300031728 Ga0316578_10006072 Ga0316578_100060724 437
1723 3300031728 Ga0316578_10016385 Ga0316578_100163852 437
1724 3300031728 Ga0316578_10034918 Ga0316578_100349182 437
1725 3300031728 Ga0316578_10039540 Ga0316578_100395402 437
1726 3300031728 Ga0316578_10075721 Ga0316578_100757211 437
1727 3300031728 Ga0316578_10132270 Ga0316578_101322701 437
1728 3300031728 Ga0316578_10133079 Ga0316578_101330791 437
1729 3300031728 Ga0316578_10134419 Ga0316578_101344191 437
1730 3300031731 Ga0307405_10007374 Ga0307405_100073746 437
1731 3300031733 Ga0316577_10000594 Ga0316577_100005947 437
1732 3300031733 Ga0316577_10001322 Ga0316577_100013222 437
1733 3300031733 Ga0316577_10003794 Ga0316577_100037943 437
1734 3300031733 Ga0316577_10004155 Ga0316577_100041554 437
1735 3300031733 Ga0316577_10005455 Ga0316577_100054553 437
1736 3300031733 Ga0316577_10007638 Ga0316577_100076382 437
1737 3300031733 Ga0316577_10024994 Ga0316577_100249941 437
1738 3300031733 Ga0316577_10026820 Ga0316577_100268203 437
1739 3300031733 Ga0316577_10034825 Ga0316577_100348252 437
1740 3300031733 Ga0316577_10067929 Ga0316577_100679292 437
1741 3300031733 Ga0316577_10076942 Ga0316577_100769421 437
1742 3300031733 Ga0316577_10086345 Ga0316577_100863451 437
1743 3300031733 Ga0316577_10103052 Ga0316577_101030521 437
1744 3300031824 Ga0307413_10139457 Ga0307413_101394572 437
1745 3300031911 Ga0307412_10033731 Ga0307412_100337315 437
1746 3300031911 Ga0307412_10047110 Ga0307412_100471102 437
1747 3300031911 Ga0307412_10067954 Ga0307412_100679542 437
1748 3300031995 Ga0307409_100050670 Ga0307409_1000506702 437
1749 3300031995 Ga0307409_100093051 Ga0307409_1000930512 437
1750 3300032002 Ga0307416_100004592 Ga0307416_1000045927 437
1751 3300032002 Ga0307416_100015361 Ga0307416_1000153612 437
1752 3300032004 Ga0307414_10051308 Ga0307414_100513083 437
1753 3300032005 Ga0307411_10098410 Ga0307411_100984101 437
1754 3300032005 Ga0307411_10167076 Ga0307411_101670761 437
1755 3300032126 Ga0307415_100010246 Ga0307415_1000102463 437
1756 3300032126 Ga0307415_100146739 Ga0307415_1001467391 437
1757 3300032133 Ga0316583_10000190 Ga0316583_100001903 437
1758 3300032133 Ga0316583_10000700 Ga0316583_100007002 437
1759 3300032133 Ga0316583_10001533 Ga0316583_100015333 437
1760 3300032133 Ga0316583_10002466 Ga0316583_100024666 437
1761 3300032133 Ga0316583_10003925 Ga0316583_100039252 437
1762 3300032133 Ga0316583_10006815 Ga0316583_100068152 437
1763 3300032133 Ga0316583_10018032 Ga0316583_100180322 437
1764 3300032133 Ga0316583_10040740 Ga0316583_100407402 437
1765 3300032137 Ga0316585_10000558 Ga0316585_100005587 437
1766 3300032137 Ga0316585_10007713 Ga0316585_100077133 437
1767 3300032139 Ga0316580_10001423 Ga0316580_100014232 437
1768 3300032139 Ga0316580_10001520 Ga0316580_100015203 437
1769 3300032139 Ga0316580_10002031 Ga0316580_100020312 437
1770 3300032139 Ga0316580_10010770 Ga0316580_100107701 437
1771 3300032139 Ga0316580_10024878 Ga0316580_100248781 437
1772 3300032168 Ga0316593_10038181 Ga0316593_100381811 437
1773 3300033180 Ga0307510_10082397 Ga0307510_100823973 437
1774 3300035083 Ga0373926_0025920 Ga0373926_0025920_133_1470 437
1775 3300035086 Ga0373934_0000687 Ga0373934_0000687_7384_8751 437
1776 3300035086 Ga0373934_0000741 Ga0373934_0000741_5792_7192 437
1777 3300035090 Ga0373949_0000198 Ga0373949_0000198_16605_17978 437
1778 3300035091 Ga0373951_0002387 Ga0373951_0002387_442_1791 437
1779 3300035111 Ga0373923_0002316 Ga0373923_0002316_3692_5029 437
1780 3300035113 Ga0373936_0014976 Ga0373936_0014976_566_1903 437
1781 3300035116 Ga0373945_0002779 Ga0373945_0002779_1221_2582 437
1782 3300035117 Ga0373953_0005532 Ga0373953_0005532_2271_3638 437
1783 3300035119 Ga0373956_0000757 Ga0373956_0000757_4077_5477 437
1784 3300035119 Ga0373956_0002802 Ga0373956_0002802_4989_6356 437
1785 3300035121 Ga0373960_0011752 Ga0373960_0011752_29_1423 437
1786 3300035170 Ga0373943_0112437 Ga0373943_0112437_15_1409 437
1787 3300035171 Ga0373946_0028796 Ga0373946_0028796_336_1697 437
1788 3300035172 Ga0373955_0000226 Ga0373955_0000226_17460_18860 437
1789 3300035172 Ga0373955_0025135 Ga0373955_0025135_460_1827 437
1790 3300035241 Ga0373961_0000014 Ga0373961_0000014_92072_93433 437
1791 3300035398 Ga0316574_0001001 Ga0316574_0001001_7371_8726 437
1792 3300035398 Ga0316574_0001207 Ga0316574_0001207_7168_8517 437
1793 3300035398 Ga0316574_0003253 Ga0316574_0003253_1801_3162 437
1794 3300035398 Ga0316574_0008740 Ga0316574_0008740_2044_3420 437
1795 3300035398 Ga0316574_0011531 Ga0316574_0011531_2154_3503 437
1796 3300035398 Ga0316574_0012596 Ga0316574_0012596_1564_2919 437
1797 3300035398 Ga0316574_0023928 Ga0316574_0023928_1973_3334 437
1798 3300035398 Ga0316574_0027059 Ga0316574_0027059_1927_3288 437
1799 3300035398 Ga0316574_0031028 Ga0316574_0031028_1278_2627 437
1800 3300035398 Ga0316574_0038544 Ga0316574_0038544_814_2175 437
1801 3300035398 Ga0316574_0055698 Ga0316574_0055698_629_1966 437
1802 3300035398 Ga0316574_0058577 Ga0316574_0058577_858_2219 437
1803 3300035398 Ga0316574_0080414 Ga0316574_0080414_453_1814 437
1804 3300035398 Ga0316574_0109931 Ga0316574_0109931_32_1375 437
1805 3300035692 Ga0373935_0001300 Ga0373935_0001300_516_1952 437
1806 3300035692 Ga0373935_0010391 Ga0373935_0010391_2012_3349 437
1807 3300035692 Ga0373935_0022153 Ga0373935_0022153_1213_2550 437
1808 3300035695 Ga0373927_0001907 Ga0373927_0001907_407_1744 437
1809 3300035695 Ga0373927_0005146 Ga0373927_0005146_4252_5604 437
1810 3300035695 Ga0373927_0025912 Ga0373927_0025912_2015_3376 437
1811 3300035695 Ga0373927_0117175 Ga0373927_0117175_323_1684 437
1812 3300035695 Ga0373927_0161969 Ga0373927_0161969_36_1433 437
1813 3300035724 Ga0373933_0000772 Ga0373933_0000772_4897_6297 437
1814 3300035724 Ga0373933_0005458 Ga0373933_0005458_1361_2728 437
1815 3300035725 Ga0373947_0004919 Ga0373947_0004919_1700_3037 437
1816 3300035725 Ga0373947_0008485 Ga0373947_0008485_2098_3495 437
1817 3300035725 Ga0373947_0016063 Ga0373947_0016063_834_2195 437
1818 3300036401 Ga0373937_0000890 Ga0373937_0000890_21779_23146 437
1819 3300036401 Ga0373937_0157469 Ga0373937_0157469_185_1522 437
1820 3300036647 Ga0316582_0006253 Ga0316582_0006253_170_1519 437
1821 3300036647 Ga0316582_0006723 Ga0316582_0006723_1018_2379 437
1822 3300036647 Ga0316582_0007635 Ga0316582_0007635_2680_4041 437
1823 3300036647 Ga0316582_0008435 Ga0316582_0008435_3049_4410 437
1824 3300036647 Ga0316582_0019625 Ga0316582_0019625_2564_3913 437
1825 3300036647 Ga0316582_0019801 Ga0316582_0019801_1418_2779 437
1826 3300036647 Ga0316582_0022862 Ga0316582_0022862_393_1742 437
1827 3300036647 Ga0316582_0033416 Ga0316582_0033416_669_2015 437
1828 3300036647 Ga0316582_0039239 Ga0316582_0039239_139_1488 437
1829 3300036647 Ga0316582_0060821 Ga0316582_0060821_609_1958 437
1830 3300036647 Ga0316582_0087847 Ga0316582_0087847_24_1361 437
1831 3300036647 Ga0316582_0092088 Ga0316582_0092088_98_1462 437
1832 3300036647 Ga0316582_0109045 Ga0316582_0109045_94_1449 437
1833 3300036647 Ga0316582_0119707 Ga0316582_0119707_250_1599 437
1834 3300036647 Ga0316582_0173291 Ga0316582_0173291_69_1406 437
1835 3300036712 Ga0316584_0000613 Ga0316584_0000613_15034_16395 437
1836 3300036712 Ga0316584_0006454 Ga0316584_0006454_5135_6484 437
1837 3300036712 Ga0316584_0016955 Ga0316584_0016955_1023_2360 437
1838 3300036712 Ga0316584_0022924 Ga0316584_0022924_857_2206 437
1839 3300036712 Ga0316584_0027667 Ga0316584_0027667_1769_3124 437
1840 3300036712 Ga0316584_0032080 Ga0316584_0032080_1017_2360 437
1841 3300036712 Ga0316584_0082825 Ga0316584_0082825_391_1728 437
1842 3300036712 Ga0316584_0083921 Ga0316584_0083921_607_1944 437
1843 3300036712 Ga0316584_0088550 Ga0316584_0088550_377_1714 437
1844 3300036712 Ga0316584_0090352 Ga0316584_0090352_151_1500 437
1845 3300036712 Ga0316584_0092943 Ga0316584_0092943_752_2101 437
1846 3300036712 Ga0316584_0111885 Ga0316584_0111885_287_1636 437
1847 3300036712 Ga0316584_0138321 Ga0316584_0138321_310_1671 437
1848 3300036712 Ga0316584_0169047 Ga0316584_0169047_161_1549 437
1849 3300036712 Ga0316584_0171414 Ga0316584_0171414_219_1580 437
1850 3300036712 Ga0316584_0210360 Ga0316584_0210360_36_1373 437
1851 3300036712 Ga0316584_0214376 Ga0316584_0214376_35_1396 437
1852 3300037068 Ga0373925_0051326 Ga0373925_0051326_628_1989 437
1853 3300037068 Ga0373925_0088118 Ga0373925_0088118_396_1757 437
1854 3300037312 Ga0395899_0005950 Ga0395899_0005950_7191_8552 437
1855 3300037312 Ga0395899_0019992 Ga0395899_0019992_1709_3070 437
1856 3300037418 Ga0395900_0002207 Ga0395900_0002207_9291_10652 437
1857 3300037418 Ga0395900_0070096 Ga0395900_0070096_2092_3453 437
1858 3300037418 Ga0395900_0080554 Ga0395900_0080554_1382_2743 437
1859 3300037466 Ga0395898_0001975 Ga0395898_0001975_20199_21560 437
1860 3300037471 Ga0395905_0004379 Ga0395905_0004379_1307_2668 437
1861 3300037471 Ga0395905_0036458 Ga0395905_0036458_1756_3117 437
1862 3300037471 Ga0395905_0089928 Ga0395905_0089928_595_1995 437
1863 3300037588 Ga0316581_0011615 Ga0316581_0011615_1103_2452 437
1864 3300037853 Ga0436364_0855899 Ga0436364_0855899_16095_17489 437
1865 3300038443 Ga0395901_0004888 Ga0395901_0004888_7093_8454 437
1866 3300038443 Ga0395901_0008049 Ga0395901_0008049_4316_5677 437
1867 3300038443 Ga0395901_0125849 Ga0395901_0125849_137_1498 437
1868 3300038443 Ga0395901_0172788 Ga0395901_0172788_196_1557 437
1869 3300038705 Ga0237819_03446 Ga0237819_03446_513_1850 437
1870 3300038725 Ga0400484_03648 Ga0400484_03648_3289_4638 437
1871 3300038725 Ga0400484_33081 Ga0400484_33081_827_2176 437
1872 3300038725 Ga0400484_38520 Ga0400484_38520_9956_11305 437
1873 3300038726 Ga0400490_03872 Ga0400490_03872_21830_23188 437
1874 3300038726 Ga0400490_20164 Ga0400490_20164_3959_5308 437
1875 3300038726 Ga0400490_26103 Ga0400490_26103_1520_2866 437
1876 3300038726 Ga0400490_31755 Ga0400490_31755_3154_4503 437
1877 3300038726 Ga0400490_47884 Ga0400490_47884_2938_4287 437
1878 3300038726 Ga0400490_49878 Ga0400490_49878_39_1388 437
1879 3300038726 Ga0400490_50905 Ga0400490_50905_50728_52077 437
1880 3300038727 Ga0400491_01864 Ga0400491_01864_2961_4310 437
1881 3300038727 Ga0400491_17037 Ga0400491_17037_454_1803 437
1882 3300038727 Ga0400491_24444 Ga0400491_24444_281_1618 437
1883 3300038735 Ga0400485_02682 Ga0400485_02682_32209_33558 437
1884 3300038735 Ga0400485_09566 Ga0400485_09566_7694_9043 437
1885 3300038735 Ga0400485_12529 Ga0400485_12529_38775_40124 437
1886 3300038735 Ga0400485_14551 Ga0400485_14551_7002_8351 437
1887 3300038735 Ga0400485_17143 Ga0400485_17143_6277_7626 437
1888 3300038741 Ga0400488_22426 Ga0400488_22426_9729_11078 437
1889 3300038741 Ga0400488_47901 Ga0400488_47901_1142_2491 437
1890 3300038741 Ga0400488_62343 Ga0400488_62343_468_1817 437
1891 3300038742 Ga0400486_06036 Ga0400486_06036_3350_4699 437
1892 3300038742 Ga0400486_08234 Ga0400486_08234_976_2325 437
1893 3300038742 Ga0400486_16402 Ga0400486_16402_11691_13040 437
1894 3300038742 Ga0400486_16511 Ga0400486_16511_5451_6800 437
1895 3300038742 Ga0400486_18734 Ga0400486_18734_37830_39179 437
1896 3300038742 Ga0400486_20299 Ga0400486_20299_11920_13269 437
1897 3300039062 Ga0400483_015191 Ga0400483_015191_4494_5843 437
1898 3300039062 Ga0400483_068767 Ga0400483_068767_34418_35767 437
1899 3300039062 Ga0400483_110321 Ga0400483_110321_7591_8940 437
1900 3300039062 Ga0400483_134788 Ga0400483_134788_71_1417 437
1901 3300039062 Ga0400483_143368 Ga0400483_143368_2616_3965 437
1902 3300039062 Ga0400483_173481 Ga0400483_173481_7962_9299 437
1903 3300039062 Ga0400483_218987 Ga0400483_218987_357_1706 437
1904 3300039062 Ga0400483_280457 Ga0400483_280457_431_1780 437
1905 3300039062 Ga0400483_291297 Ga0400483_291297_2870_4243 437
1906 3300039093 Ga0400489_18992 Ga0400489_18992_6495_7844 437
1907 3300039093 Ga0400489_21683 Ga0400489_21683_10094_11443 437
1908 3300039093 Ga0400489_25826 Ga0400489_25826_4050_5396 437
1909 3300039093 Ga0400489_29768 Ga0400489_29768_39790_41157 437
1910 3300039093 Ga0400489_35047 Ga0400489_35047_26975_28324 437
1911 3300039093 Ga0400489_45196 Ga0400489_45196_1741_3090 437
1912 3300039093 Ga0400489_52808 Ga0400489_52808_10858_12207 437
1913 3300039093 Ga0400489_68266 Ga0400489_68266_772_2109 437
1914 3300039093 Ga0400489_73307 Ga0400489_73307_11170_12519 437
1915 3300039093 Ga0400489_84719 Ga0400489_84719_902_2239 437
1916 3300039110 Ga0400487_10399 Ga0400487_10399_799_2148 437
1917 3300039110 Ga0400487_56498 Ga0400487_56498_11134_12483 437
1918 3300039437 Ga0436365_1337717 Ga0436365_1337717_636_2009 437
1919 3300041405 Ga0439438_006180 Ga0439438_006180_525_1862 437
1920 3300041407 Ga0439447_003000 Ga0439447_003000_559_1896 437
1921 3300041407 Ga0439447_003632 Ga0439447_003632_3613_4950 437
1922 3300041407 Ga0439447_005707 Ga0439447_005707_576_1913 437
1923 3300041407 Ga0439447_011486 Ga0439447_011486_139_1476 437
1924 3300041411 Ga0439466_0000784 Ga0439466_0000784_10252_11589 437
1925 3300041411 Ga0439466_0007042 Ga0439466_0007042_517_1854 437
1926 3300041411 Ga0439466_0014154 Ga0439466_0014154_1373_2710 437
1927 3300041411 Ga0439466_0024629 Ga0439466_0024629_428_1765 437
1928 3300041413 Ga0439465_0000001 Ga0439465_0000001_242_1600 437
1929 3300042006 Ga0439432_003746 Ga0439432_003746_463_1800 437
1930 3300042006 Ga0439432_022239 Ga0439432_022239_549_1886 437
1931 3300042010 Ga0439452_002710 Ga0439452_002710_3930_5267 437
1932 3300042010 Ga0439452_003663 Ga0439452_003663_562_1899 437
1933 3300042010 Ga0439452_003877 Ga0439452_003877_580_1917 437
1934 3300042010 Ga0439452_004760 Ga0439452_004760_2564_3901 437
1935 3300042010 Ga0439452_007031 Ga0439452_007031_1567_2904 437
1936 3300042013 Ga0439456_000475 Ga0439456_000475_320_1657 437
1937 3300042013 Ga0439456_003873 Ga0439456_003873_1178_2515 437
1938 3300042016 Ga0439463_003270 Ga0439463_003270_2225_3562 437
1939 3300042115 Ga0450911_001274 Ga0450911_001274_4059_5396 437
1940 3300042122 Ga0450920_002487 Ga0450920_002487_755_2092 437
1941 3300042137 Ga0450902_000703 Ga0450902_000703_491_1828 437
1942 3300042138 Ga0450903_002126 Ga0450903_002126_420_1757 437
1943 3300042146 Ga0450907_001138 Ga0450907_001138_558_1895 437
1944 3300042146 Ga0450907_007951 Ga0450907_007951_274_1611 437
1945 3300042147 Ga0450910_001712 Ga0450910_001712_704_2041 437
1946 3300042156 Ga0439446_0005663 Ga0439446_0005663_334_1671 437
1947 3300042435 Ga0439434_0002560 Ga0439434_0002560_3669_5006 437
1948 3300042436 Ga0439435_0006362 Ga0439435_0006362_1048_2445 437
1949 3300042439 Ga0439464_0000037 Ga0439464_0000037_14954_16291 437
1950 3300042461 Ga0439460_0005120 Ga0439460_0005120_499_1836 437
1951 3300042876 Ga0451577_0001566 Ga0451577_0001566_19030_20379 437
1952 3300042876 Ga0451577_0002979 Ga0451577_0002979_11894_13243 437
1953 3300042876 Ga0451577_0006392 Ga0451577_0006392_1406_2815 437
1954 3300042876 Ga0451577_0008077 Ga0451577_0008077_8773_10110 437
1955 3300042876 Ga0451577_0008256 Ga0451577_0008256_5521_6858 437
1956 3300042876 Ga0451577_0014190 Ga0451577_0014190_2839_4176 437
1957 3300042876 Ga0451577_0028842 Ga0451577_0028842_1066_2475 437
1958 3300042876 Ga0451577_0029119 Ga0451577_0029119_745_2079 437
1959 3300042876 Ga0451577_0033460 Ga0451577_0033460_1047_2384 437
1960 3300042876 Ga0451577_0036504 Ga0451577_0036504_1448_2809 437
1961 3300042876 Ga0451577_0043362 Ga0451577_0043362_1861_3252 437
1962 3300042876 Ga0451577_0043383 Ga0451577_0043383_895_2238 437
1963 3300042876 Ga0451577_0070533 Ga0451577_0070533_82_1434 437
1964 3300042876 Ga0451577_0073372 Ga0451577_0073372_1308_2645 437
1965 3300042876 Ga0451577_0089277 Ga0451577_0089277_804_2204 437
1966 3300042876 Ga0451577_0099459 Ga0451577_0099459_908_2275 437
1967 3300042876 Ga0451577_0159040 Ga0451577_0159040_219_1553 437
1968 3300042876 Ga0451577_0203484 Ga0451577_0203484_144_1580 437
1969 3300042993 Ga0439440_0003630 Ga0439440_0003630_542_1879 437
1970 3300042993 Ga0439440_0007062 Ga0439440_0007062_233_1594 437
1971 3300044673 Ga0453683_0001314 Ga0453683_0001314_14718_16055 437
1972 3300044673 Ga0453683_0003785 Ga0453683_0003785_1101_2453 437
1973 3300044673 Ga0453683_0014411 Ga0453683_0014411_529_1866 437
1974 3300044673 Ga0453683_0024988 Ga0453683_0024988_2292_3629 437
1975 3300044673 Ga0453683_0030066 Ga0453683_0030066_1339_2676 437
1976 3300044673 Ga0453683_0031936 Ga0453683_0031936_391_1728 437
1977 3300044673 Ga0453683_0060920 Ga0453683_0060920_869_2311 437
1978 3300044712 Ga0453684_0000143 Ga0453684_0000143_209900_211237 437
1979 3300044712 Ga0453684_0000662 Ga0453684_0000662_48893_50242 437
1980 3300044712 Ga0453684_0001189 Ga0453684_0001189_24538_25881 437
1981 3300044712 Ga0453684_0001522 Ga0453684_0001522_54131_55531 437
1982 3300044712 Ga0453684_0003476 Ga0453684_0003476_33618_34955 437
1983 3300044712 Ga0453684_0004507 Ga0453684_0004507_18667_20049 437
1984 3300044712 Ga0453684_0004932 Ga0453684_0004932_9695_11029 437
1985 3300044712 Ga0453684_0007194 Ga0453684_0007194_5357_6691 437
1986 3300044712 Ga0453684_0008024 Ga0453684_0008024_6886_8223 437
1987 3300044712 Ga0453684_0011638 Ga0453684_0011638_7947_9284 437
1988 3300044712 Ga0453684_0012386 Ga0453684_0012386_2986_4335 437
1989 3300044712 Ga0453684_0014214 Ga0453684_0014214_7873_9210 437
1990 3300044712 Ga0453684_0018043 Ga0453684_0018043_6023_7360 437
1991 3300044712 Ga0453684_0020890 Ga0453684_0020890_5844_7193 437
1992 3300044712 Ga0453684_0029463 Ga0453684_0029463_4792_6135 437
1993 3300044712 Ga0453684_0029789 Ga0453684_0029789_3769_5136 437
1994 3300044712 Ga0453684_0029976 Ga0453684_0029976_1604_2941 437
1995 3300044712 Ga0453684_0044999 Ga0453684_0044999_2128_3465 437
1996 3300044712 Ga0453684_0053415 Ga0453684_0053415_2604_4013 437
1997 3300044712 Ga0453684_0057256 Ga0453684_0057256_1263_2615 437
1998 3300044712 Ga0453684_0067901 Ga0453684_0067901_1479_2816 437
1999 3300044712 Ga0453684_0074325 Ga0453684_0074325_2162_3496 437
2000 3300044712 Ga0453684_0091920 Ga0453684_0091920_803_2140 437
2001 3300044712 Ga0453684_0114846 Ga0453684_0114846_932_2332 437
2002 3300044712 Ga0453684_0132760 Ga0453684_0132760_481_1839 437
2003 3300044712 Ga0453684_0150975 Ga0453684_0150975_82_1524 437
2004 3300044712 Ga0453684_0157143 Ga0453684_0157143_183_1520 437
2005 3300044712 Ga0453684_0175112 Ga0453684_0175112_694_2031 437
2006 3300044712 Ga0453684_0207395 Ga0453684_0207395_38_1420 437
2007 3300044712 Ga0453684_0213178 Ga0453684_0213178_778_2118 437
2008 3300044712 Ga0453684_0289658 Ga0453684_0289658_223_1566 437
2009 3300044712 Ga0453684_0304556 Ga0453684_0304556_253_1593 437
2010 3300044712 Ga0453684_0351888 Ga0453684_0351888_309_1646 437
2011 3300045051 Ga0451576_0003401 Ga0451576_0003401_5880_7217 437
2012 3300045051 Ga0451576_0010696 Ga0451576_0010696_5394_6731 437
2013 3300045051 Ga0451576_0011533 Ga0451576_0011533_7235_8644 437
2014 3300045051 Ga0451576_0014979 Ga0451576_0014979_6104_7441 437
2015 3300045051 Ga0451576_0018888 Ga0451576_0018888_1648_3090 437
2016 3300045051 Ga0451576_0023935 Ga0451576_0023935_1397_2749 437
2017 3300045051 Ga0451576_0034343 Ga0451576_0034343_270_1637 437
2018 3300045051 Ga0451576_0036078 Ga0451576_0036078_2400_3767 437
2019 3300045051 Ga0451576_0041929 Ga0451576_0041929_3367_4761 437
2020 3300045051 Ga0451576_0052583 Ga0451576_0052583_2593_3993 437
2021 3300045051 Ga0451576_0052961 Ga0451576_0052961_2456_3868 437
2022 3300045051 Ga0451576_0066910 Ga0451576_0066910_981_2318 437
2023 3300045051 Ga0451576_0082397 Ga0451576_0082397_127_1524 437
2024 3300045051 Ga0451576_0083978 Ga0451576_0083978_961_2403 437
2025 3300045051 Ga0451576_0092807 Ga0451576_0092807_1570_2907 437
2026 3300045051 Ga0451576_0132490 Ga0451576_0132490_1250_2587 437
2027 3300045051 Ga0451576_0244077 Ga0451576_0244077_63_1430 437
2028 3300045976 Ga0466967_0015704 Ga0466967_0015704_848_2245 437
2029 3300046452 Ga0495617_004008 Ga0495617_004008_531_1868 437
2030 3300046452 Ga0495617_005953 Ga0495617_005953_508_1845 437
2031 3300046452 Ga0495617_006874 Ga0495617_006874_450_1856 437
2032 3300046453 Ga0495627_004378 Ga0495627_004378_3968_5362 437
2033 3300046453 Ga0495627_006122 Ga0495627_006122_2902_4308 437
2034 3300046453 Ga0495627_018961 Ga0495627_018961_538_1875 437
2035 3300046454 Ga0495592_0064374 Ga0495592_0064374_124_1494 437
2036 3300046455 Ga0495603_0005075 Ga0495603_0005075_5228_6589 437
2037 3300046455 Ga0495603_0028510 Ga0495603_0028510_1222_2583 437
2038 3300046455 Ga0495603_0039995 Ga0495603_0039995_924_2261 437
2039 3300046455 Ga0495603_0044712 Ga0495603_0044712_552_1889 437
2040 3300046457 Ga0495590_0027541 Ga0495590_0027541_515_1852 437
2041 3300046457 Ga0495590_0038853 Ga0495590_0038853_29_1366 437
2042 3300046458 Ga0495591_001456 Ga0495591_001456_12750_14087 437
2043 3300046458 Ga0495591_004279 Ga0495591_004279_5139_6476 437
2044 3300046458 Ga0495591_004387 Ga0495591_004387_3478_4872 437
2045 3300046458 Ga0495591_005738 Ga0495591_005738_3809_5146 437
2046 3300046458 Ga0495591_006124 Ga0495591_006124_3443_4780 437
2047 3300046458 Ga0495591_010220 Ga0495591_010220_498_1835 437
2048 3300046458 Ga0495591_011055 Ga0495591_011055_1616_2953 437
2049 3300046458 Ga0495591_013285 Ga0495591_013285_495_1832 437
2050 3300046459 Ga0495629_0004663 Ga0495629_0004663_8138_9499 437
2051 3300046459 Ga0495629_0006556 Ga0495629_0006556_6141_7502 437
2052 3300046460 Ga0495638_0006392 Ga0495638_0006392_4203_5540 437
2053 3300046460 Ga0495638_0012535 Ga0495638_0012535_3928_5265 437
2054 3300046460 Ga0495638_0014166 Ga0495638_0014166_3803_5140 437
2055 3300046460 Ga0495638_0015816 Ga0495638_0015816_3465_4802 437
2056 3300046460 Ga0495638_0017804 Ga0495638_0017804_2828_4165 437
2057 3300046460 Ga0495638_0046420 Ga0495638_0046420_1253_2590 437
2058 3300046460 Ga0495638_0052079 Ga0495638_0052079_598_2010 437
2059 3300046460 Ga0495638_0086592 Ga0495638_0086592_70_1464 437
2060 3300046461 Ga0495641_0014063 Ga0495641_0014063_2758_4119 437
2061 3300046462 Ga0495651_0026464 Ga0495651_0026464_2141_3646 437
2062 3300046471 Ga0495650_0007633 Ga0495650_0007633_4614_5951 437
2063 3300046471 Ga0495650_0008301 Ga0495650_0008301_499_1929 437
2064 3300046471 Ga0495650_0022496 Ga0495650_0022496_276_1613 437
2065 3300046471 Ga0495650_0024421 Ga0495650_0024421_489_1826 437
2066 3300046472 Ga0495580_0000830 Ga0495580_0000830_17802_19202 437
2067 3300046472 Ga0495580_0001031 Ga0495580_0001031_8219_9616 437
2068 3300046472 Ga0495580_0003619 Ga0495580_0003619_1795_3156 437
2069 3300046472 Ga0495580_0005406 Ga0495580_0005406_607_2007 437
2070 3300046472 Ga0495580_0070641 Ga0495580_0070641_31_1392 437
2071 3300046473 Ga0495582_0000300 Ga0495582_0000300_6476_7837 437
2072 3300046473 Ga0495582_0003289 Ga0495582_0003289_7304_8701 437
2073 3300046473 Ga0495582_0004324 Ga0495582_0004324_5946_7355 437
2074 3300046474 Ga0495605_0009840 Ga0495605_0009840_3560_4897 437
2075 3300046474 Ga0495605_0020139 Ga0495605_0020139_393_1730 437
2076 3300046474 Ga0495605_0040674 Ga0495605_0040674_113_1450 437
2077 3300046475 Ga0495639_0038073 Ga0495639_0038073_627_1964 437
2078 3300046476 Ga0495662_0010418 Ga0495662_0010418_2587_3948 437
2079 3300046491 Ga0495584_0010170 Ga0495584_0010170_3381_4718 437
2080 3300046491 Ga0495584_0012240 Ga0495584_0012240_2653_3990 437
2081 3300046491 Ga0495584_0015199 Ga0495584_0015199_1472_2833 437
2082 3300046491 Ga0495584_0026064 Ga0495584_0026064_1074_2411 437
2083 3300046491 Ga0495584_0048307 Ga0495584_0048307_424_1761 437
2084 3300046491 Ga0495584_0054098 Ga0495584_0054098_189_1526 437
2085 3300046492 Ga0495585_0009805 Ga0495585_0009805_3858_5195 437
2086 3300046492 Ga0495585_0011502 Ga0495585_0011502_596_1933 437
2087 3300046492 Ga0495585_0018945 Ga0495585_0018945_484_1821 437
2088 3300046492 Ga0495585_0055350 Ga0495585_0055350_426_1787 437
2089 3300046492 Ga0495585_0092072 Ga0495585_0092072_100_1461 437
2090 3300046499 Ga0495594_0042200 Ga0495594_0042200_1060_2469 437
2091 3300046499 Ga0495594_0084470 Ga0495594_0084470_193_1593 437
2092 3300046500 Ga0495596_0000189 Ga0495596_0000189_3808_5145 437
2093 3300046500 Ga0495596_0014927 Ga0495596_0014927_337_1731 437
2094 3300046501 Ga0495607_0013741 Ga0495607_0013741_3465_4802 437
2095 3300046501 Ga0495607_0013932 Ga0495607_0013932_3258_4652 437
2096 3300046501 Ga0495607_0014107 Ga0495607_0014107_3433_4863 437
2097 3300046501 Ga0495607_0014234 Ga0495607_0014234_547_1884 437
2098 3300046501 Ga0495607_0044852 Ga0495607_0044852_750_2087 437
2099 3300046501 Ga0495607_0044918 Ga0495607_0044918_948_2285 437
2100 3300046501 Ga0495607_0061555 Ga0495607_0061555_488_1849 437
2101 3300046506 Ga0495583_0014711 Ga0495583_0014711_535_1872 437
2102 3300046506 Ga0495583_0015910 Ga0495583_0015910_516_1853 437
2103 3300046506 Ga0495583_0025972 Ga0495583_0025972_565_1902 437
2104 3300046507 Ga0495606_0015488 Ga0495606_0015488_535_1872 437
2105 3300046507 Ga0495606_0019262 Ga0495606_0019262_715_2109 437
2106 3300046507 Ga0495606_0020260 Ga0495606_0020260_605_1942 437
2107 3300046507 Ga0495606_0024485 Ga0495606_0024485_1625_3037 437
2108 3300046507 Ga0495606_0027345 Ga0495606_0027345_2172_3509 437
2109 3300046507 Ga0495606_0027439 Ga0495606_0027439_2259_3596 437
2110 3300046507 Ga0495606_0082900 Ga0495606_0082900_86_1480 437
2111 3300046511 Ga0495608_0016743 Ga0495608_0016743_3027_4427 437
2112 3300046512 Ga0495610_0010946 Ga0495610_0010946_570_1964 437
2113 3300046512 Ga0495610_0011169 Ga0495610_0011169_3684_5021 437
2114 3300046512 Ga0495610_0012817 Ga0495610_0012817_430_1767 437
2115 3300046512 Ga0495610_0020240 Ga0495610_0020240_1920_3257 437
2116 3300046512 Ga0495610_0020280 Ga0495610_0020280_2010_3347 437
2117 3300046512 Ga0495610_0033496 Ga0495610_0033496_222_1559 437
2118 3300046512 Ga0495610_0039843 Ga0495610_0039843_507_1844 437
2119 3300046512 Ga0495610_0049983 Ga0495610_0049983_200_1537 437
2120 3300046513 Ga0495616_0010570 Ga0495616_0010570_3417_4847 437
2121 3300046513 Ga0495616_0013655 Ga0495616_0013655_2903_4309 437
2122 3300046513 Ga0495616_0024816 Ga0495616_0024816_1583_2920 437
2123 3300046513 Ga0495616_0024968 Ga0495616_0024968_156_1493 437
2124 3300046513 Ga0495616_0025984 Ga0495616_0025984_1256_2650 437
2125 3300046513 Ga0495616_0034999 Ga0495616_0034999_548_1885 437
2126 3300046515 Ga0495620_0003286 Ga0495620_0003286_2981_4318 437
2127 3300046515 Ga0495620_0007645 Ga0495620_0007645_543_1880 437
2128 3300046515 Ga0495620_0010587 Ga0495620_0010587_37_1440 437
2129 3300046515 Ga0495620_0013554 Ga0495620_0013554_407_1744 437
2130 3300046515 Ga0495620_0014551 Ga0495620_0014551_500_1837 437
2131 3300046515 Ga0495620_0027450 Ga0495620_0027450_1262_2599 437
2132 3300046517 Ga0495630_0001682 Ga0495630_0001682_2513_3874 437
2133 3300046517 Ga0495630_0019865 Ga0495630_0019865_229_1566 437
2134 3300046517 Ga0495630_0080862 Ga0495630_0080862_902_2239 437
2135 3300046518 Ga0495631_0007856 Ga0495631_0007856_3481_4818 437
2136 3300046519 Ga0495632_0009698 Ga0495632_0009698_3906_5243 437
2137 3300046519 Ga0495632_0011458 Ga0495632_0011458_512_1849 437
2138 3300046519 Ga0495632_0011514 Ga0495632_0011514_566_1960 437
2139 3300046519 Ga0495632_0070091 Ga0495632_0070091_42_1379 437
2140 3300046520 Ga0495637_0006263 Ga0495637_0006263_4024_5418 437
2141 3300046520 Ga0495637_0006861 Ga0495637_0006861_3808_5145 437
2142 3300046520 Ga0495637_0008460 Ga0495637_0008460_450_1856 437
2143 3300046520 Ga0495637_0011940 Ga0495637_0011940_2275_3612 437
2144 3300046520 Ga0495637_0015289 Ga0495637_0015289_375_1712 437
2145 3300046520 Ga0495637_0018625 Ga0495637_0018625_548_1885 437
2146 3300046520 Ga0495637_0037963 Ga0495637_0037963_583_1920 437
2147 3300046522 Ga0495643_0046740 Ga0495643_0046740_546_1883 437
2148 3300046523 Ga0495644_0009846 Ga0495644_0009846_1824_3230 437
2149 3300046523 Ga0495644_0010573 Ga0495644_0010573_573_1910 437
2150 3300046524 Ga0495648_0003311 Ga0495648_0003311_302_1639 437
2151 3300046524 Ga0495648_0003771 Ga0495648_0003771_576_1913 437
2152 3300046524 Ga0495648_0014963 Ga0495648_0014963_515_1852 437
2153 3300046524 Ga0495648_0015207 Ga0495648_0015207_3689_5026 437
2154 3300046524 Ga0495648_0018204 Ga0495648_0018204_3060_4397 437
2155 3300046524 Ga0495648_0040970 Ga0495648_0040970_1145_2482 437
2156 3300046526 Ga0495666_0003807 Ga0495666_0003807_2840_4177 437
2157 3300046526 Ga0495666_0007527 Ga0495666_0007527_1585_2946 437
2158 3300046526 Ga0495666_0026280 Ga0495666_0026280_229_1590 437
2159 3300046528 Ga0495642_0003988 Ga0495642_0003988_528_1865 437
2160 3300046528 Ga0495642_0004409 Ga0495642_0004409_3569_4906 437
2161 3300046530 Ga0495654_0004201 Ga0495654_0004201_3036_4373 437
2162 3300046530 Ga0495654_0009595 Ga0495654_0009595_419_1756 437
2163 3300046530 Ga0495654_0009815 Ga0495654_0009815_3363_4700 437
2164 3300046530 Ga0495654_0010507 Ga0495654_0010507_3011_4348 437
2165 3300046530 Ga0495654_0013668 Ga0495654_0013668_2436_3773 437
2166 3300046530 Ga0495654_0017308 Ga0495654_0017308_1914_3251 437
2167 3300046530 Ga0495654_0018828 Ga0495654_0018828_1876_3213 437
2168 3300046530 Ga0495654_0019548 Ga0495654_0019548_1851_3188 437
2169 3300046530 Ga0495654_0027732 Ga0495654_0027732_504_1841 437
2170 3300046530 Ga0495654_0028995 Ga0495654_0028995_885_2222 437
2171 3300046530 Ga0495654_0030987 Ga0495654_0030987_273_1610 437
2172 3300046530 Ga0495654_0032368 Ga0495654_0032368_541_1878 437
2173 3300046530 Ga0495654_0032711 Ga0495654_0032711_541_1878 437
2174 3300046531 Ga0495665_0009575 Ga0495665_0009575_966_2327 437
2175 3300046535 Ga0495586_0065830 Ga0495586_0065830_167_1528 437
2176 3300046535 Ga0495586_0115384 Ga0495586_0115384_53_1432 437
2177 3300046536 Ga0495587_0000724 Ga0495587_0000724_18687_20087 437
2178 3300046536 Ga0495587_0033172 Ga0495587_0033172_1612_2979 437
2179 3300046538 Ga0495609_0005656 Ga0495609_0005656_1882_3276 437
2180 3300046538 Ga0495609_0006985 Ga0495609_0006985_477_1814 437
2181 3300046538 Ga0495609_0021605 Ga0495609_0021605_1547_2941 437
2182 3300046542 Ga0495597_0009227 Ga0495597_0009227_602_1939 437
2183 3300046542 Ga0495597_0009986 Ga0495597_0009986_495_1832 437
2184 3300046542 Ga0495597_0012580 Ga0495597_0012580_561_1898 437
2185 3300046542 Ga0495597_0016830 Ga0495597_0016830_501_1838 437
2186 3300046542 Ga0495597_0032995 Ga0495597_0032995_670_2076 437
2187 3300046542 Ga0495597_0041344 Ga0495597_0041344_106_1443 437
2188 3300046543 Ga0495645_0043733 Ga0495645_0043733_23_1528 437
2189 3300046543 Ga0495645_0140182 Ga0495645_0140182_201_1598 437
2190 3300046557 Ga0495622_0006735 Ga0495622_0006735_733_2070 437
2191 3300046557 Ga0495622_0007671 Ga0495622_0007671_3441_4778 437
2192 3300046558 Ga0495633_0010283 Ga0495633_0010283_521_1858 437
2193 3300046559 Ga0495667_0013486 Ga0495667_0013486_1801_3162 437
2194 3300046615 Ga0495656_0019046 Ga0495656_0019046_98_1459 437
2195 3300046615 Ga0495656_0036721 Ga0495656_0036721_551_1888 437
2196 3300046616 Ga0495668_0017652 Ga0495668_0017652_239_1576 437
2197 3300046642 Ga0495634_0017439 Ga0495634_0017439_916_2277 437
2198 3300046642 Ga0495634_0034069 Ga0495634_0034069_42_1412 437
2199 3300046648 Ga0495611_0005437 Ga0495611_0005437_570_1964 437
2200 3300046660 Ga0495625_0014420 Ga0495625_0014420_4403_5740 437
2201 3300046660 Ga0495625_0024527 Ga0495625_0024527_2708_4045 437
2202 3300046663 Ga0495635_0003892 Ga0495635_0003892_2746_4107 437
2203 3300046663 Ga0495635_0076796 Ga0495635_0076796_559_1959 437
2204 3300046664 Ga0495659_0000082 Ga0495659_0000082_11059_12468 437
2205 3300046664 Ga0495659_0001726 Ga0495659_0001726_1237_2598 437
2206 3300046664 Ga0495659_0015357 Ga0495659_0015357_639_1976 437
2207 3300046665 Ga0495661_0002392 Ga0495661_0002392_541_1878 437
2208 3300046665 Ga0495661_0011545 Ga0495661_0011545_545_1882 437
2209 3300046665 Ga0495661_0021816 Ga0495661_0021816_2333_3670 437
2210 3300046665 Ga0495661_0107267 Ga0495661_0107267_27_1388 437
2211 3300046679 Ga0495623_0035250 Ga0495623_0035250_234_1571 437
2212 3300046679 Ga0495623_0044633 Ga0495623_0044633_91_1491 437
2213 3300046681 Ga0495647_0009939 Ga0495647_0009939_1209_2627 437
2214 3300046683 Ga0495658_0000299 Ga0495658_0000299_10694_12055 437
2215 3300046683 Ga0495658_0001247 Ga0495658_0001247_3714_5123 437
2216 3300046684 Ga0495669_0009461 Ga0495669_0009461_2105_3508 437
2217 3300046684 Ga0495669_0013927 Ga0495669_0013927_1066_2427 437
2218 3300046684 Ga0495669_0029949 Ga0495669_0029949_569_1906 437
2219 3300046689 Ga0495613_0002159 Ga0495613_0002159_2827_4188 437
2220 3300046689 Ga0495613_0023475 Ga0495613_0023475_23_1414 437
2221 3300046689 Ga0495613_0032446 Ga0495613_0032446_50_1411 437
2222 3300046689 Ga0495613_0157621 Ga0495613_0157621_233_1594 437
2223 3300046690 Ga0495624_0012163 Ga0495624_0012163_497_1936 437
2224 3300046690 Ga0495624_0051867 Ga0495624_0051867_121_1458 437
2225 3300046690 Ga0495624_0112761 Ga0495624_0112761_263_1660 437
2226 3300046691 Ga0495670_0007380 Ga0495670_0007380_565_1959 437
2227 3300046691 Ga0495670_0008272 Ga0495670_0008272_238_1575 437
2228 3300046691 Ga0495670_0012800 Ga0495670_0012800_2265_3602 437
2229 3300046691 Ga0495670_0054752 Ga0495670_0054752_156_1562 437
2230 3300046692 Ga0495671_0011821 Ga0495671_0011821_3189_4526 437
2231 3300046692 Ga0495671_0013997 Ga0495671_0013997_67_1473 437
2232 3300046692 Ga0495671_0033202 Ga0495671_0033202_754_2091 437
2233 3300046692 Ga0495671_0039266 Ga0495671_0039266_654_2048 437
2234 3300046694 Ga0495649_0008493 Ga0495649_0008493_538_1875 437
2235 3300046694 Ga0495649_0015174 Ga0495649_0015174_2474_3811 437
2236 3300046694 Ga0495649_0017485 Ga0495649_0017485_515_1852 437
2237 3300046694 Ga0495649_0023160 Ga0495649_0023160_2020_3357 437
2238 3300046694 Ga0495649_0029626 Ga0495649_0029626_1122_2459 437
2239 3300046694 Ga0495649_0038945 Ga0495649_0038945_1206_2543 437
2240 3300046794 Ga0495589_0006890 Ga0495589_0006890_542_1936 437
2241 3300046794 Ga0495589_0010897 Ga0495589_0010897_571_1908 437
2242 3300046810 Ga0495660_0006210 Ga0495660_0006210_5297_6634 437
2243 3300046810 Ga0495660_0011059 Ga0495660_0011059_492_1886 437
2244 3300046810 Ga0495660_0020075 Ga0495660_0020075_2272_3609 437
2245 3300046810 Ga0495660_0027645 Ga0495660_0027645_536_1873 437
2246 3300046810 Ga0495660_0047263 Ga0495660_0047263_461_1798 437
2247 3300047315 Ga0495581_0003329 Ga0495581_0003329_1177_2538 437
2248 3300047317 Ga0495604_0001001 Ga0495604_0001001_8975_10375 437
2249 3300047319 Ga0495674_0005858 Ga0495674_0005858_9685_11022 437
2250 3300047319 Ga0495674_0015082 Ga0495674_0015082_1819_3156 437
2251 3300047319 Ga0495674_0046877 Ga0495674_0046877_1630_3135 437
2252 3300047319 Ga0495674_0046911 Ga0495674_0046911_2395_3756 437
2253 3300047319 Ga0495674_0070431 Ga0495674_0070431_698_2059 437
2254 3300047320 Ga0495672_0015582 Ga0495672_0015582_470_1807 437
2255 3300047320 Ga0495672_0021526 Ga0495672_0021526_2306_3643 437
2256 3300047320 Ga0495672_0022548 Ga0495672_0022548_2212_3549 437
2257 3300047320 Ga0495672_0024245 Ga0495672_0024245_2078_3415 437
2258 3300047320 Ga0495672_0024662 Ga0495672_0024662_2509_3846 437
2259 3300047320 Ga0495672_0024897 Ga0495672_0024897_24_1361 437
2260 3300047320 Ga0495672_0034358 Ga0495672_0034358_566_1903 437
2261 3300047320 Ga0495672_0041329 Ga0495672_0041329_942_2348 437
2262 3300047320 Ga0495672_0068591 Ga0495672_0068591_425_1762 437
2263 3300047321 Ga0495676_0027015 Ga0495676_0027015_212_1573 437
2264 3300047321 Ga0495676_0043153 Ga0495676_0043153_1736_3130 437
2265 3300047321 Ga0495676_0075211 Ga0495676_0075211_870_2231 437
2266 3300047322 Ga0495680_0012958 Ga0495680_0012958_2608_3969 437
2267 3300047322 Ga0495680_0028168 Ga0495680_0028168_2747_4084 437
2268 3300047322 Ga0495680_0050624 Ga0495680_0050624_637_1983 437
2269 3300047322 Ga0495680_0137510 Ga0495680_0137510_171_1538 437
2270 3300047323 Ga0495683_0017310 Ga0495683_0017310_1888_3294 437
2271 3300047323 Ga0495683_0030474 Ga0495683_0030474_460_1797 437
2272 3300047323 Ga0495683_0052295 Ga0495683_0052295_579_1916 437
2273 3300047443 Ga0495687_009508 Ga0495687_009508_552_1889 437
2274 3300047443 Ga0495687_009631 Ga0495687_009631_425_1762 437
2275 3300047444 Ga0495675_0030782 Ga0495675_0030782_1329_2834 437
2276 3300047445 Ga0495677_0021241 Ga0495677_0021241_461_1798 437
2277 3300047446 Ga0495679_005362 Ga0495679_005362_477_1814 437
2278 3300047446 Ga0495679_030774 Ga0495679_030774_310_1647 437
2279 3300047469 Ga0495673_0009235 Ga0495673_0009235_3655_4992 437
2280 3300047469 Ga0495673_0009240 Ga0495673_0009240_3513_4907 437
2281 3300047469 Ga0495673_0009939 Ga0495673_0009939_575_1912 437
2282 3300047469 Ga0495673_0010243 Ga0495673_0010243_431_1837 437
2283 3300047469 Ga0495673_0010973 Ga0495673_0010973_3057_4394 437
2284 3300047469 Ga0495673_0017918 Ga0495673_0017918_2006_3343 437
2285 3300047469 Ga0495673_0018453 Ga0495673_0018453_538_1875 437
2286 3300047469 Ga0495673_0037046 Ga0495673_0037046_293_1630 437
2287 3300047470 Ga0495681_0003395 Ga0495681_0003395_6294_7700 437
2288 3300047470 Ga0495681_0005954 Ga0495681_0005954_2837_4174 437
2289 3300047470 Ga0495681_0009718 Ga0495681_0009718_520_1857 437
2290 3300047470 Ga0495681_0010523 Ga0495681_0010523_452_1789 437
2291 3300047470 Ga0495681_0010998 Ga0495681_0010998_3552_4889 437
2292 3300047470 Ga0495681_0012145 Ga0495681_0012145_3338_4675 437
2293 3300047470 Ga0495681_0013501 Ga0495681_0013501_566_1960 437
2294 3300047470 Ga0495681_0013679 Ga0495681_0013679_562_1899 437
2295 3300047470 Ga0495681_0018169 Ga0495681_0018169_2061_3398 437
2296 3300047470 Ga0495681_0018998 Ga0495681_0018998_520_1857 437
2297 3300047470 Ga0495681_0020977 Ga0495681_0020977_558_1895 437
2298 3300047470 Ga0495681_0025844 Ga0495681_0025844_1149_2579 437
2299 3300047471 Ga0495684_0017361 Ga0495684_0017361_3404_4909 437
2300 3300047471 Ga0495684_0161494 Ga0495684_0161494_235_1572 437
2301 3300047472 Ga0495686_0016545 Ga0495686_0016545_615_1952 437
2302 3300047472 Ga0495686_0018995 Ga0495686_0018995_2783_4120 437
2303 3300047673 Ga0495593_0005574 Ga0495593_0005574_2077_3414 437
2304 3300047673 Ga0495593_0008906 Ga0495593_0008906_1439_2800 437
2305 3300047673 Ga0495593_0061352 Ga0495593_0061352_591_1937 437
2306 3300048088 Ga0495602_0018454 Ga0495602_0018454_5339_6739 437
2307 3300048088 Ga0495602_0024479 Ga0495602_0024479_3933_5327 437
2308 3300048088 Ga0495602_0047607 Ga0495602_0047607_2299_3636 437
2309 3300048089 Ga0495614_0005873 Ga0495614_0005873_1331_2692 437
2310 3300048091 Ga0495626_0001279 Ga0495626_0001279_6350_7687 437
2311 3300048091 Ga0495626_0007774 Ga0495626_0007774_545_1882 437
2312 3300048091 Ga0495626_0007837 Ga0495626_0007837_595_1932 437
2313 3300048091 Ga0495626_0007975 Ga0495626_0007975_562_1899 437
2314 3300048091 Ga0495626_0025223 Ga0495626_0025223_1331_2668 437
2315 3300048903 Ga0496100_0020495 Ga0496100_0020495_1412_2803 437
2316 3300048904 Ga0496101_0029344 Ga0496101_0029344_1254_2591 437
2317 3300048904 Ga0496101_0069223 Ga0496101_0069223_632_1993 437
2318 3300048905 Ga0496102_0017528 Ga0496102_0017528_1506_2867 437
2319 3300048905 Ga0496102_0023148 Ga0496102_0023148_2111_3448 437
2320 3300048905 Ga0496102_0028405 Ga0496102_0028405_2843_4204 437
2321 3300048905 Ga0496102_0083735 Ga0496102_0083735_65_1423 437
2322 3300048906 Ga0496103_0025431 Ga0496103_0025431_1759_3150 437
2323 3300048906 Ga0496103_0030251 Ga0496103_0030251_1147_2508 437
2324 3300048906 Ga0496103_0156066 Ga0496103_0156066_49_1389 437
2325 3300048907 Ga0496104_0030612 Ga0496104_0030612_1871_3232 437
2326 3300048907 Ga0496104_0049314 Ga0496104_0049314_1838_3199 437
2327 3300048907 Ga0496104_0077858 Ga0496104_0077858_1457_2794 437
2328 3300048909 Ga0496106_0003524 Ga0496106_0003524_6578_7915 437
2329 3300048909 Ga0496106_0019949 Ga0496106_0019949_1172_2533 437
2330 3300048909 Ga0496106_0024654 Ga0496106_0024654_1264_2655 437
2331 3300048909 Ga0496106_0039521 Ga0496106_0039521_786_2147 437
2332 3300048910 Ga0496107_0001542 Ga0496107_0001542_4086_5423 437
2333 3300048910 Ga0496107_0002329 Ga0496107_0002329_2817_4178 437
2334 3300048910 Ga0496107_0049763 Ga0496107_0049763_506_1867 437
2335 3300048911 Ga0496108_0042068 Ga0496108_0042068_1161_2522 437
2336 3300048911 Ga0496108_0044548 Ga0496108_0044548_1457_2818 437
2337 3300048912 Ga0496109_0109184 Ga0496109_0109184_224_1585 437
2338 3300048912 Ga0496109_0244626 Ga0496109_0244626_300_1661 437
2339 3300048913 Ga0496110_0014135 Ga0496110_0014135_4910_6301 437
2340 3300048913 Ga0496110_0023376 Ga0496110_0023376_3432_4793 437
2341 3300048913 Ga0496110_0026357 Ga0496110_0026357_133_1494 437
2342 3300048913 Ga0496110_0070048 Ga0496110_0070048_387_1724 437
2343 3300048913 Ga0496110_0232403 Ga0496110_0232403_14_1375 437
2344 3300048914 Ga0496111_0010757 Ga0496111_0010757_757_2118 437
2345 3300048914 Ga0496111_0024059 Ga0496111_0024059_2806_4197 437
2346 3300048914 Ga0496111_0218646 Ga0496111_0218646_31_1368 437
2347 3300048915 Ga0496112_0159814 Ga0496112_0159814_397_1758 437
2348 3300048915 Ga0496112_0199197 Ga0496112_0199197_51_1388 437
2349 3300048916 Ga0496113_0018647 Ga0496113_0018647_2105_3466 437
2350 3300048916 Ga0496113_0023346 Ga0496113_0023346_476_1834 437
2351 3300048916 Ga0496113_0052537 Ga0496113_0052537_492_1853 437
2352 3300048916 Ga0496113_0063545 Ga0496113_0063545_255_1616 437
2353 3300048916 Ga0496113_0066451 Ga0496113_0066451_750_2141 437
2354 3300048917 Ga0496114_0000009 Ga0496114_0000009_125233_126816 437
2355 3300048917 Ga0496114_0079460 Ga0496114_0079460_976_2337 437
2356 3300048918 Ga0496115_0000563 Ga0496115_0000563_23164_24501 437
2357 3300048918 Ga0496115_0000589 Ga0496115_0000589_13575_14936 437
2358 3300048918 Ga0496115_0015282 Ga0496115_0015282_341_1678 437
2359 3300048918 Ga0496115_0071595 Ga0496115_0071595_516_1853 437
2360 3300048918 Ga0496115_0202228 Ga0496115_0202228_24_1361 437
2361 3300048919 Ga0496116_0000051 Ga0496116_0000051_274029_275387 437
2362 3300048919 Ga0496116_0003506 Ga0496116_0003506_12826_14163 437
2363 3300048919 Ga0496116_0016278 Ga0496116_0016278_3899_5236 437
2364 3300048920 Ga0496117_0000007 Ga0496117_0000007_448873_450231 437
2365 3300048920 Ga0496117_0002904 Ga0496117_0002904_6417_7754 437
2366 3300048920 Ga0496117_0004669 Ga0496117_0004669_725_2062 437
2367 3300048920 Ga0496117_0014842 Ga0496117_0014842_399_1736 437
2368 3300048920 Ga0496117_0028413 Ga0496117_0028413_455_1792 437
2369 3300048921 Ga0496118_0000140 Ga0496118_0000140_125690_127048 437
2370 3300048921 Ga0496118_0022406 Ga0496118_0022406_518_1855 437
2371 3300048921 Ga0496118_0085899 Ga0496118_0085899_548_1885 437
2372 3300048922 Ga0496119_0000007 Ga0496119_0000007_448940_450298 437
2373 3300048924 Ga0496121_0006282 Ga0496121_0006282_12817_14154 437
2374 3300048924 Ga0496121_0021741 Ga0496121_0021741_4535_5872 437
2375 3300048924 Ga0496121_0060172 Ga0496121_0060172_525_1862 437
2376 3300048924 Ga0496121_0074555 Ga0496121_0074555_930_2267 437
2377 3300048925 Ga0496122_0000237 Ga0496122_0000237_106526_107884 437
2378 3300048925 Ga0496122_0019412 Ga0496122_0019412_4320_5657 437
2379 3300048925 Ga0496122_0070124 Ga0496122_0070124_447_1784 437
2380 3300048926 Ga0496123_0000790 Ga0496123_0000790_51_1409 437
2381 3300048926 Ga0496123_0016608 Ga0496123_0016608_4069_5406 437
2382 3300048926 Ga0496123_0058495 Ga0496123_0058495_440_1777 437
2383 3300048926 Ga0496123_0060014 Ga0496123_0060014_668_2005 437
2384 3300048927 Ga0496124_0004407 Ga0496124_0004407_5840_7198 437
2385 3300048927 Ga0496124_0005203 Ga0496124_0005203_12680_14017 437
2386 3300048927 Ga0496124_0022157 Ga0496124_0022157_571_1908 437
2387 3300048927 Ga0496124_0077974 Ga0496124_0077974_823_2160 437
2388 3300048927 Ga0496124_0083586 Ga0496124_0083586_297_1634 437
2389 3300048927 Ga0496124_0145000 Ga0496124_0145000_494_1831 437
2390 3300048928 Ga0496125_0004744 Ga0496125_0004744_14063_15421 437
2391 3300048928 Ga0496125_0017357 Ga0496125_0017357_4940_6277 437
2392 3300048928 Ga0496125_0021748 Ga0496125_0021748_4189_5526 437
2393 3300048928 Ga0496125_0029031 Ga0496125_0029031_3095_4432 437
2394 3300048928 Ga0496125_0088607 Ga0496125_0088607_578_1915 437
2395 3300048929 Ga0496126_0002437 Ga0496126_0002437_888_2246 437
2396 3300049459 Ga0495678_008428 Ga0495678_008428_3271_4608 437
2397 3300049459 Ga0495678_013561 Ga0495678_013561_1921_3258 437
2398 3300049459 Ga0495678_020866 Ga0495678_020866_560_1954 437
2399 3300049459 Ga0495678_022516 Ga0495678_022516_1077_2414 437
2400 3300049460 Ga0495682_0000174 Ga0495682_0000174_9997_11334 437
2401 3300049460 Ga0495682_0009057 Ga0495682_0009057_496_1833 437
2402 3300049460 Ga0495682_0016005 Ga0495682_0016005_1334_2671 437
2403 3300049568 Ga0501031_0112069 Ga0501031_0112069_354_1715 437
2404 3300049568 Ga0501031_0154283 Ga0501031_0154283_60_1421 437
2405 3300049569 Ga0501032_0003475 Ga0501032_0003475_4137_5498 437
2406 3300049569 Ga0501032_0011737 Ga0501032_0011737_3257_4624 437
2407 3300049570 Ga0501033_0038813 Ga0501033_0038813_118_1479 437
2408 3300049571 Ga0501034_0001019 Ga0501034_0001019_2365_3750 437
2409 3300049571 Ga0501034_0163817 Ga0501034_0163817_370_1713 437
2410 3300049571 Ga0501034_0209669 Ga0501034_0209669_184_1539 437
2411 3300049572 Ga0501036_0019941 Ga0501036_0019941_1310_2677 437
2412 3300049573 Ga0501037_0026946 Ga0501037_0026946_2568_3929 437
2413 3300049574 Ga0501038_0013910 Ga0501038_0013910_4563_5924 437
2414 3300049574 Ga0501038_0138724 Ga0501038_0138724_137_1504 437
2415 3300049575 Ga0501039_0014159 Ga0501039_0014159_71_1432 437
2416 3300049575 Ga0501039_0043620 Ga0501039_0043620_1403_2809 437
2417 3300049575 Ga0501039_0175473 Ga0501039_0175473_64_1470 437
2418 3300049576 Ga0501040_0003730 Ga0501040_0003730_3329_4690 437
2419 3300049576 Ga0501040_0068964 Ga0501040_0068964_465_1871 437
2420 3300049577 Ga0501041_0013008 Ga0501041_0013008_3414_4775 437
2421 3300049577 Ga0501041_0126008 Ga0501041_0126008_108_1577 437
2422 3300049578 Ga0501042_0007788 Ga0501042_0007788_809_2170 437
2423 3300049578 Ga0501042_0031755 Ga0501042_0031755_355_1716 437
2424 3300049579 Ga0501043_0015548 Ga0501043_0015548_346_1707 437
2425 3300049580 Ga0501046_0044594 Ga0501046_0044594_355_1716 437
2426 3300049580 Ga0501046_0176577 Ga0501046_0176577_202_1575 437
2427 3300049581 Ga0501047_0000047 Ga0501047_0000047_30957_32312 437
2428 3300049582 Ga0501048_0016477 Ga0501048_0016477_3054_4415 437
2429 3300049582 Ga0501048_0031426 Ga0501048_0031426_1286_2647 437
2430 3300049582 Ga0501048_0032987 Ga0501048_0032987_592_1998 437
2431 3300049583 Ga0501067_0017430 Ga0501067_0017430_1609_2970 437
2432 3300049584 Ga0501068_0005998 Ga0501068_0005998_4403_5764 437
2433 3300049584 Ga0501068_0015768 Ga0501068_0015768_1333_2694 437
2434 3300049585 Ga0501069_0080689 Ga0501069_0080689_41_1402 437
2435 3300049586 Ga0501070_0016000 Ga0501070_0016000_4881_6242 437
2436 3300049587 Ga0501071_0002077 Ga0501071_0002077_4498_5859 437
2437 3300049588 Ga0501072_0064796 Ga0501072_0064796_244_1605 437
2438 3300049588 Ga0501072_0069734 Ga0501072_0069734_469_1830 437
2439 3300049590 Ga0501074_0189071 Ga0501074_0189071_94_1455 437
2440 3300049591 Ga0501075_0000261 Ga0501075_0000261_27225_28586 437
2441 3300049591 Ga0501075_0004727 Ga0501075_0004727_1034_2395 437
2442 3300049591 Ga0501075_0013701 Ga0501075_0013701_1517_2878 437
2443 3300049591 Ga0501075_0018650 Ga0501075_0018650_2409_3815 437
2444 3300049592 Ga0501076_0072219 Ga0501076_0072219_156_1517 437
2445 3300049593 Ga0501077_0002214 Ga0501077_0002214_3715_5076 437
2446 3300049593 Ga0501077_0005964 Ga0501077_0005964_1805_3166 437
2447 3300049674 Ga0501242_000458 Ga0501242_000458_560_1918 437
2448 3300049705 Ga0501225_0002034 Ga0501225_0002034_1425_2783 437
2449 3300049741 Ga0501079_0027813 Ga0501079_0027813_2800_4161 437
2450 3300049741 Ga0501079_0072467 Ga0501079_0072467_71_1432 437
2451 3300049741 Ga0501079_0103836 Ga0501079_0103836_613_1974 437
2452 3300049741 Ga0501079_0117663 Ga0501079_0117663_480_1886 437
2453 3300049742 Ga0501080_0010735 Ga0501080_0010735_5855_7216 437
2454 3300049742 Ga0501080_0018399 Ga0501080_0018399_906_2267 437
2455 3300049743 Ga0501081_0004957 Ga0501081_0004957_1035_2396 437
2456 3300049743 Ga0501081_0040821 Ga0501081_0040821_45_1406 437
2457 3300049758 Ga0501241_002000 Ga0501241_002000_605_1942 437
2458 3300049766 Ga0501269_000002 Ga0501269_000002_14912_16270 437
2459 3300049823 Ga0501044_0012073 Ga0501044_0012073_213_1598 437
2460 3300049824 Ga0501045_0034838 Ga0501045_0034838_473_1834 437
2461 3300049824 Ga0501045_0076025 Ga0501045_0076025_929_2335 437
2462 3300049824 Ga0501045_0099230 Ga0501045_0099230_275_1636 437
2463 3300050491 nmdc:mga00v17_53670_c1 nmdc:mga00v17_53670_c1_520_1857 437
2464 3300050507 nmdc:mga05p37_105663_c1 nmdc:mga05p37_105663_c1_106_1443 437
2465 3300050507 nmdc:mga05p37_13094_c1 nmdc:mga05p37_13094_c1_6012_7445 437
2466 3300050507 nmdc:mga05p37_163367_c1 nmdc:mga05p37_163367_c1_845_2206 437
2467 3300050507 nmdc:mga05p37_29036_c2 nmdc:mga05p37_29036_c2_691_2085 437
2468 3300050507 nmdc:mga05p37_330_c1 nmdc:mga05p37_330_c1_25101_26441 437
2469 3300050507 nmdc:mga05p37_343480_c1 nmdc:mga05p37_343480_c1_77_1414 437
2470 3300050507 nmdc:mga05p37_50528_c1 nmdc:mga05p37_50528_c1_3147_4508 437
2471 3300050507 nmdc:mga05p37_65821_c1 nmdc:mga05p37_65821_c1_1924_3285 437
2472 3300050507 nmdc:mga05p37_68193_c1 nmdc:mga05p37_68193_c1_307_1668 437
2473 3300050507 nmdc:mga05p37_71694_c1 nmdc:mga05p37_71694_c1_216_1577 437
2474 3300050508 nmdc:mga09592_144047_c1 nmdc:mga09592_144047_c1_139_1506 437
2475 3300050508 nmdc:mga09592_236270_c1 nmdc:mga09592_236270_c1_39_1379 437
2476 3300050508 nmdc:mga09592_3709_c1 nmdc:mga09592_3709_c1_1612_2973 437
2477 3300050509 nmdc:mga0qj67_174233_c1 nmdc:mga0qj67_174233_c1_226_1587 437
2478 3300050509 nmdc:mga0qj67_178283_c1 nmdc:mga0qj67_178283_c1_31_1371 437
2479 3300050509 nmdc:mga0qj67_210207_c1 nmdc:mga0qj67_210207_c1_36_1397 437
2480 3300050509 nmdc:mga0qj67_21372_c1 nmdc:mga0qj67_21372_c1_586_1947 437
2481 3300050510 nmdc:mga06r32_169822_c1 nmdc:mga06r32_169822_c1_509_1870 437
2482 3300050510 nmdc:mga06r32_27670_c1 nmdc:mga06r32_27670_c1_3804_5165 437
2483 3300050510 nmdc:mga06r32_297242_c1 nmdc:mga06r32_297242_c1_224_1561 437
2484 3300050510 nmdc:mga06r32_32416_c1 nmdc:mga06r32_32416_c1_910_2271 437
2485 3300050511 nmdc:mga08y16_120853_c1 nmdc:mga08y16_120853_c1_727_2094 437
2486 3300050511 nmdc:mga08y16_16966_c1 nmdc:mga08y16_16966_c1_5855_7201 437
2487 3300050511 nmdc:mga08y16_221477_c1 nmdc:mga08y16_221477_c1_454_1815 437
2488 3300050511 nmdc:mga08y16_2422_c1 nmdc:mga08y16_2422_c1_12099_13478 437
2489 3300050511 nmdc:mga08y16_341015_c1 nmdc:mga08y16_341015_c1_54_1436 437
2490 3300050511 nmdc:mga08y16_354501_c1 nmdc:mga08y16_354501_c1_64_1473 437
2491 3300050511 nmdc:mga08y16_9087_c1 nmdc:mga08y16_9087_c1_2015_3370 437
2492 3300050512 nmdc:mga0n895_118814_c1 nmdc:mga0n895_118814_c1_343_1752 437
2493 3300050512 nmdc:mga0n895_1992_c1 nmdc:mga0n895_1992_c1_7478_8884 437
2494 3300050512 nmdc:mga0n895_245_c1 nmdc:mga0n895_245_c1_10357_11757 437
2495 3300050512 nmdc:mga0n895_85408_c1 nmdc:mga0n895_85408_c1_593_1954 437
2496 3300050512 nmdc:mga0n895_86088_c1 nmdc:mga0n895_86088_c1_515_1876 437
2497 3300050513 nmdc:mga0rr50_123089_c1 nmdc:mga0rr50_123089_c1_27_1364 437
2498 3300050513 nmdc:mga0rr50_131928_c1 nmdc:mga0rr50_131928_c1_332_1693 437
2499 3300050513 nmdc:mga0rr50_153510_c1 nmdc:mga0rr50_153510_c1_37_1437 437
2500 3300050513 nmdc:mga0rr50_3942_c1 nmdc:mga0rr50_3942_c1_4209_5570 437
2501 3300050513 nmdc:mga0rr50_75335_c1 nmdc:mga0rr50_75335_c1_1096_2433 437
2502 3300050514 nmdc:mga08x19_19782_c1 nmdc:mga08x19_19782_c1_182_1549 437
2503 3300050514 nmdc:mga08x19_30553_c1 nmdc:mga08x19_30553_c1_10_1392 437
2504 3300050514 nmdc:mga08x19_96135_c1 nmdc:mga08x19_96135_c1_298_1635 437
2505 3300050515 nmdc:mga0a205_20587_c1 nmdc:mga0a205_20587_c1_701_2110 437
2506 3300050515 nmdc:mga0a205_233616_c1 nmdc:mga0a205_233616_c1_85_1446 437
2507 3300050515 nmdc:mga0a205_321_c1 nmdc:mga0a205_321_c1_26237_27637 437
2508 3300050515 nmdc:mga0a205_6744_c1 nmdc:mga0a205_6744_c1_5955_7379 437
2509 3300050515 nmdc:mga0a205_7958_c1 nmdc:mga0a205_7958_c1_3567_4928 437
2510 3300050515 nmdc:mga0a205_8110_c1 nmdc:mga0a205_8110_c1_1321_2727 437
2511 3300050515 nmdc:mga0a205_8280_c1 nmdc:mga0a205_8280_c1_396_1757 437
2512 3300053083 Ga0495655_0013096 Ga0495655_0013096_261_1622 437
2513 3300053085 Ga0495619_0007786 Ga0495619_0007786_3639_5000 437
2514 3300054114 Ga0501084_0006998 Ga0501084_0006998_6145_7506 437
2515 3300060353 Ga0501082_0004682 Ga0501082_0004682_6169_7530 437
2516 3300060353 Ga0501082_0043387 Ga0501082_0043387_1046_2452 437
2517 3300060353 Ga0501082_0070194 Ga0501082_0070194_500_1906 437
2518 3300061734 Ga0530510_0006988 Ga0530510_0006988_4233_5594 437
2519 iso_pu_bacteria 2511231000 2511233647 437
2520 iso_pu_bacteria 2511231006 2511265000 437
2521 iso_pu_bacteria 2511231008 2511276337 437
2522 iso_pu_bacteria 2511231010 2511287761 437
2523 iso_pu_bacteria 2511231011 2511295291 437
2524 iso_pu_bacteria 2511231012 2511299616 437
2525 iso_pu_bacteria 2511231014 2511315849 437
2526 iso_pu_bacteria 2511231015 2511323229 437
2527 iso_pu_bacteria 2511231017 2511335015 437
2528 iso_pu_bacteria 2511231018 2511338309 437
2529 iso_pu_bacteria 2511231019 2511343096 437
2530 iso_pu_bacteria 2511231020 2511351663 437
2531 iso_pu_bacteria 2511231021 2511356023 437
2532 iso_pu_bacteria 2511231023 2511367318 437
2533 iso_pu_bacteria 2511231031 2511411458 437
2534 iso_pu_bacteria 2512047018 2512324668 437
2535 iso_pu_bacteria 2513020052 2513234026 437
2536 iso_pu_bacteria 2554235132 2554817561 437
2537 iso_pu_bacteria 2554235341 2555672260 437
2538 iso_pu_bacteria 2582580891 2583794773 437
2539 iso_pu_bacteria 2582581278 2585141201 437
2540 iso_pu_bacteria 2582581873 2585426165 437
2541 iso_pu_bacteria 2585428182 2588211164 437
2542 iso_pu_bacteria 2585428183 2588215547 437
2543 iso_pu_bacteria 2585428184 2588218969 437
2544 iso_pu_bacteria 2585428185 2588224461 437
2545 iso_pu_bacteria 2597489887 2597860339 437
2546 iso_pu_bacteria 2597489888 2597866072 437
2547 iso_pu_bacteria 2597489889 2597871906 437
2548 iso_pu_bacteria 2599185160 2599358304 437
2549 iso_pu_bacteria 2599185161 2599364653 437
2550 iso_pu_bacteria 2599185162 2599370811 437
2551 iso_pu_bacteria 2599185163 2599376833 437
2552 iso_pu_bacteria 2599185164 2599383469 437
2553 iso_pu_bacteria 2599185165 2599389916 437
2554 iso_pu_bacteria 2599185166 2599396199 437
2555 iso_pu_bacteria 2599185167 2599401459 437
2556 iso_pu_bacteria 2599185168 2599408039 437
2557 iso_pu_bacteria 2599185179 2599453146 437
2558 iso_pu_bacteria 2599185181 2599465119 437
2559 iso_pu_bacteria 2599185182 2599471428 437
2560 iso_pu_bacteria 2599185185 2599486819 437
2561 iso_pu_bacteria 2599185186 2599493966 437
2562 iso_pu_bacteria 2599185189 2599509900 437
2563 iso_pu_bacteria 2599185190 2599515149 437
2564 iso_pu_bacteria 2599185191 2599520315 437
2565 iso_pu_bacteria 2599185257 2599807057 437
2566 iso_pu_bacteria 2599185288 2599881751 437
2567 iso_pu_bacteria 2599185290 2599894529 437
2568 iso_pu_bacteria 2599185303 2599949376 437
2569 iso_pu_bacteria 2599185356 2600217853 437
2570 iso_pu_bacteria 2600254931 2600367147 437
2571 iso_pu_bacteria 2600254954 2600445494 437
2572 iso_pu_bacteria 2600255296 2601693993 437
2573 iso_pu_bacteria 2600255313 2601778020 437
2574 iso_pu_bacteria 2600255318 2601800438 437
2575 iso_pu_bacteria 2600255389 2602009903 437
2576 iso_pu_bacteria 2603880185 2606078754 437
2577 iso_pu_bacteria 2603880199 2606125586 437
2578 iso_pu_bacteria 2606217733 2608382766 437
2579 iso_pu_bacteria 2619619299 2621297385 437
2580 iso_pu_bacteria 2623620443 2624482853 437
2581 iso_pu_bacteria 2643221565 2643844773 437
2582 iso_pu_bacteria 2643221571 2643869668 437
2583 iso_pu_bacteria 2643221589 2643957539 437
2584 iso_pu_bacteria 2643221602 2644025653 437
2585 iso_pu_bacteria 2643221667 2644371872 437
2586 iso_pu_bacteria 2643221713 2644625378 437
2587 iso_pu_bacteria 2667528171 2671100825 437
2588 iso_pu_bacteria 2671180172 2671773385 437
2589 iso_pu_bacteria 2675903420 2677895792 437
2590 iso_pu_bacteria 2713897148 2715752288 437
2591 iso_pu_bacteria 2713897149 2715759028 437
2592 iso_pu_bacteria 2718217725 2718636067 437
2593 iso_pu_bacteria 2721755607 2723250808 437
2594 iso_pu_bacteria 2728369097 2729144979 437
2595 iso_pu_bacteria 2738541265 2738672890 437
2596 iso_pu_bacteria 2738541279 2738735575 437
2597 iso_pu_bacteria 2738541282 2738751283 437
2598 iso_pu_bacteria 2738541294 2738810303 437
2599 iso_pu_bacteria 2738541303 2738860324 437
2600 iso_pu_bacteria 2738541309 2738897663 437
2601 iso_pu_bacteria 2738543004 2739198207 437
2602 iso_pu_bacteria 2738543015 2739260971 437
2603 iso_pu_bacteria 2738543025 2739316406 437
2604 iso_pu_bacteria 2739367857 2740003672 437
2605 iso_pu_bacteria 2739367858 2740008489 437
2606 iso_pu_bacteria 2740891818 2740991516 437
2607 iso_pu_bacteria 2740892503 2743739881 437
2608 iso_pu_bacteria 2751185877 2753673910 437
2609 iso_pu_bacteria 2765235839 2765575329 437
2610 iso_pu_bacteria 2772190705 2772603365 437
2611 iso_pu_bacteria 2773857673 2774137004 437
2612 iso_pu_bacteria 2775506739 2775674624 437
2613 iso_pu_bacteria 2784132063 2784262367 437
2614 iso_pu_bacteria 2808606382 2808959267 437
2615 iso_pu_bacteria 2808606385 2808977663 437
2616 iso_pu_bacteria 2808606388 2808992679 437
2617 iso_pu_bacteria 2808606445 2809219325 437
2618 iso_pu_bacteria 2816332188 2816875185 437
2619 iso_pu_bacteria 2816332298 2817493506 437
2620 iso_pu_bacteria 2818991456 2819659143 437
2621 iso_pu_bacteria 2818991464 2819706493 437
2622 iso_pu_bacteria 2823421272 2823424253 437
2623 iso_pu_bacteria 2834028612 2834033291 437
2624 iso_pu_bacteria 2842733646 2842735747 437
2625 iso_pu_bacteria 2842826826 2842831553 437
2626 iso_pu_bacteria 2842832357 2842837014 437
2627 iso_pu_bacteria 2842837860 2842840376 437
2628 iso_pu_bacteria 2842843487 2842847753 437
2629 iso_pu_bacteria 2844665904 2844666432 437
2630 iso_pu_bacteria 2852612431 2852618200 437
2631 iso_pu_bacteria 2852657418 2852660978 437
2632 iso_pu_bacteria 2852667396 2852673258 437
2633 iso_pu_bacteria 2857618242 2857622345 437
2634 iso_pu_bacteria 2860867994 2860872492 437
2635 iso_pu_bacteria 2871720351 2871723260 437
2636 iso_pu_bacteria 2878029506 2878034786 437
2637 iso_pu_bacteria 2880230671 2880235435 437
2638 iso_pu_bacteria 2889290771 2889294133 437
2639 iso_pu_bacteria 2904518522 2904523003 437
2640 iso_pu_bacteria 2908446538 2908452014 437
2641 iso_pu_bacteria 2912963787 2912964494 437
2642 iso_pu_bacteria 2917070673 2917076141 437
2643 iso_pu_bacteria 2919063839 2919067833 437
2644 iso_pu_bacteria 2919097161 2919098240 437
2645 iso_pu_bacteria 2919385768 2919390720 437
2646 iso_pu_bacteria 2919399522 2919401571 437
2647 iso_pu_bacteria 2919487758 2919491000 437
2648 iso_pu_bacteria 2919501602 2919503980 437
2649 iso_pu_bacteria 2919683626 2919685232 437
2650 iso_pu_bacteria 2923153595 2923158971 437
2651 iso_pu_bacteria 2926063275 2926065447 437
2652 iso_pu_bacteria 2929150217 2929150956 437
2653 iso_pu_bacteria 2929189879 2929194597 437
2654 iso_pu_bacteria 2931390751 2931395881 437
2655 iso_pu_bacteria 2935353572 2935359565 437
2656 iso_pu_bacteria 2939636861 2939641778 437
2657 iso_pu_bacteria 2939651529 2939652002 437
2658 iso_pu_bacteria 2945928738 2945931444 437
2659 iso_pu_bacteria 2945961074 2945966234 437
2660 iso_pu_bacteria 2946006987 2946007504 437
2661 iso_pu_bacteria 2946027586 2946033093 437
2662 iso_pu_bacteria 2947233263 2947233862 437
2663 iso_pu_bacteria 2969304461 2969309604 437
2664 iso_pu_bacteria 2974289157 2974294664 437
2665 iso_pu_bacteria 2984286254 2984287197 437
2666 iso_pu_bacteria 2990196909 2990198084 437
2667 iso_pu_bacteria 2998139840 2998144854 437
2668 iso_pu_bacteria 3007395558 3007398595 437
2669 iso_pu_bacteria 3007419365 3007420407 437
2670 iso_pu_bacteria 3007614139 3007615241 437
2671 iso_pu_bacteria 3007619802 3007621071 437
2672 iso_pu_bacteria 3007718800 3007722243 437
2673 iso_pu_bacteria 3007855910 3007860062 437
2674 iso_pu_bacteria 3007861166 3007866312 437
2675 iso_pu_bacteria 8015687852 8015693057 437
2676 iso_pu_bacteria 8019769354 8019771408 437
2677 iso_pu_bacteria 8029995093 8029996041 437
2678 iso_pu_bacteria 8034962539 8034965719 437
2679 iso_pu_bacteria 8054285046 8054288887 437
2680 iso_pu_bacteria 8054347763 8054353067 437
2681 iso_pu_bacteria 8054503363 8054508386 437
2682 iso_pu_bacteria 8055770955 8055776304 437
2683 iso_pu_bacteria 8055817908 8055823339 437
2684 iso_pu_bacteria 8055878733 8055882715 437
2685 iso_pu_bacteria 8056125926 8056131068 437
2686 iso_pu_bacteria 8056131705 8056136744 437
2687 iso_pu_bacteria 8056148874 8056150567 437
2688 iso_pu_bacteria 8056161164 8056163052 437
2689 iso_pu_bacteria 8056166840 8056171714 437
2690 iso_pu_bacteria 8056177738 8056179129 437
2691 iso_pu_bacteria 8056440228 8056440793 437
2692 iso_pu_bacteria 8056569372 8056571882 437
2693 iso_pu_bacteria 8057798959 8057805142 437
2694 2162886007 SwRhRL2b_contig_1215741 SwRhRL2b_0996.00000180 438
2695 3300003320 rootH2_10055948 rootH2_100559482 438
2696 3300003322 rootL2_10170469 rootL2_101704692 438
2697 3300005262 Ga0065165_1000539 Ga0065165_10005393 438
2698 3300005288 Ga0065714_10002661 Ga0065714_1000266134 438
2699 3300005288 Ga0065714_10002760 Ga0065714_100027603 438
2700 3300005288 Ga0065714_10101317 Ga0065714_101013171 438
2701 3300005289 Ga0065704_10000562 Ga0065704_100005623 438
2702 3300005289 Ga0065704_10002082 Ga0065704_100020826 438
2703 3300005289 Ga0065704_10082107 Ga0065704_100821074 438
2704 3300005289 Ga0065704_10135794 Ga0065704_101357942 438
2705 3300005336 Ga0070680_100004033 Ga0070680_1000040339 438
2706 3300005336 Ga0070680_100076216 Ga0070680_1000762161 438
2707 3300005339 Ga0070660_100008148 Ga0070660_1000081482 438
2708 3300005355 Ga0070671_100083951 Ga0070671_1000839512 438
2709 3300005366 Ga0070659_100025516 Ga0070659_1000255161 438
2710 3300005458 Ga0070681_10085711 Ga0070681_100857113 438
2711 3300005544 Ga0070686_100065481 Ga0070686_1000654811 438
2712 3300005547 Ga0070693_100011413 Ga0070693_1000114133 438
2713 3300005563 Ga0068855_100113023 Ga0068855_1001130233 438
2714 3300006847 Ga0075431_100004236 Ga0075431_1000042363 438
2715 3300006944 Ga0099823_1003937 Ga0099823_10039375 438
2716 3300009011 Ga0105251_10007894 Ga0105251_100078942 438
2717 3300009036 Ga0105244_10008634 Ga0105244_100086342 438
2718 3300009036 Ga0105244_10018941 Ga0105244_100189412 438
2719 3300009092 Ga0105250_10026095 Ga0105250_100260953 438
2720 3300009148 Ga0105243_10116769 Ga0105243_101167692 438
2721 3300009176 Ga0105242_10024669 Ga0105242_100246692 438
2722 3300013100 Ga0157373_10000094 Ga0157373_1000009438 438
2723 3300013100 Ga0157373_10003540 Ga0157373_100035407 438
2724 3300013100 Ga0157373_10023034 Ga0157373_100230342 438
2725 3300013102 Ga0157371_10018757 Ga0157371_100187576 438
2726 3300013102 Ga0157371_10023729 Ga0157371_100237294 438
2727 3300013102 Ga0157371_10030734 Ga0157371_100307343 438
2728 3300013104 Ga0157370_10067570 Ga0157370_100675702 438
2729 3300013307 Ga0157372_10051427 Ga0157372_100514274 438
2730 3300013307 Ga0157372_10151887 Ga0157372_101518871 438
2731 3300013307 Ga0157372_10156663 Ga0157372_101566633 438
2732 3300014497 Ga0182008_10000008 Ga0182008_10000008142 438
2733 3300014497 Ga0182008_10021111 Ga0182008_100211113 438
2734 3300014497 Ga0182008_10035331 Ga0182008_100353312 438
2735 3300015261 Ga0182006_1003239 Ga0182006_10032393 438
2736 3300015262 Ga0182007_10024410 Ga0182007_100244101 438
2737 3300025292 Ga0209676_1000396 Ga0209676_100039640 438
2738 3300025292 Ga0209676_1000788 Ga0209676_100078821 438
2739 3300025711 Ga0207696_1000172 Ga0207696_100017252 438
2740 3300025711 Ga0207696_1002729 Ga0207696_10027294 438
2741 3300025711 Ga0207696_1006843 Ga0207696_10068434 438
2742 3300025728 Ga0207655_1001764 Ga0207655_100176413 438
2743 3300025728 Ga0207655_1002932 Ga0207655_100293213 438
2744 3300025728 Ga0207655_1008866 Ga0207655_10088665 438
2745 3300025735 Ga0207713_1002651 Ga0207713_10026512 438
2746 3300025735 Ga0207713_1003200 Ga0207713_10032007 438
2747 3300025735 Ga0207713_1007437 Ga0207713_10074376 438
2748 3300025917 Ga0207660_10014965 Ga0207660_100149651 438
2749 3300025917 Ga0207660_10121757 Ga0207660_101217572 438
2750 3300025919 Ga0207657_10015750 Ga0207657_100157502 438
2751 3300025919 Ga0207657_10033112 Ga0207657_100331126 438
2752 3300025921 Ga0207652_10077936 Ga0207652_100779362 438
2753 3300025935 Ga0207709_10003847 Ga0207709_100038474 438
2754 3300025935 Ga0207709_10010641 Ga0207709_100106412 438
2755 3300026041 Ga0207639_10069300 Ga0207639_100693002 438
2756 3300026116 Ga0207674_10094081 Ga0207674_100940812 438
2757 3300026142 Ga0207698_10037929 Ga0207698_100379292 438
2758 3300027296 Ga0209389_1000125 Ga0209389_10001258 438
2759 3300027312 Ga0209371_1000490 Ga0209371_100049014 438
2760 3300027907 Ga0207428_10037408 Ga0207428_100374082 438
2761 3300028558 Ga0265326_10002876 Ga0265326_100028762 438
2762 3300028573 Ga0265334_10003307 Ga0265334_100033072 438
2763 3300028653 Ga0265323_10000281 Ga0265323_100002813 438
2764 3300028800 Ga0265338_10047408 Ga0265338_100474084 438
2765 3300030500 Ga0268256_1000419 Ga0268256_100041922 438
2766 3300030500 Ga0268256_1013462 Ga0268256_10134622 438
2767 3300030731 Ga0316177_1111270 Ga0316177_11112709 438
2768 3300030732 Ga0316176_1067105 Ga0316176_10671054 438
2769 3300030744 Ga0316181_1228898 Ga0316181_12288986 438
2770 3300031235 Ga0265330_10002320 Ga0265330_100023202 438
2771 3300031235 Ga0265330_10002893 Ga0265330_100028937 438
2772 3300031235 Ga0265330_10003332 Ga0265330_100033323 438
2773 3300031235 Ga0265330_10038142 Ga0265330_100381422 438
2774 3300031238 Ga0265332_10000013 Ga0265332_10000013166 438
2775 3300031242 Ga0265329_10000141 Ga0265329_1000014121 438
2776 3300031251 Ga0265327_10000935 Ga0265327_1000093525 438
2777 3300031344 Ga0265316_10000073 Ga0265316_1000007341 438
2778 3300031344 Ga0265316_10000442 Ga0265316_1000044239 438
2779 3300031344 Ga0265316_10000823 Ga0265316_1000082313 438
2780 3300031344 Ga0265316_10003656 Ga0265316_100036563 438
2781 3300031344 Ga0265316_10005290 Ga0265316_100052909 438
2782 3300031344 Ga0265316_10024038 Ga0265316_100240382 438
2783 3300031344 Ga0265316_10099083 Ga0265316_100990832 438
2784 3300031548 Ga0307408_100000273 Ga0307408_1000002738 438
2785 3300031691 Ga0316579_10002847 Ga0316579_100028472 438
2786 3300031691 Ga0316579_10029579 Ga0316579_100295792 438
2787 3300031712 Ga0265342_10000202 Ga0265342_1000020223 438
2788 3300031712 Ga0265342_10006108 Ga0265342_100061086 438
2789 3300031712 Ga0265342_10008635 Ga0265342_100086353 438
2790 3300031712 Ga0265342_10026904 Ga0265342_100269044 438
2791 3300031727 Ga0316576_10002667 Ga0316576_100026674 438
2792 3300031727 Ga0316576_10006703 Ga0316576_100067033 438
2793 3300031727 Ga0316576_10030660 Ga0316576_100306602 438
2794 3300031728 Ga0316578_10000482 Ga0316578_100004828 438
2795 3300031728 Ga0316578_10022033 Ga0316578_100220333 438
2796 3300031728 Ga0316578_10122308 Ga0316578_101223082 438
2797 3300031911 Ga0307412_10000023 Ga0307412_10000023172 438
2798 3300032004 Ga0307414_10000666 Ga0307414_1000066611 438
2799 3300032137 Ga0316585_10023575 Ga0316585_100235752 438
2800 3300033529 Ga0316587_1002649 Ga0316587_10026491 438
2801 3300035398 Ga0316574_0034241 Ga0316574_0034241_28_1368 438
2802 3300036647 Ga0316582_0001543 Ga0316582_0001543_7852_9192 438
2803 3300036647 Ga0316582_0056789 Ga0316582_0056789_1012_2352 438
2804 3300036712 Ga0316584_0000012 Ga0316584_0000012_2061_3413 438
2805 3300036712 Ga0316584_0000143 Ga0316584_0000143_29513_30853 438
2806 3300037588 Ga0316581_0008714 Ga0316581_0008714_1121_2461 438
2807 3300039062 Ga0400483_120530 Ga0400483_120530_225_1556 438
2808 3300041405 Ga0439438_006308 Ga0439438_006308_2196_3536 438
2809 3300042137 Ga0450902_002473 Ga0450902_002473_957_2297 438
2810 3300042876 Ga0451577_0000037 Ga0451577_0000037_166023_167375 438
2811 3300042876 Ga0451577_0001296 Ga0451577_0001296_19420_20772 438
2812 3300042876 Ga0451577_0007142 Ga0451577_0007142_9146_10498 438
2813 3300042876 Ga0451577_0008256 Ga0451577_0008256_2815_4155 438
2814 3300042876 Ga0451577_0014601 Ga0451577_0014601_5739_7055 438
2815 3300042876 Ga0451577_0030261 Ga0451577_0030261_2579_3931 438
2816 3300042876 Ga0451577_0038874 Ga0451577_0038874_2473_3810 438
2817 3300042876 Ga0451577_0039911 Ga0451577_0039911_1619_2971 438
2818 3300042876 Ga0451577_0050652 Ga0451577_0050652_2332_3687 438
2819 3300042876 Ga0451577_0088373 Ga0451577_0088373_1398_2753 438
2820 3300044673 Ga0453683_0000021 Ga0453683_0000021_176264_177616 438
2821 3300044673 Ga0453683_0000082 Ga0453683_0000082_53223_54575 438
2822 3300044673 Ga0453683_0001314 Ga0453683_0001314_18006_19346 438
2823 3300044673 Ga0453683_0014411 Ga0453683_0014411_3139_4479 438
2824 3300044673 Ga0453683_0019328 Ga0453683_0019328_2263_3615 438
2825 3300044673 Ga0453683_0029763 Ga0453683_0029763_701_2053 438
2826 3300044712 Ga0453684_0000110 Ga0453684_0000110_166403_167755 438
2827 3300044712 Ga0453684_0000118 Ga0453684_0000118_104516_105853 438
2828 3300044712 Ga0453684_0000190 Ga0453684_0000190_223787_225139 438
2829 3300044712 Ga0453684_0000433 Ga0453684_0000433_96919_98259 438
2830 3300044712 Ga0453684_0000523 Ga0453684_0000523_69759_71114 438
2831 3300044712 Ga0453684_0000766 Ga0453684_0000766_28374_29726 438
2832 3300044712 Ga0453684_0001326 Ga0453684_0001326_33381_34721 438
2833 3300044712 Ga0453684_0002060 Ga0453684_0002060_2070_3422 438
2834 3300044712 Ga0453684_0002074 Ga0453684_0002074_13662_15014 438
2835 3300044712 Ga0453684_0002091 Ga0453684_0002091_47930_49282 438
2836 3300044712 Ga0453684_0005619 Ga0453684_0005619_8896_10251 438
2837 3300044712 Ga0453684_0009951 Ga0453684_0009951_8353_9693 438
2838 3300044712 Ga0453684_0018043 Ga0453684_0018043_8726_10066 438
2839 3300044712 Ga0453684_0023381 Ga0453684_0023381_6760_8259 438
2840 3300044712 Ga0453684_0026533 Ga0453684_0026533_1515_2870 438
2841 3300044712 Ga0453684_0031511 Ga0453684_0031511_4194_5552 438
2842 3300044712 Ga0453684_0033826 Ga0453684_0033826_4183_5523 438
2843 3300044712 Ga0453684_0034083 Ga0453684_0034083_4436_5791 438
2844 3300044712 Ga0453684_0036809 Ga0453684_0036809_3021_4493 438
2845 3300044712 Ga0453684_0041770 Ga0453684_0041770_3374_4780 438
2846 3300044712 Ga0453684_0055727 Ga0453684_0055727_1348_2664 438
2847 3300044712 Ga0453684_0064284 Ga0453684_0064284_449_1801 438
2848 3300044712 Ga0453684_0064387 Ga0453684_0064387_3035_4375 438
2849 3300044712 Ga0453684_0072636 Ga0453684_0072636_2715_4055 438
2850 3300044712 Ga0453684_0085995 Ga0453684_0085995_1811_3151 438
2851 3300044712 Ga0453684_0096590 Ga0453684_0096590_1089_2441 438
2852 3300044712 Ga0453684_0105824 Ga0453684_0105824_2043_3383 438
2853 3300044712 Ga0453684_0229166 Ga0453684_0229166_668_2002 438
2854 3300044712 Ga0453684_0273429 Ga0453684_0273429_147_1487 438
2855 3300045051 Ga0451576_0000039 Ga0451576_0000039_192788_194140 438
2856 3300045051 Ga0451576_0000052 Ga0451576_0000052_227775_229115 438
2857 3300045051 Ga0451576_0000279 Ga0451576_0000279_13662_15014 438
2858 3300045051 Ga0451576_0003401 Ga0451576_0003401_2589_3929 438
2859 3300045051 Ga0451576_0007719 Ga0451576_0007719_2590_3942 438
2860 3300045051 Ga0451576_0009750 Ga0451576_0009750_2928_4268 438
2861 3300045051 Ga0451576_0010696 Ga0451576_0010696_2781_4121 438
2862 3300045051 Ga0451576_0026656 Ga0451576_0026656_370_1710 438
2863 3300045051 Ga0451576_0031038 Ga0451576_0031038_3515_4867 438
2864 3300045051 Ga0451576_0039402 Ga0451576_0039402_2595_3935 438
2865 3300045051 Ga0451576_0094150 Ga0451576_0094150_1649_3001 438
2866 3300046515 Ga0495620_0000124 Ga0495620_0000124_53871_55211 438
2867 3300046519 Ga0495632_0003308 Ga0495632_0003308_4828_6168 438
2868 3300046522 Ga0495643_0001239 Ga0495643_0001239_22287_23627 438
2869 3300046522 Ga0495643_0007977 Ga0495643_0007977_5348_6688 438
2870 3300046524 Ga0495648_0046055 Ga0495648_0046055_254_1594 438
2871 3300048916 Ga0496113_0060347 Ga0496113_0060347_746_2089 438
2872 3300048919 Ga0496116_0082396 Ga0496116_0082396_211_1551 438
2873 3300048920 Ga0496117_0006894 Ga0496117_0006894_1534_2874 438
2874 3300048920 Ga0496117_0007471 Ga0496117_0007471_759_2099 438
2875 3300048920 Ga0496117_0098861 Ga0496117_0098861_41_1381 438
2876 3300048921 Ga0496118_0014028 Ga0496118_0014028_5750_7090 438
2877 3300048921 Ga0496118_0016470 Ga0496118_0016470_5379_6719 438
2878 3300048923 Ga0496120_0019523 Ga0496120_0019523_1861_3201 438
2879 3300048926 Ga0496123_0003867 Ga0496123_0003867_2344_3684 438
2880 3300048927 Ga0496124_0009296 Ga0496124_0009296_440_1966 438
2881 3300048927 Ga0496124_0014416 Ga0496124_0014416_92_1432 438
2882 3300048928 Ga0496125_0003184 Ga0496125_0003184_7954_9294 438
2883 3300048929 Ga0496126_0141242 Ga0496126_0141242_86_1426 438
2884 3300048929 Ga0496126_0163117 Ga0496126_0163117_204_1544 438
2885 3300049568 Ga0501031_0093645 Ga0501031_0093645_379_1725 438
2886 3300049569 Ga0501032_0075830 Ga0501032_0075830_204_1550 438
2887 3300049570 Ga0501033_0000336 Ga0501033_0000336_24577_25923 438
2888 3300049571 Ga0501034_0000131 Ga0501034_0000131_91513_92853 438
2889 3300049571 Ga0501034_0031493 Ga0501034_0031493_1803_3149 438
2890 3300049571 Ga0501034_0036253 Ga0501034_0036253_1880_3220 438
2891 3300049572 Ga0501036_0008830 Ga0501036_0008830_3956_5302 438
2892 3300049572 Ga0501036_0024204 Ga0501036_0024204_2303_3646 438
2893 3300049578 Ga0501042_0002736 Ga0501042_0002736_2937_4283 438
2894 3300049581 Ga0501047_0024356 Ga0501047_0024356_2467_3810 438
2895 3300049582 Ga0501048_0038268 Ga0501048_0038268_1882_3228 438
2896 3300049585 Ga0501069_0036462 Ga0501069_0036462_1098_2435 438
2897 3300049586 Ga0501070_0034633 Ga0501070_0034633_1787_3124 438
2898 3300049586 Ga0501070_0260804 Ga0501070_0260804_34_1371 438
2899 3300049590 Ga0501074_0004078 Ga0501074_0004078_210_1547 438
2900 3300049663 Ga0501223_000485 Ga0501223_000485_7808_9238 438
2901 3300049744 Ga0501083_0005941 Ga0501083_0005941_3413_4753 438
2902 3300049758 Ga0501241_001008 Ga0501241_001008_3606_4958 438
2903 3300049758 Ga0501241_003386 Ga0501241_003386_1463_2803 438
2904 3300049822 Ga0501035_0004116 Ga0501035_0004116_12371_13714 438
2905 3300049822 Ga0501035_0064043 Ga0501035_0064043_1891_3237 438
2906 3300049823 Ga0501044_0000455 Ga0501044_0000455_19140_20486 438
2907 3300049823 Ga0501044_0109621 Ga0501044_0109621_72_1418 438
2908 3300050510 nmdc:mga06r32_25301_c1 nmdc:mga06r32_25301_c1_1112_2452 438
2909 3300053093 Ga0500651_0000253 Ga0500651_0000253_9087_10427 438
2910 3300060353 Ga0501082_0169480 Ga0501082_0169480_544_1884 438
2911 iso_pu_bacteria 2511231024 2511374088 438
2912 iso_pu_bacteria 2547132512 2548846075 438
2913 iso_pu_bacteria 2554235231 2555245668 438
2914 iso_pu_bacteria 2738541284 2738760550 438
2915 iso_pu_bacteria 2765235841 2765581874 438
2916 iso_pu_bacteria 2806310737 2807410270 438
2917 iso_pu_bacteria 2806310745 2807458618 438
2918 iso_pu_bacteria 2833640130 2833641470 438
2919 iso_pu_bacteria 2842903701 2842906550 438
2920 iso_pu_bacteria 2852627209 2852629990 438
2921 iso_pu_bacteria 2919155634 2919159419 438
2922 iso_pu_bacteria 2919509842 2919512668 438
2923 iso_pu_bacteria 3007803356 3007806442 438
2924 iso_pu_bacteria 3007872151 3007876176 438
2925 iso_pu_bacteria 8052494512 8052499273 438
2926 iso_pu_bacteria 8054929484 8054932309 438
2927 iso_pu_bacteria 8056115690 8056120617 438
2928 iso_pu_bacteria 8056120720 8056121557 438
2929 iso_pu_bacteria 8056137416 8056142261 438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02812

ELFV_dehydrog_N

Glu/Leu/Phe/Val dehydrogenase, dimerisation domain

112

240

0.99

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

257

508

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fcc-assembly2.cif.gz_H glutamate dehydrogenase from e. coli 0.9917 2 438
3sbo-assembly1.cif.gz_A structure of e.coli gdh from native source 0.99 3 438
4fcc-assembly1.cif.gz_F glutamate dehydrogenase from e. coli 0.9885 2 438
3sbo-assembly1.cif.gz_D structure of e.coli gdh from native source 0.9856 2 438
3sbo-assembly1.cif.gz_B structure of e.coli gdh from native source 0.9819 2 438
ID Description Score Start End Superfamily
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9969 46 180 3.40.50.10860
2yfhF03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9824 200 363 3.40.50.720
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9824 46 180 3.40.50.10860
2yfhF03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 200 363 3.40.50.720
1b26A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9681 49 190 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A448QPU3-F1-model_v4 deleted 1.003 65 177
AF-A0A4Y5LSJ0-F1-model_v4 Glutamate dehydrogenase 1.002 51 176 GO:0004354
GO:0005829
GO:0006537
AF-A0A8A3WQ59-F1-model_v4 glutamate dehydrogenase (NADP(+)) (EC 1.4.1.4) 1.001 75 192 GO:0004354
GO:0005829
GO:0006537
AF-A0A7G7WZQ1-F1-model_v4 glutamate dehydrogenase (NADP(+)) (EC 1.4.1.4) 1.001 79 189 GO:0004354
GO:0005829
GO:0006537
AF-A0A3D0FH88-F1-model_v4 deleted 1.001 55 158

Feature Viewer

pLDDT pTM Quality
95.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map